National Library of Energy BETA

Sample records for foot miami 1a

  1. Category:Miami, FL | Open Energy Information

    Open Energy Info (EERE)

    are in this category, out of 16 total. SVFullServiceRestaurant Miami FL Florida Power & Light Co..png SVFullServiceRestauran... 77 KB SVHospital Miami FL Florida Power & Light...

  2. Miami2010_miniboone_hray.pptx

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Miami 2010 MINIBOONE ν µ ν e ν e ν µ 2008! Miami 2010 -BUFTU 3FTVMUT GSPN .JOJ#PP/& ) 3BZ H. Ray, University of Florida Miami 2010 *OUSJHVF JO 0TDJMMBUJPO 3FTVMUT .JOJ#PP/& NPUJWBUFE CZ BO PCTFSWFE FYDFTT PG F JO B CFBN -4/% FYQFSJNFOU JO T 6TFE $$2& JOUFSBDUJPO F Q è F O &YDFTT )JHIMZ DPOUSPWFSTJBM SFTVMU H. Ray, University of Florida Phys. Rev. Lett. 77:3082-3085 (1996) Phys. Rev. C 58:2489-2511 (1998) Miami 2010 -4/% UPP NBOZ NBTTFT H. Ray, University of Florida LSND

  3. Miami Dade County Resource Recovery Fac Biomass Facility | Open...

    Open Energy Info (EERE)

    Resource Recovery Fac Biomass Facility Facility Miami Dade County Resource Recovery Fac Sector Biomass Facility Type Municipal Solid Waste Location Miami-Dade County, Florida...

  4. Energy efficiency at the University of Miami

    SciTech Connect (OSTI)

    Atherton, V.; Anzoategui, F.

    1996-07-01

    The University of Miami (UM) has embarked on a very important and worthwhile mission: ``To make UM one of the most energy efficient universities in the nation by the year 2000``. In order for the University to meet this goal the authors knew they would need to take advantage of all the available technologies and address the freon issues. In June 1990 the Coral Gables Campus had five chilled Water Production Plants, each representing small independent systems serving from four to ten buildings. Because of energy conservation measures of the past, each plant had excess capacity. At that time they also had identified about 600 tons of old falling-apart air conditioning equipment. The Capital Construction Program was beginning design efforts for a new Music Recital Hall and an addition to the Law Library. With all this considered it made sense to develop a common chilled water loop to connect these plants and provide a vehicle to capitalize on available capacity. In early 1991 Florida Power and Light offered a new CILC rate with criteria that the chilled water plants met. It allowed them to produce air conditioning at 5.8 cents a kWh, compared to 7.5 cents a kWh, at the buildings. This, added to the reality of not having to maintain or replace the old systems, made this the number 1 priority project. They were convinced that this could give them a competitive edge over other institutions because it insured that they could produce air conditioning at the least cost per square foot.

  5. Miami-Dade County- Sustainable Buildings Program

    Broader source: Energy.gov [DOE]

    In 2005, the Miami-Dade Board of County Commissioners passed a resolution to incorporate sustainable building measures into county facilities. In 2007, Ordinance 07-65 created the Sustainable...

  6. West Miami, Florida: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    Hide Map This article is a stub. You can help OpenEI by expanding it. West Miami is a city in Miami-Dade County, Florida. It falls under Florida's 18th...

  7. Keeping Sustainability on Track in Miami

    Broader source: Energy.gov [DOE]

    Ajani Stewart loves his job. As Environmental Coordinator for the Office of Sustainable Initiatives in Miami, Stewart manages projects funded by a $4.7 million Energy Efficiency and Conservation Block Grant (EECBG), as well as the city's green initiatives and recycling programs.

  8. Miami International Airport stormwater NPDES plan

    SciTech Connect (OSTI)

    Perez, A.I.; Goldman, J.Z.; Schmidt, M.F.; Clark, E.E.

    1994-12-31

    Miami International Airport (MIA) is endeavoring to essentially double its traffic volume by the turn of the century. This is a great challenge since the site is already highly developed. Space, safety and other constraints make it difficult to implement conventional detention/retention stormwater practices. Other practices were evaluated to control stormwater quantity/quality, since some of the downstream bodies of water are flood-prone or environmentally sensitive.

  9. Miami Beach, Florida: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    County, Florida. It falls under Florida's 18th congressional district and Florida's 20th congressional district.12 Registered Energy Companies in Miami Beach, Florida Car...

  10. Miami-Dade County, Florida: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    in Miami-Dade County, Florida Biodiesel of South Florida LLC Biofuels Digest Cambridge Project Development Car Charging Group Inc Caribbean Energy Resources Corp ClimeCo...

  11. Archived Reference Climate Zone: 1A Miami, Florida

    Broader source: Energy.gov [DOE]

    Here you will find past versions of the commercial reference building models for existing buildings constructed before 1980, organized by building type and location. A summary ofbuilding types and climate zones is available for reference. Current versions are also available.

  12. Archived Reference Climate Zone: 1A Miami, Florida

    Broader source: Energy.gov [DOE]

    Here you will find past versions of the commercial reference building models for existing buildings constructed in or after 1980, organized by building type and location. A summary of building types and climate zones is available for reference. Current versions are also available.

  13. Breaking Ground in Miami-Dade

    Broader source: Energy.gov [DOE]

    Officials from Miami-Dade County and the U.S. Department of Energy were on hand Wednesday, October 13th to formally break ground on an innovative project that will help improve the energy efficiency of one of the county’s major water treatment facilities.   The project will upgrade and expand the existing power generation system at the water plant which generates electricity from digester gas produced at the plant.  Landfill gas, which is produced from the Solid Waste Department’s South Dade Landfill, will be collected and piped across a canal to the water plant where it will be mixed with digester gases.  By combining landfill and digester gases, the county will increase the amount of self-generated electricity, and reduce the county's consumption of electricity generated from fossil fuels.  

  14. Miami-Cass REMC- Residential Energy Efficiency Rebate Program

    Broader source: Energy.gov [DOE]

    Miami-Cass Rural Electric Membership Cooperative (MCREMC) is a member-owned electric distribution cooperative serving customers in central Indiana.  MCREMC offers energy efficiency rebates to its...

  15. Miami-Dade County- Expedited Green Buildings Process

    Broader source: Energy.gov [DOE]

    In an effort to promote environmentally sensitive design and construction, the Miami-Dade County Commissioners passed an ordinance in June 2005 to expedite the permitting process for “green”...

  16. General Merchandise 2009 TSD Miami Low Plug Load Baseline | Open...

    Open Energy Info (EERE)

    90.1 2004 Model Year 2009 IDF file http:apps1.eere.energy.govbuildingsenergyplusmodelsMiami2009TSDGeneralMerchLPLbaseline.idf XML file http:apps1.eere.energy.gov...

  17. General Merchandise 2009 TSD Miami High Plug Load 50% Energy...

    Open Energy Info (EERE)

    90.1 2004 Model Year 2009 IDF file http:apps1.eere.energy.govbuildingsenergyplusmodelsMiami2009TSDGeneralMerchHPL50percent.idf XML file http:apps1.eere.energy.gov...

  18. General Merchandise 2009 TSD Miami High Plug Load Baseline |...

    Open Energy Info (EERE)

    90.1 2004 Model Year 2009 IDF file http:apps1.eere.energy.govbuildingsenergyplusmodelsMiami2009TSDGeneralMerchHPLbaseline.idf XML file http:apps1.eere.energy.gov...

  19. Cutting Electricity Costs in Miami-Dade County, Florida

    SciTech Connect (OSTI)

    Alvarez, Carlos; Oliver, LeAnn; Kronheim, Steve; Gonzalez, Jorge; Woods-Richardson, Kathleen

    2011-01-01

    Miami-Dade County, Florida will be piping methane gas from their regional landfill to the adjacent wastewater plant to generate a significant portion of the massive facility's future electricity needs.

  20. Miami County, Ohio: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    Ohio Pleasant Hill, Ohio Potsdam, Ohio Tipp City, Ohio Troy, Ohio Union, Ohio West Milton, Ohio Retrieved from "http:en.openei.orgwindex.php?titleMiamiCounty,Ohio&oldid...

  1. Grocery 2009 TSD Miami 50% Energy Savings | Open Energy Information

    Open Energy Info (EERE)

    Savings Model Target Type ASHRAE 90.1 2004 Model Year 2009 IDF file http:apps1.eere.energy.govbuildingsenergyplusmodelsMiami2009TSDGrocery50percent.idf XML file...

  2. Cutting Electricity Costs in Miami-Dade County, Florida

    Broader source: Energy.gov [DOE]

    Miami-Dade County, Florida will be piping methane gas from their regional landfill to the adjacent wastewater plant to generate a significant portion of the massive facility's future electricity...

  3. Grocery 2009 TSD Miami Baseline | Open Energy Information

    Open Energy Info (EERE)

    Jump to: navigation, search Model Name Grocery 2009 TSD Miami Baseline Building Type Food Sales Model Type Baseline Model Target Type ASHRAE 90.1 2004 Model Year 2009 IDF file...

  4. New Miami, Ohio: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    This article is a stub. You can help OpenEI by expanding it. New Miami is a village in Butler County, Ohio. It falls under Ohio's 8th congressional district.12 References ...

  5. Cutting Electricity Costs in Miami-Dade County, Florida

    ScienceCinema (OSTI)

    Alvarez, Carlos; Oliver, LeAnn; Kronheim, Steve; Gonzalez, Jorge; Woods-Richardson, Kathleen;

    2013-05-29

    Miami-Dade County, Florida will be piping methane gas from their regional landfill to the adjacent wastewater plant to generate a significant portion of the massive facility's future electricity needs.

  6. Miami-Cass County Rural E M C | Open Energy Information

    Open Energy Info (EERE)

    Name: Miami-Cass County Rural E M C Place: Indiana Phone Number: 765-473-6668 or toll free 800-844-6668 Website: www.mcremc.coop Twitter: @MiamiCassREMC Outage Hotline:...

  7. Energy conservation at The University of Miami

    SciTech Connect (OSTI)

    Atherton, V.; Anzoategui, F.

    1995-06-01

    The University of Miami (UM) has embarked on a very important and worthwhile mission: {open_quotes}To make UM one of the most energy efficient Universities in the Nation by the year 2000.{close_quotes} In order for the University to meet this goal we knew we would need to take advantage of all the available technologies and address the freon issues. In June 1990 the Coral Gables Campus had five chilled Water Production Plants, each representing small independent systems serving from four to ten buildings. Because of energy conservation measures of the past (i.e. elimination, reheat, first generation lighting retrofits, and some diversity), each plant had excess capacity. At that time we also had identified about 600 tons of old falling apart air conditioning equipment. Our Capital Construction Program was beginning design efforts for a new Music Recital Hall and an addition to the Law Library. With all this considered it made sense to develop a common chilled water loop to connect these plants and provide a vehicle to capitalize on available capacity. As this concept took shape it became evident that a master chilled water loop encircling the entire campus would address the next 20 years of campus development. This 20 year plan would require various phases of development. Phase I would connect three chilled water production plants and enable us to supply chilled water to seven existing facilities with approximately 600 tons of old inefficient air conditioning equipment and supply chilled water to the new Law and Music facilities, (approximately 400 tons) without buying any additional chillers.

  8. NREL: Transportation Research - Miami-Dade County Hydraulic Hybrid Refuse

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Truck Testing Miami-Dade County Hydraulic Hybrid Refuse Truck Testing Photo of garbage truck with view of lake and city in background. As part of its overall strategy to reduce emissions and fuel use, Miami-Dade County currently operates 35 hydraulic hybrid refuse vehicles, with 29 more on order. Photo courtesy of Parker Hannifin NREL is evaluating the in-service performance of 10 next-generation (model year 2015) hydraulic hybrid refuse vehicles (HHVs), 8 previous-generation (model year

  9. EECBG Success Story: Keeping Sustainability on Track in Miami

    Broader source: Energy.gov [DOE]

    As Environmental Coordinator for the Office of Sustainable Initiatives in Miami, Ajani Stewart manages projects funded by a $4.7 million Energy Efficiency and Conservation Block Grant (EECBG), as well as the city's green initiatives and recycling programs. Learn more.

  10. EECBG Success Story: Breaking Ground in Miami-Dade

    Broader source: Energy.gov [DOE]

    Officials from Miami-Dade County and the U.S. Department of Energy were on hand Wednesday, October 13th to formally break ground on an innovative project that will help improve the energy efficiency of one of the county’s major water treatment facilities. Learn more.

  11. How Miami, Florida is Turning Waste Into Cash | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Miami, Florida is Turning Waste Into Cash How Miami, Florida is Turning Waste Into Cash April 7, 2011 - 3:43pm Addthis Miami-Dade officials talk about using EECBG grant funds for their Methane Sequestration Project. April Saylor April Saylor Former Digital Outreach Strategist, Office of Public Affairs What does this project do? Methane gas captured from a landfill will provide 30 percent of the electricity used at an adjacent wastewater plant. The project will upgrade and expand the existing

  12. General Merchandise 2009 TSD Miami Low Plug Load 50% Energy Savings...

    Open Energy Info (EERE)

    90.1 2004 Model Year 2009 IDF file http:apps1.eere.energy.govbuildingsenergyplusmodelsMiami2009TSDGeneralMerchLPL50percent.idf XML file http:apps1.eere.energy.gov...

  13. EECBG Success Story: How Miami, Florida is Turning Waste Into Cash

    Broader source: Energy.gov [DOE]

    In Miami, Florida, methane gas captured from a regional landfill will be used to provide 30 percent of the electricity used at an adjacent regional wastewater plant. Learn more.

  14. foote-98.pdf

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Automated Weather Balloon Radiosonde Launcher Development J. P. Foote, J. T. Lineberry, and B. R. Thompson ERC, Incorporated Tullahoma, Tennessee Introduction Balloon-borne radiosondes are a primary means used by the Atmospheric Radiation Measurement (ARM) Program to collect atmospheric data. Currently, three radiosondes are launched daily from the Central Facility at the ARM Southern Great Plains (SGP) Cloud and Radiation Testbed (CART) site during non-intensive observation periods (IOPs).

  15. Reference Buildings by Climate Zone and Representative City: 1A Miami, Florida

    Broader source: Energy.gov [DOE]

    In addition to the ZIP file for each building type, you can directly view the "scorecard" spreadsheet that summarizes the inputs and results for each location. This Microsoft Excel spreadsheet is also included in the ZIP file. For version 1.4, only the IDF file is included.

  16. Brad Foote Gear Works | Open Energy Information

    Open Energy Info (EERE)

    Brad Foote Gear Works Jump to: navigation, search Name: Brad Foote Gear Works Place: Cicero, Illinois Zip: 60804-1404 Sector: Wind energy Product: Gearing systems manufacturer...

  17. Electrofishing survey of the Great Miami River. Annual report, September 1993

    SciTech Connect (OSTI)

    Stocker, L.E.; Miller, M.C.; Engman, J.; Evans, R.L.; Koch, R.W.; Brence, W.A.

    1994-01-01

    Fish sampling by electroshocking in the Great Miami River above and below the Fernald sit was designed to determine changes in the health of the fish community compared to the previous nine years and to collect samples for uranium analysis in fish filets. This document contains information describing the findings of this program. Topics discussed include: physical and chemical parameters, species richness, species diversity, and water analysis.

  18. SmallFoot LLC | Open Energy Information

    Open Energy Info (EERE)

    SmallFoot LLC Place: Boulder, Colorado Product: Colorado-based developer of wireless demand control devices for the small commercial market. References: SmallFoot LLC1 This...

  19. Weigh-in-motion scale with foot alignment features

    DOE Patents [OSTI]

    Abercrombie, Robert Knox; Richardson, Gregory David; Scudiere, Matthew Bligh

    2013-03-05

    A pad is disclosed for use in a weighing system for weighing a load. The pad includes a weighing platform, load cells, and foot members. Improvements to the pad reduce or substantially eliminate rotation of one or more of the corner foot members. A flexible foot strap disposed between the corner foot members reduces rotation of the respective foot members about vertical axes through the corner foot members and couples the corner foot members such that rotation of one corner foot member results in substantially the same amount of rotation of the other corner foot member. In a strapless variant one or more fasteners prevents substantially all rotation of a foot member. In a diagonal variant, a foot strap extends between a corner foot member and the weighing platform to reduce rotation of the foot member about a vertical axis through the corner foot member.

  20. Electrofishing survey of the Great Miami River, September 1992. Annual report

    SciTech Connect (OSTI)

    Miller, M.C.; Bixby, R.; Engman, J.; Ross, L.; Stocker, L.

