Sample records for gender males females

  1. Gender and stress as predictors of psychopathology in male- and female-dominated graduate disciplines

    E-Print Network [OSTI]

    Valentine, Eugenia Michelle

    1996-01-01T23:59:59.000Z

    and expectations defined by society as being culturally appropriate for each gender (O' Neil, 1982). Gender-role stereotypes, therefore, are rigid and exaggerated expectations of how each gender should behave (Basow, 1992). The stereotype that certain roles... to high occupational achievement may find that co-workers are socially unresponsive to them (Banziger a Hooker, 1979) They are often viewed as social oddities, and this may sabotage and restrict their opportunities for professional relationships...

  2. For Immediate Release --Wednesday, March 20, 2013 Treating male and female cancer patients with radiation

    E-Print Network [OSTI]

    Seldin, Jonathan P.

    ? · gender differences in cancer treatment rarely explored · consequences of radiation with radiation treatment of cancer cells and the difference between female and male or female-specific treatments that improve the quality of life for all cancer

  3. Bringing men in: an analysis of male and female fertility

    E-Print Network [OSTI]

    Zhang, Li 1976-

    2009-05-15T23:59:59.000Z

    Prior research has focused on studying female fertility, but male fertility remains overlooked. Using data from the 2001 Demographic Yearbook, the 1964 to 2002 Taiwan-Fukien Demographic Yearbooks, the 2004 National Statistics Reports and the 2002...

  4. Science faculty's subtle gender biases favor male students

    E-Print Network [OSTI]

    Handelsman, Jo

    of the faculty participants did not affect responses, such that female and male faculty were equally likely demands over the next decade (1). To help close this formidable gap, the report calls for the increased training and retention of women, who are starkly underrepresented within many fields of science, especially

  5. Male-female interaction among different geographic strains of the Gulf Coast tick Amblyomma maculatum Koch

    E-Print Network [OSTI]

    Sleeba, Sarah Beth

    2006-08-16T23:59:59.000Z

    dish experiments were used to understand male-female interaction in the field, and to determine if the aggregation attachment pheromone (AAP) produced by fed males of varying strains is attractive to geographic specific strains of unfed female ticks...

  6. Situating Male Fertility: A Demographic Analysis of Male and Female Fertility in the United States

    E-Print Network [OSTI]

    Cherry, Robert Christopher

    2012-02-14T23:59:59.000Z

    are not significantly different from those reported by females (Ratcliffe, Hill, Harrington, and Walraven 2002b). Rendall et al. (1999) explored the qualities of male reported data, and found that while retrospective recollection of fertility events underreport... listing of these articles indicated that the bulk of them (over 2/3rds) dealt with either 1) family planning (Guest 2003; Mesfin 2002; Pearson 2003), fertility control (Colvard, Habenicht, and Harper 2008; Darroch 2008), 14 contraception and condom...

  7. A Case Study of Gender Bias at the Postdoctoral Level in Physics, and its Resulting Impact on the Academic Career Advancement of Females

    E-Print Network [OSTI]

    Towers, S

    2008-01-01T23:59:59.000Z

    This case study of a typical U.S. particle physics experiment explores the issues of gender bias and how it affects the academic career advancement prospects of women in the field of physics beyond the postdoctoral level; we use public databases to study the career paths of the full cohort of 57 former postdoctoral researchers on the Run II Dzero experiment to examine if males and females were treated in a gender-blind fashion on the experiment. The study finds that the female researchers were on average significantly more productive compared to their male peers, yet were allocated only 1/3 the amount of conference presentations based on their productivity. The study also finds that the dramatic gender bias in allocation of conference presentations appeared to have significant negative impact on the academic career advancement of the females.

  8. A Case Study of Gender Bias at the Postdoctoral Level in Physics, and its Resulting Impact on the Academic Career Advancement of Females

    E-Print Network [OSTI]

    S. Towers

    2008-04-19T23:59:59.000Z

    This case study of a typical U.S. particle physics experiment explores the issues of gender bias and how it affects the academic career advancement prospects of women in the field of physics beyond the postdoctoral level; we use public databases to study the career paths of the full cohort of 57 former postdoctoral researchers on the Run II Dzero experiment to examine if males and females were treated in a gender-blind fashion on the experiment. The study finds that the female researchers were on average significantly more productive compared to their male peers, yet were allocated only 1/3 the amount of conference presentations based on their productivity. The study also finds that the dramatic gender bias in allocation of conference presentations appeared to have significant negative impact on the academic career advancement of the females. The author has a PhD in particle physics and worked for six years as a postdoctoral research scientist, five of which were spent collaborating at Fermilab. She is currently completing a graduate degree in statistics.

  9. The effects of adult male mouse urine odor on evoked potentials in adult female mice

    E-Print Network [OSTI]

    Brown, Troy Edwin

    1985-01-01T23:59:59.000Z

    THE EFFECTS OF ADULT MALE MOUSE URINE ODOR ON EVOKED POTENTIALS IN ADULT FEMALE MICE A Thesis by TROY EDWIN BROWN Submitted to the Graduate College of Texas A&M University in partial fulfillment of the requirements for the degree of MASTER... OF SCIENCE MAY 1985 Major Subject: Bioengineering THE EFFECTS OF ADULT MALE MOUSE URINE ODOR ON EVOKED POTENTIALS IN ADULT FEMALE MICE A Thesis by TROY EDWIN BROWN Approved as to style and content by: Jon F. Hunter (Co ? C airman of Committee...

  10. The functional role and female perception of male song in Zebra Finches

    E-Print Network [OSTI]

    Woolley, Sarah M. N.

    The functional role and female perception of male song in Zebra Finches Mark E. HauberA,C , Dana L and perception of Zebra Finch song has driven theoretical, empirical and technological advances in behavioural ecology, endocrinology and neuroethology, and led to a greater understanding of the evolution of animal

  11. ERK Signaling in the Pituitary Is Required for Female But Not Male Fertility

    E-Print Network [OSTI]

    ERK Signaling in the Pituitary Is Required for Female But Not Male Fertility Stuart P. Bliss. Several studies suggest that ERK1 and -2 are essential modulators of hypothalamic GnRH-mediated regulation-specific depletion of ERK1 and 2 and examined a range of physiological parameters including fertility. We find

  12. Rapid estrogen regulation of DHEA metabolism in the male and female songbird brain

    E-Print Network [OSTI]

    Schluter, Dolph

    Rapid estrogen regulation of DHEA metabolism in the male and female songbird brain Devaleena S increases song behavior and the size of a brain region controlling song (HVC; Reiner et al. 2004), and also the brain (Soma 2006; Demas et al. 2007; Schlinger et al. 2007). Dehydroepiandrosterone can be converted

  13. Head black woman in charge: An investigation of how black female athletic directors negotiate their race, gender, and class identities

    E-Print Network [OSTI]

    McDowell, Jacqueline

    2009-05-15T23:59:59.000Z

    Framed as an instrumental case study, the purpose of this investigation was to understand how a select group of women, Black female athletic directors, define and negotiate their race, gender, and class identities. Data was collected via a...

  14. Male Female

    National Nuclear Security Administration (NNSA)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOn AprilA Approved:Administration SandiaAdministration NewsAdministrator6

  15. Factors affecting alcohol treatment in males: an estimation of gender-role issues, self-concept, and psychiatric symptomatology

    E-Print Network [OSTI]

    Clark, Betty Lynn

    1993-01-01T23:59:59.000Z

    FACTORS AFFECTING ALCOHOL TREATMENT IN MALES: AN EXAMINATION OF GENDER ROLE ISSUES ~ SELF CONCEPT AND PSYCHIATRIC SYMPTOMATOLOGY A Thesis by BETTY LYNN CLARK Submitted to the Office of Graduate Studies of Texas A&M University in partial... fulfillment of the requirements for the degree MASTER OF SCIENCE August 1993 Major Subject: Psychology FACTORS AFFECTING ALCOHOL TREATMENT IN MALES: AN EXAMINATION OF GENDER-ROLE ISSUES, SELF-CONCEPT, AND PSYCHIATRIC SYMPTOMATOLOGY A Thesis by BETTY...

  16. Exploring the Behavioral and Psychological Differences between Male and Female Youth with a History of Fire Involvement

    E-Print Network [OSTI]

    Morris, Ed M.

    2014-08-31T23:59:59.000Z

    . While it is supported that fire-involved youth tend to be males, recent statistics published by the National Fire Protection Association (NFPA) indicated sex differences in the type of fires set. Specifically, the NFPA report found that female youth... expression and found it surprising that females were associated with covert emotional expression through firesetting behavior because they are typically socialized to express emotions overtly. If the female-dominated structure fires documented by NFPA...

  17. Organ doses for reference adult male and female undergoing computed tomography estimated by Monte Carlo simulations

    SciTech Connect (OSTI)

    Lee, Choonsik; Kim, Kwang Pyo; Long, Daniel; Fisher, Ryan; Tien, Chris; Simon, Steven L.; Bouville, Andre; Bolch, Wesley E. [Division of Cancer Epidemiology and Genetics, National Cancer Institute, National Institute of Health, Bethesda, Maryland 20852 (United States); Department of Nuclear Engineering, Kyung Hee University, Yongin 446-701 (Korea, Republic of); Department of Nuclear and Radiological Engineering, University of Florida, Gainesville, Florida 32611 (United States); Division of Cancer Epidemiology and Genetics, National Cancer Institute, National Institute of Health, Bethesda, Maryland 20852 (United States); Department of Nuclear and Radiological Engineering, University of Florida, Gainesville, Florida 32611 (United States)

    2011-03-15T23:59:59.000Z

    Purpose: To develop a computed tomography (CT) organ dose estimation method designed to readily provide organ doses in a reference adult male and female for different scan ranges to investigate the degree to which existing commercial programs can reasonably match organ doses defined in these more anatomically realistic adult hybrid phantomsMethods: The x-ray fan beam in the SOMATOM Sensation 16 multidetector CT scanner was simulated within the Monte Carlo radiation transport code MCNPX2.6. The simulated CT scanner model was validated through comparison with experimentally measured lateral free-in-air dose profiles and computed tomography dose index (CTDI) values. The reference adult male and female hybrid phantoms were coupled with the established CT scanner model following arm removal to simulate clinical head and other body region scans. A set of organ dose matrices were calculated for a series of consecutive axial scans ranging from the top of the head to the bottom of the phantoms with a beam thickness of 10 mm and the tube potentials of 80, 100, and 120 kVp. The organ doses for head, chest, and abdomen/pelvis examinations were calculated based on the organ dose matrices and compared to those obtained from two commercial programs, CT-EXPO and CTDOSIMETRY. Organ dose calculations were repeated for an adult stylized phantom by using the same simulation method used for the adult hybrid phantom. Results: Comparisons of both lateral free-in-air dose profiles and CTDI values through experimental measurement with the Monte Carlo simulations showed good agreement to within 9%. Organ doses for head, chest, and abdomen/pelvis scans reported in the commercial programs exceeded those from the Monte Carlo calculations in both the hybrid and stylized phantoms in this study, sometimes by orders of magnitude. Conclusions: The organ dose estimation method and dose matrices established in this study readily provides organ doses for a reference adult male and female for different CT scan ranges and technical parameters. Organ doses from existing commercial programs do not reasonably match organ doses calculated for the hybrid phantoms due to differences in phantom anatomy, as well as differences in organ dose scaling parameters. The organ dose matrices developed in this study will be extended to cover different technical parameters, CT scanner models, and various age groups.

  18. Evolution of gender wage gap in Peru, 1997-2000

    E-Print Network [OSTI]

    Montes, Jose L.

    2009-05-15T23:59:59.000Z

    . The wage differential due to gender, and not to differences in labor characteristics, is called discrimination. The goal of this project is to estimate the evolution of the wages differentials and wage discrimination between males and females in Peru within...

  19. The Sexuality of Gender: Gay Male Social Theories and Their Relations to Women

    E-Print Network [OSTI]

    Oifer, Eric

    2001-04-01T23:59:59.000Z

    , Rubin wants to create a climate in which no sexual practices are prohibited because she feels that social theories of gender that problematize certain sexual activities contribute to the hete:osexist stigmatization ofgaysexuality. Rubin's"Thinking Sex... elements on behalfof erotic pleasure that is also a creation of oneself as a self, as an agent in relation with others. Blasius makesthe bold assertion that sexneednot be guided or limited byconceptions of gender. By imagining andpracticing sexoutside...

  20. Male mating behavior and costs of sexual harassment for females in cavernicolous and extremophile

    E-Print Network [OSTI]

    Schlupp, Ingo

    by physicochemical stressors, such as toxic hydrogen sulfide (H2S), or the fish occur in lightless subterranean (cave) habitats. Using five different populations from surface habitats with or without H2S, and from a sulfidic with at least one physicochemical stressor present (H2S or absence of light), a reduction in male sexual

  1. Does the gender of the professor affect the structuring of the design studio?

    E-Print Network [OSTI]

    Howard, Carolee L

    2013-02-22T23:59:59.000Z

    A large gender difference exists in the percentage of male and female students enrolled in architecture schools. Roughly one-third of architecture students are females while about half of the student population at large is female. There is also a...

  2. Evaluation of overall setup accuracy and adequate setup margins in pelvic image-guided radiotherapy: Comparison of the male and female patients

    SciTech Connect (OSTI)

    Laaksomaa, Marko, E-mail: marko.laaksomaa@pshp.fi [Department of Oncology, Tampere University Hospital (TAUH), Tampere (Finland); Kapanen, Mika [Department of Oncology, Tampere University Hospital (TAUH), Tampere (Finland); Department of Medical Physics, Tampere University Hospital (TAUH), Tampere (Finland); Tulijoki, Tapio [Department of Oncology, Tampere University Hospital (TAUH), Tampere (Finland); Peltola, Seppo; Hyödynmaa, Simo [Department of Oncology, Tampere University Hospital (TAUH), Tampere (Finland); Department of Medical Physics, Tampere University Hospital (TAUH), Tampere (Finland); Kellokumpu-Lehtinen, Pirkko-Liisa [Department of Oncology, Tampere University Hospital (TAUH), Tampere (Finland)

    2014-04-01T23:59:59.000Z

    We evaluated adequate setup margins for the radiotherapy (RT) of pelvic tumors based on overall position errors of bony landmarks. We also estimated the difference in setup accuracy between the male and female patients. Finally, we compared the patient rotation for 2 immobilization devices. The study cohort included consecutive 64 male and 64 female patients. Altogether, 1794 orthogonal setup images were analyzed. Observer-related deviation in image matching and the effect of patient rotation were explicitly determined. Overall systematic and random errors were calculated in 3 orthogonal directions. Anisotropic setup margins were evaluated based on residual errors after weekly image guidance. The van Herk formula was used to calculate the margins. Overall, 100 patients were immobilized with a house-made device. The patient rotation was compared against 28 patients immobilized with CIVCO's Kneefix and Feetfix. We found that the usually applied isotropic setup margin of 8 mm covered all the uncertainties related to patient setup for most RT treatments of the pelvis. However, margins of even 10.3 mm were needed for the female patients with very large pelvic target volumes centered either in the symphysis or in the sacrum containing both of these structures. This was because the effect of rotation (p ? 0.02) and the observer variation in image matching (p ? 0.04) were significantly larger for the female patients than for the male patients. Even with daily image guidance, the required margins remained larger for the women. Patient rotations were largest about the lateral axes. The difference between the required margins was only 1 mm for the 2 immobilization devices. The largest component of overall systematic position error came from patient rotation. This emphasizes the need for rotation correction. Overall, larger position errors and setup margins were observed for the female patients with pelvic cancer than for the male patients.

  3. Pesticide use knowledge and practices: A gender differences in Nepal

    SciTech Connect (OSTI)

    Atreya, Kishor [Alternative Development and Research Center (ADRC), GPO BOX 20078, Kathmandu (Nepal)]. E-mail: k.atreya@gmail.com

    2007-06-15T23:59:59.000Z

    It is important to understand gender difference on pesticide use knowledge, attitude and practices for identifying pesticide risks by gender and to recommend more gender-sensitive programs. However, very few studies have been conducted so far in Nepal. This study, thus, interviewed a total of 325 males and 109 females during 2005 to assess gender differences on pesticide use knowledge, attitude and practices. More than 50% females had never been to school and only <8% individuals were found trained in Integrated Pest Management (IPM). Almost all males and females did not smoke, drink and eat during pesticides application and also believed that pesticides are harmful to human health, livestock, plant diversity and their environment. However, there were gender differences on household decision on pesticides to be used (p<0.001), care of wind direction during spraying (p=0.032), prior knowledge on safety measures (p=0.016), reading and understanding of pesticides labels (p<0.001), awareness of the labels (p<0.001) and protective covers. Almost all respondents were aware of negative impacts of pesticide use on human health and environment irrespective of gender; however, females were at higher risk due to lower level of pesticide use safety and awareness. It is strongly recommended to initiate gender-sensitive educational and awareness activities, especially on pesticide use practices and safety precautions.

  4. The Role of Androgens in Male Pregnancy and Female Competitive Behavior in a Sex Role Reversed Pipefish

    E-Print Network [OSTI]

    Scobell, Sunny Kay

    2012-02-14T23:59:59.000Z

    of the male reproductive cycle in seahorses. I predicted that androgens would be low during the early stages of pregnancy and increase during the end of pregnancy as males go through another cycle of spermatogenesis in preparation for the next mating event. My...

  5. Early career outcomes of male and female agricultural graduates: a synthesis of human capital and comparable worth theories

    E-Print Network [OSTI]

    Hamer-Cotten, Jennifer Faye

    1991-01-01T23:59:59.000Z

    spring 1987. Forty-two percent (n=2, 284) of the alumni responded. To adjust for institutional response bias, the sample of respondents was weighted according to each institution's proportion of the total 1977 agricultural enrollment. Men represent... with agricultural alumni in 1987 resulted in 2, 049 respondents. Overall, gender disparity occurred during graduates' early career development. Relative to men, women received lower employment compensation (i. e. , salary and benefits) regardless of similarities...

  6. Reduced Metabolsim in Brain 'Control Networks' Following Cocaine-Cues Exposure in Female Cocaine Abusers

    SciTech Connect (OSTI)

    Volkow, N.D.; Wang, G.; Volkow, N.D.; Tomasi, D.; Wang, G.-J.; Fowler, J.S.; Telang, F.; Goldstein, R.Z.; Alia-Klein, N.; Wong, C.T.

    2011-03-01T23:59:59.000Z

    Gender differences in vulnerability for cocaine addiction have been reported. Though the mechanisms are not understood, here we hypothesize that gender differences in reactivity to conditioned-cues, which contributes to relapse, are involved. To test this we compared brain metabolism (using PET and {sup 18}FDG) between female (n = 10) and male (n = 16) active cocaine abusers when they watched a neutral video (nature scenes) versus a cocaine-cues video. Self-reports of craving increased with the cocaine-cue video but responses did not differ between genders. In contrast, changes in whole brain metabolism with cocaine-cues differed by gender (p<0.05); females significantly decreased metabolism (-8.6% {+-} 10) whereas males tended to increase it (+5.5% {+-} 18). SPM analysis (Cocaine-cues vs Neutral) in females revealed decreases in frontal, cingulate and parietal cortices, thalamus and midbrain (p<0.001) whereas males showed increases in right inferior frontal gyrus (BA 44/45) (only at p<0.005). The gender-cue interaction showed greater decrements with Cocaine-cues in females than males (p<0.001) in frontal (BA 8, 9, 10), anterior cingulate (BA 24, 32), posterior cingulate (BA 23, 31), inferior parietal (BA 40) and thalamus (dorsomedial nucleus). Females showed greater brain reactivity to cocaine-cues than males but no differences in craving, suggesting that there may be gender differences in response to cues that are not linked with craving but could affect subsequent drug use. Specifically deactivation of brain regions from 'control networks' (prefrontal, cingulate, inferior parietal, thalamus) in females could increase their vulnerability to relapse since it would interfere with executive function (cognitive inhibition). This highlights the importance of gender tailored interventions for cocaine addiction.

  7. Chat up lines: effect of the menstrual cycle and sociosexuality on female response to male sexual displays 

    E-Print Network [OSTI]

    Kubicki, Natalie E

    2008-06-27T23:59:59.000Z

    al., who asked participants to judge how a typical woman would respond to particular chat up lines, this study investigated fertility as having a possible effect on responses and asked female-only participants (N=85) how they themselves would respond...

  8. Biotransformation of 2,3,3,3-tetrafluoropropene (HFO-1234yf) in male, pregnant and non-pregnant female rabbits after single high dose inhalation exposure

    SciTech Connect (OSTI)

    Schmidt, Tobias [Institut für Toxikologie, Universität Würzburg, Versbacher Str. 9, 97078 Würzburg (Germany)] [Institut für Toxikologie, Universität Würzburg, Versbacher Str. 9, 97078 Würzburg (Germany); Bertermann, Rüdiger [Institut für Anorganische Chemie, Universität Würzburg, Am Hubland, 97074 Würzburg (Germany)] [Institut für Anorganische Chemie, Universität Würzburg, Am Hubland, 97074 Würzburg (Germany); Rusch, George M. [Honeywell, P.O. Box 1057, Morristown, NJ 07962–1057 (United States)] [Honeywell, P.O. Box 1057, Morristown, NJ 07962–1057 (United States); Hoffman, Gary M. [Huntingdon Life Sciences., East Millstone, NJ (United States)] [Huntingdon Life Sciences., East Millstone, NJ (United States); Dekant, Wolfgang, E-mail: dekant@toxi.uni-wuerzburg.de [Institut für Toxikologie, Universität Würzburg, Versbacher Str. 9, 97078 Würzburg (Germany)] [Institut für Toxikologie, Universität Würzburg, Versbacher Str. 9, 97078 Würzburg (Germany)

    2012-08-15T23:59:59.000Z

    2,3,3,3-Tetrafluoropropene (HFO-1234yf) is a novel refrigerant intended for use in mobile air conditioning. It showed a low potential for toxicity in rodents studies with most NOAELs well above 10,000 ppm in guideline compliant toxicity studies. However, a developmental toxicity study in rabbits showed mortality at exposure levels of 5,500 ppm and above. No lethality was observed at exposure levels of 2,500 and 4,000 ppm. Nevertheless, increased subacute inflammatory heart lesions were observed in rabbits at all exposure levels. Since the lethality in pregnant animals may be due to altered biotransformation of HFO-1234yf and to evaluate the potential risk to pregnant women facing a car crash, this study compared the acute toxicity and biotransformation of HFO-1234yf in male, female and pregnant female rabbits. Animals were exposed to 50,000 ppm and 100,000 ppm for 1 h. For metabolite identification by {sup 19}F NMR and LC/MS-MS, urine was collected for 48 h after inhalation exposure. In all samples, the predominant metabolites were S-(3,3,3-trifluoro-2-hydroxypropanyl)-mercaptolactic acid and N-acetyl-S-(3,3,3-trifluoro-2-hydroxypropanyl)-L-cysteine. Since no major differences in urinary metabolite pattern were observed between the groups, only N-acetyl-S-(3,3,3-trifluoro-2-hydroxypropanyl)-L-cysteine excretion was quantified. No significant differences in recovery between non-pregnant (43.10 ± 22.35 ?mol) and pregnant female (50.47 ± 19.72 ?mol) rabbits were observed, male rabbits exposed to 100,000 ppm for one hour excreted 86.40 ± 38.87 ?mol. Lethality and clinical signs of toxicity were not observed in any group. The results suggest that the lethality of HFO-1234yf in pregnant rabbits unlikely is due to changes in biotransformation patterns or capacity in pregnant rabbits. -- Highlights: ? No lethality and clinical signs were observed. ? No differences in metabolic pattern between pregnant and non-pregnant rabbits. ? Rapid and similar metabolite excretion in all groups. ? Very low amount of biotransformation in all groups (< 0.1%).

  9. The effects of waist-to-hip ratio and body weight on male judgements of female physical attractiveness, wife desirability, and health, both within and between cultures. 

    E-Print Network [OSTI]

    McLean, Julia

    2007-01-01T23:59:59.000Z

    Evolutionary theories maintain that female physical attractiveness has evolved to honestly signal health and reproductive potential. Both a low waist-to-hip ratio (WHR) and a critical range of body weight have received ...

  10. Voices of Four African American Female Clergy and Their Perceptions of Gender, Equity, and Leadership Styles in the African American Urban Church

    E-Print Network [OSTI]

    Ogletree, Evelyn 1954-

    2012-11-30T23:59:59.000Z

    (Ecklund, 2006). Gradual improvements have occurred in recent years, but discrimination, based on gender, is still present in mass across Black Protestant denominations in the United States (Gallagher, 2004). These instances of oppression have reduced... is that discrimination directed at this group comes from African American men rather than from White men and women. These are the same type of men who themselves have suffered from incidences of discrimination. While nearly half of Black pastors approve of women...

  11. PRE-MATING COMMUNICATION AND HYBRIDIZATION BETWEEN TWO MEADOW KATYDIDS, ORCHELIMUM NIGRIPES AND O. PULCHELLUM (ORTHOPTERA: TETTIGONIIDAE): MALE CALLING SONG AND ASYMMETRIC FEMALE PREFERENCE

    E-Print Network [OSTI]

    Miller, Ginger

    2010-12-06T23:59:59.000Z

    , males of both parental species and the hybrids would sing from lower grassy vegetation as well as high in kudzu and trees. They were also observed feeding on seeds and insect prey (which were ubiquitous), so this hybrid zone is not likely an ecotonal...

  12. Gender Equality and Female Empowerment Policy

    Broader source: Energy.gov (indexed) [DOE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742 33Frequently20,000 RussianBy: Thomas P. D'Agostino, Undersecretary11-161-LNGGary M.Gena E. Cadieux

  13. Gender and snow crab occupational asthma in Newfoundland and Labrador, Canada

    SciTech Connect (OSTI)

    Howse, Dana [SafetyNet, Newfoundland and Labrador Centre for Applied Health Research, Faculty of Medicine, Memorial University, St. John's, Nfld., Canada A1B 3V6 (Canada); Gautrin, Denyse [Hopital du Sacre-Coeur de Montreal, Montreal, Que., H4J 1C5 (Canada); Neis, Barbara [SafetyNet, Newfoundland and Labrador Centre for Applied Health Research, Faculty of Medicine, Memorial University, St. John's, Nfld., A1B 3V6 (Canada)]. E-mail: bneis@mun.ca; Cartier, Andre [Hopital du Sacre-Coeur de Montreal, Montreal, Que., H4J 1C5 (Canada); Horth-Susin, Lise [Valley Regional Hospital, Kentville, NS, B4N 5E3 (Canada); Jong, Michael [Faculty of Medicine, Memorial University and Health Labrador Corporation, Happy Valley, NL, AOP 1EO (Canada); Swanson, Mark C. [Mayo Clinic and Foundation, Rochester, MN 55905 (United States)

    2006-06-15T23:59:59.000Z

    Fish and shellfish processing employs many thousands of people globally, with shellfish processing becoming more important in recent years. Shellfish processing is associated with multiple occupational health and safety (OHS) risks. Snow crab occupational asthma (OA) is work-related asthma associated with processing snow crab. We present a gender analysis of findings from a 3-year multifaceted study of snow crab OA in Newfoundland and Labrador, Canada. The study was carried out in four snow crab processing communities between 2001 and 2004. An anonymous survey questionnaire on knowledge, beliefs, and concerns related to processing snow crab administered to 158 workers attending community meetings at the start of the research found that women were significantly more likely than men to associate certain health problems, especially chest tightness, difficulty breathing, and cough, with crab processing (P<0.001). Worker health assessments carried out with 215 processing workers (187 current/28 former; 120 female/95 male) found that female participants were more likely to be diagnosed as almost certain/highly probable snow crab OA and allergy (P=0.001) and to be sensitized to snow crab (P=0.01) than male participants. Work histories from the health assessments were used to classify processing jobs as male or female. Allergen sampling (211 allergen samples: 115 area, 96 personal breathing zone) indicated that the plant areas where these male jobs were concentrated were associated with lower levels of aerosolized crab allergens (the agents responsible for OA to snow crab) than areas associated with female jobs. This difference was statistically significant in the two plants with poor ventilation (p<0.001 and P=0.017 for these plants). A gender analysis of work history data showed that female health assessment participants were likely to have worked longer processing snow crab than males (5 years versus 3.5 years, respectively). Cross-referencing of work history results with allergen sampling data for male and female job areas showed a gender difference in median cumulative exposures (duration of exposurexlevel of exposures) for health assessment participants. Health assessment participants with estimated higher median cumulative exposures were more likely to receive a diagnosis of almost certain/highly probable OA and allergy. Semistructured interviews with 27 health assessment participants (24 female/ 3 male) with a diagnosis of almost certain/highly probable or possible snow crab OA indicated that these workers can experience substantial quality of life impacts while working and that they seek to reduce the economic impact of their illness by remaining at their jobs as long as possible. Indications of selection bias and other study limitations point to the need for more research exploring the relationship between the gender division of labor and knowledge, beliefs, and concerns about snow crab processing, as well as gender differences in prevalence, quality of life, and socioeconomic impact.

  14. ORIGINAL PAPER The effect of perceived female parasite

    E-Print Network [OSTI]

    Jones, Adam

    in behavioral ecology have resulted in a deeper appreciation of post-mating processes and sexual conflict and that a male's perception of female parasite load can be altered by tattooing females. We manipulated-copulatory sexual selection is dependent on a male's perception of female parasite load in pipefish. Our results

  15. Guidance on the Use of Hand-Held Survey Meters for radiological Triage: Time-Dependent Detector Count Rates Corresponding to 50, 250, and 500 mSv Effective Dose for Adult Males and Adult Females

    SciTech Connect (OSTI)

    Bolch, W.E. [University of Florida; Hurtado, J.L. [University of Florida; Lee, C. [University of Florida; Manger, Ryan P [ORNL; Hertel, Nolan [Georgia Institute of Technology; Burgett, E. [Georgia Institute of Technology; Dickerson, W. [Armed Force Radiobiological Research Institute

    2012-01-01T23:59:59.000Z

    In June 2006, the Radiation Studies Branch of the Centers for Disease Control and Prevention held a workshop to explore rapid methods of facilitating radiological triage of large numbers of potentially contaminated individuals following detonation of a radiological dispersal device. Two options were discussed. The first was the use of traditional gamma cameras in nuclear medicine departments operated as makeshift wholebody counters. Guidance on this approach is currently available from the CDC. This approach would be feasible if a manageable number of individuals were involved, transportation to the relevant hospitals was quickly provided, and the medical staff at each facility had been previously trained in this non-traditional use of their radiopharmaceutical imaging devices. If, however, substantially larger numbers of individuals (100 s to 1,000 s) needed radiological screening, other options must be given to first responders, first receivers, and health physicists providing medical management. In this study, the second option of the workshop was investigated by the use of commercially available portable survey meters (either NaI or GM based) for assessing potential ranges of effective dose (G50, 50Y250, 250Y500, and 9500 mSv). Two hybrid computational phantoms were used to model an adult male and an adult female subject internally contaminated with 241Am, 60Cs, 137Cs, 131I, or 192Ir following an acute inhalation or ingestion intake. As a function of time following the exposure, the net count rates corresponding to committed effective doses of 50, 250, and 500 mSv were estimated via Monte Carlo radiation transport simulation for each of four different detector types, positions, and screening distances. Measured net count rates can be compared to these values, and an assignment of one of four possible effective dose ranges could be made. The method implicitly assumes that all external contamination has been removed prior to screening and that the measurements be conducted in a low background, and possibly mobile, facility positioned at the triage location. Net count rate data are provided in both tabular and graphical format within a series of eight handbooks available at the CDC website (http://www.bt.cdc.gov/radiation/clinicians/evaluation).

  16. Sex and Gender

    E-Print Network [OSTI]

    Sweeney, Deborah

    2011-01-01T23:59:59.000Z

    2010 Gender in ancient Egypt. In Egyptian archaeology,Women and gender in ancient Egypt: From prehistory to lateintersexual) genders in ancient Egypt were expressed in, and

  17. Subsequent Malignancies in Children Treated for Hodgkin's Disease: Associations With Gender and Radiation Dose

    SciTech Connect (OSTI)

    Constine, Louis S. [Department of Radiation Oncology, James P. Wilmot Cancer Center at University of Rochester, Rochester, NY (United States); Department of Pediatrics, James P. Wilmot Cancer Center at University of Rochester, Rochester, NY (United States)], E-mail: louis_constine@urmc.rochester.edu; Tarbell, Nancy [Department of Pediatric Radiation Oncology, Massachusetts General Hospital, Boston, MA (United States); Hudson, Melissa M. [Department of Hematology-Oncology, St. Jude Children's Research Hospital, Memphis, TN (United States); Schwartz, Cindy [Department of Hematology-Oncology, Johns Hopkins Hospital, Baltimore, MD (United States); Fisher, Susan G. [Department of Community and Preventative Medicine, James P. Wilmot Cancer Center at University of Rochester, Rochester, NY (United States); Muhs, Ann G. B.A. [Department of Radiation Oncology, James P. Wilmot Cancer Center at University of Rochester, Rochester, NY (United States); Basu, Swati K. [Department of Community and Preventative Medicine, James P. Wilmot Cancer Center at University of Rochester, Rochester, NY (United States); Kun, Larry E. [Department of Radiological Sciences, St. Jude Children's Research Hospital, Memphis, TN (United States); Ng, Andrea; Mauch, Peter [Department of Radiation Oncology, Brigham and Women's Hospital, Boston, MA (United States); Sandhu, Ajay [Department of Radiation Oncology, University of California Medical Center-San Diego, San Diego, CA (United States); Culakova, Eva [Department of Community and Preventative Medicine, James P. Wilmot Cancer Center at University of Rochester, Rochester, NY (United States); Lyman, Gary [Department of Medicine, Duke University Medical Center, Durham, NC (United States); Mendenhall, Nancy [Department of Radiation Oncology, University of Florida Medical Center, Gainesville, FL (United States)

    2008-09-01T23:59:59.000Z

    Purpose: Subsequent malignant neoplasms (SMNs) are a dominant cause of morbidity and mortality in children treated for Hodgkin's disease (HD). We evaluated select demographic and therapeutic factors associated with SMNs, specifically gender and radiation dose. Methods and Materials: A total of 930 children treated for HD at five institutions between 1960 and 1990 were studied. Mean age at diagnosis was 13.6 years, and mean follow-up was 16.8 years (maximum, 39.4 years). Treatment included radiation alone (43%), chemotherapy alone (9%), or both (48%). Results: We found that SMNs occurred in 102 (11%) patients, with a 25-year actuarial rate of 19%. With 15,154 patient years of follow-up, only 7.18 cancers were expected (standardized incidence ratio [SIR] = 14.2; absolute excess risk [AER] = 63 cases/10,000 years). The SIR for female subjects, 19.93, was significantly greater than for males, 8.41 (p < 0.0001). After excluding breast cancer, the SIR for female patients was 15.4, still significantly greater than for male patients (p = 0.0012). Increasing radiation dose was associated with an increasing SIR (p = 0.0085). On univariate analysis, an increased risk was associated with female gender, increasing radiation dose, and age at treatment (12-16 years). Using logistic regression, mantle radiation dose increased risk, and this was 2.5-fold for female patients treated with more than 35 Gy primarily because of breast cancer. Conclusions: Survivors of childhood HD are at risk for SMNs, and this risk is greater for female individuals even after accounting for breast cancer. Although SMNs occur in the absence of radiation therapy, the risk increases with RT dose.