    1993-03-01

    At the end of summer in 1992 the fishery of the Great Miami River took an unexpected deviation from the stasis of past years as an intense suspended algal bloom decreased the compositional diversity found at the lower GMR stations. Daytime supersaturation of oxygen and elevated pHs, reaching 9 by midday during the month of August, undoubtedly caused severe deficits of oxygen at night. Despite the aeration at every riffle, the intensities of the biological processes in the water were sufficient to cause very high positive and negative excursions of oxygen over the day and night cycle. This report documents a fish harvest that was conducted as part of the oxygen excess/deficit study.

  1. Electrofishing survey of the Great Miami River. Annual report, September 7, 1995--September 8, 1995

    SciTech Connect (OSTI)

    Evans, R.L.; Miller, M.C.; Moller, B.J.; Marsh, S.L.

    1996-03-01

    Fish were collected, using electroshocking techniques, from three sites in the Great Miami River (GMR) (September 7 and 8, 1995) as part of an annual survey for Fernald Environmental Restoration Management Corporation (FERMCO). The objective was to collect fish fillets for uranium analysis and examine the health of the fish community in comparison to data collected during the past eleven years. Samples were taken from upstream (river mile = RM; RM 38) and downstream (RM 19) of the Fernald site as well as from near the Fernald effluent line (RM 24). RM 38 is isolated from upstream fish migration by two dams located near Hamilton, Ohio and fish collected from this site should not be influenced by processes at the downstream sites. Samples of 549 fish from 29 species belonging to nine families provided seventy-two samples for uranium analysis by an independent laboratory. Chemical analysis of water samples collected at each site was used to determine the effect of chemical parameters on the fish community. This study focused on comparison of the density, biomass and diversity of the fish community between sites and between years.

  2. Electrofishing survey of the Great Miami River, September 17--18, 1996. Annual report

    SciTech Connect (OSTI)

    Moller, B.; Miller, M.C.; Buschelmann, F.; Evans, R.L.

    1996-12-31

    The electrofishing survey of fish from the Great Miami River at RM 19, 24 and 38 from late summer 1996 demonstrated the sensitivity of the fish community to microhabitat variation. The variation was particularly clear between the pooled, low flow sections of the river and the runs, where fast current habitats occurred. In 1996, like most recent years, the differences were obvious between Rm 24 and RM 19 and RM 38. River Mile 24 was characterized by a fish community of current-loving fish, dominated by Catastomidae (suckers), and Ictaluridae (catfish). In contrast, samples from pooled stations at RM 19 and 38 were dominated by Centrarchidae, Clupeidae and Cyprinidae, particularly the carp. The microhabitats sampled around the abutments of bridges at RM 19 and 38 where fast current and physical structure occurred, both resembled the community at RM 24. Changes in the fish communities associated with the upstream/downstream changes in stream volume, channel size, morphology, etc., were evidenced by the community coefficients which showed least similarity between the most distant sites.

  3. Settlement of footing on compacted ash bed

    SciTech Connect (OSTI)

    Ramasamy, G.; Pusadkar, S.S.

    2007-11-15

    Compacted coal ash fills exhibit capillary stress due to contact moisture and preconsolidation stress due to the compaction process. As such, the conventional methods of estimating settlement of footing on cohesionless soils based on penetration tests become inapplicable in the case of footings on coal ash fills, although coal ash is also a cohesionless material. Therefore, a method of estimating load-settlement behavior of footings resting on coal ash fills accounting for the effect of capillary and preconsolidation stresses is presented here. The proposed method has been validated by conducting plate load tests on laboratory prepared compacted ash beds and comparing the observed and predicted load-settlement behavior. Overestimation of settlement greater than 100% occurs when capillary and preconsolidation stresses are not accounted for, as is the case in conventional methods.

  4. Foote Creek Rim II Wind Farm | Open Energy Information

    Open Energy Info (EERE)

    II Wind Farm Jump to: navigation, search Name Foote Creek Rim II Wind Farm Facility Foote Creek Rim II Sector Wind energy Facility Type Commercial Scale Wind Facility Status In...

  5. Foote Creek Rim Wind Farm | Open Energy Information

    Open Energy Info (EERE)

    Edit History Foote Creek Rim Wind Farm Jump to: navigation, search The Foote Creek Rim Wind Farm is in Carbon County, Wyoming. It consists of 133 turbines and has a total...

  6. Electrofishing survey of the Great Miami River, September 1994 Annual Report

    SciTech Connect (OSTI)

    Stocker, L.E.; Miller, M.C.; Evans, R.L.; Koch, R.W.

    1995-01-01

    Fish sampling by electroshocking in the Great Miami River upstream and downstream the Fernald site (September 25 and 26, 1994) was designed to determine changes in the health of the fish community compared to the previous ten years and to collect samples for uranium analyses in fish fillets. Samples of 853 fish, from 27 species, eight families and three sites at river mile (RM) 38, RM 24, and RM 19 provided seventy-eight samples for uranium analyses by an independent laboratory. The biomass of fish caught per hour was greatest at RM 24 > RM 19 > RM 3 8. The diversity index and the heaviest fish community was RM 24 > RM 38 > RM 19. The pooled site at RM 38 near Hamilton was diagnostically separated from the other sites by the young-of-the-year (YOY) golden redhorse, smallmouth bass and golden shiner. The darns at Hamilton acted as an effective barrier against fish migration upriver. Larger freshwater drum, gizzard shad, channel catfish and flathead catfish, which might be expected in rapid current reaches of mid-sized rivers characterize RM 24. The pool at RM 19 was distinguished from the others by YOY gizzard shad, bluegill, and longear sunfish. Thus the fish community in 1994 was separated ecologically by the physical features of the habitat more than by water quality differences between sites. These data suggest that the Fernald effluents in September were having no detectable effects on the distribution of fishes, independent of changes in habitat quality separated on physical attributes of the river channel at each site.

  7. U.S. Real Cost per Foot of Crude Oil, Natural Gas, and Dry Wells...

    Annual Energy Outlook [U.S. Energy Information Administration (EIA)]

    Foot of Crude Oil, Natural Gas, and Dry Wells Drilled (Dollars per Foot) U.S. Real Cost per Foot of Crude Oil, Natural Gas, and Dry Wells Drilled (Dollars per Foot) Decade Year-0...

  8. U.S. Nominal Cost per Foot of Crude Oil Wells Drilled (Dollars...

    Gasoline and Diesel Fuel Update (EIA)

    Oil Wells Drilled (Dollars per Foot) U.S. Nominal Cost per Foot of Crude Oil Wells Drilled (Dollars per Foot) Decade Year-0 Year-1 Year-2 Year-3 Year-4 Year-5 Year-6 Year-7 Year-8...

  9. U.S. Nominal Cost per Foot of Crude Oil, Natural Gas, and Dry...

    Gasoline and Diesel Fuel Update (EIA)

    Oil, Natural Gas, and Dry Wells Drilled (Dollars per Foot) U.S. Nominal Cost per Foot of Crude Oil, Natural Gas, and Dry Wells Drilled (Dollars per Foot) Decade Year-0 Year-1...

  10. U.S. Nominal Cost per Foot of Natural Gas Wells Drilled (Dollars...

    Gasoline and Diesel Fuel Update (EIA)

    Natural Gas Wells Drilled (Dollars per Foot) U.S. Nominal Cost per Foot of Natural Gas Wells Drilled (Dollars per Foot) Decade Year-0 Year-1 Year-2 Year-3 Year-4 Year-5 Year-6...

  11. DOE - Office of Legacy Management -- Foote Mineral Co - PA 27

    Office of Legacy Management (LM)

    Foote Mineral Co - PA 27 FUSRAP Considered Sites Site: Foote Mineral Co. (PA.27 ) Eliminated from further consideration under FUSRAP Designated Name: Not Designated Alternate Name: None Location: Exton , Pennsylvania PA.27-1 Evaluation Year: 1987 PA.27-1 Site Operations: Processed rare earth, principally zirconium and monazite sand was processed on a pilot-plant scale. PA.27-2 Site Disposition: Eliminated - Limited quantity of material handled - Potential for contamination considered remote

  12. U.S. Nominal Cost per Foot of Dry Wells Drilled (Dollars per...

    Annual Energy Outlook [U.S. Energy Information Administration (EIA)]

    Dry Wells Drilled (Dollars per Foot) U.S. Nominal Cost per Foot of Dry Wells Drilled (Dollars per Foot) Decade Year-0 Year-1 Year-2 Year-3 Year-4 Year-5 Year-6 Year-7 Year-8 Year-9...

  13. Airborne spread of foot-and-mouth disease - model intercomparison

    SciTech Connect (OSTI)

    Gloster, J; Jones, A; Redington, A; Burgin, L; Sorensen, J H; Turner, R; Dillon, M; Hullinger, P; Simpson, M; Astrup, P; Garner, G; Stewart, P; D'Amours, R; Sellers, R; Paton, D

    2008-09-04

    Foot-and-mouth disease is a highly infectious vesicular disease of cloven-hoofed animals caused by foot-and-mouth disease virus. It spreads by direct contact between animals, by animal products (milk, meat and semen), by mechanical transfer on people or fomites and by the airborne route - with the relative importance of each mechanism depending on the particular outbreak characteristics. Over the years a number of workers have developed or adapted atmospheric dispersion models to assess the risk of foot-and-mouth disease virus spread through the air. Six of these models were compared at a workshop hosted by the Institute for Animal Health/Met Office during 2008. A number of key issues emerged from the workshop and subsequent modelling work: (1) in general all of the models predicted similar directions for 'at risk' livestock with much of the remaining differences strongly related to differences in the meteorological data used; (2) determination of an accurate sequence of events is highly important, especially if the meteorological conditions vary substantially during the virus emission period; and (3) differences in assumptions made about virus release, environmental fate, and subsequent infection can substantially modify the size and location of the downwind risk area. Close relationships have now been established between participants, which in the event of an outbreak of disease could be readily activated to supply advice or modelling support.

  14. Evaluation of Confining Layer Integrity Beneath the South District Wastewater Treatment Plant, Miami-Dade Water and Sewer Department, Dade County, Florida

    SciTech Connect (OSTI)

    Starr, R.C.; Green, T.S.; Hull, L.C.

    2001-02-28

    A review has been performed of existing information that describes geology, hydrogeology, and geochemistry at the South District Wastewater Treatment Plant, which is operated by the Miami-Dade Water and Sewer Department, in Dade County, Florida. Treated sanitary wastewater is injected into a saline aquifer beneath the plant. Detection of contaminants commonly associated with treated sanitary wastewater in the freshwater aquifer that overlies the saline aquifer has indicated a need for a reevaluation of the ability of the confining layer above the saline aquifer to prevent fluid migration into the overlying freshwater aquifer. Review of the available data shows that the geologic data set is not sufficient to demonstrate that a competent confining layer is present between the saline and freshwater aquifers. The hydrogeologic data also do not indicate that a competent confining layer is present. The geochemical data show that the freshwater aquifer is contaminated with treated wastewater, and the spatial patterns of contamination are consistent with upward migration through localized conduits through the Middle Confining Unit, such as leaking wells or natural features. Recommendations for collection and interpretation of additional site characterization data are provided.

  15. Evaluation of Confining Layer Integrity Beneath the South District Wastewater Treatment Plant, Miami-Dade Water and Sewer Department, Dade County, Florida

    SciTech Connect (OSTI)

    Starr, Robert Charles; Green, Timothy Scott; Hull, Laurence Charles

    2001-02-01

    A review has been performed of existing information that describes geology, hydrogeology, and geochemistry at the South District Wastewater Treatment Plant, which is operated by the Miami-Dade Water and Sewer Department, in Dade County, Florida. Treated sanitary wastewater is injected into a saline aquifer beneath the plant. Detection of contaminants commonly associated with treated sanitary wastewater in the freshwater aquifer that overlies the saline aquifer has indicated a need for a reevaluation of the ability of the confining layer above the saline aquifer to prevent fluid migration into the overlying freshwater aquifer. Review of the available data shows that the geologic data set is not sufficient to demonstrate that a competent confining layer is present between the saline and freshwater aquifers. The hydrogeologic data also do not indicate that a competent confining layer is present. The geochemical data show that the freshwater aquifer is contaminated with treated wastewater, and the spatial patterns of contamination are consistent with upward migration through localized conduits through the Middle Confining Unit, such as leaking wells or natural features. Recommendations for collection and interpretation of additional site characterization data are provided.

  16. U1A Complex

    ScienceCinema (OSTI)

    None

    2015-01-09

    Some of the most sophisticated experiments in the stockpile stewardship program are conducted in an environmentally safe manner, nearly 1000 feet below the ground at the site. The U1a complex a sprawling underground laboratory and tunnel complex is home to a number of unique capabilities.

  17. Forty-Six-Foot Tall Needle Sculpture Rises Over Arts Quad > EMC2...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Section EMC2 News Archived News Stories Forty-Six-Foot Tall Needle Sculpture Rises Over Arts Quad September 14th, 2014 By ANUSHKA MEHROTRA Students walking around campus this...

  18. Multi-Axis Foot Reaction Force/Torque Sensor for Biomedical Applications

    Office of Scientific and Technical Information (OSTI)

    (Conference) | SciTech Connect Conference: Multi-Axis Foot Reaction Force/Torque Sensor for Biomedical Applications Citation Details In-Document Search Title: Multi-Axis Foot Reaction Force/Torque Sensor for Biomedical Applications No abstract prepared. Authors: Lind, Randall F [1] ; Love, Lonnie J [1] ; Rowe, John C [1] ; Pin, Francois G [1] + Show Author Affiliations ORNL [ORNL Publication Date: 2009-01-01 OSTI Identifier: 966106 DOE Contract Number: DE-AC05-00OR22725 Resource Type:

  19. Type B Accident Investigation Board Report BNFL, Inc. Employee Foot Injury

    Energy Savers [EERE]

    on December 17, 2003, at the East Tennessee Technology Park Building K-31 | Department of Energy BNFL, Inc. Employee Foot Injury on December 17, 2003, at the East Tennessee Technology Park Building K-31 Type B Accident Investigation Board Report BNFL, Inc. Employee Foot Injury on December 17, 2003, at the East Tennessee Technology Park Building K-31 February 1, 2004 On December 17, 2003, at approximately 7:15 a.m., an accident occurred at the U.S. Department of Energy (DOE) East Tennessee

  20. The high-foot implosion campaign on the National Ignition Facility

    SciTech Connect (OSTI)

    Hurricane, O. A. Callahan, D. A.; Casey, D. T.; Dewald, E. L.; Dittrich, T. R.; Dppner, T.; Barrios Garcia, M. A.; Hinkel, D. E.; Berzak Hopkins, L. F.; Kervin, P.; Pape, S. Le; Ma, T.; MacPhee, A. G.; Milovich, J. L.; Moody, J.; Pak, A. E.; Patel, P. K.; Park, H.-S.; Remington, B. A.; Robey, H. F.; and others

    2014-05-15

    The High-Foot platform manipulates the laser pulse-shape coming from the National Ignition Facility laser to create an indirect drive 3-shock implosion that is significantly more robust against instability growth involving the ablator and also modestly reduces implosion convergence ratio. This strategy gives up on theoretical high-gain in an inertial confinement fusion implosion in order to obtain better control of the implosion and bring experimental performance in-line with calculated performance, yet keeps the absolute capsule performance relatively high. In this paper, we will cover the various experimental and theoretical motivations for the high-foot drive as well as cover the experimental results that have come out of the high-foot experimental campaign. At the time of this writing, the high-foot implosion has demonstrated record total deuterium-tritium yields (9.310{sup 15}) with low levels of inferred mix, excellent agreement with implosion simulations, fuel energy gains exceeding unity, and evidence for the bootstrapping associated with alpha-particle self-heating.

  1. Sheet1 Water Availability Metric (Acre-Feet/Yr) Water Cost Metric ($/Acre-Foot)

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Sheet1 Water Availability Metric (Acre-Feet/Yr) Water Cost Metric ($/Acre-Foot) Current Water Use (Acre-Feet/Yr) Projected Use in 2030 (Acre-Feet/Yr) HUC_8 STATE BASIN SUBBASIN UNAPPROPRIATED SURFACE WATER METRIC UNAPPROPRIATED GROUNDWATER METRIC APPROPRIATED WATER METRIC BRACKISH GROUNDWATER METRIC WASTEWATER METRIC UNAPPROPRIATED GROUNDWATER COST METRIC APPROPRIATED WATER COST METRIC BRACKISH GROUNDWATER COST METRIC WASTEWATER COST METRIC M&I_2012 AG_2012 ENVIRONMENT 2012 THERMOELECTIC

  2. Three-Dimensional Rotational Angiography of the Foot in Critical Limb Ischemia: A New Dimension in Revascularization Strategy

    SciTech Connect (OSTI)

    Jens, Sjoerd; Lucatelli, Pierleone; Koelemay, Mark J. W.; Marquering, Henk A. Reekers, Jim A.

    2013-06-15

    Purpose. To evaluate the additional value of three-dimensional rotational angiography (3DRA) of the foot compared with digital subtraction angiography (DSA) in patients with critical limb ischemia (CLI). Technique. For 3DRA, the C-arm was placed in the propeller position with the foot in an isocentric position. The patient's unaffected foot was positioned in a footrest outside the field of view. For correct timing of 3DRA, the delay from contrast injection in the popliteal artery at the level of knee joint to complete pedal arterial enhancement was assessed using DSA. With this delay, 3DRA was started after injection of 15 ml contrast. Imaging of the 3DRA could directly be reconstructed and visualized.Materials and MethodsPatients undergoing 3DRA of the foot were prospectively registered. DSA and 3DRA images were scored separately for arterial patency and presence of collaterals. Treatment strategies were proposed based on DSA with and without the availability of 3DRA. Results. Eleven patients underwent 3DRA of the foot. One 3DRA was not included because the acquisition was focused on the heel instead of the entire foot. Diagnostic quality of 3DRA was good in all ten patients. 3DRA compared with DSA showed additional patent arteries in six patients, patent plantar arch in three patients, and collaterals between the pedal arteries in five patients. Additional information from 3DRA resulted in a change of treatment strategy in six patients. Conclusion, 3DRA of the foot contains valuable additional real-time information to better guide peripheral vascular interventions in patients with CLI and nonhealing tissue lesions.

  3. Th1A.2.pdf

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Th1A.2.pdf OFC 2015 © OSA 2015 WAN Virtualization and Dynamic End-to-End Bandwidth Provisioning Using SDN Adrian Lara 1 , Byrav Ramamurthy 1 , Eric Pouyoul 2 and Inder Monga 2 1 University of Nebraska-Lincoln, Lincoln NE 68504 {alara,byrav}@cse.unl.edu 2 Energy Science Network, Lawrence Berkeley National Laboratory, Berkeley CA 94720 {lomax,imonga}@es.net Abstract: We evaluate a WAN-virtualization framework in terms of delay and scalability and demonstrate that adding a virtual layer between

  4. Foot Drop after Ethanol Embolization of Calf Vascular Malformation: A Lesson on Nerve Injury

    SciTech Connect (OSTI)

    Tay, Vincent Khwee-Soon; Mohan, P. Chandra; Liew, Wendy Kein Meng; Mahadev, Arjandas; Tay, Kiang Hiong

    2013-08-01

    Ethanol is often used in sclerotherapy to treat vascular malformations. Nerve injury is a known complication of this procedure. However, the management of this complication is not well described in literature. This case describes a 10-year-old boy with a slow flow vascular malformation in the right calf who underwent transarterial ethanol embolization following prior unsuccessful direct percutaneous sclerotherapy. The development of a dense foot drop that subsequently recovered is described, and the management of this uncommon but distressful complication is discussed.

  5. Multiplexed Molecular Assays for Rapid Rule-Out of Foot-and-Mouth Disease

    SciTech Connect (OSTI)

    Lenhoff, R; Naraghi-Arani, P; Thissen, J; Olivas, J; Carillo, C; Chinn, C; Rasmussen, M; Messenger, S; Suer, L; Smith, S M; Tammero, L; Vitalis, E; Slezak, T R; Hullinger, P J; Hindson, B J; Hietala, S; Crossley, B; Mcbride, M

    2007-06-26

    A nucleic acid-based multiplexed assay was developed that combines detection of foot-and-mouth disease virus (FMDV) with rule-out assays for two other foreign animal diseases and four domestic animal diseases that cause vesicular or ulcerative lesions indistinguishable from FMDV infection in cattle, sheep and swine. The FMDV 'look-alike' diagnostic assay panel contains five PCR and twelve reverse transcriptase PCR (RT-PCR) signatures for a total of seventeen simultaneous PCR amplifications for seven diseases plus incorporating four internal assay controls. It was developed and optimized to amplify both DNA and RNA viruses simultaneously in a single tube and employs Luminex{trademark} liquid array technology. Assay development including selection of appropriate controls, a comparison of signature performance in single and multiplex testing against target nucleic acids, as well of limits of detection for each of the individual signatures is presented. While this assay is a prototype and by no means a comprehensive test for FMDV 'look-alike' viruses, an assay of this type is envisioned to have benefit to a laboratory network in routine surveillance and possibly for post-outbreak proof of freedom from foot-and-mouth disease.

  6. Climate Zone 1A | Open Energy Information

    Open Energy Info (EERE)

    A. Climate Zone 1A is defined as Very Hot - Humid with IP Units 9000 < CDD50F and SI Units 5000 < CDD10C . The following places are categorized as class 1A climate zones:...

  7. Miami Gasoline and Diesel Retail Prices

    U.S. Energy Information Administration (EIA) Indexed Site

    All Grades - Conventional Areas 2.396 2.402 2.384 2.435 2.425 2.531 2003-2016 Regular 2.236 2.243 2.217 2.278 2.266 2.371 2003-2016 Conventional Areas 2.236 2.243 2.217 2.278 2.266 ...

  8. Miami Power Corporation | Open Energy Information

    Open Energy Info (EERE)

    Data Utility Id 12323 Utility Location Yes Ownership I NERC Location RFC NERC RFC Yes ISO MISO Yes Activity Transmission Yes This article is a stub. You can help OpenEI by...

  9. Miami, Florida: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    of South Florida LLC Biofuels Digest Cambridge Project Development Caribbean Energy Resources Corp ClimeCo Corporation Electron Solar Energy Formerly Envigra Inc Enventure...

  10. ARM - Campaign Instrument - mmcr94miami

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    MArine Stratus Radiation Aerosol and Drizzle (MASRAD) IOP Download Data Point Reyes CA, USA; Mobile Facility, 2005.03.14 - 2005.09.14 Spring Cloud IOP Download Data ...

  11. Condition Assessment Survey (CAS) Program. Deficiency standards and inspections methods manual: Volume 1, 0.01 Foundations and footings

    SciTech Connect (OSTI)

    Not Available

    1993-05-01

    General information is presented for asset determinant factor/CAS repair codes/CAS cost factors; guide sheet tool & material listing; testing methods; inspection frequency; standard system design life tables; system work breakdown structure; and general system/material data. Deficiency standards and inspection methods are given for footings - spread/strip/grade beams; foundation walls; foundation dampproofing/waterproofing; excavation/backfill/ and piles & caissons.

  12. Buildings Energy Data Book: 3.10 Hotels/Motels

    Buildings Energy Data Book [EERE]

    5 Energy Benchmarks for Newly Constructed Large Hotels, by Selected City and End-Use (thousand Btu per square foot) Miami 1A Houston 2A Phoenix 2B Atlanta 3A Los Angeles 3B Las Vegas 3B San Francisco 3C Baltimore 4A Albuquerque 4B Seattle 4C Chicago 5A Boulder 5B Minneapolis 6A Helena 6B Duluth 7 Fairbanks 8 Note(s): Source(s): 60.9 13.2 76.3 8.4 Commercial building energy benchmarks are based off of the current stock of commercial buildings and reflect 2004 ASHRAE 90.1 Climate Zones. They are

  13. Buildings Energy Data Book: 3.10 Hotels/Motels

    Buildings Energy Data Book [EERE]

    6 Energy Benchmarks for Newly Constructed Small Hotels, by Selected City and End-Use (thousand Btu per square foot) Miami 1A Houston 2A Phoenix 2B Atlanta 3A Los Angeles 3B Las Vegas 3B San Francisco 3C Baltimore 4A Albuquerque 4B Seattle 4C Chicago 5A Boulder 5B Minneapolis 6A Helena 6B Duluth 7 Fairbanks 8 Note(s): Source(s): 36.6 2.7 12.0 3.9 Commercial building energy benchmarks are based off of the current stock of commercial buildings and reflect 2004 ASHRAE 90.1 Climate Zones. They are

  14. Buildings Energy Data Book: 3.6 Office Building Markets and Companies

    Buildings Energy Data Book [EERE]

    1 Energy Benchmarks for Newly Constructed Medium Office Buildings, by Selected City and End-Use (thousand Btu per square foot) Miami 1A Houston 2A Phoenix 2B Atlanta 3A Los Angeles 3B Las Vegas 3B San Francisco 3C Baltimore 4A Albuquerque 4B Seattle 4C Chicago 5A Boulder 5B Minneapolis 6A Helena 6B Duluth 7 Fairbanks 8 Note(s): Source(s): 38.6 0.9 0.8 1.1 Commercial building energy benchmarks are based off of the current stock of commercial buildings and reflect 2004 ASHRAE 90.1 Climate Zones.

  15. Buildings Energy Data Book: 3.6 Office Building Markets and Companies

    Buildings Energy Data Book [EERE]

    9 Energy Benchmarks for Newly Constructed Large Office Buildings, by Selected City and End-Use (thousand Btu per square foot) Miami 1A Houston 2A Phoenix 2B Atlanta 3A Los Angeles 3B Las Vegas 3B San Francisco 3C Baltimore 4A Albuquerque 4B Seattle 4C Chicago 5A Boulder 5B Minneapolis 6A Helena 6B Duluth 7 Fairbanks 8 Note(s): Source(s): 31.7 1.7 0.6 1.3 Commercial building energy benchmarks are based off of the current stock of commercial buildings and reflect 2004 ASHRAE 90.1 Climate Zones.

  16. Buildings Energy Data Book: 3.7 Retail Markets and Companies

    Buildings Energy Data Book [EERE]

    6 Energy Benchmarks for Newly Constructed Retail Buildings, by Selected City and End-Use (thousand Btu per square foot) IECC Climate Zone Miami 1A Houston 2A Phoenix 2B Atlanta 3A Los Angeles 3B Las Vegas 3B San Francisco 3C Baltimore 4A Albuquerque 4B Seattle 4C Chicago 5A Boulder 5B Minneapolis 6A Helena 6B Duluth 7 Fairbanks 8 Note(s): Source(s): 108.9 0.1 9.4 Commercial building energy benchmarks are based off of the current stock of commercial buildings and reflect 2004 ASHRAE 90.1 Climate

  17. Buildings Energy Data Book: 3.7 Retail Markets and Companies

    Buildings Energy Data Book [EERE]

    8 Energy Benchmarks for Newly Constructed Supermarkets, by Selected City and End-Use (thousand Btu per square foot) Miami 1A Houston 2A Phoenix 2B Atlanta 3A Los Angeles 3B Las Vegas 3B San Francisco 3C Baltimore 4A Albuquerque 4B Seattle 4C Chicago 5A Boulder 5B Minneapolis 6A Helena 6B Duluth 7 Fairbanks 8 Note(s): Source(s): 145.6 0.3 0.6 20.5 Commercial building energy benchmarks are based off of the current stock of commercial buildings and reflect 2004 ASHRAE 90.1 Climate Zones. They are

  18. Buildings Energy Data Book: 3.8 Hospitals and Medical Facilities

    Buildings Energy Data Book [EERE]

    4 Energy Benchmarks for Newly Constructed Hospitals, by Selected City and End-Use (thousand Btu per square foot) Miami 1A Houston 2A Phoenix 2B Atlanta 3A Los Angeles 3B Las Vegas 3B San Francisco 3C Baltimore 4A Albuquerque 4B Seattle 4C Chicago 5A Boulder 5B Minneapolis 6A Helena 6B Duluth 7 Fairbanks 8 Note(s): Source(s): 89.1 25.2 3.9 13.5 Commercial building energy benchmarks are based off of the current stock of commercial buildings and reflect 2004 ASHRAE 90.1 Climate Zones. They are

  19. Buildings Energy Data Book: 3.8 Hospitals and Medical Facilities

    Buildings Energy Data Book [EERE]

    6 Energy Benchmarks for Newly Constructed Outpatient Buildings, by Selected City and End-Use (thousand Btu per square foot) Miami 1A Houston 2A Phoenix 2B Atlanta 3A Los Angeles 3B Las Vegas 3B San Francisco 3C Baltimore 4A Albuquerque 4B Seattle 4C Chicago 5A Boulder 5B Minneapolis 6A Helena 6B Duluth 7 Fairbanks 8 Note(s): Source(s): 99.7 8.8 1.4 17.7 Commercial building energy benchmarks are based off of the current stock of commercial buildings and are designed to provide a consistent

  20. Buildings Energy Data Book: 3.9 Educational Facilities

    Buildings Energy Data Book [EERE]

    0 Energy Benchmarks for Newly Constructed Primary Schools, by Selected City and End-Use (thousand Btu per square foot) Miami 1A Houston 2A Phoenix 2B Atlanta 3A Los Angeles 3B Las Vegas 3B San Francisco 3C Baltimore 4A Albuquerque 4B Seattle 4C Chicago 5A Boulder 5B Minneapolis 6A Helena 6B Duluth 7 Fairbanks 8 Note(s): Source(s): 59.6 0.5 3.1 1.4 Commercial building energy benchmarks are based off of the current stock of commercial buildings and reflect 2004 ASHRAE 90.1 Climate Zones. They are

  1. Buildings Energy Data Book: 3.9 Educational Facilities

    Buildings Energy Data Book [EERE]

    2 Energy Benchmarks for Newly Constructed Secondary Schools, by Selected City and End-Use (thousand Btu per square foot) Miami 1A Houston 2A Phoenix 2B Atlanta 3A Los Angeles 3B Las Vegas 3B San Francisco 3C Baltimore 4A Albuquerque 4B Seattle 4C Chicago 5A Boulder 5B Minneapolis 6A Helena 6B Duluth 7 Fairbanks 8 Note(s): Source(s): 96.7 2.2 2.8 5.5 Commercial building energy benchmarks are based off of the current stock of commercial buildings and reflect 2004 ASHRAE 90.1 Climate Zones. They

  2. Simulation and analysis of the plutonium shipping container subject to 30-foot drops

    SciTech Connect (OSTI)

    Gong, C.; Gupta, N.K.; Gromada, R.J.

    1995-12-31

    The shipping container 5320 is a shipping package for radioactive materials. In order to maintain the component in this packaging within the sub-critical state when subjected to any kind of Hypothetical Accident conditions (HAC), this Type B packaging is designed with various impact limiters. The present study is to examine the energy absorbing capacity of the impact limiter design of this container subjected to a 30-foot drop onto a flat unyielding horizontal surface in each of the three critical dropping orientations. This paper presents the results of a three dimensional nonlinear dynamic impact analysis. This analysis shows the deformed configuration of the container caused by the impact and also determines the effects of different stress wave paths in three distinct drops on the stress states in the critical component. The solution to the problem was obtained using the ABAQUS (explicit) finite element computer code. The nonlinearity of this analysis involves large structural deformation, elasto-plastic materials with strain hardening as well as multiple contact interfaces. Three drop orientations were studied, namely, top down impact, bottom down impact and side impact. Results will be compared against actual drop test data.

  3. Higher velocity, high-foot implosions on the National Ignition Facility laser

    SciTech Connect (OSTI)

    Callahan, D. A.; Hurricane, O. A.; Hinkel, D. E.; Dppner, T.; Ma, T.; Park, H.-S.; Barrios Garcia, M. A.; Berzak Hopkins, L. F.; Casey, D. T.; Cerjan, C. J.; Dewald, E. L.; Dittrich, T. R.; Edwards, M. J.; Haan, S. W.; Hamza, A. V.; Kritcher, A. L.; Landen, O. L.; LePape, S.; MacPhee, A. G.; Milovich, J. L.; and others

    2015-05-15

    By increasing the velocity in high foot implosions [Dittrich et al., Phys. Rev. Lett. 112, 055002 (2014); Park et al., Phys. Rev. Lett. 112, 055001 (2014); Hurricane et al., Nature 506, 343 (2014); Hurricane et al., Phys. Plasmas 21, 056314 (2014)] on the National Ignition Facility laser, we have nearly doubled the neutron yield and the hotspot pressure as compared to the implosions reported upon last year. The implosion velocity has been increased using a combination of the laser (higher power and energy), the hohlraum (depleted uranium wall material with higher opacity and lower specific heat than gold hohlraums), and the capsule (thinner capsules with less mass). We find that the neutron yield from these experiments scales systematically with a velocity-like parameter of the square root of the laser energy divided by the ablator mass. By connecting this parameter with the inferred implosion velocity (v), we find that for shots with primary yield >1 10{sup 15} neutrons, the total yield ??v{sup 9.4}. This increase is considerably faster than the expected dependence for implosions without alpha heating (?v{sup 5.9}) and is additional evidence that these experiments have significant alpha heating.