  18. Mercury toxicokinetics-dependency on strain and gender

    SciTech Connect (OSTI)

    Ekstrand, Jimmy [Molecular and Immunological Pathology, Department of Clinical and Experimental Medicine, Linkoeping University, SE-581 85 Linkoeping (Sweden); Nielsen, Jesper B. [Department of Environmental Medicine, University of Southern Denmark, DK-5000 Odense C (Denmark); Havarinasab, Said [Molecular and Immunological Pathology, Department of Clinical and Experimental Medicine, Linkoeping University, SE-581 85 Linkoeping (Sweden); Zalups, Rudolfs K. [Division of Basic Medical Sciences, Mercer University School of Medicine, 1550 College Street, Macon, GA 31207 (United States); Soederkvist, Peter [Cell Biology, Department of Clinical and Experimental Medicine, Linkoeping University, SE-581 85 Linkoeping (Sweden); Hultman, Per, E-mail: perhu@imk.liu.s [Molecular and Immunological Pathology, Department of Clinical and Experimental Medicine, Linkoeping University, SE-581 85 Linkoeping (Sweden)

    2010-03-15T23:59:59.000Z

    Mercury (Hg) exposure from dental amalgam fillings and thimerosal in vaccines is not a major health hazard, but adverse health effects cannot be ruled out in a small and more susceptible part of the exposed population. Individual differences in toxicokinetics may explain susceptibility to mercury. Inbred, H-2-congenic A.SW and B10.S mice and their F1- and F2-hybrids were given HgCl{sub 2} with 2.0 mg Hg/L drinking water and traces of {sup 203}Hg. Whole-body retention (WBR) was monitored until steady state after 5 weeks, when the organ Hg content was assessed. Despite similar Hg intake, A.SW males attained a 20-30% significantly higher WBR and 2- to 5-fold higher total renal Hg retention/concentration than A.SW females and B10.S mice. A selective renal Hg accumulation but of lower magnitude was seen also in B10.S males compared with females. Differences in WBR and organ Hg accumulation are therefore regulated by non-H-2 genes and gender. Lymph nodes lacked the strain- and gender-dependent Hg accumulation profile of kidney, liver and spleen. After 15 days without Hg A.SW mice showed a 4-fold higher WBR and liver Hg concentration, but 11-fold higher renal Hg concentration, showing the key role for the kidneys in explaining the slower Hg elimination in A.SW mice. The trait causing higher mercury accumulation was not dominantly inherited in the F1 hybrids. F2 mice showed a large inter-individual variation in Hg accumulation, showing that multiple genetic factors influence the Hg toxicokinetics in the mouse. The genetically heterogeneous human population may therefore show a large variation in mercury toxicokinetics.

  19. Male body image: critical measurement issues

    E-Print Network [OSTI]

    Brown, Joshua Daniel

    2002-01-01T23:59:59.000Z

    12 16 RESULTS. . . 18 Companng the SM and the BIA m the Assessment of Body Image. How Accurate Were Males and Females m Gauging Their Musculanty and Body Fatness' ?. . . How Accurate Were Males and Females m Gauging What the Opposite Sex Found...-wise Compansons for Quesuon Main Effects wtth BF%. Male and Female. 49 9 Comparmg Effect Sizes (Current vs. Ideal) Body Image Assessment (BIA) vs Somatomorphic Matnx (SM) 50 10 Factor Structure of the Affective Body Satisfaction (ABS). 51 11 Comparing Explamed...

  20. Female Biology Professor: Jennifer Dever

    E-Print Network [OSTI]

    Dever, Jennifer A.

    grandmother did not & vice versa? n What are the most pressing issues for women today? (locally & globally's philosophy on women Hysteria - - - hysterectomy #12;8/15/12 3 n Females and males ARE different... more than to keep in mind for the Health field NOW - Re-defining women's roles, the feminist perspective science

  1. Communication Standards for the Female Technical Sales Professional

    E-Print Network [OSTI]

    Macke, Brenda

    2005-12-16T23:59:59.000Z

    Communication techniques to be used by female technical sales professionals (FTSP) with clients were explored by researching gender communication, technical communication, and sales communication. It was found that by ...

  2. Deserting Gender: A Feminist Rhetorical Approach to Vietnam War Novels 

    E-Print Network [OSTI]

    Womack, Anne-Marie

    2012-07-16T23:59:59.000Z

    Female characters and references to femininity throughout American war literature disrupt discursive and biological divisions of the masculine and feminine. In examining gender and war literature over the twentieth century, ...

  3. Implicit Power Brokers: Benevolent Barriers to Gender Equity

    E-Print Network [OSTI]

    Rudman, Laurie A.

    2005-01-01T23:59:59.000Z

    to women. The result was their seminal study, “Who likes competent women?” (Spence & Helmreich, 1972a). To test their hypothesis that only gender egalitarians would like competent women, they designed the Attitudes Toward Women Scale (ATWS; Spence... barriers to gender equity. The Historical Approach Gender Prejudice as Antipathy Toward Women Anti-female attitudes. The ATWS (Spence & Helmreich, 1972b) assesses blatantly sexist attitudes regarding women’s status in society (e.g., “Women should...

  4. Gender, Truth & Transition

    E-Print Network [OSTI]

    Ní Aoláin, Pionnuala; Turner, Catherine

    2007-01-01T23:59:59.000Z

    50. Id. GENDER, TRUTH & TRANSITION contested, as evidencedG. Teitel, Human Rights in Transition: Transitional JusticeU.N. GENDER, TRUTH & TRANSITION Organization of American

  5. Working Nine to Five: Economic Impacts on the Gender Gap in Macro Politics .

    E-Print Network [OSTI]

    Scott, Holly Katherine

    2013-09-28T23:59:59.000Z

    ways, which lead to a dynamic policy preference gap between genders. I test the impact of economic differences created by careers in “gender divisive,” or male dominated and non-male dominated industries on the differences between men and women’s policy...

  6. Costs influence male mate choice in a freshwater fish

    E-Print Network [OSTI]

    Keogh, Scott

    Costs influence male mate choice in a freshwater fish Bob B. M. Wong* and Michael D. Jennions that female mate choice decisions depend on the direct costs of choosing (either because of search costs or male-imposed costs). Far less is known about how direct fitness costs affect male mate choice. We

  7. Gender, Race, and Survival: A Study in Non-Small-Cell Lung Cancer Brain Metastases Patients Utilizing the Radiation Therapy Oncology Group Recursive Partitioning Analysis Classification

    SciTech Connect (OSTI)

    Videtic, Gregory M.M., E-mail: videtig@ccf.or [Department of Radiation Oncology, Taussig Cancer Institute, Cleveland Clinic, Cleveland, OH (United States); Reddy, Chandana A. [Department of Radiation Oncology, Taussig Cancer Institute, Cleveland Clinic, Cleveland, OH (United States); Chao, Samuel T. [Department of Radiation Oncology, Taussig Cancer Institute, Cleveland Clinic, Cleveland, OH (United States); Brain Tumor and NeuroOncology Center, Taussig Cancer Institute, Cleveland Clinic, Cleveland, OH (United States); Rice, Thomas W. [Department of Thoracic and Cardiovascular Surgery, Taussig Cancer Institute, Cleveland Clinic, Cleveland, OH (United States); Adelstein, David J. [Department of Hematology and Medical Oncology, Taussig Cancer Institute, Cleveland Clinic, Cleveland, OH (United States); Barnett, Gene H. [Brain Tumor and NeuroOncology Center, Taussig Cancer Institute, Cleveland Clinic, Cleveland, OH (United States); Department of Neurosurgery, Taussig Cancer Institute, Cleveland Clinic, Cleveland, OH (United States); Mekhail, Tarek M. [Department of Hematology and Medical Oncology, Taussig Cancer Institute, Cleveland Clinic, Cleveland, OH (United States); Vogelbaum, Michael A. [Brain Tumor and NeuroOncology Center, Taussig Cancer Institute, Cleveland Clinic, Cleveland, OH (United States); Department of Neurosurgery, Taussig Cancer Institute, Cleveland Clinic, Cleveland, OH (United States); Suh, John H. [Department of Radiation Oncology, Taussig Cancer Institute, Cleveland Clinic, Cleveland, OH (United States); Brain Tumor and NeuroOncology Center, Taussig Cancer Institute, Cleveland Clinic, Cleveland, OH (United States)

    2009-11-15T23:59:59.000Z

    Purpose: To explore whether gender and race influence survival in non-small-cell lung cancer (NSCLC) in patients with brain metastases, using our large single-institution brain tumor database and the Radiation Therapy Oncology Group recursive partitioning analysis (RPA) brain metastases classification. Methods and materials: A retrospective review of a single-institution brain metastasis database for the interval January 1982 to September 2004 yielded 835 NSCLC patients with brain metastases for analysis. Patient subsets based on combinations of gender, race, and RPA class were then analyzed for survival differences. Results: Median follow-up was 5.4 months (range, 0-122.9 months). There were 485 male patients (M) (58.4%) and 346 female patients (F) (41.6%). Of the 828 evaluable patients (99%), 143 (17%) were black/African American (B) and 685 (83%) were white/Caucasian (W). Median survival time (MST) from time of brain metastasis diagnosis for all patients was 5.8 months. Median survival time by gender (F vs. M) and race (W vs. B) was 6.3 months vs. 5.5 months (p = 0.013) and 6.0 months vs. 5.2 months (p = 0.08), respectively. For patients stratified by RPA class, gender, and race, MST significantly favored BFs over BMs in Class II: 11.2 months vs. 4.6 months (p = 0.021). On multivariable analysis, significant variables were gender (p = 0.041, relative risk [RR] 0.83) and RPA class (p < 0.0001, RR 0.28 for I vs. III; p < 0.0001, RR 0.51 for II vs. III) but not race. Conclusions: Gender significantly influences NSCLC brain metastasis survival. Race trended to significance in overall survival but was not significant on multivariable analysis. Multivariable analysis identified gender and RPA classification as significant variables with respect to survival.

  8. Gendering Representation: Parties, Institutions, and the Under-Representation Of Women In Brazil's State Legislatures

    E-Print Network [OSTI]

    dos Santos, Pedro G.

    2012-12-31T23:59:59.000Z

    This dissertation provides insights on what influences women's descriptive representation in state legislatures in Brazil. The study of female representation in Brazil provides for a good case study as the country uses a gender quota system...

  9. The Gender Ideological Clash in Globalization: Women, Migration, and the Modernization Building Project of the Philippines

    E-Print Network [OSTI]

    Parreñ as, Rhacel Salazar

    2007-01-01T23:59:59.000Z

    My article interrogates the local impacts of global economic argue that the development of an export-oriented Filipino economy incorporates a gender ideological clash resulting from simultaneously encouraging and discouraging female domesticity...

  10. Ethnic and gender differences in boredom proneness

    SciTech Connect (OSTI)

    Gibson, G.S.; Morales,

    1996-02-01T23:59:59.000Z

    Although boredom may exhibit many shared elements, culturally specific attitudes have also been found to exist. The present paper investigated boredom proneness among African-American college students. Data from 120 participants on the Boredom Proneness (BP) Scale was analyzed and compared to cross-cultural participants. African-American females scored significantly higher than African-American males. Scores were presented from two other studies to show a comparative look at boredom proneness in five other ethnic groups. African-American females are the only female ethnic group to score higher on the BP Scale than their male counterparts. Additionally, overall African-Americans, were found to have higher BP scores than their Western counterparts.

  11. College Gender Gaps

    E-Print Network [OSTI]

    Bronson, Mary Ann

    2013-01-01T23:59:59.000Z

    College Gender Gaps BY MARY ANN BRONSONBY MARY ANN BRONSON FALL 2013 W HY DO WOMEN ATTEND collegerelationship is crucial. Mary Ann Bronson, a Ph.D. candidate

  12. Female preference for complex male displays in hybridizing swordtails

    E-Print Network [OSTI]

    Cress, Zachary Pierce

    2009-05-15T23:59:59.000Z

    five traits (standard body length, body depth, dorsal fin width, sword length and vertical bar number) correlate to one another within natural variation of populations of X. birchmanni, X. malinche and three hybrid populations and created synthetic 3...

  13. Changing Public Views of Gender Roles in seven nations: 1988-2002.

    E-Print Network [OSTI]

    Scott, Jacqueline; Braun, Michael

    2009-01-01T23:59:59.000Z

    The paper analyzes the change of gender-role attitudes from 1988 to 2002 along two dimensions: the consequences of female labor-force participation for the children and a general gender ideology. Both dimensions are measured by two core items which...

  14. Female Figurines (Pharaonic Period)

    E-Print Network [OSTI]

    Waraksa, Elizabeth

    2008-01-01T23:59:59.000Z

    be translated “clay figure (of Isis). ” A spell to relieve arpyt Ast or “female figure of Isis. ” The term rpyt may ben sDt , a “female figure of Isis in firewood” (BM EA 9997 +

  15. Development projects in Pakistan are hiring increasing numbers of Pakistani female professionals to work on rural projects that

    E-Print Network [OSTI]

    Richner, Heinz

    Development projects in Pakistan are hiring increasing numbers of Pakistani female professionals. Policy message n Pakistan is a highly gender-segregated society, and more well-qualified female field for well-educat- ed Pakistani women Pakistan has one of the lowest female labour force

  16. DETERMINATION OF AGE AND GENDER DIFFERENCES IN BIOCHEMICAL PROCESSES AFFECTING THE DISPOSITION OF 2-BUTOXYETHANOL AND ITS METABOLITES IN MICE AND RATS TO IMPROVE PBPK MODELING

    SciTech Connect (OSTI)

    Corley, Rick A.; Grant, Donna M.; Farris, Elizabeth; Weitz, Karl K.; Soelberg, Jolen J.; Thrall, K D.; Poet, Torka S.

    2005-03-28T23:59:59.000Z

    2-Butoxyethanol (BE) is the most widely used glycol ether solvent. BE's major metabolite, butoxyacetic acid (BAA), causes hemolysis with significant species differences in sensitivity. Several PBPK models have been developed over the past two decades to describe the disposition of BE and BAA in male rats and humans to refine health risk assessments. More recent efforts by Lee et al. (1998) to describe the kinetics of BE and BAA in the National Toxicology Program (NTP) chronic inhalation studies required the use of several assumptions to extrapolate model parameters from earlier PBPK models developed for young male rats to include female F344 and both sexes of B6C3F1 mice and the effects of aging. To replace these assumptions, studies were conducted to determine the impact of age, gender and species on the metabolism of BE, and the tissue partitioning, renal acid transport and plasma protein binding of BAA. In the current study, the Lee et al. PBPK model was updated and expanded to include the further metabolism of BAA and the salivary excretion of BE and BAA which may contribute to the forestomach irritation observed in mice in the NTP study. The revised model predicted that peak blood concentrations of BAA achieved following 6-hr inhalation exposures are greatest in young adult female rats at concentrations up to 300 ppm. This is not the case predicted for old (>18 months) animals, where peak blood concentrations of BAA in male and female mice were similar to or greater than female rats. The revised model serves as a quantitative tool for integrating an extensive pharmacokinetic and mechanistic database into a format that can readily be used to compare internal dosimetry across dose, route of exposure and species.

  17. Journal of Insect Behavior, Vol. 15, No. 2, March 2002 ( C 2002) Breeding Strategies in Females of the Parasitoid

    E-Print Network [OSTI]

    King, Bethia H.

    , females are generally larger than males (Napoleon and King, 1999). It is possible that some S. endius, appears to be affected by host size (Napoleon and King, 1999). Thus, large hosts may benefit mated females

  18. Measuring sexual selection on females in sex-role-reversed Mormon crickets (Anabrus simplex, Orthoptera: Tettigoniidae)

    E-Print Network [OSTI]

    Gwynne, Darryl T.

    Measuring sexual selection on females in sex-role-reversed Mormon crickets (Anabrus simplex, Anabrus simplex, a katydid in which there can be intense sexual selection on females in nature (Gwynne B I O L O G Y Keywords: Anabrus simplex; female competition; male choice; Orthoptera; selection

  19. The Nature of Gender: work, gender and environment 

    E-Print Network [OSTI]

    Nightingale, Andrea J

    2006-01-01T23:59:59.000Z

    Gender has long been recognised as important within environmental issues, but exactly how and in what contexts it is relevant has been hotly debated. As feminist theorising around women and gender has changed, so ...

  20. The Female Grotesque Amid the Carnival of Renaissance Drama

    E-Print Network [OSTI]

    Guy, Corinee Wooten

    2009-04-24T23:59:59.000Z

    ’s experience.” 41 Additionally, Jacobean writers often dramatized unlicensed celebration to express concern over “their increasingly unfamiliar and unruly city” and reflected authority’s anxiety about “the symbols of its coherence, the devices of its... version of the hot, dry, well-regulated man’s, 108 so that quiet and submissive seemed a natural assignment for the female. Some Renaissance authorities suggested that overlaps between male and female humoral balances occur due to life style, climate...

  1. 0 Springer-Verlag 1989 Female turtles from hot nests

    E-Print Network [OSTI]

    Canberra, University of

    or proportion of development at high temperatures that matters? Arthur Georges Applied Ecology Research Group nests of fresh- water turtles with temperature-dependent sex determination is known to be a poor species, females are produced at high temperatures and males at low temperatures. A very narrow range

  2. Poverty and Productivity in Female-Headed Households in Zimbabwe

    E-Print Network [OSTI]

    Horrell, Sara; Krishnan, Pramila

    A household survey conducted in rural Zimbabwe in 2001 is used to compare the position of de facto and de jure female-headed households to those with a male head. These households are characterised by different forms of poverty that impinge...

  3. FEMALE SINGERS on CD IN THE MUSIC LIBRARY

    E-Print Network [OSTI]

    Lennard, William N.

    FEMALE SINGERS on CD IN THE MUSIC LIBRARY Choose the CATALOGUE, and perform a KEYWORD search, using *GRAHAM, Sandra *GREEN, Patricia # HAMARI, Julia HELLING, Hilke HODGSON, Alfreda HORNE, Marilyn *KRAUSE Librarian Music Library - Western Libraries Western University 2012/04/07 #12;MALE SINGERS ON CD

  4. Gender differences in office occupant perception of indoor environmental quality (IEQ)

    E-Print Network [OSTI]

    Kim, Jungsoo; de Dear, Richard; Candido, Christhina; Zhang, Hui; Arens, Edward

    2013-01-01T23:59:59.000Z

    and potential improvements. Ergonomics. 2005;48:25-37. [8]and sensations. Applied Ergonomics. 1981;12:29-33. [21]males and females at rest. Ergonomics. 1991;34:365-78. [28

  5. Special Colloquium : Looking at High Energy Physics from a gender studies perspective

    ScienceCinema (OSTI)

    None

    2011-04-25T23:59:59.000Z

    Human actors, workplace cultures and knowledge production: Gender studies analyse the social constructions and cultural representations of gender. Using methods and tools from the humanities and social science, we look at all areas, including the natural sciences and technology, science education and research labs. After a short introduction to gender studies, the main focus of my talk will be the presentation of selected research findings on gender and high energy physics. You will hear about an ongoing research project on women in neutrino physics and learn about a study on the world of high energy physicists characterised by "rites of passage" and "male tales" told during a life in physics. I will also present a study on how the HEP community communicates, and research findings on the naming culture in HEP. Getting to know findings from another field on your own might contribute to create a high energy physics culture that is fair and welcoming to all genders.

  6. Special Colloquium : Looking at High Energy Physics from a gender studies perspective

    SciTech Connect (OSTI)

    None

    2011-03-09T23:59:59.000Z

    Human actors, workplace cultures and knowledge production: Gender studies analyse the social constructions and cultural representations of gender. Using methods and tools from the humanities and social science, we look at all areas, including the natural sciences and technology, science education and research labs. After a short introduction to gender studies, the main focus of my talk will be the presentation of selected research findings on gender and high energy physics. You will hear about an ongoing research project on women in neutrino physics and learn about a study on the world of high energy physicists characterised by "rites of passage" and "male tales" told during a life in physics. I will also present a study on how the HEP community communicates, and research findings on the naming culture in HEP. Getting to know findings from another field on your own might contribute to create a high energy physics culture that is fair and welcoming to all genders.

  7. Gender and Desire: Uncursing Pandora

    E-Print Network [OSTI]

    Young-Eisendrath, Polly

    1997-01-01T23:59:59.000Z

    as a biological constraint that is in flexible and gender as a social construct which is flexible and de pendent on context. There are only two gender clubs for humans and this division leads to some important psychological develop ments. Dr. Young..., the complexity of the psychological na ture of gender and desire as I have encountered them in my prac tice and my life. What seems most significant psychologically about gender is the division of the human community into two mu tually exclusive groups...

  8. Gender determination of avian embryo

    DOE Patents [OSTI]

    Daum, Keith A. (Idaho Falls, ID); Atkinson, David A. (Idaho Falls, ID)

    2002-01-01T23:59:59.000Z

    Disclosed is a method for gender determination of avian embryos. During the embryo incubation process, the outer hard shells of eggs are drilled and samples of allantoic fluid are removed. The allantoic fluids are directly introduced into an ion mobility spectrometer (IMS) for analysis. The resulting spectra contain the relevant marker peaks in the positive or negative mode which correlate with unique mobilities which are sex-specific. This way, the gender of the embryo can be determined.

  9. Gender essentialisms and ecological feminist philosophies

    E-Print Network [OSTI]

    Mallory, Jason Leonard

    2001-01-01T23:59:59.000Z

    the oppression of women and environmental degradation. I will also provide a logical analysis of arguments for gender essentialisms and arguments against these theories. And, lastly, I will consider why gender essentialisms ought to matter for ecofeminist...

  10. Gender stereotypes in Canadian picture books

    E-Print Network [OSTI]

    Berthelot, Jennifer Gail

    1997-01-01T23:59:59.000Z

    This research sought to quantify gender representation in a sample of award winning Canadian picture books. A reliable content analysis was used to collect data pertaining to the visibility of genders in titles, main roles, secondary roles...

  11. Gender, social roles and health care utilization

    E-Print Network [OSTI]

    David, Jennifer Louise

    1992-01-01T23:59:59.000Z

    by the fixed role hypothesis. This analysis estimates a model according to which the gender differential in health care utilization is attributable to the mediating effects of gender influenced social roles and the resources and psycho-social dispositions... to physical symptoms. The present analysis esumates a model according to which the gender differential in health care utilization is attributable to the mediating effects of gender influenced social roles and associated resources and dispositions...

  12. AAUP Faculty Gender Equity Indicators 2006

    E-Print Network [OSTI]

    -11.......................................................5 Figure 2: Faculty Employment Status by Gender and Institutional Category, 2005-06-2003.................................................................................7 Figure 4: Tenure Status of Full-Time Faculty by Gender and Institutional Category, 2005-06..........8 Figure 5: Full Professors, by Gender and Institutional Type, 2005-06

  13. Gender and Computer Science Education

    E-Print Network [OSTI]

    Galpin, Vashti

    Gender and Computer Science Education Vashti Galpin vashti@cs.wits.ac.za http://www.cs.wits.ac.za/~vashti Technical Report: 1992-05 April 1992 Department of Computer Science University of the Witwatersrand Private Science Education course that was presented as part of the MSc in Computer Science by Coursework

  14. Changing her tune : how a transsexual woman claims a new identity through voice

    E-Print Network [OSTI]

    Gammon, Katharine Stoel

    2007-01-01T23:59:59.000Z

    The human voice is an important indicator of a person's gender. For male-to-female transgender individuals (or transsexuals) the voice is one of the most difficult parts of the gender transition. Males have larger and ...

  15. Available online at www.sciencedirect.com Female mate choice copying affects sexual selection in wild

    E-Print Network [OSTI]

    Indiana University

    in wild populations of the ocellated wrasse SUZANNE H. ALONZO Department of Ecology and Evolutionary and importance of nonindependent female choice in wild popula- tions. In a species with male territoriality under natural conditions in the wild. I further show that a short- term experimental increase

  16. Seeing Stars: Female Film Stars and Female Audiences in Post-Colonial Korea

    E-Print Network [OSTI]

    Park, JaeYoon

    2008-07-29T23:59:59.000Z

    , particularly in relation to such gendered processes as decolonization (and re-colonization), modernization, democratization, and globalization....

  17. The Female of the Species is More Deadly than the Male

    E-Print Network [OSTI]

    Wright, Meg

    1982-01-01T23:59:59.000Z

    here eyes off tho delicate: HlrlnG for a moment and eyed him.ruefully. "It'd be a lot oasior if I could lift tho Hho18 suction (Jut, but those old Ac4ll models aren r t dos ignod to come a,part." He tried. to nod, found it impossibln. "Easters has.... In my u~1iv(:rsc, Or climol1S:L0n, or whcrovcr,'l .').Iil the Captain of the Ento:cprise." uIn you:-c imaGination, maybo. In your H ishcs, I \\.iarosay. In realit.y,? never. 11 HHoY! aTC you Going to link with Urock?" She stood ,:tncl facod hiii1p...

  18. MALE QUALITY INFLUENCES INTERSEXUAL DYNAMICS, BUT NOT FEMALE INTRASEXUAL COMPETITION, IN A MONOGAMOUS, BIPARENTAL FISH

    E-Print Network [OSTI]

    Robart, Ashley Rogers

    2015-01-01T23:59:59.000Z

    carotenoids and clutch quality in the two- spotted goby (relationship between signal quality and physical condition:investment when mate quality varies: Differential allocation

  19. The Autoimmune Regulator (AIRE) preserves fertility in male and female Balb/c mice.

    E-Print Network [OSTI]

    Warren, Bryce

    2014-12-31T23:59:59.000Z

    of GnRH or gonadotropin release, or third, the infringement of the hypothalamic-pituitary portal circulatory system. Examples resulting in functional 22 destruction include hypothalamic/pituitary tumors or cysts (Citron et al., 1996) as well..., & Chipps, 1986) and artificially elevated gonadal steroids (Turek, Williams, Gilbaugh, & Lipshultz, 1995). Finally, a disruption of the pituitary portal circulatory system, which prevents GnRH from reaching the pituitary or gonadotropins from entering...

  20. FEMALE CONDITION AND DELAYED BENEFITS TO MALES THAT PROVIDE PARENTAL CARE: A REMOVAL STUDY

    E-Print Network [OSTI]

    (e.g.Da- vies 1989)hasled studentsof reproductivebe- havior to questionmore critically why malesin some

  1. A comparison of range of joint mobility in college females and males

    E-Print Network [OSTI]

    Staff, Kathy Rene

    1983-01-01T23:59:59.000Z

    the weighted end of the needle downward during the movement. This measuri ng techni que does not requi re extra equipment and the technique oi' administration was carefully described by Leighton ( 1966) so that comparative studies can be easily made. Roebuck..., et al. ( 1975) point out that the flexometer can be easily used to measure the human body in protective equipment as well as nude (except for some ankle measures). However, they also note that this method does not cons ider shi fti ng joint...

  2. Visual Anxiety: Deviant Gender and Depictions of the Jewish Male During the Dreyfus Affair

    E-Print Network [OSTI]

    McKee, Cameron

    2010-01-01T23:59:59.000Z

    the glorified military past of Napoleon as the height of theof the Eighteen Brumaire [Napoleon], was in reality the8 Here Dutens posited Napoleon as a crucial figure to the

  3. Faculty of Forest Sciences Gender and Forestry

    E-Print Network [OSTI]

    Faculty of Forest Sciences Gender and Forestry - a bibliography Lillemor Lyrén Forestry Library #12;SLU Forestry Library SE-901 83 Umeå, Sweden Jan 2006 1 #12;Preface The initiative to this bibliography was taken by the IUFRO Working Party 6.28.01, Gender research in forestry. The work started in spring 2003

  4. The effect of individualized self-paced single-gender classrooms on reading and math scores at the mclennan county challenge academy in Waco, Texas

    E-Print Network [OSTI]

    Martin, Marilyn Ann

    2009-05-15T23:59:59.000Z

    The intent of this study is to determine the effects on the reading and math scores of females segregated into single-gender alternative classrooms that had the benefit of an individualized, self-paced curriculum. The Challenge Academy testing clerk...

  5. Hysterectomies and gender identity among Serbian women 

    E-Print Network [OSTI]

    Sukovic, Masa

    2009-05-15T23:59:59.000Z

    In this qualitative study, I explore the impact of national culture on the gender identity of Serbian women with hysterectomies, with special emphasis on traditional motherhood discourse and its implications for women who ...

  6. Courtship and Multi-Stage Transfer of Material to the Female's Wings During Copulation in Microsepsis armillata (Diptera: Sepsidae)

    E-Print Network [OSTI]

    Bermingham, Eldredge

    to brushes on his hind tibiae, from there to his middle tarsi, and finally to the bases of the female's wings during copulation. Males of many other sepsids also have brushes on their hind tibiae, indi cating, the osmeterium, on his hind tibia (Pont, 1979). The setae of the osme terium are said to be hollow, and to draw

  7. Gender Issues Among Academic AMS Members: Comparisons with the 1993 Membership Survey

    E-Print Network [OSTI]

    Tucker, Donna F.; Ginther, Donna K.; Winkler, Julie A.

    2009-08-01T23:59:59.000Z

    in the characteristics of male and female faculty. Where appropriate, statistics for 2005 are also provided for postdoctoral scientists. Unlike the 1993 survey, the 2005 survey also provides baseline information for future monitoring of postdoctoral scholars. Finally... in 1993. The structure and adminis- tration of the 2005 survey are described in Murillo et al. (2008b). For the analyses presented below, the academic community is defined as tenure-stream faculty and research scientists with postdoctoral appointments...

  8. Sex/Gender Differences and Autism: Setting the Scene for Future Research

    E-Print Network [OSTI]

    Lai, Meng-Chuan; Lombardo, Michael V.; Auyeung, Bonnie; Chakrabarti, Bhismadev; Baron-Cohen, Simon

    2014-10-16T23:59:59.000Z

    Large-scale studies also show less RRBI12,67 and even greater social–communication difficulties alongside poorer cognitive and adaptive functioning (as seen in the Simons Simplex Collection [SSC]).12 However, in high- functioning adults, given comparable... /temperamental features (e.g., impulsivity, behavioral inhibition) awaits further investigation.control groups), female toddlers achieve better visual recep- tion than boys, yet male toddlers attain better language and motor development.73 Girls score higher...

  9. What's in a Name: A Study of Names, Gender Inference, and Gender Behavior in Facebook

    E-Print Network [OSTI]

    Saxena, Nitesh

    What's in a Name: A Study of Names, Gender Inference, and Gender Behavior in Facebook Cong Tang-SWS, Kaiserslautern, Germany Email: rchen@mpi-sws.org Abstract. In this paper, by crawling Facebook public profile probability. First, we use the name list as part of a novel and powerful technique for inferring Facebook

  10. Cognitive Structures Underlying Gendered Language Usage in Germany: Narration and Linguistic Fieldwork

    E-Print Network [OSTI]

    Kolar, Meredith

    2011-01-01T23:59:59.000Z

    Gendered Language Usage in Germany: Narration and LinguisticGendered Language Usage in Germany: Narration and LinguisticGendered Language Usage in Germany: Narration and Linguistic

  11. Evolution of Surname Distribution under Gender-Equality Measures

    E-Print Network [OSTI]

    Toral, Raúl

    Evolution of Surname Distribution under Gender- Equality Measures Luis F. Lafuerza, Raul Toral Mallorca, Spain Abstract We consider a model for the evolution of surname distribution under a gender, Toral R (2011) Evolution of Surname Distribution under Gender-Equality Measures. PLoS ONE 6(4): e18105

  12. aging female sencar: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    should increase with age after puberty. To test this, we examined age Pierce, Graham 57 Perception of Conspecific Female Pheromone Stimulates Female Calling in an Arctiid Moth,...

  13. Hysterectomies and gender identity among Serbian women

    E-Print Network [OSTI]

    Sukovic, Masa

    2009-05-15T23:59:59.000Z

    of Department, Richard L. Street, Jr. August 2007 Major Subject: Communication iii ABSTRACT Hysterectomies and Gender Identity Among Serbian Women. (August 2007) Masa Sukovic, B.A., University of Belgrade, Belgrade, Serbia Chair... Research for financially supporting this research. Without the help and cooperation of wonderful people from Serbia, completing this thesis would have been impossible and I would like to express my warmest gratitude to Nena and Nikola Novakovic, Prof...

  14. A review of "Fashioning Adultery: Gender, Sex and Civility in England, 1660-1740." by David M. Turner

    E-Print Network [OSTI]

    Elena Levy-Navarro

    2006-01-01T23:59:59.000Z

    of philoso- phy? (13). In her conclusion, Hutton compares her own analysis of Conway with Carolyn Merchant?s own examination. This comparison is a good start, but Hutton needed to do more to situate her work within the history of women in science... and the history of gender and science. The reader of Anne Conway: A Female Philosopher will find a good, traditional history of Anne Conway?s intellectual world. The scholar looking for an analysis of Anne Conway and her philosophy in relation to the latest...

  15. .Female Pupils Perception of Electrical Engineering

    E-Print Network [OSTI]

    Tal, Ayellet

    1 .Female Pupils Perception of Electrical Engineering OrzitHazzan Technion--Israel Institute. BACKGROUND The Department of Electrical Engineering at Technion1 TheDepartmentofElectricalEngineeringatTechnion is ranked among the top-10 electrical engineering and computer science departments in the world

  16. Interventional Radiology of Male Varicocele: Current Status

    SciTech Connect (OSTI)

    Iaccarino, Vittorio, E-mail: vittorio.iaccarino@unina.it; Venetucci, Pietro [University of Naples 'Federico II', Diagnostic Imaging Department-Cardiovascular and Interventional Radiology, School of Medicine (Italy)

    2012-12-15T23:59:59.000Z

    Varicocele is a fairly common condition in male individuals. Although a minor disease, it may cause infertility and testicular pain. Consequently, it has high health and social impact. Here we review the current status of interventional radiology of male varicocele. We describe the radiological anatomy of gonadal veins and the clinical aspects of male varicocele, particularly the physical examination, which includes a new clinical and ultrasound Doppler maneuver. The surgical and radiological treatment options are also described with the focus on retrograde and antegrade sclerotherapy, together with our long experience with these procedures. Last, we compare the outcomes, recurrence and persistence rates, complications, procedure time and cost-effectiveness of each method. It clearly emerges from this analysis that there is a need for randomized multicentre trials designed to compare the various surgical and percutaneous techniques, all of which are aimed at occlusion of the anterior pampiniform plexus.