  4. Higher velocity, high-foot implosions on the National Ignition Facility laser

    SciTech Connect (OSTI)

    Callahan, D. A.; Hurricane, O. A.; Hinkel, D. E.; Dppner, T.; Ma, T.; Park, H. -S.; Barrios Garcia, M. A.; Berzak Hopkins, L. F.; Casey, D. T.; Cerjan, C. J.; Dewald, E. L.; Dittrich, T. R.; Edwards, M. J.; Haan, S. W.; Hamza, A. V.; Kline, J. L.; Knauer, J. P.; Kritcher, A. L.; Landen, O. L.; LePape, S.; MacPhee, A. G.; Milovich, J. L.; Nikroo, A.; Pak, A. E.; Patel, P. K.; Rygg, J. R.; Ralph, J. E.; Salmonson, J. D.; Spears, B. K.; Springer, P. T.; Tommasini, R.; Benedetti, L. R.; Bionta, R. M.; Bond, E. J.; Bradley, D. K.; Caggiano, J. A.; Field, J. E.; Fittinghoff, D. N.; Frenje, J.; Gatu Johnson, M.; Grim, G. P.; Hatarik, R.; Merrill, F. E.; Nagel, S. R.; Izumi, N.; Khan, S. F.; Town, R. P. J.; Sayre, D. B.; Volegov, P.; Wilde, C. H.

    2015-05-15

    By increasing the velocity in high foot implosions [Dittrich et al., Phys. Rev. Lett. 112, 055002 (2014); Park et al., Phys. Rev. Lett. 112, 055001 (2014); Hurricane et al., Nature 506, 343 (2014); Hurricane et al., Phys. Plasmas 21, 056314 (2014)] on the National Ignition Facility laser, we have nearly doubled the neutron yield and the hotspot pressure as compared to the implosions reported upon last year. The implosion velocity has been increased using a combination of the laser (higher power and energy), the hohlraum (depleted uranium wall material with higher opacity and lower specific heat than gold hohlraums), and the capsule (thinner capsules with less mass). We find that the neutron yield from these experiments scales systematically with a velocity-like parameter of the square root of the laser energy divided by the ablator mass. By connecting this parameter with the inferred implosion velocity (v), we find that for shots with primary yield >1e15 neutrons, the total yield ~ v???. This increase is considerably faster than the expected dependence for implosions without alpha heating ( ~v???) and is additional evidence that these experiments have significant alpha heating.

  5. DOE O 442.1A

    Broader source: Energy.gov (indexed) [DOE]

    A 6-6-01 THIS PAGE IS TO REMAIN WITH DOE O 442.1A THIS PAGE TRANSMITS AN ADMINISTRATIVE CHANGE TO DOE O 442.1, DEPARTMENT OF ENERGY EMPLOYEE CONCERNS PROGRAM, DATED 2-1-99. THIS...

  6. EPA Mobile Source Enforcement Memo 1A

    Alternative Fuels and Advanced Vehicles Data Center [Office of Energy Efficiency and Renewable Energy (EERE)]

    UNITED STATES ENVIRONMENTAL PROTECTION AGENCY WASHINGTON, D.C. 20460 OFFICE OF ENFORCEMENT AND COMPLIANCE ASSURANCE September 4, 1997 Addendum to Mobile Source Enforcement Memorandum 1A SUBJECT: Tampering Enforcement Policy for Alternative Fuel Aftermarket Conversions A. Purpose The purpose of this document is to clarify and revise the U.S. Environmental Protection Agency's (EPA's) "tampering" enforcement policy for motor vehicles and motor vehicle engines originally designed to

  7. EIA Energy Efficiency-Table 1a. Table 1a. Consumption of Site...

    Annual Energy Outlook [U.S. Energy Information Administration (EIA)]

    a Page Last Modified: May 2010 Table 1a. Consumption of Energy (Site Energy) for All Purposes (First Use) for Selected Industries, 1998, 2002, and 2006 (Trillion Btu) MECS Survey...

  8. Bison Wind Farm 1A | Open Energy Information

    Open Energy Info (EERE)

    Bison Wind Farm 1A Jump to: navigation, search Name Bison Wind Farm 1A Facility Bison Wind 1A Sector Wind energy Facility Type Commercial Scale Wind Facility Status In Service...

  9. DOE M 481.1-1A | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    1.1-1A DOE M 481.1-1A Reimbursable Work for Non-Federal Sponsors Process Manual PDF icon DOE M 481.1-1A More Documents & Publications U.S. Department of Energy Order Doing Business ...

  10. Sample Business Plan Framework 1: A program seeking to continue...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Sample Business Plan Framework 1: A program seeking to continue operations in the ... U.S. Department of Energy Better Buildings Neighborhood Program: Sample Business Plan ...

  11. Cancellation of DOE G 440.2B-1A

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    2011-02-15

    Cancels DOE G 440.2B-1A, Implementation Guide - Performance Indicators (Metrics) for Use with Doe O 440.2B, Aviation Management and Safety.

  12. North Miami Beach, Florida: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    County, Florida. It falls under Florida's 17th congressional district and Florida's 20th congressional district.12 References US Census Bureau Incorporated place and...

  13. Miami Shores, Florida: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    County, Florida. It falls under Florida's 17th congressional district and Florida's 20th congressional district.12 References US Census Bureau Incorporated place and...

  14. North Miami, Florida: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    County, Florida. It falls under Florida's 17th congressional district and Florida's 20th congressional district.12 References US Census Bureau Incorporated place and...

  15. President Highlights Smart Energy Training at U. of Miami | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ... If you'd like to apply for an assessment, you can contact one of the 24 schools across the ... IAC. Industrial Assessment Centers Train Future Energy-Savvy Engineers Energy Department ...

  16. 3RD MIAMI INTERNATIONAL CONFERENCE ON ALTERNATIVE ENERGY SOURCES

    Office of Scientific and Technical Information (OSTI)

    ... been developed through systematic simulation de- scribing ... programming, valve changing and detector switching ... F.K. - 6 1 7 - SESSION 3F ENERGY EDUCATION -619 - THE ...

  17. Miami Springs, Florida: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    Springs, Florida: Energy Resources Jump to: navigation, search Equivalent URI DBpedia Coordinates 25.8223198, -80.289495 Show Map Loading map... "minzoom":false,"mappingservic...

  18. DOE - Office of Legacy Management -- University of Miami - FL...

    Office of Legacy Management (LM)

    Site Disposition: Eliminated - Potential for contamination considered remote based on nature of the operations FL.0-01-1 Radioactive Materials Handled: None Indicated Primary...

  19. Miami County, Indiana: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    lse,"poi":true,"imageoverlays":,"markercluster":false,"searchmarkers":"","locations":"text":"","title":"","link":null,"lat":40.770099,"lon":-86.0529604,"alt":0,"address":"","ic...

  20. Miami-Dade County- Targeted Jobs Incentive Fund

    Broader source: Energy.gov [DOE]

    The Targeted Jobs Incentive Fund (TJIF) provides financial incentives for select industries, including solar thermal and photovoltaic manufacturing, installation and repair companies that are...

  1. Miami Students' Solar Decathlon Design Focused on Sustainability

    Broader source: Energy.gov [DOE]

    The 2011 Florida International University Team designed their home around the ability to use adjustable panels on the outside of the home -- to protect from everything from sunshine to hurricanes.

  2. Miami County, Kansas: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    County, Kansas: Energy Resources Jump to: navigation, search Equivalent URI DBpedia Coordinates 38.6381689, -94.8105955 Show Map Loading map... "minzoom":false,"mappingservice...

  3. 3rd Miami international conference on alternative energy sources

    SciTech Connect (OSTI)

    Nejat Veziroglu, T.

    1980-01-01

    The conference includes sessions on solar energy, ocean thermal energy, wind energy, hydro power, nuclear breeders and nuclear fusion, synthetic fuels from coal or wastes, hydrogen production and uses, formulation of workable policies on energy use and energy conservation, heat and energy storage, and energy education. The volume of the proceedings presents the papers and lectures in condensed format grouped by subject under forty-two sessions for 319 presentations.

  4. Induction of cytochromes P450 1A1 and 1A2 by tanshinones in human HepG2

    Office of Scientific and Technical Information (OSTI)

    hepatoma cell line (Journal Article) | SciTech Connect SciTech Connect Search Results Journal Article: Induction of cytochromes P450 1A1 and 1A2 by tanshinones in human HepG2 hepatoma cell line Citation Details In-Document Search Title: Induction of cytochromes P450 1A1 and 1A2 by tanshinones in human HepG2 hepatoma cell line Diterpenoid tanshinones including tanshinone IIA (TIIA), cryptotanshinone (CTS), tanshinone I (TI) and dihydrotanshinone I (DHTI) are the major bioactive components

  5. RRC Form H-1A | Open Energy Information

    Open Energy Info (EERE)

    A Jump to: navigation, search OpenEI Reference LibraryAdd to library Reference: RRC Form H-1A Published RRC, Date Not Provided DOI Not Provided Check for DOI availability: http:...

  6. Type 1a supernovae. (Conference) | SciTech Connect

    Office of Scientific and Technical Information (OSTI)

    Conference: Type 1a supernovae. Citation Details In-Document Search Title: Type 1a supernovae. Abstract not provided. Authors: Kerstein, Alan R. ; Sankaran, Vaidyanathan ; Woosley, Stan ; Kasen, Dan ; Ma, Haitao ; Glatzmaier, Gary ; Aspden, Andy ; Bell, John ; Day, Marc ; Roepke, Fritz Publication Date: 2008-09-01 OSTI Identifier: 1142326 Report Number(s): SAND2008-6141C 509106 DOE Contract Number: DE-AC04-94AL85000 Resource Type: Conference Resource Relation: Conference: 10th Symposium on

  7. The tale of a modern animal plague: Tracing the evolutionary history and determining the time-scale for foot and mouth disease virus

    SciTech Connect (OSTI)

    Tully, Damien C. Fares, Mario A.

    2008-12-20

    Despite significant advances made in the understanding of its epidemiology, foot and mouth disease virus (FMDV) is among the most unexpected agricultural devastating plagues. While the disease manifests itself as seven immunologically distinct strains their origin, population dynamics, migration patterns and divergence times remain unknown. Herein we have assembled a comprehensive data set of gene sequences representing the global diversity of the disease and inferred the time-scale and evolutionary history for FMDV. Serotype-specific rates of evolution and divergence times were estimated using a Bayesian coalescent framework. We report that an ancient precursor FMDV gave rise to two major diversification events spanning a relatively short interval of time. This radiation event is estimated to have taken place towards the end of the 17th and the beginning of the 18th century giving us the present circulating Euro-Asiatic and South African viral strains. Furthermore our results hint that Europe acted as a possible hub for the disease from where it successfully dispersed elsewhere via exploration and trading routes.

  8. High Statistics Study of Nearby Type 1a Supernovae. QUEST Camera...

    Office of Scientific and Technical Information (OSTI)

    Statistics Study of Nearby Type 1a Supernovae. QUEST Camera Short Term Maintenance: Final Technical Report Baltay, Charles 79 ASTRONOMY AND ASTROPHYSICS Study of Type 1a Supernovae...

  9. Development and Characterization of A Multiplexed RT-PCR Species Specific Assay for Bovine and one for Porcine Foot-and-Mouth Disease Virus Rule-Out

    SciTech Connect (OSTI)

    Smith, S M; Danganan, L; Tammero, L; Vitalis, B; Lenhoff, R; Naraghi-arani, P; Hindson, B

    2007-08-06

    Lawrence Livermore National Laboratory (LLNL), in collaboration with the Department of Homeland Security (DHS) and the United States Department of Agriculture (USDA), Animal and Plant Health Inspection Services (APHIS) has developed candidate multiplexed assays that may potentially be used within the National Animal Health Laboratory Network (NAHLN), the National Veterinary Services Laboratory (Ames, Iowa) and the Plum Island Animal Disease Center (PIADC). This effort has the ability to improve our nation's capability to discriminate between foreign animal diseases and those that are endemic using a single assay, thereby increasing our ability to protect food and agricultural resources with a diagnostic test which could enhance the nation's capabilities for early detection of a foreign animal disease. In FY2005 with funding from the DHS, LLNL developed the first version (Version 1.0) of a multiplexed (MUX) nucleic-acid-based RT-PCR assay that included signatures for foot-and-mouth disease virus (FMDV) detection with rule-out tests for two other foreign animal diseases (FADs) of swine, Vesicular Exanthema of Swine (VESV) and Swine Vesicular Disease Virus (SVDV), and four other domestic viral diseases Bovine Viral Diarrhea Virus (BVDV), Bovine Herpes Virus 1 (BHV-1), Bluetongue virus (BTV) and Parapox virus complex (which includes Bovine Papular Stomatitis Virus [BPSV], Orf of sheep, and Pseudocowpox). In FY06, LLNL has developed Bovine and Porcine species-specific panel which included existing signatures from Version 1.0 panel as well as new signatures. The MUX RT-PCR porcine assay for detection of FMDV includes the FADs, VESV and SVD in addition to vesicular stomatitis virus (VSV) and porcine reproductive and respiratory syndrome (PRRS). LLNL has also developed a MUX RT-PCR bovine assay for detection of FMDV with rule out tests for the two bovine FADs malignant catarrhal fever (MCF), rinderpest virus (RPV) and the domestic diseases vesicular stomatitis virus (VSV), bovine viral diarrhea virus (BVDV), infectious bovine rhinotracheitus virus (BHV-1), bluetongue virus (BTV), and the Parapox viruses (which are of two bovine types) bovine papular stomatitis virus (BPSV) and psuedocowpox (PCP). A timeline for this development is presented in Table 1. The development of the Version 1.0 panel for FMDV rule-out and the most current efforts aimed to designed species specific panels has spanned over 2 1/2 years with multiple collaborative partnerships. This document provides a summary of the development, testing and performance data at OIE Stage 1 Feasibility into Stage 2 Assay Development and Standardization1 (see Table 2), gathered as of June 30th, 2007 for the porcine and bovine MUX assay panels. We present an overview of the identification and selection of candidate genetic signatures, the assay development process, and preliminary performance data for each of the individual signatures as characterized in the multiplexed format for the porcine and bovine panels. The Stage 1 Feasibility data of the multiplexed panels is presented in this report also includes relevant data acquired from the Version 1.0 panel as supporting information where appropriate. In contrast to last years effort, the development of the bovine and porcine panels is pending additional work to complete analytical characterization of FMDV, VESV, SVD, RPV and MCF. The signature screening process and final panel composition impacts this effort. The unique challenge presented this year was having strict predecessor limitations in completing characterization, where efforts at LLNL must precede efforts at PIADC, such challenges were alleviated in the 2006 reporting by having characterization data from the interlaboratory comparison and at Plum Island under AgDDAP project. We will present an addendum at a later date with additional data on the characterization of the porcine and bovine multiplex assays when that data is available. As a summary report, this document does not provide the details of signature generation, evaluation, and testing, nor does it provide spec

  10. DRAFT - DOE O 227.1A, Independent Oversight Program - DOE Directives,

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Delegations, and Requirements DRAFT - DOE O 227.1A, Independent Oversight Program by Website Administrator The Order prescribes requirements and responsibilities for DOE Independent Oversight Program. DOE O 227.1A, Independent Oversight Program

  11. Alternative energy sources. IV. Proceedings of the Fourth Miami International Conference, Miami Beach, FL, December 14-16, 1981. Volume 1 - Solar Collectors Storage

    SciTech Connect (OSTI)

    Veziroglu, T.N.

    1982-01-01

    Aspects of solar measurements, solar collectors, selective coatings, thermal storage, phase change storage, and heat exchangers are discussed. The analysis and testing of flat-plate solar collectors are addressed. The development and uses of plastic collectors, a solar water heating system, solar energy collecting oil barrels, a glass collector panel, and a two-phase thermosyphon system are considered. Studies of stratification in thermal storage, of packed bed and fluidized bed systems, and of thermal storage in solar towers, in wall passive systems, and in reversible chemical reactions are reported. Phase change storage by direct contact processes and in residential solar space heating and cooling is examined, as are new materials and surface characteristics for solar heat storage. The use of R-11 and Freon-113 in heat exchange is discussed.