  17. Sexual partner concurrency among female sex workers and their intimate male partners in two Mexico-U.S. border cities

    E-Print Network [OSTI]

    Robertson, Angela Marie; Robertson, Angela Marie

    2012-01-01T23:59:59.000Z

    que tienen clientes de una-sola-vez o no- regulares. Desdeno regulares o de una-sola-vez? ¨? ¿Cuánta información creesean regulares o de una-sola-vez)? ¨? ¿Usted cree que su

  18. Refined understanding of sulfur amino acid nutrition in hybrid striped bass, Morone chrysops (male symbol) x M. saxatilis (female symbol)

    E-Print Network [OSTI]

    Kelly, Mark Christopher

    2005-08-29T23:59:59.000Z

    Previous studies have indicated the level of total sulfur amino acids (TSAA) (methionine + cystine) is most limiting in practical diet formulations for hybrid striped bass (HSB), especially if animal feedstuffs are replaced with plant feedstuffs...

  19. The role of constrictor prostanoids in the development of aortic coarctation-induced hypertension in male and female rats

    E-Print Network [OSTI]

    Baltzer, Wendy Irene

    2005-02-17T23:59:59.000Z

    function and arterial blood pressure (MAP) during development of aortic coarctation-induced hypertension (HT). M and F rats, (15-18 wks.) in four groups: normotensive (NT), hypertensive (HT), ovariectomized (OVX), and OVX estrogen-replaced (OE), underwent...

  20. First male sperm precedence in multiply-mated females of the cooperative spider Anelosimus studiosus (Araneae, Theridiidae)

    E-Print Network [OSTI]

    Jones, Thomas C.

    University, Johnson City, Tennessee 37614, USA. E-mail: jonestc@etsu.edu Patricia G. Parker: Department

  1. O Que Não Dá Chupa: The Male-to-Female ‘Homosexual’ As Star of Brazil’s Economic Boom

    E-Print Network [OSTI]

    Costa, Diego

    2012-01-01T23:59:59.000Z

    Homosexual” As The Star of Brazil’s Economic Boom (earlyof Southern California Two of Brazil’s most re-occurringabout itself are that Brazil is the country of the future,

  2. Self-selection contributes significantly to the lower adiposity of faster, longer-distanced, male and female walkers

    E-Print Network [OSTI]

    Williams, Paul T.

    2006-01-01T23:59:59.000Z

    depend upon the sample percentile of the BMI or body1 shows that the 90 th percentile of BMI declines morevelocity than lower BMI percentiles, a phenomenon also

  3. The effects of two situational variables on the self-confidence of males and females in achievement settings

    E-Print Network [OSTI]

    Smith, Susan Marilyn Hartman

    1977-01-01T23:59:59.000Z

    - ~uivocal feedback on individuals' abilities, women do not have lower self-confidence than men. Feather and. Simon (1971) found no sex differences in conf1dence of passing a subsequent anagruns test when the subjects had been given feedback in the form oi..., 94 ) I ? 5. 28, yg . 01. A Scheffe's comparison of means revealed that subjects who were given clear feedback were significantly more conf1dent in same-sex competition (X= 4. 26) and less confident in oppos1te-sex competition (X= 2. 71), g g . 05...

  4. The effects of two situational variables on the self-confidence of males and females in achievement settings 

    E-Print Network [OSTI]

    Smith, Susan Marilyn Hartman

    1977-01-01T23:59:59.000Z

    - ~uivocal feedback on individuals' abilities, women do not have lower self-confidence than men. Feather and. Simon (1971) found no sex differences in conf1dence of passing a subsequent anagruns test when the subjects had been given feedback in the form oi..., 94 ) I ? 5. 28, yg . 01. A Scheffe's comparison of means revealed that subjects who were given clear feedback were significantly more conf1dent in same-sex competition (X= 4. 26) and less confident in oppos1te-sex competition (X= 2. 71), g g . 05...

  5. Education no longer deferred: the possibilities of educating urban african american males in a single gender school.

    E-Print Network [OSTI]

    James, Marlon C.

    2009-05-15T23:59:59.000Z

    The purpose of this study is to investigate the emerging school culture of Excel Academy for Boys [Pseudonym] located in the Southwestern region of the United States, and how it contributes to the social and academic development of urban African...

  6. Mathematical models and specific absorbed fractions of photon energy in the nonpregnant adult female and at the end of each trimester of pregnancy

    SciTech Connect (OSTI)

    Stabin, M.G.; Watson, E.E.; Cristy, M.; Ryman, J.C.; Eckerman, K.F. [Oak Ridge National Lab., TN (United States)] [Oak Ridge National Lab., TN (United States); Davis, J.L. [Tennessee Univ., Chattanooga, TN (United States)] [Tennessee Univ., Chattanooga, TN (United States); Marshall, D. [Florida Univ., Gainesville, FL (United States). Dept. of Nuclear Engineering] [Florida Univ., Gainesville, FL (United States). Dept. of Nuclear Engineering; Gehlen, M.K. [San Diego State Univ., CA (United States)] [San Diego State Univ., CA (United States)

    1995-05-08T23:59:59.000Z

    Mathematical phantoms representing the adult female at three, six, and nine months of gestation are described. They are modifications of the 15-year-old male/adult female phantom (15-AF phantom) of Cristy and Eckerman (1987). The model of uterine contents includes the fetus, fetal skeleton, and placenta. The model is suitable for dose calculations for the fetus as a whole; individual organs within the fetus (other than the skeleton) are not modeled. A new model for the nonpregnant adult female is also described, comprising (1) the 15-AF phantom; (2) an adjustment to specific absorbed fractions for organ self-dose from photons to better match Reference Woman masses; and (3) computation of specific absorbed fractions with Reference Woman masses from ICRP Publication 23 for both penetrating and nonpenetrating radiations. Specific absorbed fractions for photons emitted from various source regions are tabulated for the new non;pregnant adult female model and the three pregnancy models.

  7. asymptomatic female patient: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    an in-depth survey and focus group interviews (more) Held, Shawna Sue 2013-01-01 33 Perception of Conspecific Female Pheromone Stimulates Female Calling in an Arctiid Moth,...

  8. anaesthetized female rat: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    a 16-mg lead or a control solution for 30 days... Rocha, Angelica 2009-05-15 55 Perception of Conspecific Female Pheromone Stimulates Female Calling in an Arctiid Moth,...

  9. allotriploid hybryd females: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    an in-depth survey and focus group interviews (more) Held, Shawna Sue 2013-01-01 10 Perception of Conspecific Female Pheromone Stimulates Female Calling in an Arctiid Moth,...

  10. Abnormal reproductive function in female homozygous leaner mice

    E-Print Network [OSTI]

    Serpedin, Nesrin

    2004-09-30T23:59:59.000Z

    Major Subject: Toxicology ABNORMAL REPRODUCTIVE FUNCTION IN FEMALE HOMOZYGOUS LEANER MICE A Thesis...) (Chair of Toxicology Faculty) December 2003 Major Subject: Toxicology iii ABSTRACT Abnormal Reproductive Function in Female Homozygous...

  11. AAPT Philadelphia 1/02 Gender, Educational Reform,

    E-Print Network [OSTI]

    Wu, Mingshen

    AAPT Philadelphia 1/02 Gender, Educational Reform, and Instructional Assessment: Part I Laura Mc/02 Why study this issue? One goal of PER is to improve physics education for all Current reform effort is strong; reforms serving subpopulations? Is this gender gap showing at the college level in physics? #12

  12. Gender Studies Graduate Student Library Orientation, Fall 2012

    E-Print Network [OSTI]

    Graham, Nick

    collection based on Library of Congress Classification. Depending on your research focus you may require1 Gender Studies Graduate Student Library Orientation, Fall 2012 Research Resources Librarian for Gender Studies: Sylvia Andrychuk andrychs@queensu.ca Office: Stauffer Library, room 107C Queen

  13. Playing and Passing: Expressions of Identity and the Destabilization of Gender Construction

    E-Print Network [OSTI]

    Palmore, Kim J.

    2010-01-01T23:59:59.000Z

    one to mess with’: The Construction of the Butch Role in thethe Destabilization of Gender Construction A Dissertationthe Destabilization of Gender Construction by Kim J. Palmore

  14. Do women represent women? : gender and policy in Argentina and Mexico

    E-Print Network [OSTI]

    Piscopo, Jennifer M.

    2011-01-01T23:59:59.000Z

    Fiscal Federalism in Argentina: Policies, Politics, andRepresent Women? Gender and Policy in Argentina and Mexico AWomen? Gender and Policy in Argentina and Mexico. by

  15. Impaired Visuospatial Processing in Young Adult Female Fragile X

    E-Print Network [OSTI]

    Nguyen, Danh

    Trends in Children Yingratana Bella McLennan, Ling Wong, Naomi Goodrich-Hunsaker, Danielle Harvey, FloraXPCs show faster psychomotor speed compared to HCs Female Motor Reaction Times Female Oral Reaction Times was accounted for but had no significant difference in error rates as compared to controls However, female

  16. Straddler-based Gender Reform in Saudi Arabia: The Case of Jeddah Chamber of Commerce and Industry

    E-Print Network [OSTI]

    Hamilton, Katherine

    2010-01-01T23:59:59.000Z

    and Globalization in the Arab Middle East: Gender, Economyand Globalization in the Arab Middle East: Gender, Economy

  17. Female physicists lead the way on Jefferson Lab experiment |...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    is a career field full of opportunities for women. He describes the field as gender blind - one where women and men are equally recognized for their knowledge and their work....

  18. Male body image: testosterone's response to body comparisons

    E-Print Network [OSTI]

    Brown, Joshua D.

    2006-08-16T23:59:59.000Z

    Although there have been only a few etiological studies that have examined the development and maintenance of body image in males, research fairly consistently reports that exposure and presumed comparison to images of ideal male bodies increases...

  19. Gender and ethnicity referral bias for ADHD: the school's view

    E-Print Network [OSTI]

    Rollins, Dahl Annette

    2006-10-30T23:59:59.000Z

    associated with characteristics of ADHD. These risk factors include cultural differences, socioeconomic status (SES), gender, and psychosocial stressors (Greenblatt, 1994; Morgan, 1976; Reid, Casat, Norton, Anastopoulos, & Temple, 2001; Stevens, Quittner...

  20. Godly Masculinities: Gender Discourse Among the Promise Keepers

    E-Print Network [OSTI]

    Bartkowski, John P.

    2001-04-01T23:59:59.000Z

    select sample of best-selling men's manuals representing various advice genres within this movement. I argue that PK gender discourses have given rise to four evangelical archetypes of godly manhood: the Rational Patriarch (traditional masculinity...

  1. SP.406 / WGS.406 Sexual and Gender Identities, Fall 2006

    E-Print Network [OSTI]

    Surkan, Kim

    This course introduces scholarly debates about sexual identities, gender identities and expressions, and sexual orientation and its representation in various media. We begin with an investigation of the theoretical ...

  2. SP.406 / WGS.406 Sexual and Gender Identities, Fall 2005

    E-Print Network [OSTI]

    Surkan, Kim

    This course introduces scholarly debates about sexual identities, gender identities and expressions, and sexual orientation and its representation in various media. We begin with an investigation of the theoretical ...

  3. SP.406 / WMN.406 Sexual and Gender Identities, Fall 2005

    E-Print Network [OSTI]

    Surkan, Kim

    This course introduces scholarly debates about sexual identities, gender identities and expressions, and sexual orientation and its representation in various media. We begin with an investigation of the theoretical ...

  4. Equity Not Equality: The Gender Discourse of an Egyptian Activist

    E-Print Network [OSTI]

    Lewis, Pauline

    2013-01-01T23:59:59.000Z

    analysts within and without Egypt continue to have questionsthe gender discourse in Egypt that proceeded and surroundedmovement that took hold in Egypt, al-Ghazali asks if it is

  5. Insiders and Outsiders: Does Forbidding Sexual Harassment Exacerbate Gender Inequality?

    E-Print Network [OSTI]

    Chen, Daniel L.

    2010-01-01T23:59:59.000Z

    2005. “Rising Wage Inequality: The Role of Composition andTechnology and U.S. Wage Inequality: A Brief Look. ” FederalHarassment Exacerbate Gender Inequality? Daniel L. Chen and

  6. art gender differences: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    that these stock measures mask two interesting patterns: (a) gender difference in the 1970's is an important exception. In addition to other differences, their work does not focus...

  7. Post-Doctoral Fellow Department of Gender Studies

    E-Print Network [OSTI]

    Indiana University

    candidates will demonstrate a research and teaching profile emphasizing intersections of gender and sexuality will be expected to teach a 2/1 course load. Indiana University is an Equal Employment Opportunity

  8. Deserting Gender: A Feminist Rhetorical Approach to Vietnam War Novels

    E-Print Network [OSTI]

    Womack, Anne-Marie

    2012-07-16T23:59:59.000Z

    in the poststructuralist critique of psychoanalysis advanced by Diana Fuss?s Identification Papers. For my project, comparing first Freud and Burke?s theories demonstrates their varying assumptions about and investments in gender, while examining feminist revisions... project, but instead to demonstrate that Burke?s notion of identification, a term integral to the mainstream practice of rhetoric, requires analysis of gendered hierarchies that feminist scholarship demands, particularly as he theorizes it as courtship...

  9. Gender ideology: impact on dual-career couples' role strain, marital satisfaction, and life satisfaction

    E-Print Network [OSTI]

    King, Jennifer Jean

    2006-04-12T23:59:59.000Z

    gender ideologies, as measured by the Bem Sex Role Inventory-Short Form (Bem, 1981), have more or less role strain than individuals classified as having androgynous gender ideologies, as measured by the Gender Role Conflict Scale-I (O?Neil, et al..., 1995). When individuals attempt to conform to these culturally stereotyped gender role norms, psychological stress occurs. Pleck (1981) referred to this stress as gender role strain. O?Neil, Good, and Holmes (1995) developed a major research...

  10. The role of human and social capital in explaining the lack of female head coaches in women's intercollegiate sports

    E-Print Network [OSTI]

    Stumph, Kelly J

    2013-02-22T23:59:59.000Z

    likely receiving lower salaries than males. vet the 1'cmales did not report less career satisfaction (Parks et al. , 1995). There are specific factors attributed to the disparity ol' 1'emale head soccer coaches. 'I'he intrinsic measure of career success... that this salary deficit is simply a result of vvomen earning lower salaries in an array of industries not just that of coaching. For instance, it was reported that in 1995, a full-time female communications manager earned $. 86 for every $1. 00 earned bv her...

  11. adolescent female rats: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    authors 48 Female Leadership Raises Aspirations and Educational Attainment for Girls: A Policy Experiment in India MIT - DSpace Summary: Exploiting a randomized natural...

  12. adolescent female football: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    56 Female Leadership Raises Aspirations and Educational Attainment for Girls: A Policy Experiment in India MIT - DSpace Summary: Exploiting a randomized natural...

  13. american female adolescents: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Werner 69 Female Leadership Raises Aspirations and Educational Attainment for Girls: A Policy Experiment in India MIT - DSpace Summary: Exploiting a randomized natural...

  14. american adolescent females: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Werner 69 Female Leadership Raises Aspirations and Educational Attainment for Girls: A Policy Experiment in India MIT - DSpace Summary: Exploiting a randomized natural...

  15. adolescent female attendance: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    35 Female Leadership Raises Aspirations and Educational Attainment for Girls: A Policy Experiment in India MIT - DSpace Summary: Exploiting a randomized natural...

  16. adolescent female distance: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    distance 26 Female Leadership Raises Aspirations and Educational Attainment for Girls: A Policy Experiment in India MIT - DSpace Summary: Exploiting a randomized natural...

  17. adolescent females affected: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    authors 42 Female Leadership Raises Aspirations and Educational Attainment for Girls: A Policy Experiment in India MIT - DSpace Summary: Exploiting a randomized natural...

  18. adult female giraffe: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    of 14 ESTIMATION OF ANNUAL AND SEMI-ANNUAL SURVIVAL OF ADULT FEMALE BLUE CRABS AND ASSESSMENT OF THE EFFECTIVENESS OF THE Biology and Medicine Websites Summary: ESTIMATION...

  19. A chimera embryo assay reveals a decrease in embryonic cellular proliferation induced by sperm from X-irradiated male mice

    SciTech Connect (OSTI)

    Obasaju, M.F.; Wiley, L.M.; Oudiz, D.J.; Raabe, O.; Overstreet, J.W.

    1989-05-01T23:59:59.000Z

    Male mice were divided into three experimental groups and a control group. Mice in the experimental groups received one of three doses of acute X irradiation (1.73, 0.29, and 0.05 Gy) and together with the control unirradiated mice were then mated weekly to unirradiated female mice for a 9-week experimental period. Embryos were recovered from the weekly matings at the four-cell stage and examined by the chimera assay for proliferative disadvantage. Aggregation chimeras were constructed of embryos from female mice mated to irradiated males (experimental embryos) and embryos from females mated to unexposed males (control embryos) and contained either one experimental embryo and one control embryo (heterologous chimera) or two control embryos (control chimera). The control embryo in heterologous chimeras and either embryo in control chimeras were prelabeled with the vital dye fluorescein isothiocyanate (FITC), and the chimeras were cultured for 40 h and viewed under phase-contrast and epifluorescence microscopy to obtain total embryo cell number and the cellular contribution from the FITC-labeled embryo. Experimental and control embryos that were cultured singly were also examined for embryo cell number at the end of the 40-h culture period. In control chimeras, the mean ratio of the unlabeled cells:total chimera cell number (henceforth referred to as ''mean ratio'') was 0.50 with little or no weekly variation over the 9-week experimental period. During Weeks 4-7, the mean ratios of heterologous chimeras differed significantly from the mean ratio of control chimeras with the greatest differences occurring during Week 7 (0.41 for chimeras of 0.05 Gy dose group, 0.40 for chimeras of the 0.29 Gy dose group, and 0.17 for chimeras of the 1.73 Gy dose group).

  20. The making and selling of an illusion: an examination of racial and gender diversity in post-civil rights U.S. corporations

    E-Print Network [OSTI]

    Embrick, David Geronimo Truc-Thanh

    2009-05-15T23:59:59.000Z

    with other laws such as the Equal Pay Act of 196319, the Voting Rights Act of 1965, the Immigration Act of 1965, etc.) posed serious threats to the white male power structure present in corporate America. After all, it was not until after changes.... v DEDICATION This is dedicated to all the working class folks who break their backs on a daily basis for very little wages and very little respect; to the women and minorities who consistently have to deal with gender and racial discrimination...

  1. Lost Ladies, New Women: Narrative Voice and Female Identity in Willa Cather's A Lost Lady and Kate Chopin's The Awakening

    E-Print Network [OSTI]

    Von Cannon, Jordan Lindsey

    2011-04-20T23:59:59.000Z

    The impact of assigning gender to narrators, either by the author or reader, has recently become a point of interest in narratology. The increasing interest in gender, sexuality, and queer studies highlights gendered voices ...

  2. aged male rats: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  3. adult male subjects: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  4. adolescent male rats: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  5. american male smokers: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  6. asymptomatic older male: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  7. adult male voxel: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  8. aging male symptoms: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  9. adult male rats: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  10. adult male rural: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  11. adult male circumcision: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  12. adult males crustacea: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  13. adult male offspring: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  14. adult male subantarctic: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  15. adult male rat: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  16. adult male case: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  17. abortive cytoplasmic male: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  18. adult male rhesus: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  19. adult male patient: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  20. adult male population: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  1. adolescent male physical: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  2. adult male sprague: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  3. adult male canaries: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  4. adolescent male evidence: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  5. adult male albino: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  6. atlantic male walruses: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  7. adult male guppy: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  8. anesthetized male rats: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  9. adult male acquired: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  10. adult male patients: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  11. adult male reproductive: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  12. affects male type: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  13. adult male leather: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  14. abdominalis choosy males: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  15. adult males pt: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  16. adult males characterized: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  17. adolescent male kalenjin: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  18. adult male spinal: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  19. altered male physiologic: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  20. apoe ko male: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  1. adult male mice: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  2. aging male rats: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  3. aging male focus: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  4. anopheles gambiae male: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  5. adult male wistar: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  6. aging male treatment: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  7. advance transobturator male: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  8. affecting male fertility: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  9. affected male demonstration: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  10. Limits of Equivalence: Thinking Gay Male Subjectivity Outside Feminist Theory

    E-Print Network [OSTI]

    Galloway, Samuel R.

    2010-01-01T23:59:59.000Z

    Limits of Equivalence: Thinking Gay Male Subjectivityor this limit of equivalence? The problem, of course, ispaper, the limits of equivalence emerge: while all subjects

  11. Management of Male Breast Cancer in the United States: A Surveillance, Epidemiology and End Results Analysis

    SciTech Connect (OSTI)

    Fields, Emma C., E-mail: emma.fields@ucdenver.edu [Department of Radiation Oncology, University of Colorado School of Medicine, Aurora, Colorado (United States); DeWitt, Peter [Colorado Biostatistics Consortium, University of Colorado, Aurora, Colorado (United States); Fisher, Christine M.; Rabinovitch, Rachel [Department of Radiation Oncology, University of Colorado School of Medicine, Aurora, Colorado (United States)

    2013-11-15T23:59:59.000Z

    Purpose: To analyze the stage-specific management of male breast cancer (MBC) with surgery and radiation therapy (RT) and relate them to outcomes and to female breast cancer (FBC). Methods and Materials: The Surveillance, Epidemiology, and End Results database was queried for all primary invasive MBC and FBC diagnosed from 1973 to 2008. Analyzable data included age, race, registry, grade, stage, estrogen and progesterone receptor status, type of surgery, and use of RT. Stage was defined as localized (LocD): confined to the breast; regional (RegD): involving skin, chest wall, and/or regional lymph nodes; and distant: M1. The primary endpoint was cause-specific survival (CSS). Results: A total of 4276 cases of MBC and 718,587 cases of FBC were identified. Male breast cancer constituted 0.6% of all breast cancer. Comparing MBC with FBC, mastectomy (M) was used in 87.4% versus 38.3%, and breast-conserving surgery in 12.6% versus 52.6% (P<10{sup ?4}). For males with LocD, CSS was not significantly different for the 4.6% treated with lumpectomy/RT versus the 70% treated with M alone (hazard ratio [HR] 1.33; 95% confidence interval [CI] 0.49-3.61; P=.57). Postmastectomy RT was delivered in 33% of males with RegD and was not associated with an improvement in CSS (HR 1.11; 95% CI 0.88-1.41; P=.37). There was a significant increase in the use of postmastectomy RT in MBC over time: 24.3%, 27.2%, and 36.8% for 1973-1987, 1988-1997, and 1998-2008, respectively (P<.0001). Cause-specific survival for MBC has improved: the largest significant change was identified for men diagnosed in 1998-2008 compared with 1973-1987 (HR 0.73; 95% CI 0.60-0.88; P=.0004). Conclusions: Surgical management of MBC is dramatically different than for FBC. The majority of males with LocD receive M despite equivalent CSS with lumpectomy/RT. Postmastectomy RT is greatly underutilized in MBC with RegD, although a CSS benefit was not demonstrated. Outcomes for MBC are improving, attributable to improved therapy and its use in this unscreened population.

  12. 11.237 / SP.660 Gender and Race, Work, and Public Policy, Spring 2005

    E-Print Network [OSTI]

    McDowell, Ceasar

    This course provides an analytic framework for understanding the roles that gender and race play in defining the work worlds of women and men in our society, including ways in which gender intersects with race and class. ...

  13. Performing Place: Race and Gender in Contemporary Southern U.S. Commemoration

    E-Print Network [OSTI]

    Hopkins, Chandra Owenby

    2012-05-31T23:59:59.000Z

    "Performing Place: Race and Gender in Contemporary Southern U.S. Commemoration" examines three commemorative events held in the southern U.S. for the ways in which participants enact desired racialized and gendered identities ...

  14. Fusing gait and face cues for human gender recognition Caifeng Shan a,, Shaogang Gong b

    E-Print Network [OSTI]

    Gong, Shaogang

    recognition performance of 97.2%. We plot in Fig. 1 the flow chart of our multimodal gender recognition system Available online 18 March 2008 Keywords: Gender classification Canonical correlation analysis Gait energy

  15. Regulation and Execution of Meiosis in Drosophh Males

    E-Print Network [OSTI]

    9 Regulation and Execution of Meiosis in Drosophh Males lean Maines and Steven Wasserm. Identification of Male Meiotic Mutant\\ IT. Regulation of the Meiotic Cell Divisions A. Entry into Meiosis B. Regulation of the Cell Cycle Machinery C. Coordination of Meio\\i\\ with Diflerentiation D. Regulation

  16. Adult Female English Language Learners: Investment, Identity and Benefits 

    E-Print Network [OSTI]

    Wharton, Anna

    2013-07-31T23:59:59.000Z

    for investing in the English language. This study explores the self-recounted experiences of three adult female English language learners’ (ELLs) motivation for investing in English language learning, their identities and the benefits gained in a nonacademic...

  17. adult female mice: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    17 18 19 20 21 22 23 24 25 Next Page Last Page Topic Index 1 The effect of continuous infusion of human parathyroid hormone on bone architecture in female mice MIT - DSpace...

  18. Mitochondrial bioenergetic deficit precedes Alzheimer's pathology in female mouse model

    E-Print Network [OSTI]

    Brinton, Roberta Diaz

    Mitochondrial bioenergetic deficit precedes Alzheimer's pathology in female mouse model and suggests therapeutic targets for prevention of AD. ABAD aging bioenergetics brain hypometabolism mitochondria The essential role of mitochondria in cellular bioenergetics and survival has been well

  19. Fertility, Female Participation in Employment and Reconciliation Policies in Spain 

    E-Print Network [OSTI]

    Ibanez, Marta

    2010-01-01T23:59:59.000Z

    Different aspects of decisions regarding parenthood are analysed. From an institutional perspective, reconciliation policies and features of the female labour market are studied, as well as the values and life views that ...

  20. Diet composition and performance of female collegiate soccer players 

    E-Print Network [OSTI]

    Clark, Mandy Michele

    2001-01-01T23:59:59.000Z

    intake. In conclusion, female soccer players appear to meet caloric needs during periods of training, but fail to meet minimum CHO and micronutrient recommendations. Foods higher in protein and fat, in addition to foods with low nutrient value may...

  1. The effects of ethylene dibromide on the reproductive system of male mice and male rabbits

    E-Print Network [OSTI]

    Hess, Kay

    1978-01-01T23:59:59.000Z

    Ethylene dibromide (EDB) is used as an addit1ve in leaded gasolines, as a fumigant and pesticide, as a solvent and as an intermediate to various products. But recently, due to some speculat1on, concern has grown over the possible effects of EDB... has terminated in ei ther conflicting reports or unpublished data. The newspapers caption front page articles--"Worries Are Growing Over Male Infertility Because of Job Hazards". And due to growing I Citations used on the following pages follow...

  2. The relationship of male socialization and personality pathology in male batterer subtypes

    E-Print Network [OSTI]

    Shefferman, Lee

    2007-09-17T23:59:59.000Z

    invaluable. I always joked that you were my Texas mother and yet there is a lot of truth in that statement. You fed me (love the wine mushrooms) and looked out for me. I would also like to thank John Wagner for sitting me down and giving me a talking... techniques may not be the sole or most effective 9 therapeutic intervention for treating male batterers. Specifically, such a finding may provide further evidence for the need to tailor treatment approaches based on batterer subtype and to consider...

  3. BETWEEN TRADITION AND MODERNIZATION: ATTITUDES TO WOMEN'S EMPLOYMENT AND GENDER ROLES IN CROATIA

    E-Print Network [OSTI]

    Løw, Erik

    AND GENDER ROLES IN CROATIA By Marija Brajdi Vukovi, Institute for Social Research Zagreb Gunn Birkelund AND MODERNIZATION: ATTITUDES TO WOMEN'S EMPLOYMENT AND GENDER ROLES IN CROATIA By Marija Brajdi Vukovi, Institute we analyze the attitudes toward gender roles and women's employment in Croatia. Using the SEESSP

  4. A Report on the Workshop on Gender Equity in Materials Science and Engineering

    E-Print Network [OSTI]

    Gilbert, Matthew

    A Report on the Workshop on Gender Equity in Materials Science and Engineering May 18 - 20, 2008 College Park, Maryland GENDER EQUITY IN MATERIALS SCIENCE AND ENGINEERING Sponsored by: #12;This report on the results of the Workshop on Gender Equity in Materials Science and Engineering was sponsored

  5. Gender Bias in Academic Medicine: Pitfalls, Promise and Progress

    E-Print Network [OSTI]

    Sheridan, Jennifer

    Gender Bias in Academic Medicine: Pitfalls, Promise and Progress University of Pittsburgh April 28 evaluators) · That these cumulative disadvantages impede women's progress toward leadership #12;Tremendous gains in medicine · In 2007-08, women comprised: ­ 49% of medical students ­ 45% residents & fellows

  6. Women in management: gender, age and working lives 

    E-Print Network [OSTI]

    Jyrkinen, Marjut; McKie, Linda

    The project reported in this briefing paper explored how age and gender inter-weave and impact on the working and home lives of women managers working in two EU member states, namely Finland and Scotland. The proportion of women in middle...

  7. Instrumental Borders of Gender and Religious Conversion in the Balkans*

    E-Print Network [OSTI]

    Paris-Sud XI, Université de

    Instrumental Borders of Gender and Religious Conversion in the Balkans* ALBERT DOJA ABSTRACT In this paper I look at religious identifications and affiliations in the Balkans as instrumental political else, the Balkans is a place of passages, encounters and contacts, formidable in its capability

  8. Faculty Retention and Gender Adrienne Kertzer and Jenny Godley

    E-Print Network [OSTI]

    Calgary, University of

    1 Faculty Retention and Gender Adrienne Kertzer and Jenny Godley Advisory Committee on the Status, and home faculty; by year, rank, and total number of faculty members across the 1 E-mail Adrienne Kertzer, and total number of faculty members in the home faculty.3 In January 2013, Jenny Godley, Department

  9. Weird Bodily Noises: Improvising Race, Gender, and Jazz History

    E-Print Network [OSTI]

    Williams, Peter

    2013-08-31T23:59:59.000Z

    This dissertation explores avant-garde jazz in Kansas City in the late 20th and early 21st centuries to find out how they both reproduce and complicate narratives of jazz history and norms of race and gender. Working in a ...

  10. SWET for the Summit: Exploration of Singapore’s First All-female Mount Everest Team

    E-Print Network [OSTI]

    Goh, Tan Leng

    2009-01-01T23:59:59.000Z

    FEMALE MOUNT EVEREST TEAM SWET for the Summit: ExplorationAll-female Mount Everest Team Tan Leng Goh California Statecommunity. The first all female team to summit Mount Everest

  11. A Crack in the Pipeline: Why Female Underrepresented Racial Minority Students Leave Engineering

    E-Print Network [OSTI]

    Vazquez-Akim, Jenn

    2014-01-01T23:59:59.000Z

    Espinosa, Lorelle L. (2011). Pipelines and pathways: womenAngeles A Crack in the Pipeline: Why Female UnderrepresentedA Crack in the Pipeline: Why Female Underrepresented Racial

  12. Exploration of pathways related to the decline in female circumcision in Egypt

    E-Print Network [OSTI]

    Modrek, Sepideh; Liu, Jenny X

    2013-01-01T23:59:59.000Z

    decline in female circumcision in Egypt. BMC Public HealthFemale circumcision in Egypt: social implications, currentfemale circumcision in Egypt: evidence and interpretation.

  13. SWORDTAIL MATE CHOICE AND REPRODUCTIVE ALLOCATION: EFFECTS OF MALE CONDITION

    E-Print Network [OSTI]

    Simpson, Suzanne

    2011-04-26T23:59:59.000Z

    were placed on a ?High-food? (HF) or ?Low-food? (LF) diet with 30 HF and 30 LF. Within each group (HF or LF) the males were then divided into tanks with 5 males per tank. Thus we had 6 HF replicates and 6 LF replicates. The males were consistently fed... of covariance GLM Generalized linear model GLMM Generalized linear mixed model HF High-food LF Low-food R Statistical program used for data analysis vi TABLE OF CONTENTS Page ABSTRACT...

  14. adolescent male health: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    PROMOTION AMONG RACIAL AND ETHNIC MINORITY MALES Funding Opportunity Number: PA-10-236. CFDA Number(s): 93.361, 93.847, 93.837, 93.399. Engineering Websites Summary: initial and...

  15. Alternative mating tactics and extreme male dimorphism in fig wasps. 

    E-Print Network [OSTI]

    Cook, James M; Compton, Steven G; Herre, E Allen; West, Stuart A

    1997-01-01T23:59:59.000Z

    The dimorphisms in morphology and behaviour of male fig wasps are among the most extreme in the animal kingdom, and offer excellent oppotunities to test the predictions of certain sexual selection models.

  16. Zinc levels in hair of pre-adolescent females

    E-Print Network [OSTI]

    Earp, Cheryl Fricke

    1978-01-01T23:59:59.000Z

    values in the same row, bearing a, common super- script letter, are not (P+. 05) significantly different. 29 Figure 3. Zinc Content of Hair from Medium Income Females According to Age and Ethnic Origin. IOyr. olds 9 yr. olds cd I I yr. olds l50... loo Negro Ethnic Origin Mexican CaUcasian 31 Figure 4. Zinc Content oi Hair from Low Income Females According to age and Ethnic Origin. 9yr. olds O z lO r O C N II yr, olds 100 Negro Ethnic Origin Mexican Caucasian The hair zinc means...

  17. Fairer Trade, Removing Gender Bias in US Import Taxes

    E-Print Network [OSTI]

    Taylor, Lori L.; Dar, Jawad

    Fairer Trade Removing Gender Bias in US Import Taxes LORI L. TAYLOR AND JAWAD DAR Mosbacher Institute VOLUME 6 | ISSUE 3 | 2015 There are many inequalities in US tariff policy. Products imported from certain countries enter duty free..., the US Su- preme Court refused to hear appeals from import- ers Rack Room Shoes Inc. and Forever 21 Inc., thereby blocking their attempts to challenge an earlier ruling by the Court of Internation- al Trade. The importers had argued before the Court...

  18. Female Health Issues: Part I Gynecological Dif:iculties

    E-Print Network [OSTI]

    Dever, Jennifer A.

    care provider B. The Progressive Era (1890's-1920's) · Reformers worked to change availability of prenatal & child health care #12;10/29/12 3 C. 60's & 70's redefining10/29/12 1 Female Health Issues: Part I ­ Gynecological Dif:iculties I

  19. A Female Homo erectus Pelvis from Gona, Ethiopia

    E-Print Network [OSTI]

    Utrecht, Universiteit

    A Female Homo erectus Pelvis from Gona, Ethiopia Scott W. Simpson,1,2 Jay Quade,3 Naomi E. Levin,4 of Gona, Afar, Ethiopia. This obstetrically capacious pelvis demonstrates that pelvic shape in H. erectus), in the Gona Paleoanthropological Research Project study area in the Afar Regional State, Ethiopia (Fig. 1

  20. Gender differences in the employment expectations of final year undergraduates in a university in Central China 

    E-Print Network [OSTI]

    Zhu, Jian

    2011-11-24T23:59:59.000Z

    This study investigates the gender differences in final year undergraduates’ employment expectations, broken down by salary expectations, occupational expectations and working region expectations, in a university in ...

  1. Do women represent women? : gender and policy in Argentina and Mexico

    E-Print Network [OSTI]

    Piscopo, Jennifer M.

    2011-01-01T23:59:59.000Z

    and Gender Quotas in Mexico. ? Electoral Studies 22: 101-of Decentralization: Lessons from Mexico, ed. Marcelo M.Federalismo Fiscal en México. ? MPRA Paper 10572, Munich,

  2. Smoking and Ischemic Heart Disease Disparities Between Studies, Genders, Times, and Socioeconomic Strata

    E-Print Network [OSTI]

    Leistikow, Bruce N.

    2009-01-01T23:59:59.000Z

    United States White heart disease mortality rates by gender–year–years of education, ages 25–64 years Heart disease death rate*

  3. Employment Discrimination Based on Sexual Orientation and Gender Identity in West Virginia

    E-Print Network [OSTI]

    Mallory, Christy; Hasenbush, Amira; Liebowitz, Sarah

    2013-01-01T23:59:59.000Z

    Human Rights Act prohibits employment discrimination basedEmployment Discrimination Based on Sexual Orientation andor gender identity in employment. 2 This report summarizes

  4. Humor perception in men and women: effect of joke type and gender of joke target 

    E-Print Network [OSTI]

    Parekh, Manisha

    2013-02-22T23:59:59.000Z

    on humor perception than target or vice versa. Gender nnd Humor Perception 27 References Brodzinsky, D. M. , Barnet, K. & Aiello, J. R. (1981). Sex of subject and gender identity as factors in humor appreciation. Sex Roles, 7, 561-573. Cantor, Joanne R...Gender and Humor Perception Humor Perception in Men and Women: Effect of Joke Type and Gender of Joke Target Manisha Parekh Submitted to the Office of Honors Programs and Academic Scholarships Texas A Ec M University 1998-1999 University...

  5. Women & early-stage entrepreneurship : examining the impact of the venture funding crisis on male and female-led technology start-ups

    E-Print Network [OSTI]

    Swaminathan, Shuba

    2010-01-01T23:59:59.000Z

    Women in technology have always been a minority and the number of women who are founders of venture backed start-ups is even lower. This research empirically investigates venture capital funding received by entrepreneurs ...

  6. An exploratory study of the effects of job characteristics on wage determination and wage differentials between workers in male-dominated and female-dominated occupations

    E-Print Network [OSTI]

    Allen, William Keith

    1984-01-01T23:59:59.000Z

    in construct validity. Past studies in the area of wage determination and wage differentials have ttvually looked at wage differentials between men and women. After the introduction of legislation such as the Equal Pay Act of 1963 and Title VII of the Civil... the passage oi' the Equal Pay Act of 1963 and at that time it wss not unusual to find men receiving higher wages than women for virtually the same work). The results of studies by McNulty (1967) and Buckley (1971) support Fuchs' (1971) findings...

  7. Fiona R.L. Burford Peter K. McGregor Rui F. Oliveira Male-like mudballing behavior of some female fiddler crabs (Uca tangeri)

    E-Print Network [OSTI]

    are carried from within the burrow to the mudflat surface and placed in the area surrounding the burrow

  8. Quantitative genetics of growth, carcass-quality traits, and disease resistance in hybrid striped bass (Morone chrysops [female] x Morone saxatilis [male])

    E-Print Network [OSTI]

    Wang, Xiaoxue

    2009-05-15T23:59:59.000Z

    A 10 x 10 factorial mating design and a ‘common-garden’ rearing approach were employed to examine genetic effects and heritability of growth, carcass-quality traits, and disease resistance, important production traits in the aquaculture of hybrid...

  9. Race and Male Employment in the Wake of the Great Recession

    E-Print Network [OSTI]

    Saldin, Dilano

    Race and Male Employment in the Wake of the Great Recession: Black Male Employment Rates by this Center), nearly half of working-age black males were not employed in many inner city neighborhoods.1 another devastating blow to inner city economies and the employment prospects of African American males

  10. The Gender Breakdown of the Applicant Pool for Tenure-Track Faculty Positions at a Sample of North American Research Astronomy Programs

    E-Print Network [OSTI]

    Thompson, Todd A

    2015-01-01T23:59:59.000Z

    The demographics of the field of Astronomy, and the gender balance in particular, is an important active area of investigation. A piece of information missing from the discussion is the gender breakdown of the applicant pool for faculty positions. For a sample of 35 tenure-track faculty positions at 25 research universities advertised over the last few years in astronomy and astrophysics, I find that the ratio of female applicants to the total number of applicants is ~0.2, with little dispersion and with no strong dependence on the total number of applicants. Some discussion is provided in the context of the fraction of women at the graduate student, postdoctoral researcher, and assistant professor levels, but strong conclusions are not possible given the limitations of the study. Current and future faculty search committees will likely be interested to compare their numbers to this distribution to decide whether or not they could be doing more to attract an applicant pool that is representative of the commun...

  11. The female protagonists in the novels of Romulo Gallegos

    E-Print Network [OSTI]

    Pierce, Susan Elizabeth

    1972-01-01T23:59:59.000Z

    reoeived critical acolaim. Out of his nine novels six of them contain strong female protagonists. They are Reinaldo Solar (1913), Za tre Cora (1925), Delta SCrbara (1929), ~Pobre ne o (1957), Sabre la atelea t1erla (1945), ann a brtena de a en el... ' REINALDO SOLAR ~ ~ ~ ~ ~ ~ . ~ ~ ~ . . 16 Roeaura Nendeville . . . . . . . . . 16 IV. LA TREPADORA . ~ . ~ . ~ Adelsida Ssloede de Guanipa Viotoria Guanipa V. DONA BARBARA DcHa Barbara Narisela Barquero VI. POBRE NEGRO Luisana Alcorta ~ 27 27 57...

  12. The female protagonists in the novels of Romulo Gallegos 

    E-Print Network [OSTI]

    Pierce, Susan Elizabeth

    1972-01-01T23:59:59.000Z

    reoeived critical acolaim. Out of his nine novels six of them contain strong female protagonists. They are Reinaldo Solar (1913), Za tre Cora (1925), Delta SCrbara (1929), ~Pobre ne o (1957), Sabre la atelea t1erla (1945), ann a brtena de a en el... ' REINALDO SOLAR ~ ~ ~ ~ ~ ~ . ~ ~ ~ . . 16 Roeaura Nendeville . . . . . . . . . 16 IV. LA TREPADORA . ~ . ~ . ~ Adelsida Ssloede de Guanipa Viotoria Guanipa V. DONA BARBARA DcHa Barbara Narisela Barquero VI. POBRE NEGRO Luisana Alcorta ~ 27 27 57...

  13. The evolution of infanticide by males in mammalian societies

    E-Print Network [OSTI]

    Lukas, Dieter; Huchard, Elise

    2014-11-14T23:59:59.000Z

    of social monogamy in mammals. Science 341, 526-530 (2013). 10. C. Opie, Q. D. Atkinson, R. I. M. Dunbar, S. Schultz, Male infanticide leads to social monogamy in mammals. Proc. Natl. Acad. Sci. U. S. A. 110, 13328-13332 (2013). 11. G. R. Pradhan, C. P. Van...

  14. Floral oil collection by male Tetrapedia bees (Hymenoptera: Apidae: Tetrapediini)

    E-Print Network [OSTI]

    Floral oil collection by male Tetrapedia bees (Hymenoptera: Apidae: Tetrapediini) Simone C 2011 ­ Accepted 23 June 2011 Abstract ­ Several groups of solitary bees, known as oil-collecting bees, oil-collecting bees belong to the tribes Centridini, Tapinotaspidini, and Tetrapediini (Apidae: Apinae

  15. The Impact a Diversity Culture Has on the "Think Manager, Think Male" Stereotype: A Social Identity Theory of Leadership Perspective on Gender Stereotypes in Sport Organizations

    E-Print Network [OSTI]

    Aicher, Thomas Joseph

    2010-10-12T23:59:59.000Z

    ). Additionally, researchers have found access and treatment discrimination in intercollegiate athletics and postulate 3 discrimination as another factor limiting women in leadership positions (Aicher & Sagas, in press; Knoppers, 1992; Lovett & Lowry, 1994... by a desire to increase self-esteem and reduce uncertainty (Turner, 1975). Social identity theory focuses on intergroup relations (e.g., prejudice, discrimination, and conditions that promote different behavior types) and centers on three main foci...

  16. Male gender, increased blood viscosity, body mass index and triglyceride levels are independently associated with systemic relative hypertension in sickle cell anemia

    E-Print Network [OSTI]

    Boyer, Edmond

    , Centre Hospitalier Universitaire de Pointe-à-Pitre, Pointe- à-Pitre, Guadeloupe; 2 Université des'Iinvestigation Clinique - Epidémiologie Clinique 802 Inserm Antilles-Guyane, Centre Hospitalier Universitaire de Pointe-à-Pitre, Pointe-à-Pitre, Guadeloupe; 5 Unité Transversale de la Drépanocytose, Centre Hospitalier Universitaire de

  17. The doctoral thesis "Gender Quotas in Company Boards and Recruitment Effects" explores the legislative demand for gender balance in Norwegian public limited company (PLC)

    E-Print Network [OSTI]

    Løw, Erik

    the legislative demand for gender balance in Norwegian public limited company (PLC) boards, and in particular article is based on a survey conducted in 2008. In the survey, all board members of PLC boards were

  18. Gender and Development. Agendas and cultural impasses Norma Fuller Ph. D

    E-Print Network [OSTI]

    Martin, Jeff

    , and gender Lecture 6: Millennium Development Goals, climate change and gender equality Lecture 7: Mining" In: Bell, David, Roger Keil and Leesa Fawcett (editors): Political Ecology: Global and Local 2008 The constitution of political actors: peasant communities, mining and mobilization in Bolivian

  19. Women, Gender and Sexuality Studies Recognizes Outstanding Students Women's Center Awards Dinner

    E-Print Network [OSTI]

    Gilchrist, James F.

    Women, Gender and Sexuality Studies Recognizes Outstanding Students Women's Center Awards Dinner's Studies Award was started in 1997 to recognize a gradua ng Women's Studies student who combines strong/or in the community. This year, Women, Gender, and Sexuality Studies awarded two outstanding students at the Women

  20. An Analysis of Three White Male High School Assistant Principal Perceptions of Black Males Students in a Suburban District

    E-Print Network [OSTI]

    Ragsdale, Laura Anne

    2013-05-09T23:59:59.000Z

    Introduction ????.????????????????.. 28 Employment ????????????????????.. 31 Equity of Salary and Low Wages ????????????. 37 Mobility ?????????????????????? 38 Structure of a Nuclear Family ?????????????.. 41 Discrimination in Society...-Identification ???????????????.??? 57 ?Acting White? ???????????????????. 61 Discipline ?????????????????????.. 65 Theories Impacting Achievement of Black Males ?????????. 71 Discrimination and Prejudice in Society ?????????... 71 Expectations by Schools...

  1. Reproductive Termination in Female Japanese Monkeys: A Comparative Life History Perspective

    E-Print Network [OSTI]

    Fedigan, Linda M.

    Reproductive Termination in Female Japanese Monkeys: A Comparative Life History Perspective MARY S; reproductive termination ABSTRACT This study explores the question of reproductive termination (loss used a large sample of completed lives to identify reproductively terminated female Japanese macaques

  2. Gender dependent survival of allogeneic trophoblast stem cells

    E-Print Network [OSTI]

    Epple - Farmer, Jessica Anne

    2009-05-15T23:59:59.000Z

    stem cells may exhibit and confer immune privilege. These findings suggest applications in cell and gene therapy as well as provide a new model for studying trophoblast physiology and immunology. iv DEDICATION John Donne wrote that ?No man... or their in vitro-differentiated derivatives have been largely unsuccessful. When syngeneic TS cells were injected subcutaneously into non-pregnant females, they were reported to differentiate into giant cells within 5-10 days and to degenerate rapidly (7...

  3. A review of "Literary Circles and Gender in Early Modern Europe: A Cross-Cultural Approach" by Julie Campbell

    E-Print Network [OSTI]

    Desroches, Lissa Beauchamp

    2007-01-01T23:59:59.000Z

    with compelling historical context and astute literary analysis. Julie Campbell. Literary Circles and Gender in Early Modern Europe: A Cross- Cultural Approach. Aldershot, UK: Ashgate, 2006. viii + 221 pp. $89.95. Review by LISSA BEAUCHAMP DESROCHES..., UNIVERSITY OF NEW BRUNSWICK, FREDERICTON. Julie Campbell?s study of how gender operates in the literary circles and salons of early modern Europe relies on a balance between genders as a matter of fact and gender as a matter for discourse. In other words...

  4. INTRODUCTION Parkinson's disease (PD) is characterized pathologically by the

    E-Print Network [OSTI]

    Diggle, Peter J.

    females, with an average age of 61.45 years (youngest 42, oldest 75). Gender (male/female) 23/9 Hoehn & Yahr 1.0 5 Hoehn & Yahr 1.5 3 Hoehn & Yahr 2.0 24 Median PD onset age (years (interquartile range)) 61. Gender; 4.Current drug treatment for PD; 5. Hoehn & Yahr score; 6. Family history of PD; 7. Familial

  5. How women organize social networks different from men

    E-Print Network [OSTI]

    Szell, Michael

    2013-01-01T23:59:59.000Z

    Superpositions of social networks, such as communication, friendship, or trade networks, are called multiplex networks, forming the structural backbone of human societies. Novel datasets now allow quantification and exploration of multiplex networks. Here we study gender-specific differences of a multiplex network from a complete behavioral dataset of an online game society of about 300,000 players. On the individual level females perform better economically and are less risk-taking than males. Males reciprocate friendship requests from females faster than vice versa and hesitate to reciprocate hostile actions of females. On the network level females have more communication partners, who themselves are less connected than partners of males. We find a strong homophily effect for females and higher clustering coefficients of females in trade and attack networks. Cooperative links between males are under-represented, reflecting competition for resources among males. These results confirm quantitatively that fema...

  6. Berries Bittersweet: Visual Representations of Black Female Sexuality in Contemporary American Pornography

    E-Print Network [OSTI]

    Cruz, Ariane Renee

    2010-01-01T23:59:59.000Z

    moving image porn featuring gay male anal penetration usings Anal Show (1-5). Renowned originator of gonzo porn, John

  7. Factors Influencing a Female’s Selection of a Construction Management Degree: A Study of Junior- and Senior-Level Undergraduate Students

    E-Print Network [OSTI]

    Ritter, Lisa M

    2014-07-24T23:59:59.000Z

    the industry so they may tap into this market segment. Many influential factors have been identified as to a female’s decision to pursue a career in the construction industry, starting with their decision to pursue an undergraduate construction management (CM...

  8. ORIGINAL PAPER A lover, not a fighter: mating causes male crickets

    E-Print Network [OSTI]

    Gwynne, Darryl T.

    studies have examined the effects of mating experience on agonistic behaviour, despite the fact that dominant males usually acquire more matings. We investigated the effect of mating experience on male weapon size) and conducted two experiments. In the first, we varied male mating experience by allowing

  9. Adenosine analogs inhibit fighting in isolated male mice

    SciTech Connect (OSTI)

    Palmour, R.M.; Lipowski, C.J.; Simon, C.K.; Ervin, F.R.

    1989-01-01T23:59:59.000Z

    The potent adenosine analogs N-ethylcarboxamide adenosine (NECA) and phenylisopropyladenosine (PIA) inhibit fighting and associated agonistic behaviors in isolated male mice. These effects are reversed by methylxanthines; moderate doses of NECA which inhibit fighting have minimal effects on spontaneous locomotor activity. At very low doses, both NECA and PIA increase fighting in parallel with previously reported increases of motor activity. Brain levels of (/sup 3/H)-NECA and (/sup 3/H)-PIA achieved at behaviorally effective doses suggest an involvement of adenosine receptors. The biochemical mechanism of adenosine receptor action with respect to fighting is unknown, but may include neuromodulatory effects on the release of other, more classical neurotransmitters.

  10. Gender differences in undergraduate students' performance, perception and participation in physics 

    E-Print Network [OSTI]

    Donnelly, Robyn Claire Annabel

    2014-11-27T23:59:59.000Z

    Research has been undertaken to obtain a thorough understanding of the existence and degree of gender disparity in students' participation and performance in introductory university physics courses at the University ...

  11. An evaluation of gender-based weighting factors for internal dosimetry 

    E-Print Network [OSTI]

    Spiars, Joanna Hamilton

    1994-01-01T23:59:59.000Z

    This study assesses gender effects on radiation dose weighting factors used in internal dosimetry. A weighting factor represents the relative contribution of a particular organ or tissue to the total detriment due to the effects from uniform whole...

  12. THE NATIVE AND NONNATIVE PROCESSING OF NUMBER AND GENDER AGREEMENT IN SPANISH: AN ERP INVESTIGATION

    E-Print Network [OSTI]

    Aleman Banon, Jose

    2012-08-31T23:59:59.000Z

    The present study utilizes EEG to examine the processing of number and gender agreement in Spanish by native speakers and adult English-speaking learners. With respect to native processing, the study focuses on how different ...

  13. Queering Medieval Gender and Sexuality: Pre- and Postmodern Representations of Virginity

    E-Print Network [OSTI]

    Balke, Jennifer Floray

    2012-05-31T23:59:59.000Z

    , hagiographical, and fictional, as well as texts such as Robert Glück's 1994 Margery Kempe that defy categorization. Using queer theory, especially Judith Butler's theory of the performativity of gender, and Julia Kristeva's theory of the abject, this project...

  14. Genus quid est? Roman Scholars on Grammatical Gender and Biological Sex*

    E-Print Network [OSTI]

    Corbeill, Anthony P.

    2008-01-01T23:59:59.000Z

    From at least as early as Varro, Roman scholars and grammarians occupy themselves with cataloguing peculiar instances of grammatical gender. The practice, with little extant precedent in Greek tradition, finds the grammarians ...

  15. Effects of Gender on the Production of Emphasis in Jordanian Arabic: A Sociophonetic Study

    E-Print Network [OSTI]

    Abudalbuh, Mujdey

    2011-10-03T23:59:59.000Z

    Emphasis, or pharyngealization, is a distinctive phonetic phenomenon and a phonemic feature of Semitic languages such as Arabic and Hebrew. The goal of this study is to investigate the effect of gender on the production ...

  16. Sexuality and obesity, a gender perspective: results from French national random probability survey of sexual

    E-Print Network [OSTI]

    Paris-Sud XI, Université de

    RESEARCH Sexuality and obesity, a gender perspective: results from French national random activity, sexual satisfaction, unintended pregnancies, and abortions in obese people and to discuss (BMI 25-obese (BMI >30). Results Obese women were less likely than

  17. Making Space for Urban Girls: A Politics of Geography and Gender

    E-Print Network [OSTI]

    Gleason, Emily

    2008-01-01T23:59:59.000Z

    Massey, Doreen. 1994. Space, place, and gender. Minneapolis:Up in School: Politics, Space, Bodies, and Signs in theand Planning D. : Society and Space. Vol. 14: 581-599.

  18. The global landscape of gender quotas on corporate boards : contexts for adoption and opposition in 2014

    E-Print Network [OSTI]

    Park, Jacqueline, S.M. Massachusetts Institute of Technology

    2014-01-01T23:59:59.000Z

    There has been an acceleration in the adoption of gender quotas on boards since Norway pioneered legislation in 2003. Countries that have made parallel reforms have primarily been in the western European bloc, while other ...

  19. Gender differences in psychopathology examined under an expanded transactional theory of stress framework

    E-Print Network [OSTI]

    Lee, Jillian April

    2009-05-15T23:59:59.000Z

    – and examines gender differences within a transactional theory of stress that takes into account levels of cognitive processing (an expanded transactional theory of stress). Both studies found that men are more physiologically reactive to disorder...

  20. A review of "Laboring Women: Reproduction and Gender in New World Slavery" by Jennifer L. Morgan.

    E-Print Network [OSTI]

    Elisa Oh

    2004-01-01T23:59:59.000Z

    wives and mothers, should be educated for the sake of society. All in all, Women Philosophers of the Seventeenth Century is pleas- ant to read, because it is lucidly written, and highly informative. Jennifer L. Morgan. Laboring Women: Reproduction... and Gender in New World Slavery. Philadelphia: University of Pennsylvania Press, 2004. xi + 279 pp. + 16 illus. $55.00. Review by ELISA OH, BOSTON UNIVERSITY. In Laboring Women: Reproduction and Gender in New World Sla- very, Jennifer L. Morgan explores...

  1. Embryonic effects transmitted by male mice irradiated with 512 MeV/u {sup 56}Fe nuclei

    SciTech Connect (OSTI)

    Wiley, L.M.; Van Beek, M.E.A.B.; Raabe, O.G.

    1994-06-01T23:59:59.000Z

    High-energy, high-charge nuclei may contribute substantially to the yearly equivalent dose in space flight from galactic cosmic radiation (GCR) at solar minimum. The largest single heavy-ion component is {sup 56}Fe. We used the mouse embryo chimera assay to test 512 MeV/u {sup 56}Fe nuclei for effects on the rate of proliferation of embryonic cells transmitted by sperm from irradiated mice. Male CD1 mice were acutely irradiated with 0.01, 0.05, or 0.1 Gy (LET, 184 keV/{mu}m; fluence, 3.5 x 10{sup 4}-3.3 x 10{sup 5} nuclei/cm{sup 2}; average dose rate, 0.02 Gy/min) at the Lawrence Berkeley Laboratory BEVATRON/BEVALAC Facility in Berkeley, CA. Irradiated males were bred weekly for 7 weeks to nonirradiated females and their four-cell embryos were paired with control embryos, forming aggregation chimeras. After 30-35 h of culture, chimeras were dissociated to obtain {open_quotes}proliferation ratios{close_quotes} (number of cells contributed by the embryo from the irradiated male/total number of cells in the chimera). Significant dose-dependent decreases in proliferation ratios were obtained across all three dose groups for postirradiation week 2 (P < 0.05 to P < 0.003). The 0.01- and 0.05-Gy dose groups also produced significant decreases in proliferation ratios for postirradiation week 1 (P < 0.05 to P < 0.01) and the 0.05-Gy dose group produced significant decreases in proliferation ratios for postirradiation week 6 (P < 0.05). Postirradiation weeks 1, 2 and 6 correspond to irradiation of epididymal sperm, testicular spermatids and spermatogonia, respectively. We calculate that only about 5% of sperm in the 0.1-Gy, 2.5% in the 0.05-Gy and 0.5% in the 0.01-Gy dose groups sustained direct hits from {sup 56}Fe nuclei. However, up to 47% of sperm during postirradiation weeks 1 and 2 transmitted proliferation ratios that were at or below one standard deviation from control mean proliferation ratios. 26 refs., 4 figs., 10 tabs.

  2. Cognitive Structures Underlying Gendered Language Usage in Germany: Narration and Linguistic Fieldwork

    E-Print Network [OSTI]

    Kolar, Meredith

    2011-01-01T23:59:59.000Z

    Nurturant Parent system of morality (NPM) (Chapter 4). SFMstrength, and purity, while NPM is based on empathy andoccasional features of NPM reasoning, female consultants

  3. Portraits of the Sun: Violence, Gender, and Nation in the Art of Shiraga Kazuo and Tanaka Atsuko

    E-Print Network [OSTI]

    Kunimoto, Thalia Namiko

    2010-01-01T23:59:59.000Z

    to Challenge the Midsummer Burning Sun." Gutai 3 (1955): 24.Dazai, Osamu. The Setting Sun. Norfolk: J. Laughlin, 1956.and Sachiko Nakajima. Rising Suns, Rising Daughters: Gender,

  4. The Effects of Alcohol and Age on Astrocytes In Female Rats Following an Inflammatory Stimulus

    E-Print Network [OSTI]

    Simpson, Ashley

    2009-09-30T23:59:59.000Z

    THE EFFECTS OF ALCOHOL AND AGE ON ASTROCYTES IN FEMALE RATS FOLLOWING AN INFLAMMATORY STIMULUS A Senior Scholars Thesis by ASHLEY NICOLE SIMPSON Submitted to the Office of Undergraduate Research Texas A...&M University In partial fulfillment of the requirements for the designation as UNDERGRADUATE RESEARCH SCHOLAR April 2006 Major: Biology THE EFFECTS OF ALCOHOL AND AGE ON ASTROCYTES IN FEMALE RATS FOLLOWING...

  5. IMPROVING LARVAL SUNSHINE BASS PRODUCTION THROUGH SUPPLEMENTATION OF FEMALE WHITE BASS BROODSTOCK DIETS WITH

    E-Print Network [OSTI]

    tested, menhaden fish oil provided female white bass broodstock the fatty acids (~3.9% n-3 long fish oil are essential for embryonic survival, sunshine bass appear to have lower n-3 LCIMPROVING LARVAL SUNSHINE BASS PRODUCTION THROUGH SUPPLEMENTATION OF FEMALE WHITE BASS BROODSTOCK

  6. Why have there been so few female Nobel laureates in science and just

    E-Print Network [OSTI]

    Barbosa, Marcia C. B.

    Why have there been so few female Nobel laureates in science ­ and just two in physics? The usual werecausedbyoxidationatthetipsof thecarbonanodes.Shetookoutmany patents for searchlights and cinema projectors, and in 1902 be secondary." She ended up abandoning science. But being single did not make the life of the female scientist

  7. aging male hypothalamic-pituitary-gonadal: Topics by E-print...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  8. advertisement-call modification male: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Locker Half Male Varun Aggarwala Daniel Stringer Noah Benson John Philbin Michael Campbell Michael Nathan Lawrence Brown Theodor Oxholm John Jackson Jeffrey Haymaker Keith...

  9. Human exploitation of male fiddler crab claws: behavioural consequences and implications for conservation

    E-Print Network [OSTI]

    during low tide and the major claw is pulled off and the male is then released on the mudflat. This human

  10. Scent marking in wild banded mongooses: 2. Intrasexual overmarking and competition between males

    E-Print Network [OSTI]

    Rüedi, Peter

    Scent marking in wild banded mongooses: 2. Intrasexual overmarking and competition between males on wild banded mongooses, Mungos mungo, suggests that overmarking may primarily affect behavioural mating

  11. Chemical mediation of male mate location behavior in the parasitoid Cardiochiles nigriceps (Hymenoptera: Braconidae)

    E-Print Network [OSTI]

    Syvertsen, Thomas Charles

    1992-01-01T23:59:59.000Z

    . nigriceps on the downwind edge of the slide (Figure 4). After the male became relaxed the air stream was turned on and the responses of the male were recorded with a video camera. Each male was allowed 1. 0 minute to respond. If the response was positive... and courtship was elicited no max- imum observation time was set and the behaviors were observed until the male dismounted the model. Video recordings of the experiments were re- played at a later time and events were logged with an event recorder. Courtship...

  12. The role of male-male relationships in partner violence treatment groups: the effects of improving same sex relationships on attachment

    E-Print Network [OSTI]

    Barnes, Ashley D.

    2009-05-15T23:59:59.000Z

    ; Gondolf, 1997; Holtzworth-Munroe & Meehan, 2004). Outcome research has demonstrated that of those males who completed treatment for domestic violence, recidivism rates ranged from 24% to 40% within 6 to 24 months 3 following termination (Gondolf...

  13. Gender and Global Political Economy Post-Doctoral Fellowship Dr. Bipasha Baruah, Department of Women's Studies and Feminist Research at Western

    E-Print Network [OSTI]

    Lennard, William N.

    Gender and Global Political Economy Post-Doctoral Fellowship Dr. Bipasha Baruah, Department possibility of renewal for a second year) Post-Doctoral Fellowship in Gender and Global Political Economy

  14. LARGE-SCALE MOVEMENT PATTERNS OF MALE LOGGERHEAD SEA TURTLES (CARETTA CARETTA)

    E-Print Network [OSTI]

    LARGE-SCALE MOVEMENT PATTERNS OF MALE LOGGERHEAD SEA TURTLES (CARETTA CARETTA) IN SHARK BAY Management Title of Thesis: Large-Scale Movement Patterns of Male Loggerhead Sea Turtles (Caretta caretta) in Shark Bay, Australia Report No. 524 Examining Committee: Chair: Christine Gruman Master of Resource

  15. Mechanisms of Mating-Behavior Deterioration in Early Aging Male C. elegans 

    E-Print Network [OSTI]

    Guo, Xiaoyan

    2014-08-06T23:59:59.000Z

    . This is consistent with the observation that old males exhibit reduced control over their ability to mate. Caloric restriction is an efficient non-genetic intervention to increase lifespan. I demonstrated here that it also improves mating behavior in 3-day-old males...

  16. Gene expression divergence and nucleotide differentiation between males of different color morphs and mating

    E-Print Network [OSTI]

    Gene expression divergence and nucleotide differentiation between males of different color morphs sequencing, it is possible to obtain data on both nucleotide sequence variation and gene expression. We have between males, but many genetic markers showed nucleotide differentiation between different color morphs

  17. The Conditional Effects of Female Descriptive Representation: A Study of Policy Influence in State Legislatures, 1983-2002

    E-Print Network [OSTI]

    Barnes, Mary Elizabeth

    2012-02-14T23:59:59.000Z

    (Phillips 1995; Weldon 2002). This study will examine female descriptive representation and incorporation and its effect on substantive representation of female group salient issues and answer the following research question: Does an increase in female...), but there is also a significant amount or literature negating this claim. Women may behave in an isolated manner when legislating and they may not be able to articulate what females as a group really want (Weldon 2002). There may be no way to establish...

  18. Together We Will: Evidence from a Field Experiment on Female Voter Turnout in Pakistan

    E-Print Network [OSTI]

    Together We Will: Evidence from a Field Experiment on Female Voter Turnout in Pakistan Xavier Giné Akbar at the Pakistan Poverty Alleviation Program (PPAF) in Islamabad for their support

  19. The perceived influence of past mentoring experiences on the mentoring practices of selected female school executives

    E-Print Network [OSTI]

    Ashley, Betty Diane

    2009-05-15T23:59:59.000Z

    Although research on mentoring dates back to the early 1980’s, there is little research available which examines the influence of past mentoring experiences on relationships in which female school executives, in turn, serve as the mentors...

  20. POETISA CHIC: FASHIONING THE MODERN FEMALE POET IN CENTRAL AMERICA, 1929-1944

    E-Print Network [OSTI]

    Finzer, Erin S.

    2008-01-01T23:59:59.000Z

    This dissertation explores the cultural and literary "fashionings" of Central American female poets of the 1930s in order to demonstrate how some of these poets entered the lettered city (Ángel Rama's term for the nexus ...

  1. The effect of continuous infusion of human parathyroid hormone on bone architecture in female mice

    E-Print Network [OSTI]

    Eisenberg, Rahel E. (Rahel Esther)

    2009-01-01T23:59:59.000Z

    This research sought to create an animal model of secondary hyperparathyroidism through continuous infusion of parathyroid hormone (PTH) in adult female mice, and to subsequently study the catabolic effects of PTH. Osmotic ...

  2. Osteopontin-mediated neutrophilic infiltration and higher liver injury in a female rodent alcoholic steatohepatitis model

    E-Print Network [OSTI]

    Banerjee, Atrayee

    2009-05-15T23:59:59.000Z

    Females are known to be more susceptible to alcoholic liver disease (ALD), but the precise mechanism behind this increased susceptibility is not well understood. The objective of this study was to identify the molecular mechanism behind...

  3. This Is “Ladies’ Night”: A Case Study of a Grassroots Golf Program for Black Females

    E-Print Network [OSTI]

    Rosselli, Anthony C

    2014-07-24T23:59:59.000Z

    beginner golfers. Individual interviews with the golf instructor and seven of her participants were conducted. These women were self-identifying Black and female who attended at least three of the original ladies’ clinics. Additional data were gathered...

  4. "Imbued with the science of Venus": Female Fallenness, Sexual Pedagogy, and Victorian Pornography

    E-Print Network [OSTI]

    Wicktor, Emily D.

    2010-12-16T23:59:59.000Z

    As a decidedly heterogeneous genre, Victorian pornography offers a wide range of sexual narratives, including those that directly challenge both real and fictional narrative constructions of female fallenness by foregrounding ...

  5. Identifying the Predictors of Female Project Managers' Salaries in the United States

    E-Print Network [OSTI]

    Kamranzadeh, Amineh

    2012-11-30T23:59:59.000Z

    This study seeks to explore the predictors of female project managers’ salary in the construction industry, and to analyze their impacts on determining the salary. Experience, age, marital status, motherhood, having children at home, and the number...

  6. A dyadic protocol for training complex skills: a replication using female participants 

    E-Print Network [OSTI]

    Sanchez-Ku, Maria Luisa

    1999-01-01T23:59:59.000Z

    A DYADIC PROTOCOL FOR TRAINING COMPLEX SKILLS: A REPLICA11ON USING FEMALE PARTICIPANTS A Thesis by MARIA LUISA SANCHEZ-KU Submitted to the Office of Graduate Studies of Texas A&M University in partial fulfillment of the requirements... ABSTRACT A Dyadic Protocol For Training Complex Skills: A Replication Using Female Participants. (August I 999) Maria Luisa Sanchez-Ku, B. A. , Ohio Wesleyan University Chair of Advisory Committee: Dr. Winfred Arthur, Jr. The effectiveness...

  7. A dyadic protocol for training complex skills: a replication using female participants

    E-Print Network [OSTI]

    Sanchez-Ku, Maria Luisa

    1999-01-01T23:59:59.000Z

    A DYADIC PROTOCOL FOR TRAINING COMPLEX SKILLS: A REPLICA11ON USING FEMALE PARTICIPANTS A Thesis by MARIA LUISA SANCHEZ-KU Submitted to the Office of Graduate Studies of Texas A&M University in partial fulfillment of the requirements... ABSTRACT A Dyadic Protocol For Training Complex Skills: A Replication Using Female Participants. (August I 999) Maria Luisa Sanchez-Ku, B. A. , Ohio Wesleyan University Chair of Advisory Committee: Dr. Winfred Arthur, Jr. The effectiveness...

  8. Menstrual Support for Females with Developmental Disabilities: Survey and Interview of Parents or Caretakers

    E-Print Network [OSTI]

    Park, Hye Ran

    2013-12-31T23:59:59.000Z

    ramifications of the eugenics movement, however, have proved much more durable. Simultaneously, the state’s interests in requiring sterilization started outweighing the rights of a person with retardation (Vitello, 1978). In addition, the various movements (de...; Williams & Nind, 1999); and for many years little research investigated the perspectives of females with developmental disabilities (Rodgers, Lipscombe, & Santer, 2006). Although several publications have addressed contraceptive management in females...

  9. Effect of age on vibration sensitivity and motor nerve conduction among females

    E-Print Network [OSTI]

    Crumpton, Lesia LaWon

    1990-01-01T23:59:59.000Z

    EFFECT OF AGE ON VIBRATION SENSITIVITY AND MOTOR NERVE CONDUCTION AMONG FEMALES A Thesis by LES IA LA WON CRUMPTON Submitted to the Office of Graduate Studies of Texas A&M University in partial fulfillment of the requirements for the degree... of MASTER OF SCIENCE December 1990 Major Subject: Industrial Engineering EFFECT OF AGE ON VIBRATION SENS~ AND MOTOR NERVE CONDUCTION AlvIONG FEMALES A Thesis by LESIA LAWON CRUMPTON Approved as to style and content by: erome J. nglet (Chair...