  12. High Statistics Study of Nearby Type 1a Supernovae. QUEST Camera Short Term

    Office of Scientific and Technical Information (OSTI)

    Maintenance: Final Technical Report (Technical Report) | SciTech Connect Technical Report: High Statistics Study of Nearby Type 1a Supernovae. QUEST Camera Short Term Maintenance: Final Technical Report Citation Details In-Document Search Title: High Statistics Study of Nearby Type 1a Supernovae. QUEST Camera Short Term Maintenance: Final Technical Report The Quest Camera was installed at the Palomar Obervatory in California. The camera was used to carry out a survey of low redshift Type 1a

  13. Systematic Effects in Type-1a Supernovae Surveys from Host Galaxy...

    Office of Scientific and Technical Information (OSTI)

    Systematic Effects in Type-1a Supernovae Surveys from Host Galaxy Spectra Strauss, Michael A. Princeton University 79 ASTRONOMY AND ASTROPHYSICS Cosmology, supernovae, stellar...

  14. Implementation of DOE Order 580.1A, Department of Energy Personal...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    The revision also removed outdated and conflicting language. DOE O 580.1A was also administratively revised in October 2012 to correct spacing, numberinglettering sequence, update ...

  15. Extension of DOE O 311.1A, Equal Employment Opportunity and Diversity Program

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    2000-12-21

    This Notice extends DOE O 311.1A, Equal Employment Opportunity and Diversity Program, dated 12-30-96 until 12-30-01, unless sooner rescinded.

  16. High Statistics Study of Nearby Type 1a Supernovae. QUEST Camera...

    Office of Scientific and Technical Information (OSTI)

    Statistics Study of Nearby Type 1a Supernovae. QUEST Camera Short Term Maintenance: Final Technical Report Citation Details In-Document Search Title: High Statistics Study of ...

  17. High Statistics Study of Nearby Type 1a Supernovae. QUEST Camera...

    Office of Scientific and Technical Information (OSTI)

    High Statistics Study of Nearby Type 1a Supernovae. QUEST Camera Short Term Maintenance: Final Technical Report Citation Details In-Document Search Title: High Statistics Study of ...

  18. Evaluation of the Cask Transportation Facility Modifications (CTFM) compliance to DOE order 6430.1A

    SciTech Connect (OSTI)

    ARD, K.E.

    1999-07-14

    This report was prepared to evaluate the compliance of Cask Transportation Facility Modifications (CTFM) to DOE Order 6430.1A.

  19. Understanding the Mechanism of Human P450 CYP1A2 Using Coupled

    Office of Scientific and Technical Information (OSTI)

    Quantum-Classical Simulations in a Dynamical Environment (Technical Report) | SciTech Connect Technical Report: Understanding the Mechanism of Human P450 CYP1A2 Using Coupled Quantum-Classical Simulations in a Dynamical Environment Citation Details In-Document Search Title: Understanding the Mechanism of Human P450 CYP1A2 Using Coupled Quantum-Classical Simulations in a Dynamical Environment The reaction mechanism of the human P450 CYP1A2 enzyme plays a fundamental role in understanding the

  20. Policy Flash 2014-40 Implementation of DOE O 580.1A, DOE Energy...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Policy Flash 2014-40 Implementation of DOE O 580.1A, DOE Energy Personal Property Management Questions may be referred to Scott Whiteford (202) 287-1563 or scott.whiteford@hq.doe.g...

  1. A polymorphism in metallothionein 1A (MT1A) is associated with cadmium-related excretion of urinary beta 2‐microglobulin

    SciTech Connect (OSTI)

    Lei, Lijian; Department of Epidemiology, School of Public Health, Shanxi Medical University, Shanxi ; Chang, Xiuli; Rentschler, Gerda; Tian, Liting; Zhu, Guoying; Chen, Xiao; Jin, Taiyi; Broberg, Karin

    2012-12-15

    Objectives: Cadmium (Cd) toxicity of the kidney varies between individuals despite similar exposure levels. In humans Cd is mainly bound to metallothioneins (MT), which scavenge its toxic effects. Here we analyzed whether polymorphisms in MT genes MT1A and MT2A influence Cd-related kidney damage. Methods: In a cross-sectional study N = 512 volunteers were selected from three areas in South-Eastern China, which to varying degree were Cd-polluted from a smelter (control area [median Cd in urine U-Cd = 2.67 μg/L], moderately [U-Cd = 4.23 μg/L] and highly [U-Cd = 9.13 μg/L] polluted areas). U-Cd and blood Cd (B-Cd) concentrations were measured by graphite-furnace atomic absorption spectrometry. MT1A rs11076161 (G/A), MT2A rs10636 (G/C) and MT2A rs28366003 (A/G) were determined by Taqman assays; urinary N-Acetyl-beta-(D)-Glucosaminidase (UNAG) by spectrometry, and urinary β2-microglobulin (UB2M) by ELISA. Results: Higher B-Cd (natural log-transformed) with increasing number of MT1A rs11076161 A-alleles was found in the highly polluted group (p-value trend = 0.033; all p-values adjusted for age, sex, and smoking). In a linear model a significant interaction between rs11076161 genotype and B-Cd was found for UNAG (p = 0.001) and UB2M concentrations (p = 0.001). Carriers of the rs11076161 AA genotype showed steeper slopes for the associations between Cd in blood and natural log-transformed UB2M (β = 1.2, 95% CI 0.72–1.6) compared to GG carriers (β = 0.30, 95% CI 0.15–0.45). Also for UNAG (natural log-transformed) carriers of the AA genotype had steeper slopes (β = 0.55, 95% CI 0.27–0.84) compared to GG carriers (β = 0.018, 95% CI − 0.79–0.11). Conclusions: MT1A rs11076161 was associated with B-Cd concentrations and Cd-induced kidney toxicity at high exposure levels. -- Highlights: ► Cadmium is toxic to the kidney but the susceptibility differs between individuals. ► The toxic effect of cadmium is scavenged by metallothioneins. ► A common variant of metallothionein 1A was genotyped in 512 cadmium exposed humans. ► Variant carriers of this polymorphism showed more kidney damage from cadmium. ► The frequency of these variants needs to be taken into account in risk assessment.

  2. Miami-Dade County- Voluntary Energy Efficiency and Renewable Energy Program

    Broader source: Energy.gov [DOE]

    Note: In 2010, the Federal Housing Finance Agency (FHFA), which has authority over mortgage underwriters Fannie Mae and Freddie Mac, directed these enterprises against purchasing mortgages of homes...

  3. Implementation of DOE Order 580.1A, Department of Energy Personal Property Management

    Broader source: Energy.gov [DOE]

    On March 30, 2012 The Department of Energy (DOE) published DOE Order 580.1A, DOE Property Management Program) as part of a deregulation initiative to replace obsolete parts to the DOE Property Management Regulation (DOE-PMR) codified at 41 CFR 109. The Order replaced obsolete and prescriptive provisions of the DOE-PMR. The DOE Order 580.1A provided contractor property managers more flexibility in implementing personal property management functions. Changes included increasing the dollar threshold for accountable property; provided protocols for foreign transactions (loans, transfers, abandonment); guidance for High Risk Personal Property; clarified what is considered sensitive property; and added definitions. The revision also removed outdated and conflicting language. DOE O 580.1A was also administratively revised in October 2012 to correct spacing, numbering/lettering sequence, update office names; and punctuation.

  4. Buildings Energy Data Book: 3.6 Office Building Markets and Companies

    Buildings Energy Data Book [EERE]

    0 Energy Benchmarks for Existing Medium Office Buildings, by Selected City and End-Use (thousand Btu per square foot) IECC Post Pre Post Pre Post Pre Post Pre Miami 1A 1.0 0.0 22.0 19.2 0.4 0.4 1.9 13.0 Houston 2A 4.6 1.8 15.5 14.7 0.5 0.5 1.5 12.8 Phoenix 2B 4.0 0.7 17.5 19.4 0.4 0.4 1.9 15.0 Atlanta 3A 7.8 4.3 10.1 10.4 0.6 0.5 1.4 13.9 Los Angeles 3B 4.1 0.3 8.0 3.5 0.5 0.5 1.4 10.9 Las Vegas 3B 5.6 1.4 13.2 14.6 0.5 0.5 1.8 14.5 San Francisco 3C 5.8 1.7 2.9 1.2 0.6 0.6 1.1 8.9 Baltimore 4A

  5. Buildings Energy Data Book: 3.6 Office Building Markets and Companies

    Buildings Energy Data Book [EERE]

    8 Energy Benchmarks for Existing Large Office Buildings, by Selected City and End-Use (thousand Btu per square foot) IECC Post Pre Post Pre Post Pre Post Pre Miami 1A 0.3 0.8 21.9 24.5 0.3 0.2 3.1 3.5 Houston 2A 4.2 4.4 17.7 20.9 0.3 0.3 2.8 3.3 Phoenix 2B 3.0 3.3 16.2 18.3 0.3 0.3 3.2 3.7 Atlanta 3A 6.9 8.5 14.1 17.5 0.4 0.4 2.6 3.2 Los Angeles 3B 2.8 2.9 11.9 13.0 0.4 0.4 2.5 2.7 Las Vegas 3B 4.6 4.7 10.8 13.0 0.3 0.3 2.7 3.3 San Francisco 3C 5.0 6.4 5.6 6.6 0.4 0.4 1.8 2.1 Baltimore 4A 9.8

  6. Buildings Energy Data Book: 3.7 Retail Markets and Companies

    Buildings Energy Data Book [EERE]

    5 Energy Benchmarks for Existing Retail Buildings, by Selected City and End-Use (thousand Btu per square foot) IECC Post Pre Post Pre Post Pre Miami 1A 0.5 0.7 23.0 25.2 14.3 16.1 Houston 2A 11.6 12.4 16.2 18.9 14.6 16.9 Phoenix 2B 8.3 10.2 17.2 21.3 14.2 17.5 Atlanta 3A 24.9 26.2 9.2 11.2 15.1 17.4 Los Angeles 3B 6.9 7.7 3.3 3.9 13.4 14.1 Las Vegas 3B 15.4 17.9 11.6 14.8 12.7 16.9 San Francisco 3C 22.4 22.5 0.7 1.0 10.6 12.1 Baltimore 4A 43.0 46.9 6.2 7.9 13.3 16.2 Albuquerque 4B 30.2 33.8 5.3

  7. Buildings Energy Data Book: 3.7 Retail Markets and Companies

    Buildings Energy Data Book [EERE]

    7 Energy Benchmarks for Existing Supermarkets, by Selected City and End-Use (thousand Btu per square foot) IECC Post Pre Post Pre Post Pre Post Pre Miami 1A 2.2 2.2 11.8 12.4 0.4 0.4 11.1 11.1 Houston 2A 21.6 21.5 9.7 10.7 0.4 0.4 18.0 18.5 Phoenix 2B 21.4 21.2 11.2 13.2 0.4 0.4 13.6 15.6 Atlanta 3A 41.3 41.1 5.4 6.1 0.5 0.5 21.1 21.7 Los Angeles 3B 22.5 22.3 1.1 1.1 0.5 0.5 12.7 12.3 Las Vegas 3B 32.9 32.6 8.3 10.2 0.4 0.4 18.8 20.1 San Francisco 3C 50.0 48.4 0.3 0.3 0.5 0.5 13.2 13.1 Baltimore

  8. Buildings Energy Data Book: 3.8 Hospitals and Medical Facilities

    Buildings Energy Data Book [EERE]

    3 Energy Benchmarks for Existing Hospitals, by Selected City and End-Use (thousand Btu per square foot) IECC Post Pre Post Pre Post Pre Post Pre Miami 1A 34.6 40.7 88.9 85.4 1.8 1.8 20.0 21.0 Houston 2A 42.1 48.0 89.5 86.9 2.2 2.1 19.6 20.8 Phoenix 2B 42.2 48.6 82.1 80.2 2.0 1.9 20.7 21.9 Atlanta 3A 45.8 53.9 83.7 82.1 2.5 2.5 19.0 20.6 Los Angeles 3B 45.4 46.9 75.4 71.0 2.5 2.4 18.5 18.8 Las Vegas 3B 40.9 48.0 69.5 69.0 2.2 2.2 18.5 21.2 San Francisco 3C 49.2 52.8 66.5 64.1 2.8 2.7 17.1 18.0

  9. Buildings Energy Data Book: 3.8 Hospitals and Medical Facilities

    Buildings Energy Data Book [EERE]

    5 Energy Benchmarks for Existing Outpatient Buildings, by Selected City and End-Use (thousand Btu per square foot) IECC Post Pre Post Pre Post Pre Post Pre Miami 1A 65.4 60.3 69.6 61.9 0.7 0.7 24.6 23.9 Houston 2A 73.2 76.2 54.0 52.9 0.8 0.8 22.1 24.0 Phoenix 2B 79.1 79.8 54.7 52.9 0.7 0.7 23.8 25.3 Atlanta 3A 83.1 91.1 41.8 42.1 0.9 0.9 22.1 24.6 Los Angeles 3B 87.8 86.3 37.4 35.6 0.9 0.9 22.5 23.1 Las Vegas 3B 76.6 80.5 44.1 44.0 0.8 0.8 23.2 25.5 San Francisco 3C 85.0 93.4 25.0 24.7 1.0 1.0

  10. Buildings Energy Data Book: 3.9 Educational Facilities

    Buildings Energy Data Book [EERE]

    4 Energy Benchmarks for Existing Large Hotels, by Selected City and End-Use (thousand Btu per square foot) IECC Post Pre Post Pre Post Pre Post Pre Miami 1A 1.4 0.1 155.0 142.0 30.1 29.4 8.9 11.2 Houston 2A 7.1 1.9 119.9 117.9 38.1 37.1 8.8 10.8 Phoenix 2B 4.5 1.1 113.2 111.5 33.5 32.7 9.1 11.4 Atlanta 3A 13.1 3.8 91.3 88.5 45.7 44.6 8.8 10.5 Los Angeles 3B 3.1 0.7 77.5 74.9 44.3 43.1 8.9 10.4 Las Vegas 3B 7.4 2.2 78.9 83.0 39.0 38.0 9.0 11.2 San Francisco 3C 8.0 2.6 48.8 49.6 50.8 49.5 8.7 10.0

  11. Buildings Energy Data Book: 3.9 Educational Facilities

    Buildings Energy Data Book [EERE]

    7 Energy Benchmarks for Existing Small Hotels, by Selected City and End-Use (thousand Btu per square foot) IECC Post Pre Post Pre Post Pre Post Pre Miami 1A 0.2 0.0 25.7 21.2 5.6 5.4 6.7 2.6 Houston 2A 2.8 0.7 17.7 16.1 6.7 6.5 5.6 2.0 Phoenix 2B 2.0 0.2 18.7 17.0 6.0 5.9 6.2 2.3 Atlanta 3A 5.4 1.9 12.0 11.1 7.8 7.6 5.4 1.6 Los Angeles 3B 1.7 0.0 9.5 9.7 7.6 7.4 5.2 1.4 Las Vegas 3B 3.4 0.6 13.6 13.5 6.8 6.6 5.7 1.9 San Francisco 3C 4.4 0.3 5.8 6.1 8.5 8.3 4.5 0.9 Baltimore 4A 9.2 3.7 9.6 8.8

  12. Buildings Energy Data Book: 3.9 Educational Facilities

    Buildings Energy Data Book [EERE]

    1 Energy Benchmarks for Existing Secondary Schools, by Selected City and End-Use (thousand Btu per square foot) IECC Post Pre Post Pre Post Pre Post Pre Miami 1A 1.0 10.2 73.6 17.5 1.2 1.4 6.0 9.1 Houston 2A 9.5 7.0 49.7 20.7 1.5 1.3 5.2 10.9 Phoenix 2B 6.6 20.9 53.9 10.0 1.3 1.7 5.7 8.8 Atlanta 3A 18.7 5.8 31.4 5.2 1.7 1.6 5.0 7.3 Los Angeles 3B 5.7 11.5 25.2 14.4 1.7 1.5 5.0 10.3 Las Vegas 3B 10.5 15.8 34.7 1.7 1.5 1.8 5.3 7.5 San Francisco 3C 16.1 36.2 11.4 7.3 1.9 1.9 4.8 8.4 Baltimore 4A

  13. Buildings Energy Data Book: 3.9 Educational Facilities

    Buildings Energy Data Book [EERE]

    9 Energy Benchmarks for Existing Primary Schools, by Selected City and End-Use (thousand Btu per square foot) IECC Post Pre Post Pre Post Pre Post Pre Miami 1A 0.7 0.7 20.6 22.4 1.4 1.4 3.1 3.4 Houston 2A 6.4 8.3 13.3 17.2 1.7 1.7 2.4 2.9 Phoenix 2B 4.1 6.1 14.2 19.6 1.6 1.5 2.9 3.6 Atlanta 3A 12.5 16.8 7.6 10.6 2.0 2.0 2.1 2.7 Los Angeles 3B 4.4 4.4 6.1 6.6 1.9 1.9 2.2 2.4 Las Vegas 3B 6.6 10.2 10.1 14.5 1.8 1.7 2.6 3.4 San Francisco 3C 10.9 12.6 2.3 3.0 2.2 2.1 1.9 2.2 Baltimore 4A 18.6 29.8

  14. Supplemental Reactor Physics Calculations and Analysis of ELF Mk 1A Fuel

    SciTech Connect (OSTI)

    Michael A. Pope

    2014-10-01

    These calculations supplement previous the reactor physics work evaluating the Enhanced Low Enriched Uranium (LEU) Fuel (ELF) Mk 1A element. This includes various additional comparisons between the current Highly Enriched Uranium (HEU) and LEU along with further characterization of the performance of the ELF fuel. The excess reactivity to be held down at BOC for ELF Mk 1A fuel is estimated to be approximately $2.75 greater than with HEU for a typical cycle. This is a combined effect of the absence of burnable poison in the ELF fuel and the reduced neck shim worth in LEU fuel compared to HEU. Burnable poison rods were conceptualized for use in the small B positions containing Gd2O3 absorber. These were shown to provide $2.37 of negative reactivity at BOC and to burn out in less than half of a cycle. The worth of OSCCs is approximately the same between HEU and ELF Mk 1A (LEU) fuels in the representative loading evaluated. This was evaluated by rotating all banks simultaneously. The safety rod worth is relatively unchanged between HEU and ELF Mk 1A (LEU) fuels in the representative loading evaluated. However, this should be reevaluated with different loadings. Neutron flux, both total and fast (>1 MeV), is either the same or reduced upon changing from HEU to ELF Mk 1A (LEU) fuels in the representative loading evaluated. This is consistent with the well-established trend of lower neutron fluxes for a given power in LEU than HEU.The IPT loop void reactivity is approximately the same or less positive with ELF Mk 1A (LEU) fuel than HEU in the representative loading evaluated.