  10. Economic Reforms and Gender-based Wage Inequality in the Presence of Factor Market Distortions

    E-Print Network [OSTI]

    Bandyopadhyay, Antar

    1 Economic Reforms and Gender-based Wage Inequality in the Presence of Factor Market Distortions-based wage inequality. The analysis finds that credit market reform and tariff reform produce favourable reforms, general equilibrium. JEL classifications: D50, J16, F21. The authors are thankful to Prof

  11. Age, gender, and breed as risk factors for acute and chronic equine laminitis

    E-Print Network [OSTI]

    Alford, Patricia Lee

    1999-01-01T23:59:59.000Z

    , and time of diagnosis. The 90% of case-control pairs (78 acute, 155 chronic) having complete data for age, gender, and breed were used in separate conditional logistic recession models for acute and chronic laminitis. The odds ratio was calculated...

  12. An Extended Local Binary Pattern for Gender Classification Abbas Roayaei Ardakany, Mircea Nicolescu, Monica Nicolescu

    E-Print Network [OSTI]

    Nicolescu, Monica

    allows many applications in human computer interaction, psychology, and security [1]. Prior research has, and human­computer interfaces (adjusting the software behavior with respect to the user's gender) [5 is to simply use gray-scale or color pixel vectors as features [6]. Second, many methods use approaches

  13. The Influence of Birth Order and Gender on Narcissism as it Relates to Career Development

    E-Print Network [OSTI]

    Duffy, Clare 1978-

    2011-08-09T23:59:59.000Z

    that this relationship would be impacted by family birth order and gender. Heinz Kohut's theory of self-psychology was utilized to understand narcissism from both an adaptive and maladaptive, developmental perspective. A review of narcissism and self-development theories...

  14. Remembering a Future Caribbean Gender, Generation and Memory: Remembering a Future Caribbean1

    E-Print Network [OSTI]

    Toronto, University of

    Remembering a Future Caribbean Gender, Generation and Memory: Remembering a Future Caribbean1 by D, in the dusk of her life, there was little that was memorable in the contemporary Caribbean. This is a provocatively harsh opening, one that a glance at any Human Development Report ­ which notes that the Caribbean

  15. Inequality and the Politics of Social Policy Implementation: Gender, Age and Chile's 2004 Health Reforms

    E-Print Network [OSTI]

    Wisconsin at Madison, University of

    Reforms CHRISTINA EWIG and GASTO´ N A. PALMUCCI * University of Wisconsin-Madison, USA Summary implementation. We examine the 2004 Chilean health reforms that sought to regulate private insurers, and measure their effects on gender and age inequality. We find that reforms intended to decrease these inequalities largely

  16. Gender-specific out-migration, deforestation and urbanization in the Ecuadorian Amazon

    E-Print Network [OSTI]

    Lopez-Carr, David

    Gender-specific out-migration, deforestation and urbanization in the Ecuadorian Amazon Alisson F rates of deforestation of any Amazonian nation. Most of this forest elimination has been caused on deforestation, urbanization and regional development, population mobility within the Amazon has hardly been

  17. A Muslim Feminist Interpretation of Women's Empowerment and Gender Parity: Case Studies of Morocco and Egypt

    E-Print Network [OSTI]

    Feather, Ginger Reeves

    2012-05-31T23:59:59.000Z

    This research focuses on changes in women's empowerment and gender parity during the reigns of Mohammed VI in Morocco (1999-present) and Hosni Mubarak in Egypt (1981-11 February 2011). Despite the absence of regime change in Morocco, the social...

  18. For Immediate Release --Wednesday, July 17, 2013 Counselling in female-only groups shows promise as

    E-Print Network [OSTI]

    Seldin, Jonathan P.

    of the participants in gambling addiction treatment programs. Many programs designed to help with gambling problems, the traditional male-oriented treatment model for addiction, as well as economic and child-care concerns surrounding treatment, among many other

  19. Gender-specific modulation of cocaine-induced place preference by 3,4-methylenedioxymethamphetamine

    E-Print Network [OSTI]

    Diller, Anna Jean

    2013-02-22T23:59:59.000Z

    kindly provided suggestions in female rat experimentation, as well as taught lavage procedures, and provided access to microscope slide staining and scoring equipment. Rodrigo Valles, Angelica Rocha, and Aaron L. Cardon from the Department...

  20. The Black Male Youth Academy: Understanding the impact of a critical literacy intervention program on underserved youth

    E-Print Network [OSTI]

    Scorza, D'Artagnan

    2013-01-01T23:59:59.000Z

    of your participation in the Black Male Youth Academy? 5.recommend the Black Male Youth Academy to your peers? PleaseJournal of the American Academy of Child & Adolescent

  1. A male of the bee genus Agapostemon in Dominican amber (Hymenoptera: Halictidae)

    E-Print Network [OSTI]

    Engel, Michael S.; Breitkreuz, Laura C.V.

    2013-09-04T23:59:59.000Z

    The first fossil species of the caenohalictine bee genus Agapostemon Guérin-Méneville (Halictinae: Caenohalictini:Agapostemonina) is described and figured from a single male preserved in EarlyMiocene (Burdigalian) amber ...

  2. Investigating the influence of media on male body image: in search of a potential moderator

    E-Print Network [OSTI]

    Mignogna, Joseph

    2013-02-22T23:59:59.000Z

    of all three of the body image assessment measures (Body Image Assessment, BIA; Body Morph Assessment, BMA; and Somatomorphic Matrix, SM) in measuring various aspects of male body image. The BIA and BMA were mainly sensitive to measuring "thinness...

  3. Genomics and Transcriptomics of Hybrid Male Sterility Assessed in Multiple Interspecies Feline Breeds 

    E-Print Network [OSTI]

    Davis, Brian W

    2013-05-13T23:59:59.000Z

    Hybrid male sterility (HMS) is typically the first mechanism fortifying reproductive isolation resulting from genomic incompatibilities. Three interspecies feline breeds derived from domestic cat crosses to wild cat species (Asian leopard cat...

  4. Fitting It All Together: How Courtship- and Mating-Responsive Genes Affect Drosophila melanogaster Male Behavior

    E-Print Network [OSTI]

    Ellis, Lisa Lynn

    2011-10-21T23:59:59.000Z

    interactions ..................................................................................... 1 Drosophila melanogaster as a tool for understanding behavior .... 3 Reproductive behaviors of Drosophila males ................................ 4... melanogaster courtship ritual .................................................. 6 3 The Drosophila somatic sex-determination hierarchy regulates somatic tissue development and courtship behavior ............................................... 7 4...

  5. The neuromolecular mechanisms that coordinate food availability with C. elegans male sexual behavior

    E-Print Network [OSTI]

    Gruninger, Todd Ryan

    2009-05-15T23:59:59.000Z

    -103, results in spontaneous seizures of the male sex muscles.Interestingly, I found that food deprivation can suppress unc-103(lf)-induced seizures,suggesting that pathways activated under this environmental condition can suppress theexcitability...

  6. Genomics and Transcriptomics of Hybrid Male Sterility Assessed in Multiple Interspecies Feline Breeds

    E-Print Network [OSTI]

    Davis, Brian W

    2013-05-13T23:59:59.000Z

    Hybrid male sterility (HMS) is typically the first mechanism fortifying reproductive isolation resulting from genomic incompatibilities. Three interspecies feline breeds derived from domestic cat crosses to wild cat species (Asian leopard cat...

  7. The Leadership Perspectives of African American Males after Participation in a Leadership Development Program

    E-Print Network [OSTI]

    Preston, Tammie M

    2014-10-14T23:59:59.000Z

    This study investigated the perceptions of African American undergraduate males who attend a predominately White institution in the southwest as they concern leadership after participation in a leadership development program and the influence...

  8. Differential Attraction of Heliothis subflexa Males to Synthetic Pheromone Lures in Eastern US

    E-Print Network [OSTI]

    Differential Attraction of Heliothis subflexa Males to Synthetic Pheromone Lures in Eastern US in Eastern US showed that when the acetates were omitted from a 7-component blend in rubber septa, fewer

  9. The postnatal development of the sex organs in prenatally and early postnatally irradiated male albino rats

    E-Print Network [OSTI]

    Ricks, Robert Clinton

    1964-01-01T23:59:59.000Z

    THE POSTNATAL DEVELOPMENT OF THE SEX ORGANS IN PRENATALLY AND EARLY POSTNATALLY IRRADIATED MALE ALBINO RATS A Thesis By ROBERT C. RICKS Submitted to the Graduate College of the Texas ARM University in partial fulfillment of the requirements... for the degree of MASTER OF SCIENCE August, 1964 Major Subject: Zoology THE POSTNATAL DEVELOPMENT OF THE SEX ORGANS IN PRENATALLY AND EARLY POSTNATALLY IRRADIATED MALE ALBINO RATS A Thesis By ROBERT C. RICKS Approved as to style and content by...

  10. African American Women in Appalachia: Personal Expressions of Race, Place and Gender

    E-Print Network [OSTI]

    Barbour-Payne, Yunina Carol

    2014-06-04T23:59:59.000Z

    Kentucky, Tennessee and West Virginia. They also represent the first and second generation members of the Affrilachian Poets. Both the women 8 themselves (bodies and experiences) and their works offer points of departure for conversations regarding... of “Quantum physics, Appalachian culture, gender equality and mountaintop removal” (CrystalGood.net). Born and raised in the region of Appalachia, she is a native of West Virginia and an activist of issues facing Appalachians of all kinds. She credits...

  11. Understanding Men: Gender Sociology and the New International Research on Masculinities

    E-Print Network [OSTI]

    Connell, Robert W.

    2001-04-01T23:59:59.000Z

    "natural," eiOther prescribed by God or a consequence of biology. Essentialist views of gender are still popular, and are constantly reinforced in the media. However they are increasingly under challenge, not only in biology (Fausto-Sterling 1992), but also... of "multi-optional masculinities" to emphasisethe potential diversity (WidersprUche 1998). 2. Hierarchy and hegemony Different masculinities do not sit side­ by-side like dishes in a smorgasbord; there are definite relations between them. Typically, some...

  12. PERSONAL DATA (IT0002) Mr. Miss Dr.

    E-Print Network [OSTI]

    Tennessee, University of

    Update PERSONAL DATA (IT0002) Mr. Miss Dr. Gender Male Female State Complete Information No Address OF TENNESSEE PERSONAL DATA FORM Personnel # PERMANENT RESIDENCE (IT0006-Subtype 1) Form of Address: New Ms Code PDF Rev. 03/20/2008 Page 1 of 2 #12;ADDITIONAL PERSONAL DATA (IT0077) Yes Yes No Employee

  13. FELLOWSHIPS 1973-74 Congressional Fellows

    E-Print Network [OSTI]

    Puglisi, Joseph

    -year renewal Fellows #12;Science & Technology Policy Fellows 2006-2007 Age range: 28 to 66 (average age = 37FellowsperAge #12;Gender Breakdown of All 2006-07 First-Year Fellows (n=109) 57%43% Females Males #12;Percentage for International Development Fogarty International Center of the National Institutes of Health Foreign Agricultural

  14. Space use by female Greater Prairie-Chickens in response to wind energy development

    E-Print Network [OSTI]

    Sandercock, Brett K.

    Space use by female Greater Prairie-Chickens in response to wind energy development V. L. WINDER,1-Chickens in response to wind energy development. Ecosphere 5(1):3. http://dx.doi.org/10.1890/ ES13-00206.1 Abstract. Wind energy development is targeted to meet 20% of U.S. energy demand by 2030. In Kansas, optimal sites

  15. Daily movements of female white-tailed deer relative to parturition and breeding.

    SciTech Connect (OSTI)

    Gino J. D'Angelo; Christopher E. Comer; John C. Kilgo; Cory D. Drennan; David A. Osborn; Karl V. Miller

    2005-10-01T23:59:59.000Z

    Abstract: To assess how white-tailed deer (Odocoileus virginianus) herd demographics influence reproductive behaviors, we examined 24-h diel movements of female whitetailed deer relative to parturition and breeding in a low-density population with a near even sex ratio at the Savannah River Site (SRS), South Carolina. We conducted a series of intensive, 24-h radio-tracking periods of 13 females during spring and fall 2002. We compared daily range (ha), rate of travel (m/h), and distance between extreme daily locations (m), among the periods of pre-parturition and post-parturition and pre-, peak-, and post-rut. From pre-parturition to post-parturition, we observed decreases in diel range size (�¢����38.2%), distance between extreme diel locations (�¢����17.0%), and diel rate of travel (�¢����18.2%). Diel range size, distance between extreme diel locations, and diel rate of travel during the pre-rut and rut exceeded those observed during post-rut. We further identified substantial increases in mobility during 12 24-h diel periods for eight females during our fall monitoring. Our data suggest that female white-tailed deer reduce mobility post-fawning following exaggerated movements during pre-parturition. Furthermore, despite a near equal sex ratio, estrous does may be required to actively seek potential mates due to low population density.

  16. Patterns of coalition formation by adult female baboons in Amboseli, Kenya

    E-Print Network [OSTI]

    Alberts, Susan C

    Patterns of coalition formation by adult female baboons in Amboseli, Kenya JOAN B. SILK*, SUSAN CDepartment of Biology, Duke University zInstitute for Primate Research, National Museums of Kenya, Nairobi, Kenya x, in Amboseli, Kenya. There is a broad consensus that, when ecological conditions favour collective defence

  17. Original Article The effect of ecological harshness on perceptions of the ideal female body size

    E-Print Network [OSTI]

    Cooper, Brenton G.

    Original Article The effect of ecological harshness on perceptions of the ideal female body size Why do researchers regularly observe a relationship between ecological conditions and the heaviness life history strategies typically adopted by individuals living in harsh versus benign ecologies

  18. Effects of wind energy development on survival of female greater prairie-chickens

    E-Print Network [OSTI]

    Sandercock, Brett K.

    community, grouse, hazard function, mortality, preda- tion, wind turbine *Correspondence author. EEffects of wind energy development on survival of female greater prairie-chickens Virginia L of Florida, Gainesville, FL 32611, USA Summary 1. The potential effects of wind energy development

  19. Research Report Effects of ethanol consumption by adult female rats on subsequent

    E-Print Network [OSTI]

    Galef Jr., Bennett G.

    Research Report Effects of ethanol consumption by adult female rats on subsequent consumption January 2004 Abstract We used a two-bottle choice test to measure voluntary ethanol consumption by adolescent rats that had lived with ethanol-consuming or water-consuming adult conspecifics. We found

  20. Nutrition and Cancer Brown Kelp Modulates Endocrine Hormones in Female Sprague-Dawley

    E-Print Network [OSTI]

    California at Berkeley, University of

    Nutrition and Cancer Brown Kelp Modulates Endocrine Hormones in Female Sprague-Dawley Rats Asians. However, studies from our laboratory suggest that the anti-estrogenic effects of dietary kelp modulation related to kelp ingestion in a pilot study of premenopausal women, we investigated the endocrine

  1. What is pelvic inflammatory disease (PID)? PID is an infection of the female reproductive organs

    E-Print Network [OSTI]

    Virginia Tech

    What is pelvic inflammatory disease (PID)? PID is an infection of the female reproductive organs may become inflamed, irritated, swollen and possibly scarred. The most common causes of PID. PID is one of the leading causes of infertility in women. How does someone get PID? PID is caused

  2. Lee Smith's Fair and Tender Ladies: the female espistolary novel and the construction of knowledge

    E-Print Network [OSTI]

    Grubbs, Amy Marie

    1994-01-01T23:59:59.000Z

    This thesis focuses on how Lee Smith, a North Carolina writer, uses the traditional female epistolary form in a revolutionary way in her 1988 novel Fair and Tender Ladies. Smith's use of the form is revolutionary because, as many critics have...

  3. PHENOTYPIC PLASTICITY IN AGE AT FIRST REPRODUCTION OF FEMALE NORTHERN SEA OTTERS

    E-Print Network [OSTI]

    PHENOTYPIC PLASTICITY IN AGE AT FIRST REPRODUCTION OF FEMALE NORTHERN SEA OTTERS (ENHYDRA LUTRIS phenotypic plasticity. When populations are near carrying capacity (K) or when they are declining due) populations in Alaska provides an opportunity to examine phenotypic plasticity. Using premolar teeth

  4. MOVEMENT OF FEMALE WHITE-TAILED DEER: EFFECTS OF CLIMATE AND INTENSIVE ROW-CROP AGRICULTURE

    E-Print Network [OSTI]

    1099 MOVEMENT OF FEMALE WHITE-TAILED DEER: EFFECTS OF CLIMATE AND INTENSIVE ROW-CROP AGRICULTURE in intensively (>80%) cultivated areas. From January 2001 to August 2002, we monitored movements of 77 (61 adult of seasonal migration, whereas crop emergence and harvest had minimal effects. Four deer (8%) dispersed a mean

  5. Single Enrichment Variables Differentially Reduce Age-Related Memory Decline in Female Mice

    E-Print Network [OSTI]

    Frick, Karyn M.

    Single Enrichment Variables Differentially Reduce Age-Related Memory Decline in Female Mice Lauren to determine how different elements of enrichment, for example, cognitive stimu- lation and voluntary exercise), running wheels alone (exercise), or both toys and running wheels (complex enrichment) for 4 weeks prior

  6. Costs of mating competition limit male lifetime breeding success in polygynous mammals

    E-Print Network [OSTI]

    Lukas, Dieter; Clutton-Brock, Tim

    2014-05-14T23:59:59.000Z

    . Nature 462(7274), 786-789. 42. Young, A. J. & Bennett, N. C. 2013 Intra-sexual selection in cooperative mammals and birds: why are females not bigger and better armed? Phil. Trans. R. Soc. B 368(1631), 20130075. Supplementary references S43. Glander, K. E...

  7. Gender-specific differences and the impact of family integration on time trends in

    E-Print Network [OSTI]

    Zurich, University of

    -stratified Swiss suicide rates Andrea Riebler11 , Leonhard Held1 , H°avard Rue2 and Matthias Bopp1 1 Biostatistics Unit, Institute of Social and Preventive Medicine, University of Zurich, Hirschengraben 84, 8001 Zurich.rue@math.ntnu.no Suicide has become one of the leading causes of death of Swiss males aged between 15 and 44 years, whose

  8. Comparative distribution of misonidazole and its amine metabolite in female Swiss Webster mice

    SciTech Connect (OSTI)

    Born, J.L.; Hadley, W.M.

    1985-06-01T23:59:59.000Z

    The distribution of misonidazole and its terminal reduction product 1-(2-amino-1-imidazolyl)-3-methoxy-2-propanol (misoamine) were compared in female Swiss Webster mice to determine if either misonidazole or misoamine is distributed to peripheral nerves. Female Swiss Webster mice received a 100 mg/kg (5 ..mu..Ci/..mu..mole) i.p. dose of either /sup 3/H-misonidazole or /sup 3/H-miso-amine and the distribution of radioactivity was determined in various tissues including sciatic nerves and other myelinated nerves. Misonidazole produced higher initial tissue concentrations of radioactivity than did miso-amine. The relative tissue concentrations of radioactivity produced by misonidazole or miso-amine were similar, although not identical, 48 hours after administration of the drugs. Both sciatic and other myelinated nerves were found to retain radioactivity following the administration of either misonidazole or miso-amine.

  9. EST analysis of male accessory glands from Heliconius butterflies with divergent mating systems

    E-Print Network [OSTI]

    Walters, James R.; Harrison, Richard G.

    2008-12-08T23:59:59.000Z

    proteins observed in the male accessory gland cDNA libraries. Dots (.) indicate identity between sequences; tildes (~) represent alignment gaps; Hme00007 MNKILILLVVILGAMCLVEAEHDSNLDSKRAAGCPPGQEEYYGMCYGTRKSESGRRDQSGGLNNNNRRSQ Her00048 .KN..N..L..MA...I.A.....YYPS.N.RQ.P.........N.R...S.QG.I.ELG..R~~HHIG...E Hme00007 NEGLNNNNRRSQWEGLNNNNRRSQREGLNNNNRRSQSRELNNNNRRSQSGELNNNNRRSQREGLNNNNRR Her00048 .S* Hme00007...

  10. Mutation analysis of BRCA1 and BRCA2 in a male breast cancer population

    SciTech Connect (OSTI)

    Friedman, L.S.; Gayther, S.A.; Ponder, B.A.J. [Univ. of Cambridge (United Kingdom)] [and others

    1997-02-01T23:59:59.000Z

    A population-based series of 54 male breast cancer cases from Southern California were analyzed for germ-line mutations in the inherited breast/ovarian cancer genes, BRCA1 and BRCA2. Nine (17%) of the patients had a family history of breast and/or ovarian cancer in at least one first-degree relative. A further seven (13%) of the patients reported breast/ovarian cancer in at least one second-degree relative and in no first-degree relatives. No germ-line BRCA1 mutations were found. Two male breast cancer patients (4% of the total) were found to carry novel truncating mutations in the BRCA2 gene. Only one of the two male breast cancer patients carrying a BRCA2 mutation had a family history of cancer, with one case of ovarian cancer in a first-degree relative. The remaining eight cases (89%) of male breast cancer with a family history of breast/ovarian cancer in first-degree relatives remain unaccounted for by mutations in either the BRCA1 gene or the BRCA2 gene. 23 refs., 1 fig., 5 tabs.

  11. FOREST ENTOMOLOGY A Male-Produced Aggregation Pheromone of Monochamus alternatus

    E-Print Network [OSTI]

    Hanks, Lawrence M.

    )- ethanol, the male-produced pheromone of the congeneric M. galloprovincialis Dejean, in Ã?eld ex- periments consisting of 2-(undecyloxy)-ethanol combined with the host plant volatiles -pinene and ethanol. A follow-up experiment showed that 2-(undecyloxy)-ethanol was synergized by both ethanol and -pinene. Coupled gas

  12. Site fidelity, home range behaviour and habitat utilization of male harlequin toads (Amphibia:Atelopus hoogmoedi)

    E-Print Network [OSTI]

    Hödl, Walter

    :Atelopus hoogmoedi) from Suriname:relevant aspects for conservation breeding SALAMANDRA 1 45 Abstract. Recently, neotropical harlequin toads (Atelopus spp.) have undergone drastic population de- clines. Captive breeding has rainy season (April to August) at Brownsberg Nature Park, Suriname. Dur- ing this period, males

  13. An exploration of the stages of change model in a group treatment program for male batterers

    E-Print Network [OSTI]

    Wells, Robert Davis

    2005-02-17T23:59:59.000Z

    in partial fulfillment of the requirements for the degree of DOCTOR OF PHILOSOPHY December 2004 Major Subject: Counseling Psychology AN EXPLORATION OF THE STAGES OF CHANGE MODEL IN A GROUP TREATMENT PROGRAM...) __________________________ Michael R. Benz (Head of Department) December 2004 Major Subject: Counseling Psychology iii ABSTRACT An Exploration of the Stages of Change Model in a Group Treatment Program for Male Batterers. (December 2004...

  14. Clinical overlap between Posttraumatic Stress Disorder and Borderline Personality Disorder in male veterans

    E-Print Network [OSTI]

    Boggs, Christina Danielle

    2006-10-30T23:59:59.000Z

    previous literature by providing an investigation of clinical features across two groups: PTSD only and comorbid PTSD and BPD in a sample of male veterans (n=178). Results suggest that the two groups were distinct, with the comorbid group displaying higher...

  15. Ape Society: Trading Favours An alpha-male chimpanzee allots mating opportunities with receptive

    E-Print Network [OSTI]

    [1] have shown that chimpanzees trade mating opportunities for support in power contests. OddlyApe Society: Trading Favours An alpha-male chimpanzee allots mating opportunities with receptive rare among animals, exchange of one currency for another -- in this case sex for power -- may

  16. A Gene Necessary for Normal Male Courtship, yellow, Acts Downstream of fruitless in the

    E-Print Network [OSTI]

    Gruber, Jonathan

    A Gene Necessary for Normal Male Courtship, yellow, Acts Downstream of fruitless in the Drosophila- ship behavior, genes acting downstream of fru have not yet been identified. Here we demonstrate that the yellow (y) gene is genetically downstream of fru in the 3rd -instar larval brain. Yellow protein

  17. Photoperiod Mediated Changes in Olfactory Bulb Neurogenesis and Olfactory Behavior in Male White-

    E-Print Network [OSTI]

    Nelson, Randy J.

    Photoperiod Mediated Changes in Olfactory Bulb Neurogenesis and Olfactory Behavior in Male White to long day lengths (LD) and short day lengths (SD) for 10 to 15 weeks and then examined olfactory bulb cell proliferation and survival using the thymidine analog BrdU, olfactory bulb granule cell morphology

  18. Seismic signals are crucial for male mating success in a visual specialist jumping spider (Araneae: Salticidae)

    E-Print Network [OSTI]

    Hoy, Ronald R.

    Seismic signals are crucial for male mating success in a visual specialist jumping spider (Araneae of multicomponent seismic courtship signals in addition to and produced in concert with its multiple visual ornaments and movement displays. Here, we demonstrate the importance of these seismic signals

  19. Mechanisms of Individual Variation in Reproductive Behavior in Female Xiphophorous birchmanni

    E-Print Network [OSTI]

    Smith, Victoria Lee

    2014-06-06T23:59:59.000Z

    for the Cayman Cortisol EIA kit ......... 12 2.5 Individual female cortisol levels over repeated sampling ....................................... 12 3.1 Validation of the cayman cortisol EIA kit with Xiphophorus birchmanni pooled water samples... of steroids from the column. This technique should collect only free (and not glucuronidated or sulfated) steroids (Vermeirssen and Scott, 1996). Eluates were dried under nitrogen and re-suspended in   9 600 microliters EIA buffer. Additional details...

  20. The effectiveness of visual evaluation scores as predictors of growth and fertility in Brangus females

    E-Print Network [OSTI]

    Harkey, Gary Don

    1990-01-01T23:59:59.000Z

    ). However, other studies indicated that higher postweaning growth delayed puberty in beef heifers (MacNeil et al. , 1985 and Fiss and Wilton, 1989). Seemingly, the interrelationships which exist between growth and reproductive performance may vary... growth and age at puberty (MacNeil et al. , 1985 and Fiss and Wilton, 1989). Managerial practices designed to maximize postweaning gain of replacement females are not only economically unfeasible in most instances, but have also been shown to reduce...

  1. (Per)Forming Female Politics: The Making of the `Modern Woman'

    E-Print Network [OSTI]

    Anderson, Christine Aliisa

    2008-01-01T23:59:59.000Z

    (Per)Forming Female Politics: The Making of the ?Modern Woman? in London, 1890-1914 By Copyright 2008 Christine A. Anderson Submited to the graduate degre program in History and the Graduate Faculty of the University of Kansas..., history, and the performing arts, and nurtured my pasion for and talents in these subjects. It is to both of them, therefore, that I dedicate this disertation. v v List of Abreviations AFL Actreses? Franchise League ILP Independent...

  2. The Social Mobility-Fertility Hypothesis: a racial and class comparison among southern females.

    E-Print Network [OSTI]

    White, Carolyn Delores

    1974-01-01T23:59:59.000Z

    and Level of Occupational Aspiration for Mate (LOAM) Summary of Phase I Test of the SMF Hypothesis. Social Mobility Tables Comparing Mean Fertility by the Educational Level of Mother (ELM) and the Level of Educational Aspiration (LEA) . Social Mobility... . Number and Percentage of Adjusted (}uota of Females Recontacted at Wave III by State and Race. Outline of Analytical Phases Bivariate Relationship Between Parity and Level of Educational Aspirations (LEA) Bivariate Relationship Between Parity...

  3. Difference as a means of defiance: a study of female subjectivity in six Jacobean plays

    E-Print Network [OSTI]

    Rodriguez, Mary Grace

    1995-01-01T23:59:59.000Z

    of the requirements for the degree of MASTER OF ARTS Approved as to style and content by: Katherine E. Kelly (Chair of Committee ffrey Cox (Member) Moocha 1 R. Han (Member) J. Lawrence Mitchell (Head of Department) August 1995 Major Subject: English... ABSTRACT Difference as a Means of Defiance: A Study of Female Subjectivity in Six Jacobean Plays. (August 1995) Mary Grace Rodriguez, B. A. , Texas A&M University Chair of Advisory Committee: Dr. Katherine E. Kelly The Hegelian dialectic clearly...

  4. Race and gender differences in the effect of informal social supports on the use of health services by the elderly

    E-Print Network [OSTI]

    Nelson, Martha Alice

    1990-01-01T23:59:59.000Z

    RACE AND GENDER DIFFERENCES IN THE EFFECT OF INFORMAL SOCIAL SUPPORTS ON THE USE OF HEALTH SERVICES BY THE ELDERLY A Thesis by MARTHA ALICE NELSON Submitted to the Office of Graduate Studies of Texas A&M University in partial fulfillment... of the requirements for the degree of MASTER OF SCIENCE December 1990 Major Subject: Sociology RACE AND GENDER DIFFERENCES IN THE EFFECT OF INFORMAL SOCIAL SUPPORTS ON THE USE OF HEALTH SERVICES BY THE ELDERLY A Thesis by MARTHA ALICE NELSON Approved...

  5. Tel: +44 (0) 1603 591574 Email: business@uea.ac.uk Web: www.uea.ac.uk/business Gender, caste and growth assessment in India

    E-Print Network [OSTI]

    Everest, Graham R

    is to change, gender relations have to be accounted for in growth policy and practice. In India, where caste Gender, caste and growth assessment in India Women in many countries don't tend to contribute to will experience different opportunities and benefits from those belonging to others. In 2006 the India country

  6. Introduction: what’s new about gender inequalities in the 21st century?

    E-Print Network [OSTI]

    Scott, Jacqueline; Crompton, Rosemary; Lyonette, Clare

    2010-01-01T23:59:59.000Z

    as well as the confl icts between diff erent ‘feminisms’ that these diff erences can generate. Ellingsæter examines the way diff erent Nordic ‘woman- friendly’ policies are powerful ways of institutionalising changing social norms relating to ‘good... at home. Both the system of work and the system of benefi ts depended on this male breadwinner model (Williams 2004). However, the model came under pressure to change in the 1960s and 1970s, partly in response to equality issues that were voiced...

  7. Effects of Family-Related Facotrs on Female Project Managers' Salaries in the Construction Industry in the United States

    E-Print Network [OSTI]

    Bilbo, David; Bigelow, Ben F.; Rybkowski, Zofia; Kamranzadeh, Amineh

    2014-07-31T23:59:59.000Z

    This study explores predictors of female project managers’ salary in the construction industry and analyzes the relationship between salaries and specific variables. Although prior research indicates a relationship does exist between certain...

  8. Insights into a researcher's attempt to study the mentoring needs of first-year, white, female teachers in diverse schools 

    E-Print Network [OSTI]

    Attaway, Kathy Ann

    2008-10-10T23:59:59.000Z

    While schools in America are becoming more culturally diverse, the majority of first-year teachers continue to be white females. Although mentoring has proven to be an effective means of supporting first-year teachers, ...

  9. Effects of Family-Related Facotrs on Female Project Managers' Salaries in the Construction Industry in the United States 

    E-Print Network [OSTI]

    Bilbo, David; Bigelow, Ben F.; Rybkowski, Zofia; Kamranzadeh, Amineh

    2014-07-31T23:59:59.000Z

    This study explores predictors of female project managers’ salary in the construction industry and analyzes the relationship between salaries and specific variables. Although prior research indicates a relationship does ...

  10. The Role Mentoring Plays in a White Female Novice Teacher's Perceptions of Her Enculturation into a Culturally Diverse Campus

    E-Print Network [OSTI]

    Noble, Erica Michelle

    2012-07-16T23:59:59.000Z

    played in a White female novice teacher's perceptions of her enculturation into a culturally diverse campus. Several methods of data collection were used, including 9 semi-structured interviews with the novice teacher, email dialogues, 3 days...

  11. The gender gap on concept inventories in physics: what is consistent, what is inconsistent, and what factors influence the gap?

    E-Print Network [OSTI]

    Madsen, Adrian; Sayre, Eleanor C

    2013-01-01T23:59:59.000Z

    We review the literature on the gender gap on concept inventories in physics. Across studies, men consistently score higher on pre-tests of the Force Concept Inventory (FCI) and Force and Motion Conceptual Evaluation (FMCE) by about 10%, and in most cases score higher on post-tests as well, also by about 10%. The average difference in normalized gain is about 6%. This difference is much smaller than the average difference in normalized gain between traditional lecture and interactive engagement (25%), but is large enough that it could impact the results of studies comparing the effectiveness of different teaching methods. Based on our analysis of 24 published articles comparing the impact of 34 factors that could potentially influence the gender gap, no single factor is sufficient to explain the gap. Several high-profile studies that have claimed to account for or reduce the gender gap have failed to be replicated, suggesting that isolated claims of explanations of the gender gap should be interpreted with ca...

  12. An Examination of Potential Racial and Gender Bias in the Principal Version of the Interactive Computer Interview System

    E-Print Network [OSTI]

    DiPonio, Joseph Michael

    2010-07-09T23:59:59.000Z

    Abstract The primary object of this study was to determine whether racial and/or gender bias were evidenced in the use of the ICIS-Principal. Specifically, will the use of the ICIS-Principal result in biased scores at a ...

  13. POSTDOCTORAL FELLOWSHIP: DIGITAL HUMANITIES AND NEW MEDIA The Institute for Women's and Gender Studies (IWGS) at the University of

    E-Print Network [OSTI]

    Martin, Jeff

    POSTDOCTORAL FELLOWSHIP: DIGITAL HUMANITIES AND NEW MEDIA The Institute for Women's and Gender in Digital Humanities and New Media starting as soon as possible, and lasting up to two years. The successful Postdoctoral Fellow will consult and collaborate with faculty members on digital and new media projects. S

  14. A Cholinergic Sensory-Motor Circuit Controls the Male Copulation Behavior in C. elegans

    E-Print Network [OSTI]

    Liu, Yishi

    2012-07-16T23:59:59.000Z

    for the degree of DOCTOR OF PHILOSOPHY Approved by: Chair of Committee, L. Rene Garcia Committee Members, James Grau Brian Perkins Michael Smotherman Head of Department, Jack McMahan May 2011 Major Subject: Biology iii ABSTRACT A... Cholinergic Sensory-motor Circuit Controls the Male Copulation Behavior In C. elegans. (May 2011) Yishi Liu, B.S., Huazhong Agricultural University Chair of Advisory Committee: Dr. L. Rene Garcia The nervous system coordinates a sequence of muscle...

  15. Insights into a researcher's attempt to study the mentoring needs of first-year, white, female teachers in diverse schools

    E-Print Network [OSTI]

    Attaway, Kathy Ann

    2008-10-10T23:59:59.000Z

    INSIGHTS INTO A RESEARCHER’S ATTEMPT TO STUDY THE MENTORING NEEDS OF FIRST-YEAR, WHITE, FEMALE TEACHERS IN DIVERSE SCHOOLS A Dissertation by KATHY ANN ATTAWAY Submitted to the Office of Graduate Studies of Texas A&M University... in partial fulfillment of the requirements for the degree of DOCTOR OF PHILOSOPHY December 2007 Major Subject: Educational Administration INSIGHTS INTO A RESEARCHER’S ATTEMPT TO STUDY THE MENTORING NEEDS OF FIRST-YEAR, WHITE, FEMALE...

  16. Acculturation and Transformation among Female Immigrant Military Spouses in an ESL Learning Program at a Community College

    E-Print Network [OSTI]

    Darnell, Patricia

    2012-07-16T23:59:59.000Z

    ACCULTURATION AND TRANSFORMATION AMONG FEMALE IMMIGRANT MILITARY SPOUSES IN AN ESL LEARNING PROGRAM AT A COMMUNITY COLLEGE A Dissertation by PATRICIA DARNELL Submitted to the Office of Graduate Studies of Texas A&M University in partial... Copyright 2012 Patricia Darnell ACCULTURATION AND TRANSFORMATION AMONG FEMALE IMMIGRANT MILITARY SPOUSES IN AN ESL LEARNING PROGRAM AT A COMMUNITY COLLEGE A Dissertation by PATRICIA DARNELL Submitted to the Office of Graduate Studies of Texas A...

  17. 04/16/2007 11:56 AMMore Females Because Sisters Kill Their Brothers -Not such an altruistic behavior in parasitoid wasps -Softpedia Page 1 of 2http://news.softpedia.com/news/More-Females-Because-They-Kill-Male-Offspring-51802.shtml

    E-Print Network [OSTI]

    Gardner, Andy

    Insect Brain Changed as They Evolved to More Social Parasitoid Wasps Could Be Future's Weapon AgainstDefender Antivirus Guaranteed detection and removal of all viruses. PC World Best Buy! visit site > SIPfoundry A Free

  18. Protection of the female reproductive system from natural and artificial insults

    DOE Patents [OSTI]

    Tilly, Jonathan L. (Windham, NH); Kolesnick, Richard N. (New York, NY)

    2010-12-14T23:59:59.000Z

    Described are methods for protecting the female reproductive system against natural and artificial insults by administering to women a composition comprising an agent that antagonizes one or more acid sphingomyelinase (ASMase) gene products. Specifically, methods disclosed herein serve to protect women's germline from damage resulting from cancer therapy regimens including chemotherapy or radiotherapy. In one aspect, the method preserves, enhances, or revives ovarian function in women, by administering to women a composition containing sphingosine-1-phosphate, or an analog thereof. Also disclosed are methods to prevent or ameliorate menopausal syndromes and to improve in vitro fertilization techniques.

  19. A review of "Rembrandt and the Female Nude" by Eric Jan Sluijter

    E-Print Network [OSTI]

    Silver, Larry

    2007-01-01T23:59:59.000Z

    arguments. The center of the book, nearly 200 pages long, is aptly titled ?Doctrine.? Eric Jan Sluijter. Rembrandt and the Female Nude. Amsterdam University Press, 2006. 448pp. + 100 color, 250 b/w illus. $74.50/59.50 Euros. Review by LARRY SILVER... materials. Eric Jan Sluijter, professor of Dutch and Renaissance art history at the University of Leiden, wrote his earlier studies exploring the Dutch visual- ization of Greco-Roman myths as well as interpretive issues concerning the 186 SEVENTEENTH...

  20. INFORMATION ABOUT RECENT APPLIED MATH PH.D.'S Student Advisor Thesis Title Completed Placement Period of Study Previous Degrees Received Gender Ethnicity Citizenship

    E-Print Network [OSTI]

    Ge, Qiaode Jeff

    Petrole, Paris 9/95 ­ 5/02 Master of Science ­ Michigan Technological University Male Asian China Somsak

  1. Semen parameters of Callithrix jacchus: ejaculates from selected males of proven fertility

    E-Print Network [OSTI]

    Busch, Leo Joseph

    1981-01-01T23:59:59.000Z

    . Presently, however, both of these species are only available in extremely limited numbers from a small number of domestic breeding facilities. Although researchers here in the United States have only just begun utilizing the small Brazilian common... laboratory primate. Its small size, approximately 25 cm in height and 300 g in weight at maturity, makes it relatively easy to handle and inexpens1ve to house and feed. It becomes sexually mature at 14 to 18 months, with the female hav1ng an ovar1an cycle...

  2. The Effect of Cues of Parental Investment on Attractiveness Ratings of Males: The Impact of Child Presence and Age 

    E-Print Network [OSTI]

    Went, Hannah

    2007-01-01T23:59:59.000Z

    According to evolutionary theories of mate choice, male parental investment is a desired characteristic of long term mates. Brase (2006) found that cues of a positive disposition towards parental investment increased ...

  3. The Effect of Music Therapy on Executive Function Skills in Male, Incarcerated Adults in a Correctional Facility

    E-Print Network [OSTI]

    Ellis, Elisha

    2014-05-31T23:59:59.000Z

    The purpose of the present study was to examine the effect of participation in a music therapy group on the executive function skills of male, incarcerated adults in a county correctional facility. Participants (N=16) were ...

  4. The Relationship Between Teachers' Preparation and Perceived Level of Technology Use in Mathematics With Middle School African American Males

    E-Print Network [OSTI]

    Mason, Sherrie Dee

    2012-10-19T23:59:59.000Z

    that the level of teachers' preparedness had an influence on the use and implementation of technology use in the classroom. Teachers' preparedness in the use of instructional technology was related to their African American male students' mathematical achievement...

  5. A review of "Law, Crime and English Society, 1660-1830" by Norma Landau and "Crime, Gender and Social Order in Early Modern England" by Garthine Walker

    E-Print Network [OSTI]

    Sherman, Donovan

    2010-01-01T23:59:59.000Z

    postmodern philosophy and historical analysis energizes Law, Crime and English Society, 1660-1830, edited by Norma Landau, and Crime, Gender and Social Order in Early Modern England by Garthine Walker. While only the latter acknowledges its reviews 17...

  6. A Critical Examination of Texas Mathematics Achievement in Grades Three through Eight by Mathematical Objective across Race/Ethnicity, Gender, and Socioeconomic Status

    E-Print Network [OSTI]

    Fox, Brandon

    2012-02-14T23:59:59.000Z

    The purpose of this quantitative study was to identify performance differences on the TAKS mathematics assessments in grades three through eight across race/ethnicity, gender, and socioeconomic status in the years 2004, 2007, and 2010. The guiding...

  7. Legal Pluralism, Cultural Contestation and Gender (In)justice: An Interpretation of Women?s Rights Cases in the Supreme Court of Nepal

    E-Print Network [OSTI]

    Pradhan, Rajendra

    2010-10-20T23:59:59.000Z

    activists filed numerous public interest litigations pertaining to women’s rights and gender justice in the Supreme Court of Nepal. These cases concerned a wide range of issues, including ancestral property, marriage, divorce, marital rape, sexual harassment...

  8. A review of "Dido's Daughters: Literacy, Gender, and Empire in Early Modern England and France" by Margaret W. Ferguson.

    E-Print Network [OSTI]

    Julie D. Campbell

    2004-01-01T23:59:59.000Z

    196 SEVENTEENTH-CENTURY NEWS Margaret W. Ferguson. Dido?s Daughters: Literacy, Gender, and Empire in Early Modern England and France. Chicago: University of Chicago Press, 2003. xiv + 506 pp. + 8 illus. $25.00 paper. Review by JULIE D. CAMPBELL... of approaches to ?defining and valuing literacy? in late medieval and early modern France and England (6). As she inter- rogates the history of literacy studies, she stresses that the notion of ?contestable inheritance? is a metaphor central to her argument...

  9. A review of "Subordinate Subjects: Gender, the Political Nation, and Literary Form in England." by Mihoko Suzuki

    E-Print Network [OSTI]

    Elisa Oh

    2004-01-01T23:59:59.000Z

    in England, 1588-1688. Aldershot, UK: Ashgate, 2003. x + 330 pp. + 6 illus. $79.95. Review by ELISA OH, BOSTON UNIVERSITY. REVIEWS 51 Mihoko Suzuki?s study of the evolution of political self-definition by women and apprentices traces a continuum... of political discourse from late Elizabethan England through the Restoration. This book will be of most use to scholars interested in gender and class issues, because Suzuki seeks to demonstrate equivalences between early modern women and apprentices...

  10. Effects of the Master Gardener program on the self-development of female inmates of a Federal Prison Camp 

    E-Print Network [OSTI]

    Migura, Melanie Marie

    1996-01-01T23:59:59.000Z

    EFFECTS OF THE MASTER GARDENER PROGRAM ON THE SELF-DEVELOPMENT OF FEMALE INMATES OF A FEDERAL PRISON CAMP A Thesis by MELANIE MANE MIGURA Submitted to the Office of Graduate Studies of Texas A&M University in partial fulfillment... of the requirements for the degree of MASTER OF SCIENCE August 1996 Major Subject: Horticulture EFFECTS OF THE MASTER GARDENER PROGRAM ON THE SELF-DEVELOPMENT OF FEMALE INMATES OF A FEDERAL PRISON CAMP A Thesis by MELANIE MARIE MIGURA Submitted to Texas A...

  11. A review of "Judging Maria de Macedo: A Female Visionary and the Inquisition in Early Modern Portugal" by Bryan Givens

    E-Print Network [OSTI]

    Hegstrom, Valerie

    2012-01-01T23:59:59.000Z

    reviews 65 Bryan Givens. Judging Maria de Macedo: A Female Visionary and the Inquisition in Early Modern Portugal. Baton Rouge: Louisiana State University Press, 2011. viii + 255 pp. $48.00. Review by #17;#25; #30;#31;#18;#30; #23...;#30;#8;#26;#19;#31;#20;#21;, #28;#31;#18;#8;#23;#25;#21; #16;#20;#29;#27;#8; #29;#27;#18;#17;#30;#31;#26;#18;#19;#16;. In his preface to Judging Maria de Macedo: A Female Visionary and the Inquisition in Early Modern Portugal, Bryan Givens tells us he did not set out to write a...

  12. The declining use of the Mixtec language : the persistence of memory, discrimination, and social hierarchies of power

    E-Print Network [OSTI]

    Perry, Elizabeth

    2009-01-01T23:59:59.000Z

    Mixteco Spanish Female SMT Spanish None Male SMT SpanishNone Male SMT SpanishNone Male SMT Mixteco Spanish Male SMT Mixteco Spanish

  13. Insights into a researcher's attempt to study the mentoring needs of first-year, white, female teachers in diverse schools

    E-Print Network [OSTI]

    Attaway, Kathy Ann

    2009-05-15T23:59:59.000Z

    While schools in America are becoming more culturally diverse, the majority of first-year teachers continue to be white females. Although mentoring has proven to be an effective means of supporting first-year teachers, little research has been done...

  14. Effects of the Master Gardener program on the self-development of female inmates of a Federal Prison Camp

    E-Print Network [OSTI]

    Migura, Melanie Marie

    1996-01-01T23:59:59.000Z

    Population. Subjects, . . . Instrumentation. . Data Collection. . . Data Analysis. IV FINDINGS AND DISCUSSION. . . . . . . . . 22 . . . . . . . 22 . . . . . . . 23 . . . . . . 26 27 . . . . . . . 29 Pilot Study Results... (Beck and Gilliard, 1995a). The National Center for Research in Vocational Education suggested female inmates need substantial support in acquiring skills to secure and maintain employment upon release from prison (Norton, Ciccone and Littlefield, 1987...

  15. Effects of obesity and metabolic syndrome on steroidogenesis and folliculogenesis in the female Ossabaw mini-pig

    E-Print Network [OSTI]

    Newell-Fugate, Annie; Taibl, Jessica; Alloosh, Mouhamad; Sturek, Michael; Bahr, Janice; Nowak, Romana; Krisher, Rebecca

    mini-pigs. Nineteen nulliparous, sexually mature female Ossabaw pigs were fed a high fat/cholesterol/fructose diet (n=10) or a control diet (n=9) for eight months. After a three-month diet-induction period, pigs remained on their respective diets...

  16. Treatment with 8-OH-DPAT attenuates the weight loss associated with activity-based anorexia in female rats

    E-Print Network [OSTI]

    Hull, Elaine

    ) plays an important role in controlling food intake and regulating body weight. In addition, clinical). This animal model allows researchers to directly manipulate neuronal and endocrine systems that may the effects of pharmacological manipulation of the 5-HT system in female rats exposed to conditions

  17. The effect of alcohol on the bone growth spurt of rats at a time equivalent to adolescent females 

    E-Print Network [OSTI]

    Chaffin, Catherine Lee

    1997-01-01T23:59:59.000Z

    The objective of this study is to determine the effect of long-term alcohol consumption on the growth spurt in adolescent rats. Female Sprague-Dawley rats were fed one of three diets (alcohol, pair-fed or chow) for 3 months. ...

  18. The Johns Hopkins University admits students of any race, color, gender, religion, age, national or ethnic origin, disability, marital status or veteran status to all of the rights, privileges, programs, ben-

    E-Print Network [OSTI]

    Scharfstein, Daniel

    , ethnicity, national origin, age, disability, religion, sexual orientation, gender identity or expression Facilities · Alumni · Banking Services · Bike Racks · Bookstore · Bulletin Boards · Career Services

  19. An Examination of the Role of Health Behaviors in the Relation between Neighborhood Disadvantage and Internalizing Symptoms among Latino Adolescents

    E-Print Network [OSTI]

    Rubens, Sonia Lynne

    2014-08-31T23:59:59.000Z

    in Latino adolescents despite the fact that symptoms of internalizing disorders increase during adolescence across ethnic and racial groups (Canino et al., 2004; Costello, Mustillo, Erkanli, Keeler, & Angold, 2003). Therefore, this study examines... internalizing symptoms than younger adolescents, and since females are more likely to report these symptoms than males, age and gender were controlled for in the analysis (Costello, Mustillo, Erkanli, Keeler, & Angold, 2003). Analyses also controlled...

  20. Women's status and fertility transition in China in the 1980's: integrating quantitative and qualitative approaches

    E-Print Network [OSTI]

    Liu, Peihang

    1996-01-01T23:59:59.000Z

    protects the rights and interests of women, guaranteeing that men and women will receive equal pay for equal work, and recruiting and training female cadres as well as male (Yao, 1983 ). The Marriage Law in 1950 which, along with Land Reform... sexual division of labor did not change completely. In some areas, women were even pushed out of employment and to home because of the notion that wotnen's reproductive leave would reduce econonuc productivity. Traditional gender discrimination...

  1. Decomposing the reciprocal relationships between academic achievement and general self-esteem

    E-Print Network [OSTI]

    Liu, Xiaoru

    1991-01-01T23:59:59.000Z

    -esteem are reciprocal and mediated by these psychosocial intervening variables. The robustness of the hypothesized model is further tested by examining the two demographic variables--age and gender, both as exogenous and moderating variables. All the hypothesized... relationships are robust and none of them are attenuated in the presence of gender and age as exogenous variables. Separate models are tested for males and females as well as for the two age cohorts (grades 7-9 and 10-12). The results of the analyses...

  2. Science and Poetry: Narrativizing Marital Crisis in Reform-Era Rural China

    E-Print Network [OSTI]

    Xiao, Hui Faye

    2011-10-01T23:59:59.000Z

    to the intellectual group whose social influence radiates not only through scientific organizations and journals, but also through the educational system and various cultural media, and consequently blurs the boundaries between scientific and humanist discourses... is gendered m a l e — f o r example, Chen Jingrun and Li Siguang in the 1980s1 reportage by Xu Chi. In "Return, Cries the Cuckoo," the urban/rural divide is powerful enough to reverse the usual gender model of male mentor and female student. Although Qiu...

  3. Significant Expression Levels of Transgenic PPP1CC2 in Testis and Sperm Are Required to Overcome the Male

    E-Print Network [OSTI]

    Significant Expression Levels of Transgenic PPP1CC2 in Testis and Sperm Are Required to Overcome the Male Infertility Phenotype of Ppp1cc Null Mice Nilam Sinha1 *¤ , Stephen Pilder2 , Srinivasan, Pennsylvania, United States of America Abstract PPP1CC2, one of four isoforms of the ser/thr protein

  4. 2-(Undecyloxy)-ethanol is a major component of the male-produced aggregation pheromone of Monochamus

    E-Print Network [OSTI]

    Hanks, Lawrence M.

    -INIA, Palencia 34071, Spain, 2 Natural Resources Institute, University of Greenwich, Chatham Maritime, Kent ME4 4 of Ecology, Swedish University of Agricultural Sciences, PO Box 7044, Uppsala S-750 07, Sweden, 5 College using gas chromatography (GC) coupled to mass spectrometry, a single male-specific compound was detected

  5. Toxic hydrogen sulphide and dark caves: pronounced male life-history divergence among locally adapted Poecilia mexicana

    E-Print Network [OSTI]

    Schlupp, Ingo

    Toxic hydrogen sulphide and dark caves: pronounced male life-history divergence among locally are characterized by exceptionally high concentrations of hydrogen sulphide (H2S): deep-sea hydrothermal vents, hydrocarbon seeps, as well as intertidal zones, salt marshes, mudflats and sewage outfalls, where hydrogen

  6. The Role of Interventional Radiology in the Diagnosis and Management of Male Impotence

    SciTech Connect (OSTI)

    Spiliopoulos, Stavros [Patras University Hospital, Department of Radiology (Greece)] [Patras University Hospital, Department of Radiology (Greece); Shaida, Nadeem [Cambridge University Hospitals NHS Trust, Addenbrooke's University Hospital, Department of Radiology (United Kingdom)] [Cambridge University Hospitals NHS Trust, Addenbrooke's University Hospital, Department of Radiology (United Kingdom); Katsanos, Konstantinos [Guy's and St Thomas' NHS Trust, Department of Radiology (United Kingdom)] [Guy's and St Thomas' NHS Trust, Department of Radiology (United Kingdom); Krokidis, Miltiadis, E-mail: mkrokidis@hotmail.com [Cambridge University Hospitals NHS Trust, Addenbrooke's University Hospital, Department of Radiology (United Kingdom)] [Cambridge University Hospitals NHS Trust, Addenbrooke's University Hospital, Department of Radiology (United Kingdom)

    2013-10-15T23:59:59.000Z

    Erectile dysfunction (ED) is defined as the persistent inability to reach or maintain penile rigidity enough for sexual satisfaction. Nearly 30% of the men between ages 40 and 70 years are affected by ED. A variety of pathologies, including neurological, psychological, or endocrine disorders and drug side effects, may incite ED. A commonly identified cause of ED is vascular disease. Initial diagnostic workup includes a detailed physical examination and laboratory tests. Whilst duplex ultrasound is considered the first-line diagnostic modality, intra-arterial digital subtraction angiography is still considered the 'gold standard' for the diagnosis of arteriogenic impotence. Percutaneous endovascular treatment may be offered in patients with vasculogenic ED that has failed to respond to oral medical therapy as an alternative to penile prosthesis or open surgical repair. In arteriogenic ED balloon angioplasty of the aorto-iliac axis, and in veno-occlusive ED, percutaneous venous ablation using various embolization materials has been reported to be safe and to improve sexual performance. Recently, the ZEN study investigated the safety and feasibility of drug-eluting stents for the treatment of arteriogenic ED attributed to internal pudendal artery stenosis with promising preliminary results. This manuscript highlights the role of interventional radiology in the diagnosis and minimally invasive treatment of male impotence.

  7. Prenatal ethanol exposure programs an increased susceptibility of non-alcoholic fatty liver disease in female adult offspring rats

    SciTech Connect (OSTI)

    Shen, Lang; Liu, Zhongfen; Gong, Jun; Zhang, Li [Department of Pharmacology, Basic Medical School of Wuhan University, Wuhan 430071 (China); Wang, Linlong [Department of Orthopedic Surgery, Zhongnan Hospital of Wuhan University, Wuhan 430071 (China); Magdalou, Jacques [UMR 7561 CNRS-Nancy Université, Faculté de Médicine, Vandoeuvre-lès-Nancy (France); Chen, Liaobin [Department of Orthopedic Surgery, Zhongnan Hospital of Wuhan University, Wuhan 430071 (China); Wang, Hui, E-mail: wanghui19@whu.edu.cn [Department of Pharmacology, Basic Medical School of Wuhan University, Wuhan 430071 (China); Research Center of Food and Drug Evaluation, Wuhan University, Wuhan 430071 (China)

    2014-01-15T23:59:59.000Z

    Prenatal ethanol exposure (PEE) induces dyslipidemia and hyperglycemia in fetus and adult offspring. However, whether PEE increases the susceptibility to non-alcoholic fatty liver disease (NAFLD) in offspring and its underlying mechanism remain unknown. This study aimed to demonstrate an increased susceptibility to high-fat diet (HFD)-induced NAFLD and its intrauterine programming mechanisms in female rat offspring with PEE. Rat model of intrauterine growth retardation (IUGR) was established by PEE, the female fetus and adult offspring that fed normal diet (ND) or HFD were sacrificed. The results showed that, in PEE + ND group, serum corticosterone (CORT) slightly decreased and insulin-like growth factor-1 (IGF-1) and glucose increased with partial catch-up growth; In PEE + HFD group, serum CORT decreased, while serum IGF-1, glucose and triglyceride (TG) increased, with notable catch-up growth, higher metabolic status and NAFLD formation. Enhanced liver expression of the IGF-1 pathway, gluconeogenesis, and lipid synthesis as well as reduced expression of lipid output were accompanied in PEE + HFD group. In PEE fetus, serum CORT increased while IGF-1 decreased, with low body weight, hyperglycemia, and hepatocyte ultrastructural changes. Hepatic IGF-1 expression as well as lipid output was down-regulated, while lipid synthesis significantly increased. Based on these findings, we propose a “two-programming” hypothesis for an increased susceptibility to HFD-induced NAFLD in female offspring of PEE. That is, the intrauterine programming of liver glucose and lipid metabolic function is “the first programming”, and postnatal adaptive catch-up growth triggered by intrauterine programming of GC-IGF1 axis acts as “the second programming”. - Highlights: • Prenatal ethanol exposure increase the susceptibility of NAFLD in female offspring. • Prenatal ethanol exposure reprograms fetal liver’s glucose and lipid metabolism . • Prenatal ethanol exposure cause the adaptive change of glucocorticoid-IGF1 axis.

  8. Housing sexuality: domestic space and the development of female sexuality in the fiction of Angela Carter and Jeanette Winterson 

    E-Print Network [OSTI]

    Cantrell, Samantha E.

    2005-08-29T23:59:59.000Z

    Whirter (Member) ___________________________ Melanie Hawthorne (Member) ___________________________ Paul A. Parrish (Head of Department) May 2004 Major Subject: English iii ABSTRACT Housing Sexuality Domestic Space and the Development of Female Sexuality... committee: Marian Eide, Melanie Hawthorne, Pam Matthews, and David McWhirter. Their confidence in me and patience with me helped me to face the daunting task of writing. Paulette Bomnskie in the English Graduate Studies Office offered vital support as I...

  9. Short term effects of commercial polychlorinated biphenyl (PCB) mixtures and individual PCB congeners in female Sprague-Dawley rats

    E-Print Network [OSTI]

    Chen, Yu-Chyu

    1992-01-01T23:59:59.000Z

    fulfillment of the requirements for the degree of MASTER OF SCIENCE December 1992 Major subject: Toxicology SHORT TERM EFFECTS OF COMMERCIAL POLYCHLORINATED BIPHENYL (PCB) MIXTURES AND INDIVIDUAL PCB CONGENERS IN FEMALE SPRAGUE-DAWLEY RATS A Thesis... of isomers 3 12 24 42 46 42 24 12 3 1 209 This thesis followed the format and style of Toxicology and Applied Pharmacology. isomers and congeners in which there are differences with respect to the number of halogen atoms and their substitution...

  10. Cellulose and psyllium supplementation in 10 females: the effect on food intake and in vitro fermentation variables

    E-Print Network [OSTI]

    Haynes, Susan Renee

    1988-01-01T23:59:59.000Z

    CELLULOSE AND PSYLLIUM SUPPLEMENTATION IN 10 FEMALES: THE EFFECT ON FOOD INTAKE AND IN VITRO FERMENTATION VARIABLES A Thesis by SUSAN RENEE HAYNES Submitted to the Graduate College of Texas A&M University in partial fulfillment... of the requirements for the degree of MASTER QF SCIENCE August 1988 Major Subject: Nutrition CELLULOSE AND PSYLLIUM SUPPLEMENTATION IN 10 FEMAI ES: THE EFFECT ON FOOD INTAKE AND IN VITRO FERMENTATION VARIABLES A Thesis by SUSAN RENEE HAYNES Approved...

  11. The effects of three different frequencies of low intensity walking on exercise adherence in a sedentary female workforce

    E-Print Network [OSTI]

    Schiller, Deborah Anne

    1991-01-01T23:59:59.000Z

    of three different frequencies of low intensity walking on exercise adherence and selected physiological and psychological indices of health and fitness. Thirty-four sedentary female volunteers from the Westinghouse Electronic Assembly Plant were... appreciated. Sincere appreciation is extended to the Westinghouse Electronic Assembly Plant for providing an environment that was conducive to learning and supportive of research. Special thanks to the women who volunteered their time and effort to serve...

  12. Title: Gender differences in presentation, management and in-hospital outcome in patients with ST-elevation myocardial infarction. Data from 5,000 patients included in the ORBI

    E-Print Network [OSTI]

    1 Title: Gender differences in presentation, management and in-hospital outcome in patients with ST. Titre: Différences liées au genre dans la présentation, la gestion et le devenir intra hospitalier des: Background: Gender differences in presentation, management and outcome in patients with ST

  13. Effects of Nicotine Exposure on In Vitro Metabolism of Chlorpyrifos in Male Sprague-Dawley Rats

    SciTech Connect (OSTI)

    Lee, Sookwang; Busby, Andrea L.; Timchalk, Charles; Poet, Torka S.

    2009-01-30T23:59:59.000Z

    Chlorpyrifos (CPF) is a common organophosphate (OP) insecticide which is metabolized by CYP450s to the neurotoxic metabolite, chlorpyrifos-oxon (CPF-oxon) and a non-toxic metabolite, 3,5,6-trichloro-2-pyridinol (TCP). The objective of this study was to quantify the effect of repeated in vivo nicotine exposures on CPF in vitro metabolism and marker substrate activities in rats. Male Sprague-Dawley rats were dosed subcutaneously with 1 mg nicotine/kg/, for up to 10 days. Animals showed signs of cholinergic crisis after the initial nicotine doses, but exhibited adaptation after a couple days of treatment. Rats were sacrificed on selected days 4 or 24 hr after the last nicotine-treatment. While CYP450 reduced CO spectra were not different across the treatments, the single nicotine dose group showed a 2-fold increase in CYP2E1 marker substrate (p-nitrophenol) activity 24 hr after a single nicotine treatment compared to saline controls. Conversely, repeated nicotine treatments resulted in decreased EROD marker substrate activity 4 hr after the 7th day of treatment. CPF-oxon Vmax and Km did not show significant changes across the different nicotine treatment groups. The Vmax describing the metabolism of CPF to TCP was increased on all groups (days 1, 7, and 10) 24 hr after nicotine treatment but were unchanged 4 hr after nicotine treatment. Results of this in vitro study suggest that repeated nicotine exposure (i.e., from smoking) may result in altered metabolism of CPF. Future in vivo experiments based on these results will be conducted to ascertain the impact of in vivo nicotine exposures on CPF metabolism in rats.

  14. Endocrine disruption mechanism of o,p'-DDT in mature male tilapia (Oreochromis niloticus)

    SciTech Connect (OSTI)

    Leanos-Castaneda, Olga [Department of Integrative Biology, University of Guelph, Ontario, N1G 2W1 (Canada)]. E-mail: olgalidia09@yahoo.com; Kraak, Glen van der [Department of Integrative Biology, University of Guelph, Ontario, N1G 2W1 (Canada); Rodriguez-Canul, Rossanna [Departamento de Recursos del Mar, CINVESTAV Unidad Merida, Carretera Antigua a Progreso km. 6, Ap. Postal 73 'Cordemex', Merida, Yucatan 97310 (Mexico); Gold, G. [Departamento de Recursos del Mar, CINVESTAV Unidad Merida, Carretera Antigua a Progreso km. 6, Ap. Postal 73 'Cordemex', Merida, Yucatan 97310 (Mexico)

    2007-06-01T23:59:59.000Z

    The aim of the present study was to evaluate, in vivo, the potential of o,p'-DDT to disrupt the endocrine system of mature male tilapia. In particular, the possibility that o,p'-DDT effects were mediated directly via the estrogen receptor (ER). Compounds with known ability to bind to the ER were employed: estradiol to induce and tamoxifen to inhibit the estrogenic effects result of the activation of the ER. In addition, an aromatase inhibitor, 4-hydrxyandrostenedione (4-OHA), was used to assess the ability of o,p'-DDT to induce estrogenic effects in a surrounding of low estradiol concentration. The effects of estradiol and o,p'-DDT were studied alone or in the presence of tamoxifen or 4-OHA at the end of a 12-day period of exposure. The main endpoints measured were plasma alkaline-labile phosphorous (ALP; an indirect indicator of vitellogenin), estradiol, testosterone and o,p'-DDT. It was found that o,p'-DDT was able to induce the vitellogenesis (measured as plasma ALP increase) and decrease the circulating levels of estradiol and testosterone. Interestingly, o,p'-DDT kept this ability in whole fish with low concentrations of estradiol which would exclude endogenous estradiol as indirect mediator of the estrogenic effects induced by o,p'-DDT. In addition, the plasma concentration of o,p'-DDT, instead of that of estradiol, was closely related to the plasma ALP increase induced by o,p'-DDT. This indicates that o,p'-DDT could have directly activated the vitellogenesis. The antiestrogenic action of tamoxifen to inhibit the vitellogenesis and the decrease on plasma estradiol induced by o,p'-DDT indicates that o,p'-DDT can bind directly to the ER. In conclusion, this in vivo study shows that o,p'-DDT has the potential to disrupt the endocrine system and strongly supports that the estrogenic actions of o,p'-DDT involve binding to the ER.

  15. Chaddars and Pink Collars in Pakistan: Gender, Work and the Global Economy A Dissertation Presented to the Faculty of the Department of Sociology and

    E-Print Network [OSTI]

    Fraden, Seth

    Chaddars and Pink Collars in Pakistan: Gender, Work and the Global Economy A Dissertation Presented in Pakistan, employed in a global workplace i.e. international call centers, manage the dialectical with their local cultural imperatives. This question is of special significance in deeply patriarchal Pakistan

  16. An Investigation of the Perceptions of Latino High School Males Who Were in Danger of Dropping Out but Persevered

    E-Print Network [OSTI]

    Nell, Jan Elizabeth

    2012-02-14T23:59:59.000Z

    Chambers Fred Bonner Anita McCormick Head of Department, Fredrick Nafukho December 2010 Major Subject: Educational Administration iii ABSTRACT An Investigation of the Perceptions of Latino High School Males Who Were in Danger of Dropping.... Fred Bonner, Dr. Tara Venzant Chambers, and Dr. Anita McCormick, was insightful and invaluable. I never felt discouraged or criticized when they offered constructive comments to improve the study. For that, I am truly grateful. Dr. Jim Scheurich, my...

  17. Predicting and understanding male weight training athletes' intentions to use anabolic-androgenic steroids: implications for prevention

    E-Print Network [OSTI]

    Riem, Kurt Erich

    1992-01-01T23:59:59.000Z

    , & Payne, 1984; Taylor & Black, 1987). Among males using AASs in an attempt to increase body size and perhaps self-esteem are a growing number of adolescents (Buckley et al. , 1988; Johnson, Jay, Shoup, & Rickert, 1989). Specifically, Buckley et al... intentions to be good indicators of their actual behavior for both alcohol use (Schlegel, Crawford, & Sanborn, 1977) and marijuana use (Schlegel & DiTecco, 1978). More importantly, adolescents' expressed intentions to smoke cigarettes have been reported...

  18. A review of "Dramatic Difference: Gender, Class, and Genre in the Early Modern Closet Drama." by Karen Raber 

    E-Print Network [OSTI]

    Julie D. Campbell

    2002-01-01T23:59:59.000Z

    REVIEWS 61 versial?corrective to critics such as Catherine Gallagher who have emphasized Behn?s witty identifications between female playwright and prostitute. The Theatre of Aphra Behn thus makes a different kind of contribution to Behn studies... from Behn?s Afterlife. If Spencer?s study contributes to our historical understanding of the reception of women?s writing in the eighteenth century, Hughes?s work chal- lenges our conceptions of the ideological underpinnings and over- tones of Behn?s...

  19. Sheet1

    E-Print Network [OSTI]

    Cai, Qianqi

    48, Pitman, Lisa A. 79, Female. 49, Prachyl, Conner A. 42, Female. 50, Rotter, Thomas E. 71, Female. 51, Toweson, John B. 71, Male. 52, Zheng, Wenchu, 64 ...

  20. Are Litigation and Collective Bargaining Complements or Substitutes for Achieving Gender Equality? A Study of the British Equal Pay Act

    E-Print Network [OSTI]

    Deakin, Simon; Butlin, Sarah Fraser; McLaughlin, Colm; Polanska, Aleksandra

    2015-01-01T23:59:59.000Z

    level using a locally agreed job evaluation scheme. An earlier job evaluation under the white book had been carried out in 1987, but it had ignored the effect of bonus schemes which had tended to benefit workers in male dominated grades by, on average... , up to 30 per cent of basic pay. While these bonuses had at some earlier point been related to productivity elated, monitoring of performance had generally ceased and, as later litigation made clear (see below, section 4.3), they had come to be seen...

  1. 17(lowercase beta)-estradiol and Tamoxifen prevent gastric cancer by modulating leukocyte recruitment and oncogenic pathways in Helicobacter pylori-infected INS-GAS male mice

    E-Print Network [OSTI]

    Sheh, Alexander

    Helicobacter pylori infection promotes male predominant gastric adenocarcinoma in humans. Estrogens reduce gastric cancer risk and previous studies showed that prophylactic 17?-estradiol (E2) in INS-GAS mice decreases H. ...

  2. Effects of feeding stimulant and insecticide mixtures on feeding response and morality of adult male corn earworm, Helicoverpa zea (Boddie)(Lepidoptera:Noctuidae)

    E-Print Network [OSTI]

    Clemens, Christopher Glen

    1996-01-01T23:59:59.000Z

    stimulants on feeding behavior and mortality of pheromone trap captured adult male corn earworms, Helicoverpa zea (Boddie), to screen and evaluate toxicants for use in an attracticide formulation. Commercially-available formulations of acephate, boric acid...

  3. Effects of feeding stimulant and insecticide mixtures on feeding response and morality of adult male corn earworm, Helicoverpa zea (Boddie)(Lepidoptera:Noctuidae) 

    E-Print Network [OSTI]

    Clemens, Christopher Glen

    1996-01-01T23:59:59.000Z

    stimulants on feeding behavior and mortality of pheromone trap captured adult male corn earworms, Helicoverpa zea (Boddie), to screen and evaluate toxicants for use in an attracticide formulation. Commercially-available formulations of acephate, boric acid...