  15. Compositions and methods related to serotonin 5-HT1A receptors

    DOE Patents [OSTI]

    Mukherjee, Jogeshwar; Saigal, Neil

    2010-06-08

    Contemplated substituted arylpiperazinyl compounds, and most preferably 18F-Mefway, exhibit desirable in vitro and in vivo binding characteristics to the 5-HT1A receptor. Among other advantageous parameters, contemplated compounds retain high binding affinity, display optimal lipophilicity, and are radiolabeled efficiently with 18F-fluorine in a single step. Still further, contemplated compounds exhibit high target to non-target ratios in receptor-rich regions both in vitro and in vivo, and selected compounds can be effectively and sensitively displaced by serotonin, thus providing a quantitative tool for measuring 5-HT1A receptors and serotonin concentration changes in the living brain.

  16. Compositions and methods related to serotonin 5-HT1A receptors

    DOE Patents [OSTI]

    Mukherjee, Jogeshwar; Saigal, Neil; Saigal, legal representative, Harsh

    2012-09-25

    Contemplated substituted arylpiperazinyl compounds, and most preferably 18F-Mefway, exhibit desirable in vitro and in vivo binding characteristics to the 5-HT1A receptor. Among other advantageous parameters, contemplated compounds retain high binding affinity, display optimal lipophilicity, and are radiolabeled efficiently with 18F-fluorine in a single step. Still further, contemplated compounds exhibit high target to non-target ratios in receptor-rich regions both in vitro and in vivo, and selected compounds can be effectively and sensitively displaced by serotonin, thus providing a quantitative tool for measuring 5-HT1A receptors and serotonin concentration changes in the living brain.

  17. Syntaxin 1a Variants Lacking an N-peptide or Bearing the LE Mutation Bind

    Office of Scientific and Technical Information (OSTI)

    to Munc18a in a Closed Conformation (Journal Article) | SciTech Connect Syntaxin 1a Variants Lacking an N-peptide or Bearing the LE Mutation Bind to Munc18a in a Closed Conformation Citation Details In-Document Search Title: Syntaxin 1a Variants Lacking an N-peptide or Bearing the LE Mutation Bind to Munc18a in a Closed Conformation Authors: Colbert, Karen N. ; Hattendorf, Douglas A. ; Weiss, Thomas M. ; Burkhardt, Pawel ; Fasshauer, Dirk ; Weis, William I. Publication Date: 2014-05-13 OSTI

  18. XOP 2.1 - a new version of the x-ray optics software toolkit. (Conference)

    Office of Scientific and Technical Information (OSTI)

    | SciTech Connect XOP 2.1 - a new version of the x-ray optics software toolkit. Citation Details In-Document Search Title: XOP 2.1 - a new version of the x-ray optics software toolkit. No abstract prepared. Authors: Sanchez del Rio, M. ; Dejus, R. J. Publication Date: 2003-09-09 OSTI Identifier: 828855 Report Number(s): ANL/XFD/CP-111417 TRN: US0404349 DOE Contract Number: W-31-109-ENG-38 Resource Type: Conference Resource Relation: Conference: 8th International Conference on Synchrotron

  19. Development and Characterization of a Multiplexed RT-PCR Species Specific Assay for Bovine and one for Porcine Foot-and-Mouth Disease Virus Rule-Out Supplemental Materials

    SciTech Connect (OSTI)

    Smith, S; Danganan, L; Tammero, L; Lenhoff, R; Naraghi-arani, P; Hindson, B

    2007-08-06

    Lawrence Livermore National Laboratory (LLNL), in collaboration with the Department of Homeland Security (DHS) and the United States Department of Agriculture (USDA), Animal and Plant Health Inspection Services (APHIS) has developed advanced rapid diagnostics that may be used within the National Animal Health Laboratory Network (NAHLN), the National Veterinary Services Laboratory (Ames, Iowa) and the Plum Island Animal Disease Center (PIADC). This effort has the potential to improve our nation's ability to discriminate between foreign animal diseases and those that are endemic using a single assay, thereby increasing our ability to protect animal populations of high economic importance in the United States. Under 2005 DHS funding we have developed multiplexed (MUX) nucleic-acid-based PCR assays that combine foot-and-mouth disease virus (FMDV) detection with rule-out tests for two other foreign animal diseases Vesicular Exanthema of Swine (VESV) and Swine Vesicular Disease (SVD) and four other domestic viral diseases Bovine Viral Diarrhea Virus (BVDV), Bovine Herpes Virus 1 (BHV-1 or Infectious Bovine Rhinotracheitus IBR), Bluetongue virus (BTV) and Parapox virus complex (which includes Bovine Papular Stomatitis Virus BPSV, Orf of sheep, and Pseudocowpox). Under 2006 funding we have developed a Multiplexed PCR [MUX] porcine assay for detection of FMDV with rule out tests for VESV and SVD foreign animal diseases in addition to one other domestic vesicular animal disease vesicular stomatitis virus (VSV) and one domestic animal disease of swine porcine reproductive and respiratory syndrome (PRRS). We have also developed a MUX bovine assay for detection of FMDV with rule out tests for the two bovine foreign animal diseases malignant catarrhal fever (MCF), rinderpest virus (RPV) and the domestic diseases vesicular stomatitis virus (VSV), bovine viral diarrhea virus (BVDV), infectious bovine rhinotracheitus virus (BHV-1), bluetongue virus (BTV), and the Parapox viruses which are of two bovine types bovine papular stomatitis virus (BPSV) and psuedocowpox (PCP). This document provides details of signature generation, evaluation, and testing, as well as the specific methods and materials used. A condensed summary of the development, testing and performance of the multiplexed assay panel was presented in a 126 page separate document, entitled 'Development and Characterization of A Multiplexed RT-PCR Species Specific Assay for Bovine and one for Porcine Foot-and-Mouth Disease Virus Rule-Out'. This supplemental document provides additional details of large amount of data collected for signature generation, evaluation, and testing, as well as the specific methods and materials used for all steps in the assay development and utilization processes. In contrast to last years effort, the development of the bovine and porcine panels is pending additional work to complete analytical characterization of FMDV, VESV, VSV, SVD, RPV and MCF. The signature screening process and final panel composition impacts this effort. The unique challenge presented this year was having strict predecessor limitations in completing characterization, where efforts at LLNL must preceed efforts at PIADC, such challenges were alleviated in the 2006 reporting by having characterization data from the interlaboratory comparison and at Plum Island under AgDDAP project. We will present an addendum at a later date with additional data on the characterization of the porcine and bovine multiplex assays when that data is available.

  20. Mirror Advanced Reactor Study (MARS). Final report. Volume 1-A. Commercial fusion electric plant

    SciTech Connect (OSTI)

    Donohue, M.L.; Price, M.E.

    1984-07-01

    Volume 1-A contains the following chapters: (1) plasma engineering, (2) magnets, (3) ecr heating systems, (4) anchor ion-cyclotron resonance heating system, (5) sloshing ion neutral beam, (6) end cell structure, (7) end plasma technology, (8) fueling, (9) startup ion cyclotron resonant heating systems, and (10) end cell radiation analysis. (MOW)

  1. Canister storage building compliance assessment DOE Order 6430.1A, General Design Criteria

    SciTech Connect (OSTI)

    BLACK, D.M.

    1999-08-12

    This document presents the Project's position on compliance with DOE Order 6430.1A ''General Design Criteria.'' No non-compliances are shown. The compliance statements have been reviewed and approved by DOE. Open items are scheduled to be closed prior to project completion.

  2. Notice of Intent to Revise DOE O 200.1A, Information Technology Management--Withdrawn

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    2011-12-15

    Withdrawn 3-24-14. Although DOE O 200.1A was revised in December 2008, there have been significant changes in IT governance processes and Departmental use of new technologies such as Web 2.0 technologies since that time.

  3. DOE Order 412.1a, Work Authorization System Administrative Change

    Broader source: Energy.gov [DOE]

    "The purpose of this Flash is to inform contracting personnel the department issued an administrative change to DOE Order 412.1a, Work Authorization System. The changes update organizational names, references, websites, etc. Attached is a summary of the change with the updated order. Additionally, the order may be found at: https://www.directives.doe.gov/directives-documents/0412.1-BOrder-A-admchg1"

  4. LittleFoot Energy | Open Energy Information

    Open Energy Info (EERE)

    Zip: 02144 Region: Greater Boston Area Sector: Efficiency Product: Implement thermal storage, geothermal, solar, monitoring and control in hybrid system designs that offset...

  5. EGR Control for Emisson Reduction Using Fast Response Sensors - Phase 1A

    SciTech Connect (OSTI)

    Gravel, Roland; Conley, Jason; Kittelson, David

    2008-09-30

    The overall objective of this project was to develop exhaust gas recirculation (EGR) control strategies using fast-response Particulate Matter (PM) sensors and NOx sensors to improve the quality of particulate and gaseous emissions from diesel engines. This project initially comprised three phases: (1) Phase IA - sensor requirements to meet PM sensor specifications, NOx sensor assessment, and initial model development for EGR control; (2) Phase IB - continue development on PM and NOx sensors, integrate the sensor signals into the control simulations, and finalize model development for control strategies; and (3) Phase II - validation testing of the control strategies. Only Phase 1A was funded by DOE and executed by Honeywell. The major objectives of Phase 1A of the project included: (1) Sensor validation and operation of fast-response PM and NOx sensors; (2) Control system modeling of low-pressure EGR controls, development of control strategies, and initial evaluation of these models and strategies for EGR control in diesel engines; (3) Sensor testing to understand applicability of fast-response PM sensors in determining loading rates of the particle trap; and (4) Model validation and sensor testing under steady-state and transient operational conditions of actual engines. In particular, specific objectives included demonstration of: (1) A PM sensor response time constant (T10 - T90) of better than 100 milliseconds (msec); (2) The ability to detect PM at concentrations from 0.2 to 2 Bosch smoke number (BSN) or equivalent; (3) PM sensor accuracy to within 20% BSN over the entire range of operation; and (4) PM sensor repeatability to within 10% over the PM entire sensor range equivalent to a BSN of 0.2 to 2.

  6. Inverter Load Rejection Over-Voltage Testing: SolarCity CRADA Task 1a Final Report

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Inverter Load Rejection Over-Voltage Testing SolarCity CRADA Task 1a Final Report A. Nelson, A. Hoke, and S. Chakraborty National Renewable Energy Laboratory J. Chebahtah, T. Wang, and B. Zimmerly SolarCity Corporation Technical Report NREL/TP-5D00-63510 February 2015 NREL is a national laboratory of the U.S. Department of Energy Office of Energy Efficiency & Renewable Energy Operated by the Alliance for Sustainable Energy, LLC This report is available at no cost from the National Renewable

  7. Synthesis of heterocycles: Indolo (2,1-a) isoquinolines, renewables, and aptamer ligands for cellular imaging

    SciTech Connect (OSTI)

    Beasley, Jonathan

    2013-05-07

    In this thesis, we explore both total syntheses and methodologies of several aromatic heterocyclic molecules. Extensions of the Kraus indole synthesis toward 2-substituted and 2,3-disubstituted indoles, as well as biologically attractive indolo[2,1-a]isoquinolines are described. Recent renewable efforts directed to commodity maleic acid and the first reported furan-based ionic liquids are described. Our total synthesis of mRNA aptamer ligand PDC-Gly, and its dye coupled forms, plus aminoglycoside dye coupled ligands used in molecular imaging, are described.

  8. Computer media security considerations: DOE Order 5635. 1A and DOE Order 5637. 1

    SciTech Connect (OSTI)

    Clever, J.J.

    1988-01-01

    This paper suggests that the examples for marking computer and word processing media and the written specifications for marking word processing media, contained in Chapter III, DOE Order 5635.1A, are technically incorrect. SNLA study indicates that strict compliance can lead to damage to the computer media drive and/or media itself. A model for technically appropriate marking is recommended which would facilitate longer distance visual identification of sensitive media, allow proper human readable identification of the classification levels, categories, special access/handling, and accountability/control data as applicable to the specific media. A diskette labeling example is provided which will meet the model requirements and which will not adversely act to cause damage to either the computer drive or the media. 5 refs., 15 figs.

  9. Experiment summary for n/y attenuation through materials (Environments 1A).

    SciTech Connect (OSTI)

    DePriest, Kendall Russell

    2006-05-01

    The Radiation Effects Sciences (RES) program is responsible for conducting Neutron Gamma Energy Transport (NuGET) code validation. In support of this task, a series of experiments were conducted in the annular core research reactor (ACRR) to investigate the modification of the incident neutron/gamma environment by aluminum (Al6061) and high-density polyethylene (HDPE) spheres with 4-in and 7-in-diameter. The experiment series described in this report addresses several NuGET validation concerns. The validation experiment series also addresses the design and execution of proper reactor testing to match the hostile radiation environments and to match the component stresses that arise from the hostile radiation environments. This report summarizes the RES Validation: n/{gamma} Attenuation through Materials, Environments 1A, experiments conducted at the ACRR in FY 2003 using ACRR Experiment Plans 933 and 949.

  10. MREG V1.1 : a multi-scale image registration algorithm for SAR applications.

    SciTech Connect (OSTI)

    Eichel, Paul H.

    2013-08-01

    MREG V1.1 is the sixth generation SAR image registration algorithm developed by the Signal Processing&Technology Department for Synthetic Aperture Radar applications. Like its predecessor algorithm REGI, it employs a powerful iterative multi-scale paradigm to achieve the competing goals of sub-pixel registration accuracy and the ability to handle large initial offsets. Since it is not model based, it allows for high fidelity tracking of spatially varying terrain-induced misregistration. Since it does not rely on image domain phase, it is equally adept at coherent and noncoherent image registration. This document provides a brief history of the registration processors developed by Dept. 5962 leading up to MREG V1.1, a full description of the signal processing steps involved in the algorithm, and a user's manual with application specific recommendations for CCD, TwoColor MultiView, and SAR stereoscopy.

  11. NEW - DOE O 329.1A Chg 1 (Admin Chg), Excepted Service Authorities for EJ and EK Pay Plans

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    The order establishes requirements and responsibilities for the employment and compensation of individuals when using DOE expected service authorities. Supersedes DOE O 329.1A.

  12. TANK 18 AND 19-F TIER 1A EQUIPMENT FILL MOCK UP TEST SUMMARY

    SciTech Connect (OSTI)

    Stefanko, D.; Langton, C.