  4. Spring Chinook Salmon Interactions Indices and Residual/Precocious Male Monitoring in the Upper Yakima Basin; Yakima/Klickitat Fisheries Project Monitoring and Evaluation, 2004-2005 Annual Report.

    SciTech Connect (OSTI)

    Pearsons, Todd N.; Johnson, Christopher L. (Washington Department of Fish and Wildlife, Olympia, WA); James, Brenda B. (Cascade Aquatics, Ellensburg, WA)

    2005-05-01T23:59:59.000Z

    This report examines some of the factors that can influence the success of supplementation, which is currently being tested in the Yakima Basin using upper Yakima stock of spring chinook salmon. Supplementation success in the Yakima Basin is defined relative to four topic areas: natural production, genetics, ecological interactions, and harvest (Busack et al. 1997). The success of spring chinook salmon supplementation in the Yakima Basin is dependent, in part, upon fish culture practices and favorable physical and biological conditions in the natural environment (Busack et al. 1997; James et al. 1999; Pearsons et al., 2003; Pearsons et al. 2004). Shortfalls in either of these two topics (i.e., failure in culturing many fish that have high long-term fitness or environmental conditions that constrain spring chinook salmon production) will cause supplementation success to be limited. For example, inadvertent selection or propagation of spring chinook that residualize or precocially mature may hinder supplementation success. Spring chinook salmon that residualize (do not migrate during the normal migration period) may have lower survival rates than migrants and, additionally, may interact with wild fish and cause unacceptable impacts to non-target taxa. Large numbers of precocials (nonanadromous spawners) may increase competition for females and significantly skew ratios of offspring sired by nonanadromous males, which could result in more nonanadromous spring chinook in future generations. Conditions in the natural environment may also limit the success of spring chinook supplementation. For example, intra or interspecific competition may constrain spring chinook salmon production. Spring chinook salmon juveniles may compete with each other for food or space or compete with other species that have similar ecological requirements. Monitoring of spring chinook salmon residuals, precocials, prey abundance, carrying capacity, and competition will help researchers interpret why supplementation is working or not working (Busack et al. 1997). Monitoring ecological interactions will be accomplished using interactions indices. Interactions indices will be used to index the availability of prey and competition for food and space. The tasks described below represent various subject areas of juvenile spring chinook salmon monitoring but are treated together because they can be accomplished using similar methods and are therefore more cost efficient than if treated separately. Topics of investigation we pursued in this work were: (1) strong interactor monitoring (competition index and prey index), (2) carrying capacity monitoring (microhabitat monitoring); (3) residual and precocious male salmon monitoring (abundance); (4) performance of growth modulation in reducing precocious males during spawning; (5) incidence of predation by residualized chinook salmon; and (6) benefits of salmon carcasses to juvenile salmonids. This report is organized into six chapters to represent these topics of investigation. Data were collected during the summer and fall, 2004 in index sections of the upper Yakima Basin (Figure 1). Previous results on the topics in this report were reported in James et al. (1999), and Pearsons et al. (2003; 2004). Hatchery-reared spring chinook salmon were first released during the spring of 1999. The monitoring plan for the Yakima/Klickitat Fisheries Project calls for the continued monitoring of the variables covered in this report. All findings in this report should be considered preliminary and subject to further revision as more data and analytical results become available.

  5. Abstract The fiddler crab Uca tangeri communicates using a visual waving display and a vibratory drumming

    E-Print Network [OSTI]

    of an empty mudflat, a waving male, a threatening male, and a wandering fe- male were presented to male-intensity waves were elicited by the female and threatening male stimuli than the mudflat stimulus or the waving

  6. The use of labeled leucine in establishing the time of allanto-chorionic fusion in the female albino rat with reference to implantation

    E-Print Network [OSTI]

    Rutledge, James Edward

    1966-01-01T23:59:59.000Z

    THE USE OF LABELED LEUCINE IN ESTABLISHING THE TIME OF ALLANTO-CHORIONIC FUSION IN THE FEMALE ALBINO RA T WIT H RE FERE NC E T 0 IM PLANTA T I ON A Thesis By JAMES EDWARD RUTLEDGE Submitted to the Graduate College of the Texas ASSAM... University in partial fulfillment of the requirements for the degree of MASTER OF SCIENCE January 1966 Major Subject: Physiology of Reproduction THE USE OF LABELED LEUCINE IN ESTABLISHING THE TIME OF ALLANTO- CHORIONIC FUSION IN THE FEMALE ALBINO RAT...

  7. Tracheal resonance database.

    E-Print Network [OSTI]

    Speech Communication Group (Massachusetts Institute of Technology); Sonderegger, Morgan A.; Chi, Xuemin, 1979-

    2006-02-08T23:59:59.000Z

    Syllables recorded from seven male and seven female speakers. Includes simultaneously recorded microphone and accelerometer signals.

  8. Dosimetry considerations in the enhanced sensitivity of male Wistar rats to chronic ethylene glycol-induced nephrotoxicity

    SciTech Connect (OSTI)

    Corley, R.A. [Battelle Pacific Northwest Division, Richland, WA 99352 (United States)], E-mail: rick.corley@pnl.gov; Wilson, D.M. [Dow Chemical Company, Midland, MI 48674 (United States); Hard, G.C. [Tairua, 2853 (New Zealand); Stebbins, K.E.; Bartels, M.J. [Dow Chemical Company, Midland, MI 48674 (United States); Soelberg, J.J. [Battelle Pacific Northwest Division, Richland, WA 99352 (United States); Dryzga, M.D. [Dow Chemical Company, Midland, MI 48674 (United States); Gingell, R. [Shell Oil Company, Houston, TX 77002 (United States); McMartin, K.E. [Louisiana State University Health Sciences Center, Shreveport, LA 71130 (United States); Snellings, W.M. [Dow Chemical Company, Midland, MI 48674 (United States)

    2008-04-15T23:59:59.000Z

    Male Wistar rats have been shown to be the most sensitive sex, strain and species to ethylene glycol-induced nephrotoxicity in subchronic studies. A chronic toxicity and dosimetry study was therefore conducted in male Wistar rats administered ethylene glycol via the diet at 0, 50, 150, 300, or 400 mg/kg/day for up to twelve months. Subgroups of animals were included for metabolite analysis and renal clearance studies to provide a quantitative basis for extrapolating dose-response relationships from this sensitive animal model in human health risk assessments. Mortality occurred in 5 of 20 rats at 300 mg/kg/day (days 111-221) and 4 of 20 rats at 400 mg/kg/day (days 43-193), with remaining rats at this dose euthanized early (day 203) due to excessive weight loss. Increased water consumption and urine volume with decreased specific gravity occurred at 300 mg/kg/day presumably due to osmotic diuresis. Calculi (calcium oxalate crystals) occurred in the bladder or renal pelvis at {>=} 300 mg/kg/day. Rats dying early at {>=} 300 mg/kg/day had transitional cell hyperplasia with inflammation and hemorrhage of the bladder wall. Crystal nephropathy (basophilic foci, tubule or pelvic dilatation, birefringent crystals in the pelvic fornix, or transitional cell hyperplasia) affected most rats at 300 mg/kg/day, all at 400 mg/kg/day, but none at {<=} 150 mg/kg/day. No significant differences in kidney oxalate levels, the metabolite responsible for renal toxicity, were observed among control, 50 and 150 mg/kg/day groups. At 300 and 400 mg/kg/day, oxalate levels increased proportionally with the nephrotoxicity score supporting the oxalate crystal-induced nephrotoxicity mode of action. No treatment-related effects on the renal clearance of intravenously infused {sup 3}H-inulin, a marker for glomerular filtration, and {sup 14}C-oxalic acid were observed in rats surviving 12 months of exposure to ethylene glycol up to 300 mg/kg/day. In studies with naive male Wistar and F344 rats (a less sensitive strain), a significant difference was observed in oxalate clearances between young rats (i.e. Wistar clearance < F344) but not in age-matched old rats. Regardless, the ratios of oxalate:inulin clearances in these two strains of rats, including those exposed to ethylene glycol, were all < 1, suggesting that a fraction of the filtered oxalate is reabsorbed. Other species, including humans, typically have clearance ratios > 1 and are more effective at clearing oxalic acid by both glomerular filtration and active secretion. Thus, the lower renal clearance and kidney accumulation of oxalates in male Wistar rats enhances their sensitivity, which will be a factor in human risk assessments. The benchmark dose values (BMD05, BMDL05) were 170 mg/kg/day and 150 mg/kg/day for nephropathy, and 170 mg/kg/day and 160 mg/kg/day for birefringent crystals, using incidence times severity data in each case. The NOAEL of 150 mg/kg/day is the same as that reported after 16-week exposure and appears to be a threshold dose below which no renal toxicity occurs, regardless of exposure duration.

  9. The obscure events contributing to the evolution of an incipient sex chromosome in Populus A retrospective working hypothesis.

    SciTech Connect (OSTI)

    Tuskan, Gerald A [ORNL; Tschaplinski, Timothy J [ORNL; Chen, Jay [ORNL; Labbe, Jessy L [ORNL; Ranjan, Priya [ORNL; DiFazio, Steven P [West Virginia University; Slavov, Goncho T. [West Virginia University; Yin, Tongming [ORNL

    2012-01-01T23:59:59.000Z

    Genetic determination of gender is a fundamental developmental and evolutionary process in plants. Although it appears that dioecy in Populus is partially genetically controlled, the precise gender-determining systems remain unclear. The recently-released second draft assembly and annotated gene set of the Populus genome provided an opportunity to re-visit this topic. We hypothesized that over evolutionary time, selective pressure has reformed the genome structure and gene composition in the peritelomeric region of the chromosome XIX which has resulted in a distinctive genome structure and cluster of genes contributing to gender determination in Populus. Multiple lines of evidence support this working hypothesis. First, the peritelomeric region of the chromosome XIX contains significantly fewer single nucleotide polymorphisms than the rest of Populus genome and has a distinct evolutionary history. Second, the peritelomeric end of chromosome XIX contains the largest cluster of the nucleotide-binding site-leucine-rich repeat (NBS-LRR) class of disease resistances genes in the entire Populus genome. Third, there is a high occurrence of small microRNAs on chromosome XIX coincident to the region containing the putative gender-determining locus and the major cluster of NBS-LRR genes. Further, by analyzing the metabolomic profiles of floral bud in male and female Populus trees using a gas chromatography-mass spectrometry, we found there are gender-specific accumulations of phenolic glycosides. Taken together, these findings provide new insights into the genetic control of gender determination in Populus.

  10. Seasonal Patterns of Melatonin, Cortisol, and Progesterone Secretion in Female Lambs Raised Beneath a 500-kV Transmission Line.

    SciTech Connect (OSTI)

    Lee, Jack M.

    1992-06-01T23:59:59.000Z

    Although several kinds of biological effects of electric and magnetic fields have been reported from laboratory studies, few have been independently replicated. When this study was being planned, the suppression of nighttime melatonin in rodents was thought to represent one of the strongest known effects of these fields. The effect had been replicated by a single laboratory for 60-Hz electric fields, and by multiple laboratories for d-c magnetic fields. The primary objective of this study was to determine whether the effect of electric and magnetic fields on melatonin would also occur in sheep exposed to a high voltage transmission line. The specific hypothesis tested by this experiment was as follows: The electrical environment produced by a 60-Hz, 500-kV transmission line causes a depression in nocturnal melatonin in chronically exposed female lambs. This may mimic effects of pinealectomy or constant long-day photoperiods, thus delaying the onset of reproductive cycles. Results of the study do not provide evidence to support the hypothesis. Melatonin concentrations in the sheep exposed to the transmission line showed the normal pattern of low daytime and high nighttime serum levels. As compared to the control group, there were no statistically significant group differences in the mean amplitude, phase, or duration of the nighttime melatonin elevation.

  11. The relationship between the bone mineral density and urinary cadmium concentration of residents in an industrial complex

    SciTech Connect (OSTI)

    Shin, Minah; Paek, Domyung [Institute of Health and Environment, Department of Environmental Health, School of Public Health, Seoul National University, Gwanak-599, Gwanak-gu, Seoul 151-742 (Korea, Republic of)] [Institute of Health and Environment, Department of Environmental Health, School of Public Health, Seoul National University, Gwanak-599, Gwanak-gu, Seoul 151-742 (Korea, Republic of); Yoon, Chungsik, E-mail: csyoon@snu.ac.kr [Institute of Health and Environment, Department of Environmental Health, School of Public Health, Seoul National University, Gwanak-599, Gwanak-gu, Seoul 151-742 (Korea, Republic of)] [Institute of Health and Environment, Department of Environmental Health, School of Public Health, Seoul National University, Gwanak-599, Gwanak-gu, Seoul 151-742 (Korea, Republic of)

    2011-01-15T23:59:59.000Z

    Background: An association between cadmium exposure and bone mineral density (BMD) has been demonstrated in elderly women, but has not been well studied in youths and men. Some studies report either no or a weak association between cadmium exposure and bone damage. Objectives: This study was designed to investigate the relationship between the urinary cadmium (U-Cd) levels and BMD of females and males of all ages. Methods: A total of 804 residents near an industrial complex were surveyed in 2007. U-Cd and BMD on the heel (non-dominant calcaneus) were analyzed with AAS-GTA and Dual-Energy X-ray absorptiometry, respectively. Demographic characteristics were collected by structured questionnaires. Osteoporosis and osteopenia were defined by BMD cut-off values and T-scores set by the WHO; T score>-1, normal; -2.5females (0.64 {mu}g/g creatinine) were higher than those in males (0.48 {mu}g/g creatinine) (p<0.001). With the logistic regression model, osteopenia was associated with high U-Cd levels ({>=}1.0 {mu}g/g creatinine) in females (OR=2.92; 95% CI, 1.51-5.64) and in males (OR=3.37; 95% CI, 1.09-10.38). With the multiple linear regression model, the BMD of the adult group was negatively associated with U-Cd (<0.05), gender (female, p<0.001) and age (p<0.001). The BMD of participants who were {<=}19 years of age was negatively associated with gender (female, p<0.01), whereas it was positively associated with age and BMI (p<0.001). BMD was not associated with exercise, smoking habits, alcohol consumption, job or parental education. Conclusion: Results suggested that U-Cd might be associated with osteopenia as well as osteoporosis in both male and female adults. Age and female gender were negatively associated with BMD in the adult group, whereas age was positively associated with BMD in the youth group. Cadmium exposure may be a potential risk factor for lower-BMD and osteopenia symptoms as well as for osteoporosis symptoms. - Research Highlights: {yields} The relationship between the urinary cadmium levels and BMD was investigated. {yields} U-Cd was associated with osteopenia and osteoporosis in adults. {yields} Cadmium exposure may be a potential risk factor for lower-BMD and osteopenia.

  12. Polychlorinated biphenyl 77 augments angiotensin II-induced atherosclerosis and abdominal aortic aneurysms in male apolipoprotein E deficient mice

    SciTech Connect (OSTI)

    Arsenescu, Violeta [Graduate Center for Nutritional Sciences, University of Kentucky, 800 Rose Street, Lexington, KY 40536-0200 (United States)] [Graduate Center for Nutritional Sciences, University of Kentucky, 800 Rose Street, Lexington, KY 40536-0200 (United States); Arsenescu, Razvan [Digestive Diseases and Nutrition, University of Kentucky, 800 Rose Street, Lexington, KY 40536-0200 (United States)] [Digestive Diseases and Nutrition, University of Kentucky, 800 Rose Street, Lexington, KY 40536-0200 (United States); Parulkar, Madhura; Karounos, Michael [Graduate Center for Nutritional Sciences, University of Kentucky, 800 Rose Street, Lexington, KY 40536-0200 (United States)] [Graduate Center for Nutritional Sciences, University of Kentucky, 800 Rose Street, Lexington, KY 40536-0200 (United States); Zhang, Xuan [Graduate Center for Toxicology, University of Kentucky, 800 Rose Street, Lexington, KY 40536-0200 (United States)] [Graduate Center for Toxicology, University of Kentucky, 800 Rose Street, Lexington, KY 40536-0200 (United States); Baker, Nicki [Graduate Center for Nutritional Sciences, University of Kentucky, 800 Rose Street, Lexington, KY 40536-0200 (United States)] [Graduate Center for Nutritional Sciences, University of Kentucky, 800 Rose Street, Lexington, KY 40536-0200 (United States); Cassis, Lisa A., E-mail: lcassis@uky.edu [Graduate Center for Nutritional Sciences, University of Kentucky, 800 Rose Street, Lexington, KY 40536-0200 (United States)

    2011-11-15T23:59:59.000Z

    Infusion of angiotensin II (AngII) to hyperlipidemic mice augments atherosclerosis and causes formation of abdominal aortic aneurysms (AAAs). Each of these AngII-induced vascular pathologies exhibit pronounced inflammation. Previous studies demonstrated that coplanar polychlorinated biphenyls (PCBs) promote inflammation in endothelial cells and adipocytes, two cell types implicated in AngII-induced vascular pathologies. The purpose of this study was to test the hypothesis that administration of PCB77 to male apolipoprotein E (ApoE) -/- mice promotes AngII-induced atherosclerosis and AAA formation. Male ApoE-/- mice were administered vehicle or PCB77 (49 mg/kg, i.p.) during week 1 and 4 (2 divided doses/week) of AngII infusion. Body weights and total serum cholesterol concentrations were not influenced by administration of PCB77. Systolic blood pressure was increased in AngII-infused mice administered PCB77 compared to vehicle (156 {+-} 6 vs 137 {+-} 5 mmHg, respectively). The percentage of aortic arch covered by atherosclerotic lesions was increased in AngII-infused mice administered PCB77 compared to vehicle (2.0 {+-} 0.4 vs 0.9 {+-} 0.1%, respectively). Lumen diameters of abdominal aortas determined by in vivo ultrasound and external diameters of excised suprarenal aortas were increased in AngII-infused mice administered PCB77 compared to vehicle. In addition, AAA incidence increased from 47 to 85% in AngII-infused mice administered PCB77. Adipose tissue in close proximity to AAAs from mice administered PCB77 exhibited increased mRNA abundance of proinflammatory cytokines and elevated expression of components of the renin-angiotensin system (angiotensinogen, angiotensin type 1a receptor (AT1aR)). These results demonstrate that PCB77 augments AngII-induced atherosclerosis and AAA formation. -- Highlights: Black-Right-Pointing-Pointer Polychlorinated biphenyl 77 (PCB77) promotes AngII-induced hypertension. Black-Right-Pointing-Pointer PCB77 augments AngII-induced atherosclerosis. Black-Right-Pointing-Pointer PCB77 promotes AngII-induced AAA formation and rupture. Black-Right-Pointing-Pointer PCB77 promotes inflammation in periaorticadipose tissue surrounding AAAs.

  13. GENDER AND CULTURE HER_10.indd 231HER_10.indd 231 11/29/2006 5:55:43 PM11/29/2006 5:55:43 PM

    E-Print Network [OSTI]

    Herring, Susan

    flirtatious conversations with females than vice versa (Bruckman, 1993). We find that females participate more with how appropriate it is for women to speak and be heard in public, as well as attitudes toward AND CULTURE Q1 dominance reproduced from offline Thai culture--in which women are socialized to be docile

  14. Changing gender role attitudes

    E-Print Network [OSTI]

    Scott, Jacqueline

    2008-01-01T23:59:59.000Z

    , the Netherlands, Italy, Ireland and Spain). Third, the ISSP data pro- vides a sufficient time span (14 years, with surveys in 1988, 1994 and 2002) for the systematic investigation of the underlying causes of attitudinal change. Attitudinal Changes in Great Britain... and Spain. Unfortunately, in both Italy and Spain survey participation was only for two of the three waves, with Italy not participating in 2002 and Spain not participating in 1988. The per- centages reflect the combined attitudes of men and women, although...

  15. TOTAL WORKFORCE Males

    National Nuclear Security Administration (NNSA)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOn AprilAElectronic Input Options Gary L. Hirsch SNLMay 20102 | NationalThis1QA:

  16. TOTAL WORKFORCE Males

    National Nuclear Security Administration (NNSA)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOn AprilAElectronic Input Options Gary L. Hirsch SNLMay 20102 | NationalThis1QA:2 4 6 0 0 6

  17. TOTAL WORKFORCE Males

    National Nuclear Security Administration (NNSA)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOn AprilAElectronic Input Options Gary L. Hirsch SNLMay 20102 | NationalThis1QA:2 4 6 0 0 6

  18. TOTAL WORKFORCE Males

    National Nuclear Security Administration (NNSA)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOn AprilAElectronic Input Options Gary L. Hirsch SNLMay 20102 | NationalThis1QA:2 4 6 0 0

  19. TOTAL WORKFORCE Males

    National Nuclear Security Administration (NNSA)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOn AprilAElectronic Input Options Gary L. Hirsch SNLMay 20102 | NationalThis1QA:2 4 6 0 0

  20. TOTAL WORKFORCE Males

    National Nuclear Security Administration (NNSA)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOn AprilAElectronic Input Options Gary L. Hirsch SNLMay 20102 | NationalThis1QA:2 4 6 0 09

  1. TOTAL WORKFORCE Males

    National Nuclear Security Administration (NNSA)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOn AprilAElectronic Input Options Gary L. Hirsch SNLMay 20102 | NationalThis1QA:2 4 6 0 097

  2. TOTAL WORKFORCE Males

    National Nuclear Security Administration (NNSA)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOn AprilAElectronic Input Options Gary L. Hirsch SNLMay 20102 | NationalThis1QA:2 4 6 0

  3. TOTAL WORKFORCE Males

    National Nuclear Security Administration (NNSA)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOn AprilAElectronic Input Options Gary L. Hirsch SNLMay 20102 | NationalThis1QA:2 4 6 01 3

  4. TOTAL WORKFORCE Males

    National Nuclear Security Administration (NNSA)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOn AprilAElectronic Input Options Gary L. Hirsch SNLMay 20102 | NationalThis1QA:2 4 6 01 35

  5. TOTAL WORKFORCE Males

    National Nuclear Security Administration (NNSA)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOn AprilAElectronic Input Options Gary L. Hirsch SNLMay 20102 | NationalThis1QA:2 4 6 01

  6. TOTAL WORKFORCE Males

    National Nuclear Security Administration (NNSA)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOn AprilAElectronic Input Options Gary L. Hirsch SNLMay 20102 | NationalThis1QA:2 4 6 013

  7. TOTAL WORKFORCE Males

    National Nuclear Security Administration (NNSA)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOn AprilAElectronic Input Options Gary L. Hirsch SNLMay 20102 | NationalThis1QA:2 4 6 0139

  8. TOTAL WORKFORCE Males

    National Nuclear Security Administration (NNSA)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOn AprilAElectronic Input Options Gary L. Hirsch SNLMay 20102 | NationalThis1QA:2 4 6

  9. TOTAL WORKFORCE Males

    National Nuclear Security Administration (NNSA)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOn AprilAElectronic Input Options Gary L. Hirsch SNLMay 20102 | NationalThis1QA:2 4 60

  10. TOTAL WORKFORCE Males

    National Nuclear Security Administration (NNSA)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOn AprilAElectronic Input Options Gary L. Hirsch SNLMay 20102 | NationalThis1QA:2 4 604

  11. TOTAL WORKFORCE Males

    National Nuclear Security Administration (NNSA)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOn AprilAElectronic Input Options Gary L. Hirsch SNLMay 20102 | NationalThis1QA:2 4 6043

  12. TOTAL WORKFORCE Males

    National Nuclear Security Administration (NNSA)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOn AprilAElectronic Input Options Gary L. Hirsch SNLMay 20102 | NationalThis1QA:2 4 604376

  13. TOTAL WORKFORCE Males

    National Nuclear Security Administration (NNSA)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOn AprilAElectronic Input Options Gary L. Hirsch SNLMay 20102 | NationalThis1QA:2 4 6043763

  14. TOTAL WORKFORCE Males

    National Nuclear Security Administration (NNSA)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOn AprilAElectronic Input Options Gary L. Hirsch SNLMay 20102 | NationalThis1QA:2 4

  15. TOTAL WORKFORCE Males

    National Nuclear Security Administration (NNSA)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOn AprilAElectronic Input Options Gary L. Hirsch SNLMay 20102 | NationalThis1QA:2 42 4 1 0

  16. TOTAL WORKFORCE Males

    National Nuclear Security Administration (NNSA)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOn AprilAElectronic Input Options Gary L. Hirsch SNLMay 20102 | NationalThis1QA:2 42 4 1 00

  17. Patterns of variation in leucocyte counts of female tree swallows, Tachycineta bicolor: Repeatability over time and relationships with condition and costs of reproduction

    E-Print Network [OSTI]

    Dawson, Russell D.

    University Way, Prince George, BC, Canada V2N 4Z9 A B S T R A C TA R T I C L E I N F O Article history is increasingly being recognized as a reliable indicator of stress in birds. In this study we examined whether HL time, date, age, climate conditions or with measures of maternal investment in female tree swallows

  18. Reproductive effects assessment of largemouth bass and bluegill in the Watts Bar Lake/Clinch River system

    SciTech Connect (OSTI)

    Niemela, S.L.; McCracken, M.K.; Ivey, L.J.; Greeley, M.S. Jr. [Oak Ridge National Lab., TN (United States)

    1995-12-31T23:59:59.000Z

    Successful reproduction is key to the survival and maintenance of viable fish populations and therefore an important consideration in ecological risk assessments. In order to evaluate the reproductive health of fish in the Watts Bar Lake/Clinch River system downstream of the Department of Energy facilities in Oak Ridge, TN, largemouth bass (Micropterus salmoides) and bluegill sunfish (Lepomis macrochirus) were collected from seven sites at the beginning of the spawning period and a suite of parameters indicative of reproductive condition were measured. Measures of reproductive condition common to male and female fish included gonadal somatic index (GSI), and plasma concentrations of reproductive hormones. Gender specific analyses included a histological examination of the testes in males and a quantitative evaluation of ovarian parameters in females including determinations of fecundity, the number of vitellogenic and atretic oocytes, and the incidences of ovarian parasites. Evidence of reproductive impairment in largemouth bass at the two sites immediately adjacent to the Oak Ridge Reservation included lower GSIs and reproductive hormone levels (males and females), and reduced fecundity and an increase in the number of atretic oocytes (females). Similar trends were not observed in bluegill sunfish. These findings suggest that reproduction in a top-level predatory fish species, the largemouth bass, may be negatively affected by activities on the Oak Ridge Reservation.

  19. 28/05/2008 18:53Malaria parasites fine-tune offspring's gender: study | Health | Reuters Page 1 of 2http://www.reuters.com/article/healthNews/idUSL2887819620080528?sp=true

    E-Print Network [OSTI]

    Gardner, Andy

    28/05/2008 18:53Malaria parasites fine-tune offspring's gender: study | Health | Reuters Page 1 of 2http://www.reuters.com/article/healthNews/idUSL2887819620080528?sp=true ¥ $ - Learn. Practice 2007 Broker Center sponsored links You are here: Home > News > Health > Article Reuters Widgets Get

  20. Use of genomic data in risk assessment case study: I. Evaluation of the dibutyl phthalate male reproductive development toxicity data set

    SciTech Connect (OSTI)

    Makris, Susan L., E-mail: makris.susan@epa.gov [U.S. Environmental Protection Agency, National Center for Environmental Assessment, Office of Research and Development, (Mail code 8623P), 1200 Pennsylvania Ave., NW, Washington, DC 20460 (United States); Euling, Susan Y. [U.S. Environmental Protection Agency, National Center for Environmental Assessment, Office of Research and Development, (Mail code 8623P), 1200 Pennsylvania Ave., NW, Washington, DC 20460 (United States); Gray, L. Earl [U.S. Environmental Protection Agency, National Health and Environmental Effects Research Laboratory, Office of Research and Development, (MD-72), Highway 54, Research Triangle Park, NC 27711 (United States); Benson, Robert [U.S. Environmental Protection Agency, Region 8, (Mail code 8P-W), 1595 Wynkoop Street, Denver, CO 80202 (United States); Foster, Paul M.D. [National Toxicology Program, National Institute of Environmental Health Sciences, P.O. Box 12233 (MD K2-12), Research Triangle Park, NC 27709 (United States)

    2013-09-15T23:59:59.000Z

    A case study was conducted, using dibutyl phthalate (DBP), to explore an approach to using toxicogenomic data in risk assessment. The toxicity and toxicogenomic data sets relative to DBP-related male reproductive developmental outcomes were considered conjointly to derive information about mode and mechanism of action. In this manuscript, we describe the case study evaluation of the toxicological database for DBP, focusing on identifying the full spectrum of male reproductive developmental effects. The data were assessed to 1) evaluate low dose and low incidence findings and 2) identify male reproductive toxicity endpoints without well-established modes of action (MOAs). These efforts led to the characterization of data gaps and research needs for the toxicity and toxicogenomic studies in a risk assessment context. Further, the identification of endpoints with unexplained MOAs in the toxicity data set was useful in the subsequent evaluation of the mechanistic information that the toxicogenomic data set evaluation could provide. The extensive analysis of the toxicology data set within the MOA context provided a resource of information for DBP in attempts to hypothesize MOAs (for endpoints without a well-established MOA) and to phenotypically anchor toxicogenomic and other mechanistic data both to toxicity endpoints and to available toxicogenomic data. This case study serves as an example of the steps that can be taken to develop a toxicological data source for a risk assessment, both in general and especially for risk assessments that include toxicogenomic data.

  1. International Symposium Women as Visionaries, Healers and Poisoners

    E-Print Network [OSTI]

    Peters, Achim

    International Symposium Women as Visionaries, Healers and Poisoners ­ Autonomous Female Religious:45 Dinner SUNDAY 05.05.2013 CONTESTED GENDER AND SOCIAL ROLES: FEMALE HEALERS AND POISONERS 09:30 Anna) -- The gender of the poisoner: containership, analogic kinship and female poisoning lineages (dug rgyud) among

  2. 3rd Survey on the Situation of PhD Students in the Max Planck Society Open from the 25th of May until the 21th of June

    E-Print Network [OSTI]

    insurance I don't have such an insurance other insurance G8 Are you male or female? Variables: G8 1 Female 2

  3. attraction influences mate-choice: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Influences Social Influences on the Mate Choices of Male and Female Japanese Quail Bennett. The results of those studies are summarized here. Females prefer to affiliate with...

  4. Possible modulation of N-methyl-D,L-aspartic acid induced prolactin release by testicular steroids in the adult male rhesus monkey

    SciTech Connect (OSTI)

    Arslan, M.; Rizvi, S.S.R.; Jahan, S.; Zaidi, P.; Shahab, M. (Quaid-i-Azam Univ., Islamabad (Pakistan))

    1991-01-01T23:59:59.000Z

    N-methyl-D,L-aspartic acid (NMA), an agonist of the neurotransmitter glutamate has been shown to acutely stimulate the release of prolactin (PRL) in intact rats and monkeys. To further investigate the role of neuroexcitatory amino acids in PRL secretion, the effects of NMA administration were examined on PRL release in long term orchidectomized adult rhesus monkeys, in both the absence and presence of testosterone. Intact and long term castrated adult male monkeys weighing between 8-13 kg, were implanted with a catheter via the saphenous vein for blood withdrawal and drug infusion. Blood samples were collected at 10 min intervals for 50 min before and 70 min after administration of the drug or vehicle. Plasma PRL concentrations were estimated using radioimmunoassay. Whereas a single iv injection of NMA induced a prompt discharge of PRL in intact monkeys, an identical dose had surprisingly no effect on PRL secretion in orchidectomized animals. On the other hand, plasma PRL increases in response to a challenge dose of thyrotropin releasing hormone were similar in magnitude in the two groups of monkeys. Testosterone replacement in orchidectomized animals by parenteral administration of testosterone enanthate reinitiated the PRL responsiveness to acute NMA stimulation. These results indicate that N-methyl-D-aspartic acid (NMDA) dependent drive to PRL release in the adult male rhesus monkey may be overtly influenced by the sex steroid milieu.

  5. Dosimetric Comparison of Involved-Field Three-Dimensional Conformal Photon Radiotherapy and Breast-Sparing Proton Therapy for the Treatment of Hodgkin's Lymphoma in Female Pediatric Patients

    SciTech Connect (OSTI)

    Andolino, David L., E-mail: dandolin@iupui.edu [Department of Radiation Oncology, Indiana University School of Medicine, Bloomington, IN (United States); Hoene, Ted [Midwest Proton Radiotherapy Institute, Bloomington, IN (United States); Xiao, Lu [Department of Radiation Oncology, Indiana University School of Medicine, Bloomington, IN (United States); Buchsbaum, Jeffrey; Chang, Andrew L. [Department of Radiation Oncology, Indiana University School of Medicine, Bloomington, IN (United States); Midwest Proton Radiotherapy Institute, Bloomington, IN (United States)

    2011-11-15T23:59:59.000Z

    Purpose: To assess the potential reduction in breast dose for young girls with Hodgkin's lymphoma (HL) treated with breast-sparing proton therapy (BS-PT) as compared with three-dimensional conformal involved-field photon radiotherapy (3D-CRT). Methods and Materials: The Clarian Health Cancer Registry was queried for female pediatric patients with the diagnosis of HL who received radiotherapy at the Indiana University Simon Cancer Center during 2006-2009. The original CT simulation images were obtained, and 3D-CRT and BS-PT plans delivering 21 Gy or cobalt gray equivalent (CGE) in 14 fractions were created for each patient. Dose-volume histogram data were collected for both 3D-CRT and BS-PT plans and compared by paired t test for correlated samples. Results: The cancer registry provided 10 female patients with Ann Arbor Stage II HL, aged 10-18 years at the time of treatment. Both mean and maximum breast dose were significantly less with BS-PT compared with 3D-CRT: 0.95 CGE vs. 4.70 Gy (p < 0.001) and 21.07 CGE vs. 23.11 Gy (p < 0.001), respectively. The volume of breast receiving 1.0 Gy/CGE and 5.0 Gy/CGE was also significantly less with BS-PT, 194 cm{sup 3} and 93 cm{sup 3}, respectively, compared with 790 cm{sup 3} and 360 cm{sup 3} with 3D-CRT (p = 0.009, 0.013). Conclusion: Breast-sparing proton therapy has the potential to reduce unnecessary breast dose in young girls with HL by as much as 80% relative to involved-field 3D-CRT.

  6. Sheet1

    E-Print Network [OSTI]

    Cai, Qianqi

    8, Engermann, Elijah N. 61, Female. 9, Hansen, Sandra M. 61, Female. 10, Kinney, Grant H. 42, Male. 11, Kinney, Matthew J. 59, Male. 12, LaFrancois, Sarah N.

  7. Roster(4)

    E-Print Network [OSTI]

    ahn

    48, Pitman, Lisa A. 9.2, 40, Male. 49, Prachyl, Conner A. 9.15, 32, Female. 50, Rotter, Thomas E. 9.1, 50, Male. 51, Toweson, John B. 9.05, 53, Female.

  8. Individualized Data for Lab 4

    E-Print Network [OSTI]

    46, Onaghise, Oluwatumininu E. 9.70, 49, Female. 47, Peng, Xihan, 9.75, 69, Female. 48, Pitman, Lisa A. 9.80, 65, Male. 49, Prachyl, Conner A. 9.85, 67, Male.

  9. Sequence of the chicken sex chromosomes

    E-Print Network [OSTI]

    Bellott, Daniel Winston

    2010-01-01T23:59:59.000Z

    In birds, as in mammals, the chromosome complement determines sex. Male birds are designated ZZ, female ZW. Mammals have the opposite system; males are XY and females XX. Both the avian ZW and mammalian XY pair are believed ...

  10. The pulmonary response of white and black adults to six concentrations of ozone

    SciTech Connect (OSTI)

    Seal, E. Jr.; McDonnell, W.F.; House, D.E.; Salaam, S.A.; Dewitt, P.J.; Butler, S.O.; Green, J.; Raggio, L. (Environmental Protection Agency, Chapel Hill, NC (United States))

    1993-04-01T23:59:59.000Z

    Many early studies of respiratory responsiveness to ozone (O3) were done on healthy, young, white males. The purpose of this study was to determine whether gender or race differences in O3 response exist among white and black, males and females, and to develop concentration-response curves for each of the gender-race groups. Three hundred seventy-two subjects (n > 90 in each gender-race group), ages 18 to 35 yr, were exposed once for 2.33 h to 0.0 (purified air), 0.12, 0.18, 0.24, 0.30, or 0.40 ppm O3. Each exposure was preceded by baseline pulmonary function tests and a symptom questionnaire. The first 2 h of exposure included alternating 15-min periods of rest and exercise on a motorized treadmill producing a minute ventilation (VE) of 25 L/min/m2 body surface area (BSA). After exposure, subjects completed a set of pulmonary function tests and a symptom questionnaire. Lung function and symptom responses were expressed as percent change from baseline and analyzed using a nonparametric two factor analysis of variance. Three primary variables were analyzed: FEV1, specific airway resistance (SRaw), and cough. Statistical analysis demonstrated no significant differences in response to O3 among the individual gender-race groups. For the group as a whole, changes in the variables FEV1, SRaw, and cough were first noted at 0.12, 0.18, and 0.18 ppm O3, respectively. Adjusted for exercise difference, concentration-response curves for FEV1 and cough among white males were consistent with previous reports (1).

  11. Non-invasive Multidisciplinary Approach to the Study of Reproduction and Calf Development in Bottlenose Dolphin (Tursiops truncatus): The Rimini Delfinario Experience

    E-Print Network [OSTI]

    Tizzi, Raffaella; Accorsi, Pier Attilio; Azzali, Massimo

    2010-01-01T23:59:59.000Z

    presumed) Gulf of Mexico (Campeche) Beta* Female 1981 (presumed) Gulf of Mexico (Campeche) Sole Male 03 May 1993

  12. Mating behaviour, epibiotic growth, and the effect of salinity on grooming activity in the hermaphroditic shrimp Lysmata wurdemanni 

    E-Print Network [OSTI]

    Giri, Tuhin

    2004-09-30T23:59:59.000Z

    species of decapod crustaceans observed to exhibit protandry, 31 belong to the Infraorder Caridea (reviewed in Bauer (2000)). Protandric hermaphroditism found in these shrimp is believed to have evolved from a gonochoristic ancestor, but the mechanism... females, as well as individuals that experience a very short male phase; (D) Protandry with primary males; (E) Protandric simultaneous hermaphroditism. (After Bauer (2000)) Juvenile Male Female A Juvenile Male Female Primary Female B Juvenile...

  13. Correlations Among Gender, Career Interests, Conservation Issues, And Curriculum Choice By Students In Wildlife And Fisheries Sciences At Texas A&M University From 2000 To 2008

    E-Print Network [OSTI]

    Woldhagen, Ashley N.

    2010-10-12T23:59:59.000Z

    due to complying with the law protecting endangered species. PplMnWL People have the right to manage wildlife populations. WLtoAll Wildlife belong to all people, even if found on private land. BredHnt It is ok to breed and raise wildlife (deer...ProN ESReimbA ESReimbD ESReimbN PplMnWLA PplMnWLD PplMnWLN WLtoAllA WLtoAllD WLtoAllN BredHntA BredHntD BredHntN GvRgOcnA GvRgOcnD GvRgOcnN SanctGvA SanctGvD SanctGvN WLPetA WLPetD WLPetN FshCrulA FshCrulD FshCrulN AnRt.PpA AnRt.PpD AnRt.PpN 2000 2008 Male...

  14. An Introduction to Prolog A.1 A Short Background

    E-Print Network [OSTI]

    Nugues, Pierre

    into Prolog facts ended with a period: character(priam, iliad). character(hecuba, iliad). character characters male(priam). female(hecuba). male(achilles). female(andromache). male(agamemnon). female characters such as parentage: % Fathers % Mothers father(priam, hector). mother(hecuba, hector). father

  15. Individualized Data for Lab 5

    E-Print Network [OSTI]

    ahn

    9, Hansen, Sandra M. 11.15, 43, Female. 10, Kinney, Grant H. 11.1, 39, Female. 11, Kinney, Matthew J. 11.05, 40, Female. 12, LaFrancois, Sarah N. 11, 35, Male.

  16. Modulation of benzo[a]pyrene induced neurotoxicity in female mice actively immunized with a B[a]P–diphtheria toxoid conjugate

    SciTech Connect (OSTI)

    Schellenberger, Mario T.; Grova, Nathalie; Farinelle, Sophie; Willième, Stéphanie [Institute of Immunology, Centre de Recherche Public de la Santé/Laboratoire National de Santé, 20A rue Auguste Lumière, L-1950 Luxembourg, Grand-Duchy of Luxembourg (Luxembourg); Schroeder, Henri [University of Nancy, URAFPA, INRA UC340, F-54500 Vandoeuvre-lès-Nancy (France); Muller, Claude P., E-mail: claude.muller@crp-sante.lu [Institute of Immunology, Centre de Recherche Public de la Santé/Laboratoire National de Santé, 20A rue Auguste Lumière, L-1950 Luxembourg, Grand-Duchy of Luxembourg (Luxembourg)

    2013-09-01T23:59:59.000Z

    Benzo[a]pyrene (B[a]P) is a small molecular weight carcinogen and the prototype of polycyclic aromatic hydrocarbons (PAHs). While these compounds are primarily known for their carcinogenicity, B[a]P and its metabolites are also neurotoxic for mammalian species. To develop a prophylactic immune strategy against detrimental effects of B[a]P, female Balb/c mice immunized with a B[a]P–diphtheria toxoid (B[a]P–DT) conjugate vaccine were sub-acutely exposed to 2 mg/kg B[a]P and behavioral performances were monitored in tests related to learning and memory, anxiety and motor coordination. mRNA expression of the NMDA receptor (NR1, 2A and 2B subunits) involved in the above behavioral functions was measured in 5 brain regions. B[a]P induced NMDA1 expression in three (hippocampus, amygdala and cerebellum) of five brain regions investigated, and modulated NMDA2 in two of the five brain regions (frontal cortex and cerebellum). Each one of these B[a]P-effects was reversed in mice that were immunized against this PAH, with measurable consequences on behavior such as anxiety, short term learning and memory. Thus active immunization against B[a]P with a B[a]P–DT conjugate vaccine had a protective effect and attenuated the pharmacological and neurotoxic effects even of high concentrations of B[a]P. - Highlights: • B[a]P-antibodies attenuated B[a]P induced NMDA expression in several brain regions. • B[a]P had measurable consequences on anxiety, short term learning and memory. • B[a]P immunization attenuated the pharmacological and neurotoxic effects of B[a]P. • Vaccination may also provide some protection against chemical carcinogenesis.

  17. Gender Diversity in Corporate Leadership

    E-Print Network [OSTI]

    McLean, Lindsey

    2011-01-01T23:59:59.000Z

    ceiling’ and attain top leadership positions has positivehierarchy. Thus, changing leadership may be a mechanism toDiversity in Corporate Leadership RECENTLY RELEASED WORKING

  18. MAPK-ERK activation in kidney of male rats chronically fed ochratoxin A at a dose causing a significant incidence of renal carcinoma

    SciTech Connect (OSTI)

    Marin-Kuan, M. [Nestle Research Center, PO Box 44, Vers-chez-les-Blanc, CH-1000 Lausanne 26 (Switzerland)], E-mail: maricel.marin-kuan@rdls.nestle.com; Nestler, S. [Nephro-Urology Unit, Institute of Child Health, University College London, 30 Guilford Street, London WC1E 1EH (United Kingdom); Department of Environmental Science and Technology, Imperial College London, London SW7 2AZ (United Kingdom); Verguet, C.; Bezencon, C.; Piguet, D.; Delatour, T. [Nestle Research Center, PO Box 44, Vers-chez-les-Blanc, CH-1000 Lausanne 26 (Switzerland); Mantle, P. [Department of Environmental Science and Technology, Imperial College London, London SW7 2AZ (United Kingdom); Cavin, C.; Schilter, B. [Nestle Research Center, PO Box 44, Vers-chez-les-Blanc, CH-1000 Lausanne 26 (Switzerland)

    2007-10-15T23:59:59.000Z

    Kidney samples of male Fischer 344 (F-344) rats fed a carcinogenic dose of OTA over 7 days, 21 days and 12 months were analysed for various cell signalling proteins known to be potentially involved in chemical carcinogenicity. OTA was found to increase the phosphorylation of atypical-PKC. This was correlated with a selective downstream activation of the MAP-kinase extracellular regulated kinases isoforms 1 and 2 (ERK1/2) and of their substrates ELK1/2 and p90RSK. Moreover, analysis of effectors acting upstream of PKC indicated a possible mobilisation of the insulin-like growth factor-1 receptor (lGFr) and phosphoinositide-dependent kinase-1 (PDK1) system. An increased histone deacetylase (HDAC) enzymatic activity associated with enhanced HDAC3 protein expression was also observed. These findings are potentially relevant with respect to the understanding of OTA nephrocarcinogenicity. HDAC-induced gene silencing has previously been shown to play a role in tumour development. Furthermore, PKC and the MEK-ERK MAP-kinase pathways are known to play important roles in cell proliferation, cell survival, anti-apoptotic activity and renal cancer development.

  19. MALE RIO GRANDE WILD TURKEY

    E-Print Network [OSTI]

    . Jernigan5 Texas Parks and Wildlife Department, Matador Wildlife Management Area, 3036 FM 3256, Paducah, TX

  20. Jonathan Male | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious Rank EERE: Alternative Fuels Data CenterEnergyGlossary ofHomeJC3 Bulletin Archive JC3Lushetsky

  1. Table 1. Description of the 74 deaths caused by malignant neoplasms in Down syndrome population, California, January 1, 1988 December 31, 2002

    E-Print Network [OSTI]

    Paris-Sud XI, Université de

    .9) 3 Female 56.2 1989 Acute leukemia NOS (208.0) 4 Female 2.3 1990 Megakaryocytic leukemia (207.2) 5 Female 2.7 1990 Unspecified leukemia (208.9) 6 Female 3.0 1990 Acute leukemia NOS (208.0) 7 Male 36.3 1991 Acute lymphoid leukemia (204.0) 10 Male 63.2 1991 Bladder, part unspecified (188.9) 11 Female 2

  2. Sound production during courtship and spawning of Oreochromis mossambicus: malefemale and

    E-Print Network [OSTI]

    ­male interactions M. C. P. AMORIM*, P. J. FONSECA AND V. C. ALMADA* *Unidade de Investigac¸a~o em Eco-etologia. I. Only territorial males produced sounds, during male­female and male­male court- ship interactions

  3. Organ doses, effective doses, and risk indices in adult CT: Comparison of four types of reference phantoms across different examination protocols

    SciTech Connect (OSTI)

    Zhang Yakun; Li Xiang; Paul Segars, W.; Samei, Ehsan [Medical Physics Graduate Program, Duke University, Durham, North Carolina 27705 and Carl E. Ravin Advanced Imaging Laboratories, Duke University, Durham, North Carolina 27705 (United States); Carl E. Ravin Advanced Imaging Laboratories, Duke University, Durham, North Carolina 27705 and Department of Radiology, Duke University, Durham, North Carolina 27705 (United States); Medical Physics Graduate Program, Duke University, Durham, North Carolina 27705 (United States); Carl E. Ravin Advanced Imaging Laboratories, Duke University, Durham, North Carolina 27705 (United States) and Department of Radiology, Duke University, Durham, North Carolina 27705 (United States); Medical Physics Graduate Program, Duke University, Durham, North Carolina 27705 (United States); Carl E. Ravin Advanced Imaging Laboratories, Duke University, Durham, North Carolina 27705 (United States); Department of Radiology, Duke University, Durham, North Carolina 27705 (United States) and Departments of Physics, Biomedical Engineering, and Electrical and Computer Engineering, Duke University, Durham, North Carolina 27705 (United States)

    2012-06-15T23:59:59.000Z

    Purpose: Radiation exposure from computed tomography (CT) to the public has increased the concern among radiation protection professionals. Being able to accurately assess the radiation dose patients receive during CT procedures is a crucial step in the management of CT dose. Currently, various computational anthropomorphic phantoms are used to assess radiation dose by different research groups. It is desirable to better understand how the dose results are affected by different choices of phantoms. In this study, the authors assessed the uncertainties in CT dose and risk estimation associated with different types of computational phantoms for a selected group of representative CT protocols. Methods: Routinely used CT examinations were categorized into ten body and three neurological examination categories. Organ doses, effective doses, risk indices, and conversion coefficients to effective dose and risk index (k and q factors, respectively) were estimated for these examinations for a clinical CT system (LightSpeed VCT, GE Healthcare). Four methods were used, each employing a different type of reference phantoms. The first and second methods employed a Monte Carlo program previously developed and validated in our laboratory. In the first method, the reference male and female extended cardiac-torso (XCAT) phantoms were used, which were initially created from the Visible Human data and later adjusted to match organ masses defined in ICRP publication 89. In the second method, the reference male and female phantoms described in ICRP publication 110 were used, which were initially developed from tomographic data of two patients and later modified to match ICRP 89 organ masses. The third method employed a commercial dosimetry spreadsheet (ImPACT group, London, England) with its own hermaphrodite stylized phantom. In the fourth method, another widely used dosimetry spreadsheet (CT-Expo, Medizinische Hochschule, Hannover, Germany) was employed together with its associated male and female stylized phantoms. Results: For fully irradiated organs, average coefficients of variation (COV) ranged from 0.07 to 0.22 across the four male phantoms and from 0.06 to 0.18 across the four female phantoms; for partially irradiated organs, average COV ranged from 0.13 to 0.30 across the four male phantoms and from 0.15 to 0.30 across the four female phantoms. Doses to the testes, breasts, and esophagus showed large variations between phantoms. COV for gender-averaged effective dose and k factor ranged from 0.03 to 0.23 and from 0.06 to 0.30, respectively. COV for male risk index and q factor ranged from 0.06 to 0.30 and from 0.05 to 0.36, respectively; COV for female risk index and q factor ranged from 0.06 to 0.49 and from 0.07 to 0.54, respectively. Conclusions: Despite closely matched organ mass, total body weight, and height, large differences in organ dose exist due to variation in organ location, spatial distribution, and dose approximation method. Dose differences for fully irradiated radiosensitive organs were much smaller than those for partially irradiated organs. Weighted dosimetry quantities including effective dose, male risk indices, k factors, and male q factors agreed well across phantoms. The female risk indices and q factors varied considerably across phantoms.

  4. High power connection system

    DOE Patents [OSTI]

    Schaefer, Christopher E. (Warren, OH); Beer, Robert C. (Noblesville, IN); McCall, Mark D. (Youngstown, OH)

    2000-01-01T23:59:59.000Z

    A high power connection system adapted for automotive environments which provides environmental and EMI shielding includes a female connector, a male connector, and a panel mount. The female connector includes a female connector base and a snap fitted female connector cover. The male connector includes a male connector base and a snap fitted male connector cover. The female connector base has at least one female power terminal cavity for seatably receiving a respective female power terminal. The male connector base has at least one male power terminal cavity for seatably receiving a respective male power terminal. The female connector is covered by a cover seal and a conductive shroud. A pair of lock arms protrude outward from the front end of the male connector base, pass through the panel mount and interface with a lever of a lever rotatably connected to the shroud to thereby mechanically assist mating of the male and female connectors. Safety terminals in the male and female connectors provide a last-to-connect-first-to-break connection with an HVIL circuit.

  5. SelfingSelfing andand OutcrossingOutcrossing The ESS andThe ESS and HermaphroditismHermaphroditism

    E-Print Network [OSTI]

    Cruzan, Mitchell B.

    SelfingSelfing andand OutcrossingOutcrossing The ESS andThe ESS and Hermaphroditism.females. If pollen is a reward forIf pollen is a reward for pollinators.pollinators. #12;ESS ModelsESS Models Shapes by different resources.by different resources. Male Success » FemaleSuccess» Male Success » FemaleSuccess» ESS

  6. Patterns of Testosterone and Prolactin Concentrations and Reproductive Behavior of

    E-Print Network [OSTI]

    Walters, Jeffrey R.

    - centrations of testosterone (T) and prolactin (PRL) in female breeders, male breeders, and male helpers dur breeder, and male helper PRL levels did not differ and increased from the prebreeding stage through PRL declined, while female PRL continued to increase. Based on these results, we conclude

  7. Multi-institutional Quantitative Evaluation and Clinical Validation of Smart Probabilistic Image Contouring Engine (SPICE) Autosegmentation of Target Structures and Normal Tissues on Computer Tomography Images in the Head and Neck, Thorax, Liver, and Male Pelvis Areas

    SciTech Connect (OSTI)

    Zhu, Mingyao [Department of Radiation Oncology, Washington University School of Medicine, St. Louis, Missouri (United States); Bzdusek, Karl [Philips Healthcare, Fitchburg, Wisconsin (United States); Brink, Carsten [Institute of Clinical Research, University of Southern Denmark, Odense (Denmark); Laboratory of Radiation Physics, Odense University Hospital, Odense (Denmark); Eriksen, Jesper Grau [Department of Oncology, Odense University Hospital, Odense (Denmark); Hansen, Olfred [Institute of Clinical Research, University of Southern Denmark, Odense (Denmark); Department of Oncology, Odense University Hospital, Odense (Denmark); Jensen, Helle Anita [Department of Oncology, Odense University Hospital, Odense (Denmark); Gay, Hiram A.; Thorstad, Wade [Department of Radiation Oncology, Washington University School of Medicine, St. Louis, Missouri (United States); Widder, Joachim; Brouwer, Charlotte L.; Steenbakkers, Roel J.H.M.; Vanhauten, Hubertus A.M. [Department of Radiation Oncology, University Medical Center Groningen, University of Groningen, Groningen (Netherlands); Cao, Jeffrey Q.; McBrayne, Gail [London Regional Cancer Centre, Ontario (Canada); Patel, Salil H. [Department of Radiation Oncology, Rhode Island Hospital, Providence, Rhode Island (United States); Cannon, Donald M. [Department of Human Oncology, University of Wisconsin—Madison (United States); Hardcastle, Nicholas [Department of Physical Science, Peter MacCallum Cancer Centre, Melbourne (Australia); Tomé, Wolfgang A. [Montefiore Medical Center and Institute of Onco-Physics, Albert Einstein College of Medicine, Bronx, New York (United States); Guckenberg, Matthias [University of Würzburg, Department of Radiation Oncology, Würzburg (Germany); Parikh, Parag J., E-mail: pparikh@radonc.wustl.edu [Department of Radiation Oncology, Washington University School of Medicine, St. Louis, Missouri (United States)

    2013-11-15T23:59:59.000Z

    Purpose: Clinical validation and quantitative evaluation of computed tomography (CT) image autosegmentation using Smart Probabilistic Image Contouring Engine (SPICE). Methods and Materials: CT images of 125 treated patients (32 head and neck [HN], 40 thorax, 23 liver, and 30 prostate) in 7 independent institutions were autosegmented using SPICE and computational times were recorded. The number of structures autocontoured were 25 for the HN, 7 for the thorax, 3 for the liver, and 6 for the male pelvis regions. Using the clinical contours as reference, autocontours of 22 selected structures were quantitatively evaluated using Dice Similarity Coefficient (DSC) and Mean Slice-wise Hausdorff Distance (MSHD). All 40 autocontours were evaluated by a radiation oncologist from the institution that treated the patients. Results: The mean computational times to autosegment all the structures using SPICE were 3.1 to 11.1 minutes per patient. For the HN region, the mean DSC was >0.70 for all evaluated structures, and the MSHD ranged from 3.2 to 10.0 mm. For the thorax region, the mean DSC was 0.95 for the lungs and 0.90 for the heart, and the MSHD ranged from 2.8 to 12.8 mm. For the liver region, the mean DSC was >0.92 for all structures, and the MSHD ranged from 5.2 to 15.9 mm. For the male pelvis region, the mean DSC was >0.76 for all structures, and the MSHD ranged from 4.8 to 10.5 mm. Out of the 40 autocontoured structures reviews by experts, 25 were scored useful as autocontoured or with minor edits for at least 90% of the patients and 33 were scored useful autocontoured or with minor edits for at least 80% of the patients. Conclusions: Compared with manual contouring, autosegmentation using SPICE for the HN, thorax, liver, and male pelvis regions is efficient and shows significant promise for clinical utility.

  8. Cough REVIEW Open Access Epidemiology of cough in relation to China

    E-Print Network [OSTI]

    Kefang Lai; Jiayu Pan; Ruchong Chen; Baojuan Liu; Wei Luo; Nanshan Zhong

    Cough is one of the most common complaints for which patients seek medical attention. Misdiagnosis and mistreatment of cough exist commonly in China. The prevalence of acute cough caused by upper airway infection fluctuates between 9 % and 64 % in the community, for chronic cough, the prevalence>10 % in most surveys, ranging from 7.2%-33%. The common causes of chronic cough are upper airway cough syndrome (previously called as post nasal drip syndrome [PNDS]), cough variant asthma (CVA), gastroesophageal reflux related cough (GERD) and eosinophilic bronchitis (EB). There is a regional discrepancy regarding the prevalence of common causes of cough and distribution of gender among China, UK, USA, the most common cause of chronic cough in China are CVA, followed by UACS, EB and atopic cough (AC), the male is almost equal to female in numbers in China. The risk factors for cough includes cold air, smoking, environmental pollutants, noxious substances and allergens, and unreasonable diet habits.

  9. Pathways, Networks and Systems Medicine Conferences

    SciTech Connect (OSTI)

    Nadeau, Joseph H. [Pacific Northwest Research Institute] [Pacific Northwest Research Institute

    2013-11-25T23:59:59.000Z

    The 6th Pathways, Networks and Systems Medicine Conference was held at the Minoa Palace Conference Center, Chania, Crete, Greece (16-21 June 2008). The Organizing Committee was composed of Joe Nadeau (CWRU, Cleveland), Rudi Balling (German Research Centre, Brauschweig), David Galas (Institute for Systems Biology, Seattle), Lee Hood (Institute for Systems Biology, Seattle), Diane Isonaka (Seattle), Fotis Kafatos (Imperial College, London), John Lambris (Univ. Pennsylvania, Philadelphia),Harris Lewin (Univ. of Indiana, Urbana-Champaign), Edison Liu (Genome Institute of Singapore, Singapore), and Shankar Subramaniam (Univ. California, San Diego). A total of 101 individuals from 21 countries participated in the conference: USA (48), Canada (5), France (5), Austria (4), Germany (3), Italy (3), UK (3), Greece (2), New Zealand (2), Singapore (2), Argentina (1), Australia (1), Cuba (1), Denmark (1), Japan (1), Mexico (1), Netherlands (1), Spain (1), Sweden (1), Switzerland (1). With respect to speakers, 29 were established faculty members and 13 were graduate students or postdoctoral fellows. With respect to gender representation, among speakers, 13 were female and 28 were male, and among all participants 43 were female and 58 were male. Program these included the following topics: Cancer Pathways and Networks (Day 1), Metabolic Disease Networks (Day 2), Day 3 ? Organs, Pathways and Stem Cells (Day 3), and Day 4 ? Inflammation, Immunity, Microbes and the Environment (Day 4). Proceedings of the Conference were not published.

  10. Hybrid Zones: Representations of Race in Late Nineteenth-Century French Visual Culture

    E-Print Network [OSTI]

    Stringer, Rozanne McGrew

    2011-04-26T23:59:59.000Z

    In this study, I examine images of the black female and black male body and the female Spanish Gypsy by four artists ??_?? Edgar Degas, ?_??douard Manet, Fr?_??d?_??ric Bazille, and Henri de Toulouse??_???Lautrec ??_?? ...

  11. Caribbean Journal of Science, Vol. 31, No. 1-2, 65-72, 1995 Copyright 1995 College of Arts and Sciences

    E-Print Network [OSTI]

    Hedges, Blair

    collecting data as holotype; MCZ R178768 (male) and CARE 60721 (female), between Cayo Fortuna and Riito, female, Cayo Fortuna, Yateras, Guantanamo Prov., 16 March 1987, collected by Antonio Perez- Asso; CARE

  12. Journal of Chemical Ecology, Vol. 30, No. 9, September 2004 (C 2004) BEHAVIORAL ACTIVITY OF STEREOISOMERS

    E-Print Network [OSTI]

    component of the courtship stimulating, contact sex pheromone of the female German cock- roach. Although INTRODUCTION Upon contact with a mature female, sexually mature males of the German cock- roach, Blattella

  13. YEAR

    National Nuclear Security Administration (NNSA)

    8 YEAR 2013 Males 27 Females 11 YEAR 2013 SES 1 EN 05 1 EN 04 11 NN (Engineering) 8 NQ (ProfTechAdmin) 15 NU (TechAdmin Support) 2 YEAR 2013 American Indian Alaska Native Male...

  14. YEAR

    National Nuclear Security Administration (NNSA)

    96 YEAR 2013 Males 69 Females 27 YEAR 2013 SES 1 EJEK 9 EN 04 27 NN (Engineering) 26 NQ (ProfTechAdmin) 30 NU (TechAdmin Support) 3 YEAR 2013 American Indian Alaska Native Male...

  15. YEAR

    National Nuclear Security Administration (NNSA)

    31 YEAR 2013 Males 20 Females 11 YEAR 2013 SES 2 EN 04 4 NN (Engineering) 12 NQ (ProfTechAdmin) 12 NU (TechAdmin Support) 1 YEAR 2013 American Indian Alaska Native Male (AIAN,...

  16. Biosystematics of Encarsia pergandiella and Encarsia tabacivora: two cryptic species of whitefly parasitoids (Hymenoptera: Aphelinidae)

    E-Print Network [OSTI]

    Johnson, Roishene Collette

    1996-01-01T23:59:59.000Z

    and 31 male antennae did not reveal any consistent size or shape differences among the three populations. Canonical discriminant analyses of these data indicated that males are more readily differentiated morphologically than females. The light and dark...

  17. Electrical connector | OSTI, US Dept of Energy, Office of Scientific...

    Office of Scientific and Technical Information (OSTI)

    connector includes a female component having one or more receptacles, a first test receptacle, and a second test receptacle. The electrical connector also includes a male...

  18. age-related lh surge: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    RELEASE FOLLOWING STEROID MANIPULATIONS Physics Websites Summary: ) and prolactin (PRL) levels have been studied in groups of immature normal male and female Wistar rats and...

  19. Forgiving Overconfidence in Tort Law

    E-Print Network [OSTI]

    Luppi, Barbara; Parisi, Francesco

    2009-01-01T23:59:59.000Z

    Driving Ability” 18 Accident Analysis and Prevention 299–Males and Females” 23 Accident Analysis and Prevention 45–Seatbelt Usage” 17 Accident Analysis and Prevention, 119–33.

  20. Distribution and Variation of Pocket Gophers (Genus Geomys) in the Southwestern United States.

    E-Print Network [OSTI]

    Davis, William B.

    1940-01-01T23:59:59.000Z

    , constricted near middle. 5. Hind foot of females usually 34 mm., or more. in length ; premaxillary tongues terminating anterior to lacrimal proc- esses ........................................................ G. bursarius* 5l. Hind foot of females usually.... mm. or more (males 16,000 cu. mm., or more). 2. Zygomatic arches widely divergent anteriorly; hind foot of females averaging 27 mm. or more (29 mm. or more in males). 3. "Volume" of skull in females near 14,000 cu. mm.; body length averaging 231...

  1. The "Improperly Educated" Woman in British Novels, 1790-1801 

    E-Print Network [OSTI]

    Osbourne, Lacie

    2012-10-19T23:59:59.000Z

    effects of restrictive gender identities on female education. I employ feminist literary history and criticism to evaluate the participation of Elizabeth Inchbald, Mary Hays, and Maria Edgeworth in this continuing educational debate through...

  2. The "Improperly Educated" Woman in British Novels, 1790-1801

    E-Print Network [OSTI]

    Osbourne, Lacie

    2012-10-19T23:59:59.000Z

    effects of restrictive gender identities on female education. I employ feminist literary history and criticism to evaluate the participation of Elizabeth Inchbald, Mary Hays, and Maria Edgeworth in this continuing educational debate through...

  3. asian dub foundation: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Websites Summary: to the modern era. EALC 375: Women and Gender in China -- Past and Present -- An examination of changes in sex roles and in constructs of the female as...

  4. ambiental diversidade cultural: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Websites Summary: to the modern era. EALC 375: Women and Gender in China -- Past and Present -- An examination of changes in sex roles and in constructs of the female as...

  5. asian pear trees: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Websites Summary: to the modern era. EALC 375: Women and Gender in China -- Past and Present -- An examination of changes in sex roles and in constructs of the female as...

  6. Project 2012: Increasing Female Representation in Government

    E-Print Network [OSTI]

    McLean, Lindsey

    2011-01-01T23:59:59.000Z

    Slovenia Ukraine Hungary Croatia Bosnia and Herzegovina Rep.HG) Chile (HS/HG) Croatia (HG) Finland (HS) Germany (HG)

  7. WHAT'S AHEAD IN 2014 Female Uniforms

    E-Print Network [OSTI]

    . Lightweight Navy Working Uniforms Also this spring, the Navy Uniform Matters office and the Navy Clothing uniforms made of different fabrics. If the evaluations are successful, Navy leadership will determine which served as CMC. I have 22 years of continuous Navy service that includes nine ships of various platforms

  8. -PERSPECTIVES Sexual selection by cryptic female choice

    E-Print Network [OSTI]

    Bermingham, Eldredge

    de Mexico, Apartado Postal70-275,UNAM,04510Mexico,D.F.,Mexico. Events occurring within's reproductive tract, providing lubrication, sperm nutrition, pH buffering, osmotic buffering and defenses

  9. Web Appendix: The Phantom Gender Difference

    E-Print Network [OSTI]

    Sprott, Julien Clinton

    for the CPS topcoded wage data are valid, then estimates using Census and ACS data should reach essentially topcodes have been much higher than the corresponding topcodes for CPS data. Further, the ACS wage data, which covers years 2000-2007, is topcoded at 200,000, higher than the CPS topcode through 2001 and equal

  10. Varieties of Feminism German Gender Politics in

    E-Print Network [OSTI]

    Sheridan, Jennifer

    reunifica- tion and later, by European Union integration, as well as by historically established assumptions east West export Books at eweb@hawaii.edu phone North American orders: 1-800-621-2736 Order by phone, 8 the completed order form to: Stanford University Press 11030 South Langley Ave Chicago, IL 60628 P A y m e N

  11. E(Race)ing gender: Stratified identities

    E-Print Network [OSTI]

    Nguyen, Le Thuy Thi

    2000-01-01T23:59:59.000Z

    VITA 87 INTRODUCTION In October of 1991, Anita Faye Hill came forward with her story of sexual misconduct at the Senate confirmation hearings of Supreme Court nominee, Clarence Thomas. Responding to speculations about her motives for exposing Thomas...'s experience of race when the two forces intersect? In hterary circles as in legal forums, we see this complex negotiation of identity, as exemplified in Anita Hill's testimony, throughout the landscape of African American women's writings. More than fifty...

  12. F.E. S.D. Gender

    Energy Savers [EERE]

    (NON-HISPANIC) 17 4 2.1% 23.53% 100.0% 0.312 0 4 ASIAN (NON-HISPANIC) 4 2 0.5% 0.263 1 1 HISPANIC (ALLRACES) 28 8 3.5% 28.57% 82.4% 0.257 0.3738043 7 1 COMPARISON 17...

  13. Gender and Generational Change in Egypt

    E-Print Network [OSTI]

    Sieverding, Maia

    2012-01-01T23:59:59.000Z

    Secondary Schools in Egypt. San Domenico di Fiesole Italy:and Economic Growth in Egypt. ” In Explaining Growth in thein the Labor Market in Egypt. ” In The Egyptian Economy:

  14. Risk Taking and Gender in Hierarchies

    E-Print Network [OSTI]

    Scotchmer, Suzanne

    2006-01-01T23:59:59.000Z

    and Investors’ Attitudes toward Risk. ” forthcoming (2003)in attitudes toward ?nancial risk. ” Evolution and HumanGrossman. 2005a. “Sex and Risk: Experimen- tal Evidence. ” (

  15. F.E. S.D. Gender

    Office of Environmental Management (EM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742 33 1112011AT&T,OfficeEnd of Year 2010Salt |Exelon GenerationExtraction Utility792 206 26.01%

  16. F.E. S.D. Gender

    Office of Environmental Management (EM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742 33 1112011AT&T,OfficeEnd of Year 2010Salt |Exelon GenerationExtraction Utility792 206 26.01%0 0

  17. Gender and Transport | Open Energy Information

    Open Energy Info (EERE)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page onYou are now leaving Energy.gov You are now leaving Energy.gov You are8COaBulkTransmissionSitingProcess.pdf Jump1946865°,Park, Texas:Webinars/Puesta en Marcha,Geary,GenSelfand Transport

  18. Menstrual cycle effects on spatial location tasks

    E-Print Network [OSTI]

    Andrew, Sarah

    2013-02-22T23:59:59.000Z

    The relationship between menstrual cycle hormones and performance on gender-linked spatial tasks was examined in college women. Healthy women and men over the age of 18 and not taking hormonal preparations completed tasks that typically show a male...

  19. Maling af enzymatiske effekter med spektral billedanalyse

    E-Print Network [OSTI]

    metoden p°a glastal- lerkner. Projektet er udført i samarbejde med Novozymes. #12;ii #12;Forord Dette. Lyngby, 1. juli 2013 Kristian Ryder Thomsen #12;iv #12;Tak Tak til Novozymes, Technical Service

  20. Postnatal Testosterone Concentrations and Male Social Development

    E-Print Network [OSTI]

    Alexander, Gerianne M.

    2014-01-13T23:59:59.000Z

    :134–9. doi:10.1177/ 0963721412473755 5. Forest MG, Sizonenko PC, Cathiard AM, Bertrand J. Hypophysogonadal func- tion in humans during the first year of life: 1. Evidence for testicular activity in early infancy. J Clin Invest (1974) 53:819–28. doi:10....1172/JCI107621 6. Forest MG, Deperetii E, Bertrand J. Hypothalamic-pituitary-gonadal rela- tionships in man from birth to puberty. Clin Endocrinol (1976) 5:551–69. doi:10.1111/j.1365-2265.1976.tb01985.x 7. Andersson AM, Toppari J, Haavisto AM, Petersen JH...