    2011-11-04

    The United States Department of Energy (US DOE) has determined that Tanks 18-F and 19-F have met the F-Tank Farm (FTF) General Closure Plan Requirements and are ready to be permanently closed. The high-level waste (HLW) tanks have been isolated from FTF facilities. To complete operational closure they will be filled with grout for the purpose of: (1) physically stabilizing the tanks, (2) limiting/eliminating vertical pathways to residual waste, (3) discouraging future intrusion, and (4) providing an alkaline, chemical reducing environment within the closure boundary to control speciation and solubility of select radionuclides. Bulk waste removal and heel removal equipment remain in Tanks 18-F and 19-F. This equipment includes the Advance Design Mixer Pump (ADMP), transfer pumps, transfer jets, standard slurry mixer pumps, equipment-support masts, sampling masts, dip tube assemblies and robotic crawlers. The present Tank 18 and 19-F closure strategy is to grout the equipment in place and eliminate vertical pathways by filling voids in the equipment to vertical fast pathways and water infiltration. The mock-up tests described in this report were intended to address placement issues identified for grouting the equipment that will be left in Tank 18-F and Tank 19-F. The Tank 18-F and 19-F closure strategy document states that one of the Performance Assessment (PA) requirements for a closed tank is that equipment remaining in the tank be filled to the extent practical and that vertical flow paths 1 inch and larger be grouted. The specific objectives of the Tier 1A equipment grout mock-up testing include: (1) Identifying the most limiting equipment configurations with respect to internal void space filling; (2) Specifying and constructing initial test geometries and forms that represent scaled boundary conditions; (3) Identifying a target grout rheology for evaluation in the scaled mock-up configurations; (4) Scaling-up production of a grout mix with the target rheology (16 second flow cone value) from 0.25 cubic feet to 4.3 cubic feet. (Ten 0.43 cubic batches were produced because full-scale equipment was not available for the Tier 1A test.); (5) Demonstrating continuous gravity filling of the ADMP mock up test form; (6) Demonstrating continuous gravity filling of 1 inch and 2 inch schedule 40 pipe; and (7) Demonstrating filling of 1 inch and 2 inch schedule 40 pipe from the bottom up by discharging through a tube inserted into the pipes. The Tier 1A mock-up test focused on the ADMP and pipes at least one inch in diameter. The ADMP which is located in center riser of Tank 18-F is a concern because the column for this long-shaft (55 ft) pump is unique and modification to the pump prior to placing it in service limited the flow path options for filling by creating a single flow path for filling and venting the ADMP support column. The large size, vertical orientation, and complicated flow path in the ADMP warrants a detailed description of this piece of ancillary equipment.

  13. A materials compatibility study in FM-1, a liquid component of a paste extrudable explosive

    SciTech Connect (OSTI)

    Goods, S.H.; Shepodd, T.J.; Mills, B.E.; Foster, P.

    1993-09-01

    The chemical compatibility of various metallic and organic containment materials with a constituent of a paste extrudable explosive (PEX) has been examined through a series of long-term exposures. Corrosion coupons and mechanical test specimens (polymers only) were exposed to FM-1, a principal liquid component of PEX, at 74{degree}C. RX-08-FK is the LLNL designator for this formulation. Compatibility was determined by measuring changes in weight, physical dimensions, and mechanical properties, by examining the coupons for discoloration, surface attack, and corrosion products, and by analyzing for dissolved metals in the FM-1. Of the metals and alloys examined, none of the 300 series stainless steels exhibited adequate corrosion resistance after 74 days of exposure. Copper showed evidence of severe uniform surface attack. Monel 400 also exhibited signs of chemical attack. Nickel and tantalum showed less evidence of attack, although neither, was immune to the liquid. Gold coupons developed a ``tarnish`` film. The gold along with an aluminum alloy, 6061 (in the T6 condition) performed the most satisfactorily. A wide range of polymers were tested for 61 days at 74{degree}C. The materials that exhibited the most favorable response in terms of weight change, dimensional stability, and mechanical properties were Kalrez, PTFE Teflon, and polyethylene.

  14. Environmental impact of Yucca Mountain repository after Urex+1a separation

    SciTech Connect (OSTI)

    Djokic, Denia; Ahn, Joonhong

    2007-07-01

    The environmental impact of Yucca Mountain Repository (YMR), expressed as the radiotoxicity of radionuclides released from failed waste packages, has been evaluated for the case of partitioning and vitrification the 63,000 MT of commercial spent nuclear fuel (CSNF) currently designated for disposal. A parametric study on the effect of fuel cycle parameters on environmental impact has also been conducted. CSNF inventory has been evaluated by using ORIGEN2. UREX+1a separation is considered as the base case, and the removal of individual nuclide groups has also been investigated. Of particular interest is the effect of Cs/Sr removal on the waste loading of a canister. An existing waste-conditioning model for high-level liquid waste (HLLW) solidification with borosilicate glass is used to determine the composition and waste loading of a vitrified waste canister by a set of waste loading constraints. A previously developed release model has been applied to evaluate the environmental impact of the vitrified waste packages in YMR. Numerical results show that while the removal of Tc and Cs/Sr does not have an effect on the environmental impact profile, it is linearly sensitive to separation efficiency of actinides. The uncertainty associated with the environmental impact resulting from the uncertainties of radionuclide solubility values has been computed. It was determined that in the case of U, TRU, Tc, and Cs/Sr inventory reduction by a factor of 100 and subsequent vitrification, the repository footprint would decrease by a factor of 3.4, implying that 3.4 times more electricity generation could be accommodated while the environmental impact is up to a factor of 100 smaller than the direct disposal case. (authors)

  15. miR-4295 promotes cell proliferation and invasion in anaplastic thyroid carcinoma via CDKN1A

    SciTech Connect (OSTI)

    Shao, Mingchen; Geng, Yiwei; Lu, Peng; Xi, Ying; Wei, Sidong; Wang, Liuxing; Fan, Qingxia; Ma, Wang

    2015-09-04

    MicroRNAs (miRNAs) play important roles in the pathogenesis of many types of cancers by negatively regulating gene expression at posttranscriptional level. However, the role of microRNAs in anaplastic thyroid carcinoma (ATC), has remained elusive. Here, we identified that miR-4295 promotes ATC cell proliferation by negatively regulates its target gene CDKN1A. In ATC cell lines, CCK-8 proliferation assay indicated that the cell proliferation was promoted by miR-4295, while miR-4295 inhibitor significantly inhibited the cell proliferation. Transwell assay showed that miR-4295 mimics significantly promoted the migration and invasion of ATC cells, whereas miR-4295 inhibitors significantly reduced cell migration and invasion. luciferase assays confirmed that miR-4295 directly bound to the 3'untranslated region of CDKN1A, and western blotting showed that miR-4295 suppressed the expression of CDKN1A at the protein levels. This study indicated that miR-4295 negatively regulates CDKN1A and promotes proliferation and invasion of ATC cell lines. Thus, miR-4295 may represent a potential therapeutic target for ATC intervention. - Highlights: • miR-4295 mimics promote the proliferation and invasion of ATC cells. • miR-4295 inhibitors inhibit the proliferation and invasion of ATC cells. • miR-4295 targets 3′UTR of CDKN1A in ATC cells. • miR-4295 negatively regulates CDKN1A in ATC cells.

  16. HIC1 interacts with a specific subunit of SWI/SNF complexes, ARID1A/BAF250A

    SciTech Connect (OSTI)

    Van Rechem, Capucine; Boulay, Gaylor; Leprince, Dominique

    2009-08-07

    HIC1, a tumor suppressor gene epigenetically silenced in many human cancers encodes a transcriptional repressor involved in regulatory loops modulating p53-dependent and E2F1-dependent cell survival and stress responses. HIC1 is also implicated in growth control since it recruits BRG1, one of the two alternative ATPases (BRM or BRG1) of SWI/SNF chromatin-remodeling complexes to repress transcription of E2F1 in quiescent fibroblasts. Here, through yeast two-hybrid screening, we identify ARID1A/BAF250A, as a new HIC1 partner. ARID1A/BAF250A is one of the two mutually exclusive ARID1-containing subunits of SWI/SNF complexes which define subsets of complexes endowed with anti-proliferative properties. Co-immunoprecipitation assays in WI38 fibroblasts and in BRG1-/- SW13 cells showed that endogenous HIC1 and ARID1A proteins interact in a BRG1-dependent manner. Furthermore, we demonstrate that HIC1 does not interact with BRM. Finally, sequential chromatin immunoprecipitation (ChIP-reChIP) experiments demonstrated that HIC1 represses E2F1 through the recruitment of anti-proliferative SWI/SNF complexes containing ARID1A.

  17. Work plan for phase 1A paleochannel studies at the Cheney disposal cell, Grand Junction, Colorado: Draft

    SciTech Connect (OSTI)

    1996-11-01

    This document will serve as a Work Plan for continuing paleochannel characterization activities at the Cheney disposal site near Grand Junction, Colorado. Elevated levels of nitrate were encountered in ground water from two monitor wells installed in alluvial paleochannels near the Cheney disposal cell in 1994. This triggered a series of investigations (Phase 1) designed to determine the source of nitrate and other chemical constituents in ground water at the site. A comprehensive summary of the Phase 1 field investigations (limited to passive monitoring and modeling studies) conducted by the Remedial Action Contractor (RAC) and Technical Assistance Contractor (TAC) to date is provided in Section 2.0 of this document. Results of Phase 1 were inconclusive regarding the potential interaction between the disposal cell and the paleochannels, so additional Phase 1A investigations are planned. Recommendations for Phase 1A tasks and possible future activities are discussed in Section 3.0. Detailed information on the implementation of the proposed Phase 1A tasks appears in Section 4.0 and will provide the basis for Statements of Work (SOW) for each of these tasks. A detailed sampling plan is provided to ensure quality and a consistency with previous data collection efforts.

  18. TRUPACT-I Unit 0 test data analysis. [Puncture bar impacts; free fall of package 12 inches onto unyielding surface; 30-foot free fall drop onto unyielding target; 40-inch drops onto 6-inch diagmeter puncture bar; engulfment in jet fuel fire for 35 minutes

    SciTech Connect (OSTI)

    Romesberg, L.E.; Hudson, M.L.; Osborne, D.M.

    1985-09-01

    TRUPACT-I was tested to evaluate the response of the design to the normal and hypothetical accident conditions specified in applicable regulations. The governing regulations are contained in DOE Order No. 5480.1, Chapter 3 and 10 CFR, Part 71, Refs. 1 and 2. Tests were conducted at Oak Ridge National Laboratory, Oak Ridge, TN, and at Sandia National Laboratories, Albuquerque, NM. Normal condition tests included three 13-pound (1.25 in. diameter) puncture bar impacts onto the exterior surface and free fall of the package 12 inches onto an essentially unyielding surface. Hypothetical accident conditions included in the test sequence were two 30-foot free fall drops of the package onto an essentially unyielding target, four 40-inch drops onto a 6-inch-diameter puncture bar, and engulfment in a JP-4 jet fuel fire for 35 minutes. Instrumentation data traces will be published in Ref. 3 and are not reproduced herein. This report presents an analysis of the available data and an interpretation of the results. The results of the tests are compared to results from numerical analyses and scale model tests which are incorporated in the TRUPACT-I SARP, Ref. 4. 9 refs., 43 figs., 3 tabs.

  19. Fixing two-nucleon weak-axial coupling L{sub 1,A} from {mu}{sup -}d capture

    SciTech Connect (OSTI)

    Chen, J.-W.; Inoue, Takashi; Ji Xiangdong; Li Yingchuan

    2005-12-15

    We calculate the muon capture rate on the deuteron to next-to-next-to-leading order in the pionless effective field theory. The result can be used to constrain the two-nucleon isovector axial coupling L{sub 1,A} to {+-}2 fm{sup 3} if the muon capture rate is measured to the 2% level. From this, one can determine the neutrino-deuteron breakup reactions and the pp fusion cross section in the sun to the same level of accuracy.

  20. Prospects for the study of the {tau}-tilde system in SPS1a' at the ILC

    SciTech Connect (OSTI)

    Bechtle, Philip; Berggren, Mikael; List, Jenny; Schade, Peter; Stempel, Olga

    2010-09-01

    The prospects for the analysis of {tau} channels at the supersymmetry (SUSY) benchmark point SPS1a', especially from e{sup +}e{sup -{yields}{tau}}-tilde{sub 1}{sup +{tau}}-tilde{sub 1}{sup -} and e{sup +}e{sup -{yields}{tau}}-tilde{sub 2}{sup +{tau}}-tilde{sub 2}{sup -}, have been studied in full simulation of the ILD detector concept foreseen for the International Linear Collider. All accessible SUSY channels as well as all standard model backgrounds were generated at a center-of-mass energy E{sub CMS}=500 GeV, including the beam energy spectrum and beam backgrounds expected for nominal ILC beam parameters. With an integrated luminosity of 500 fb{sup -1} delivered to the experiment, the masses of the {tau}-tilde{sub 1} and {tau}-tilde{sub 2} can be measured to 107.73{sub -0.05}{sup +0.03} GeV{+-}1.1{center_dot}{delta}M{sub {chi}-}tilde{sub 1}{sup 0} and 183{sub -5}{sup +11} GeV{+-}18{center_dot}{delta}M{sub {chi}-}tilde{sub 1}{sup 0}, respectively, while the true values in SPS1a' are 107.9 GeV and 194.9 GeV, respectively. This corresponds to {delta}M{sub {tau}-}tilde{sub 1}/M{sub {tau}-}tilde{sub 1{approx}}0.1% and {delta}M{sub {tau}-}tilde{sub 2}/M{sub {tau}-}tilde{sub 2{approx}}3% with reasonable assumptions on {delta}M{sub {chi}-}tilde{sub 1}{sup 0}. The cross sections for {tau}-tilde{sub 1} and {tau}-tilde{sub 2} pair production could be obtained with a precision of 3.1% and 4.2%, respectively. Combining the mass and cross section measurement in the {tau}-tilde{sub 2} channel allows to determine the LSP mass with a relative error of 1.7%, assuming a known {tau}-tilde mixing angle. In {tau}-tilde{sub 1{yields}{tau}{chi}}-tilde{sub 1}{sup 0} decays, the {tau} polarization is measured to be 91{+-}9% and 86{+-}5% in the {pi} and {rho} decay channels of the {tau}, respectively. The true value in the simulated SPS1a' sample is 89.6%.

  1. User`s manual for EROSION/MOD1: A computer program for fluids-solids erosion

    SciTech Connect (OSTI)

    Lyczkowski, R.W.; Bouillard, J.X.; Folga, S.M.; Chang, S.L.

    1992-09-01

    This report describes EROSION/MOD1, a computer program that was developed as a two-dimensional analytical tool for the general analysis of erosion in fluid-solids systems and the specific analysis of erosion in bubbling fluidized-bed combustors. Contained herein are implementations of Finnie`s impaction erosion model, Neilson and Gilchrist`s combined ductile and brittle erosion model, and several forms of the monolayer energy dissipation erosion model. These models and their implementations are described briefly. The global structure of EROSION/MOD1 that contains these models is also discussed. The input data for EROSION/MOD1 are given, and a sample problem for a fluidized bed is described. The hydrodynamic input data are assumed to come from the output of FLUFIX/MOD2.

  2. ARM - Publications: Science Team Meeting Documents: Comparison...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Kollias, Pavlos RSMASUniversity of Miami Albrecht, Bruce University of Miami The Department of Energy (DOE) Atmospheric Radiation Measurements (ARM) Program operates a ...

  3. Car Charging Group Inc | Open Energy Information

    Open Energy Info (EERE)

    search Name: Car Charging Group, Inc. Place: Miami Beach, Florida Product: Miami Beach, USA based installer of plug-in vehicle charge equipment. References: Car Charging Group,...

  4. ARM - Publications: Science Team Meeting Documents: Clouds and...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Clouds and radiation in the Arctic coastal system - effects of local heterogeneity Key, Erica University of Miami, RSMAS Minnett, Peter University of Miami Improving our...

  5. The eukaryotic translation elongation factor eEF1A2 induces neoplastic properties and mediates tumorigenic effects of ZNF217 in precursor cells of human ovarian carcinomas

    SciTech Connect (OSTI)

    Sun, Yu; Wong, Nicholas; Guan, Yinghui; Salamanca, Clara M.; Cheng, Jung Chien; Lee, Jonathan M.; Gray, Joe W.; Auersperg, Nelly

    2008-04-25

    Ovarian epithelial carcinomas (OEC) frequently exhibit amplifications at the 20q13 locus which is the site of several oncogenes, including the eukaryotic elongation factor EEF1A2 and the transcription factor ZNF217. We reported previously that overexpressed ZNF217 induces neoplastic characteristics in precursor cells of OEC. Unexpectedly, ZNF217, which is a transcriptional repressor, enhanced expression of eEF1A2. In this study, array comparative genomic hybridization, single nucleotide polymorphism and Affymetrix analysis of ZNF217-overexpressing cell lines confirmed consistently increased expression of eEF1A2 but not of other oncogenes, and revealed early changes in EEF1A2 gene copy numbers and increased expression at crisis during immortalization. We defined the influence of eEF1A2 overexpression on immortalized ovarian surface epithelial cells, and investigated interrelationships between effects of ZNF217 and eEF1A2 on cellular phenotypes. Lentivirally induced eEF1A2 overexpression caused delayed crisis, apoptosis resistance and increases in serum-independence, saturation densities, and anchorage independence. siRNA to eEF1A2 reversed apoptosis resistance and reduced anchorage independence in eEF1A2-overexpressing lines. Remarkably, siRNA to eEF1A2 was equally efficient in inhibiting both anchorage independence and resistance to apoptosis conferred by ZNF217 overexpression. Our data define neoplastic properties that are caused by eEF1A2 in nontumorigenic ovarian cancer precursor cells, and suggest that eEF1A2 plays a role in mediating ZNF217-induced neoplastic progression.

  6. Evaluation of LLTR Series II tests A-1A and A-1B test results. [Large Leak Test Rig

    SciTech Connect (OSTI)

    Shoopak, B F; Amos, J C; Norvell, T J

    1980-03-01

    The standard methodology, with minor modifications provides conservative yet realistic predictions of leaksite and other sodium system pressures in the LLTR Series II vessel and piping. The good agreement between predicted and measured pressures indicates that the TRANSWRAP/RELAP modeling developed from the Series I tests is applicable to larger scale units prototypical of the Clinch River steam generator design. Calculated sodium system pressures are sensitive to several modeling parameters including rupture disc modeling, acoustic velocity in the test vessel, and flow rate from the rupture tube. The acoustic velocity which produced best agreement with leaksite pressures was calculated based on the shroud diameter and shroud wall thickness. The corresponding rupture tube discharge coefficient was that of the standard design methodology developed from Series I testing. As found in Series I testing, the Series II data suggests that the leading edge of the flow in the relief line is two phase for a single, doubled-ended guillotine tube rupture. The steam generator shroud acts as if it is relatively transparent to the transmission of radial pressures to the vessel wall. Slightly lower sodium system maximum pressures measured during Test A-1b compared to Test A-1a are attributed to premature failure (failure at a lower pressure) of the rupture disc in contact with the sodium for test A-1b. The delay in failure of the second disc in Test A-1b, which was successfully modeled with TRANSWRAP, is attributed to the limited energy in the nitrogen injection.

  7. Foote Creek Rim I Wind Farm | Open Energy Information

    Open Energy Info (EERE)

    In Service Owner PacifiCorpEugene Water & Electric Board Developer SeaWestTomen Energy Purchaser PacifiCorpEugene Water & Electric Board Location Carbon County WY...

  8. Microsoft Word - Chemetall Foote_Kings Mountain and Silver Peak...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    ... 3.2.1 Air Quality and Greenhouse Gas ......Management Agency FIRM Flood Rate Insurance Map FONSI Finding of No Significant ...

  9. Sample Business Plan Framework 1: A program seeking to continue operations in the post-grant period as a not-for-profit (NGO) entity

    Broader source: Energy.gov [DOE]

    U.S. Department of Energy Better Buildings Neighborhood Program: Sample Business Plan Framework 1: A program seeking to continue operations in the post-grant period as a not-for-profit (NGO) entity.

  10. Genetic variation in the CYP1A1 gene is related to circulating PCB118 levels in a population-based sample

    SciTech Connect (OSTI)

    Lind, Lars; Penell, Johanna; Syvänen, Anne-Christine; Axelsson, Tomas; Ingelsson, Erik; Morris, Andrew P.; Lindgren, Cecilia; Salihovic, Samira; Bavel, Bert van; Lind, P. Monica

    2014-08-15

    Several of the polychlorinated biphenyls (PCBs), i.e. the dioxin-like PCBs, are known to induce the P450 enzymes CYP1A1, CYP1A2 and CYP1B1 by activating the aryl hydrocarbon receptor (Ah)-receptor. We evaluated if circulating levels of PCBs in a population sample were related to genetic variation in the genes encoding these CYPs. In the population-based Prospective Investigation of the Vasculature in Uppsala Seniors (PIVUS) study (1016 subjects all aged 70), 21 SNPs in the CYP1A1, CYP1A2 and CYP1B1 genes were genotyped. Sixteen PCB congeners were analysed by high-resolution chromatography coupled to high-resolution mass spectrometry (HRGC/ HRMS). Of the investigated relationships between SNPs in the CYP1A1, CYP1A2 and CYP1B1 and six PCBs (congeners 118, 126, 156, 169, 170 and 206) that captures >80% of the variation of all PCBs measured, only the relationship between CYP1A1 rs2470893 was significantly related to PCB118 levels following strict adjustment for multiple testing (p=0.00011). However, there were several additional SNPs in the CYP1A2 and CYP1B1 that showed nominally significant associations with PCB118 levels (p-values in the 0.003–0.05 range). Further, several SNPs in the CYP1B1 gene were related to both PCB156 and PCB206 with p-values in the 0.005–0.05 range. Very few associations with p<0.05 were seen for PCB126, PCB169 or PCB170. Genetic variation in the CYP1A1 was related to circulating PCB118 levels in the general elderly population. Genetic variation in CYP1A2 and CYP1B1 might also be associated with other PCBs. - Highlights: • We studied the relationship between PCBs and the genetic variation in the CYP genes. • Cross sectional data from a cohort of elderly were analysed. • The PCB levels were evaluated versus 21 SNPs in three CYP genes. • PCB 118 was related to variation in the CYP1A1 gene.

  11. Caffeic acid phenethyl ester inhibits 3-MC-induced CYP1A1 expression through induction of hypoxia-inducible factor-1α

    SciTech Connect (OSTI)

    Kim, Hyung Gyun; Han, Eun Hee; Im, Ji Hye; Lee, Eun Ji; Jin, Sun Woo; Jeong, Hye Gwang

    2015-09-25

    Caffeic acid phenethyl ester (CAPE), a natural component of propolis, is reported to have anticarcinogenic properties, although its precise chemopreventive mechanism remains unclear. In this study, we examined the effects of CAPE on 3-methylcholanthrene (3-MC)-induced CYP1A1 expression and activities. CAPE reduced the formation of the benzo[a]pyrene-DNA adduct. Moreover, CAPE inhibited 3-MC-induced CYP1A1 activity, mRNA expression, protein level, and promoter activity. CAPE treatment also decreased 3-MC-inducible xenobiotic-response element (XRE)-linked luciferase, aryl hydrocarbons receptor (AhR) transactivation and nuclear localization. CAPE induced hypoxia inducible factor-1α (HIF-1α) protein level and HIF-1α responsible element (HRE) transcriptional activity. CAPE-mediated HIF-1α reduced 3-MC-inducible CYP1A1 protein expression. Taken together, CAPE decreases 3-MC-mediated CYP1A1 expression, and this inhibitory response is associated with inhibition of AhR and HIF-1α induction. - Highlights: • CAPE reduced the formation of the benzo[a]pyrene-DNA adduct. • CAPE inhibited 3-MC-induced CYP1A1 expression. • CAPE induced HIF-1α induction. • CAPE-mediated HIF-1α reduced 3-MC-inducible CYP1A1 expression.

  12. HTR-PROTEUS Pebble Bed Experimental Program Cores 1, 1A, 2, and 3: Hexagonal Close Packing with a 1:2 Moderator-to-Fuel Pebble Ratio

    SciTech Connect (OSTI)

    John D. Bess; Barbara H. Dolphin; James W. Sterbentz; Luka Snoj; Igor Lengar; Oliver Köberl

    2013-03-01

    In its deployment as a pebble bed reactor (PBR) critical facility from 1992 to 1996, the PROTEUS facility was designated as HTR-PROTEUS. This experimental program was performed as part of an International Atomic Energy Agency (IAEA) Coordinated Research Project (CRP) on the Validation of Safety Related Physics Calculations for Low Enriched HTGRs. Within this project, critical experiments were conducted for graphite moderated LEU systems to determine core reactivity, flux and power profiles, reaction-rate ratios, the worth of control rods, both in-core and reflector based, the worth of burnable poisons, kinetic parameters, and the effects of moisture ingress on these parameters. Four benchmark experiments were evaluated in this report: Cores 1, 1A, 2, and 3. These core configurations represent the hexagonal close packing (HCP) configurations of the HTR-PROTEUS experiment with a moderator-to-fuel pebble ratio of 1:2. Core 1 represents the only configuration utilizing ZEBRA control rods. Cores 1A, 2, and 3 use withdrawable, hollow, stainless steel control rods. Cores 1 and 1A are similar except for the use of different control rods; Core 1A also has one less layer of pebbles (21 layers instead of 22). Core 2 retains the first 16 layers of pebbles from Cores 1 and 1A and has 16 layers of moderator pebbles stacked above the fueled layers. Core 3 retains the first 17 layers of pebbles but has polyethylene rods inserted between pebbles to simulate water ingress. The additional partial pebble layer (layer 18) for Core 3 was not included as it was used for core operations and not the reported critical configuration. Cores 1, 1A, 2, and 3 were determined to be acceptable benchmark experiments.

  13. Sulforaphane inhibits CYP1A1 activity and promotes genotoxicity induced by 2,3,7,8-tetrachlorodibenzo-p-dioxin in vitro

    SciTech Connect (OSTI)

    Yang, Fangxing; Zhuang, Shulin; Zhang, Chao; Dai, Heping; Liu, Weiping

    2013-06-15

    Increasing environmental pollution by carcinogens such as some of persistent organic pollutants (POPs) has prompted growing interest in searching for chemopreventive compounds which are readily obtainable. Sulforaphane (SFN) is isolated from cruciferous vegetables and has the potentials to reduce carcinogenesis through various pathways. In this study, we studied the effects of SFN on CYP1A1 activity and genotoxicity induced by 2,3,7,8-tetrachlorodibenzo-p-dioxin (TCDD). The results showed that SFN inhibited TCDD-induced CYP1A1 activity in H4IIE cells by directly inhibiting CYP1A1 activity, probably through binding to aryl hydrocarbon receptor and/or CYP1A1 revealed by molecular docking. However, SFN promoted TCDD-induced DNA damage in yeast cells and reduced the viability of initiated yeast cells. Besides, it is surprising that SFN also failed to reduce genotoxicity induced by other genotoxic reagents which possess different mechanisms to lead to DNA damage. Currently, it is difficult to predict whether SFN has the potentials to reduce the risk of TCDD based on the conflicting observations in the study. Therefore, further studies should be urgent to reveal the function and mechanism of SFN in the stress of such POPs on human health. - Highlights: Sulforaphane inhibited TCDD-induced CYP1A1 activity in H4IIE cells. Sulforaphane may bind to aryl hydrocarbon receptor and/or CYP1A1. Sulforaphane promoted TCDD-induced DNA damage in yeast cells. Sulforaphane may promote DNA damage by DNA strand breaks or DNA alkylation.

  14. HTR-PROTEUS Pebble Bed Experimental Program Cores 1, 1A, 2, and 3: Hexagonal Close Packing with a 1:2 Moderator-to-Fuel Pebble Ratio

    SciTech Connect (OSTI)

    John D. Bess; Barbara H. Dolphin; James W. Sterbentz; Luka Snoj; Igor Lengar; Oliver Köberl

    2012-03-01

    In its deployment as a pebble bed reactor (PBR) critical facility from 1992 to 1996, the PROTEUS facility was designated as HTR-PROTEUS. This experimental program was performed as part of an International Atomic Energy Agency (IAEA) Coordinated Research Project (CRP) on the Validation of Safety Related Physics Calculations for Low Enriched HTGRs. Within this project, critical experiments were conducted for graphite moderated LEU systems to determine core reactivity, flux and power profiles, reaction-rate ratios, the worth of control rods, both in-core and reflector based, the worth of burnable poisons, kinetic parameters, and the effects of moisture ingress on these parameters. Four benchmark experiments were evaluated in this report: Cores 1, 1A, 2, and 3. These core configurations represent the hexagonal close packing (HCP) configurations of the HTR-PROTEUS experiment with a moderator-to-fuel pebble ratio of 1:2. Core 1 represents the only configuration utilizing ZEBRA control rods. Cores 1A, 2, and 3 use withdrawable, hollow, stainless steel control rods. Cores 1 and 1A are similar except for the use of different control rods; Core 1A also has one less layer of pebbles (21 layers instead of 22). Core 2 retains the first 16 layers of pebbles from Cores 1 and 1A and has 16 layers of moderator pebbles stacked above the fueled layers. Core 3 retains the first 17 layers of pebbles but has polyethylene rods inserted between pebbles to simulate water ingress. The additional partial pebble layer (layer 18) for Core 3 was not included as it was used for core operations and not the reported critical configuration. Cores 1, 1A, 2, and 3 were determined to be acceptable benchmark experiments.

  15. Biophysical Analysis of Anopheles gambiae Leucine-Rich Repeat Proteins APL1A1, APL1B and APL1C and Their Interaction with LRIM1

    DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

    Williams, Marni; Summers, Brady J.; Baxter, Richard H. G.; Kobe, Bostjan

    2015-03-16

    Natural infection of Anopheles gambiae by malaria-causing Plasmodium parasites is significantly influenced by the APL1 genetic locus. The locus contains three closely related leucine-rich repeat (LRR) genes, APL1A, APL1B and APL1C. Multiple studies have reported the participation of APL1A—C in the immune response of A. gambiae to invasion by both rodent and human Plasmodium isolates. APL1C forms a heterodimer with the related LRR protein LRIM1 via a C-terminal coiled-coil domain that is also present in APL1A and APL1B. The LRIM1/APL1C heterodimer protects A. gambiae from infection by binding the complement-like protein TEP1 to form a stable and active immune complex.more » We report solution x-ray scatting data for the LRIM1/APL1C heterodimer, the oligomeric state of LRIM1/APL1 LRR domains in solution and the crystal structure of the APL1B LRR domain. The LRIM1/APL1C heterodimeric complex has a flexible and extended structure in solution. In contrast to the APL1A, APL1C and LRIM1 LRR domains, the APL1B LRR domain is a homodimer. The crystal structure of APL1B-LRR shows that the homodimer is formed by an N-terminal helix that complements for the absence of an N-terminal capping motif in APL1B, which is a unique distinction within the LRIM1/APL1 protein family. Full-length APL1A1 and APL1B form a stable complex with LRIM1. Our results support a model in which APL1A1, APL1B and APL1C can all form an extended, flexible heterodimer with LRIM1, providing a repertoire of functional innate immune complexes to protect A. gambiae from a diverse array of pathogens.« less

  16. Proteomic analysis of trichloroethylene-induced alterations in expression, distribution, and interactions of SET/TAF-Iα and two SET/TAF-Iα-binding proteins, eEF1A1 and eEF1A2, in hepatic L-02 cells

    SciTech Connect (OSTI)

    Hong, Wen-Xu; Yang, Liang; Chen, Moutong; Yang, Xifei; Ren, Xiaohu; Fang, Shisong; Ye, Jinbo; Huang, Haiyan; Peng, Chaoqiong; Zhou, Li; Huang, Xinfeng; Yang, Fan; Wu, Desheng; Zhuang, Zhixiong; Liu, Jianjun

    2012-09-01

    Emerging evidence indicates that trichloroethylene (TCE) exposure causes severe hepatotoxicity. However, the mechanisms of TCE hepatotoxicity remain unclear. Recently, we reported that TCE exposure up-regulated the expression of the oncoprotein SET/TAF-Iα and SET knockdown attenuated TCE-induced cytotoxicity in hepatic L-02 cells. To decipher the function of SET/TAF-Iα and its contributions to TCE-induced hepatotoxicity, we employed a proteomic analysis of SET/TAF-Iα with tandem affinity purification to identify SET/TAF-Iα-binding proteins. We identified 42 novel Gene Ontology co-annotated SET/TAF-Iα-binding proteins. The identifications of two of these proteins (eEF1A1, elongation factor 1-alpha 1; eEF1A2, elongation factor 1-alpha 2) were confirmed by Western blot analysis and co-immunoprecipitation (Co-IP). Furthermore, we analyzed the effects of TCE on the expression, distribution and interactions of eEF1A1, eEF1A2 and SET in L-02 cells. Western blot analysis reveals a significant up-regulation of eEF1A1, eEF1A2 and two isoforms of SET, and immunocytochemical analysis reveals that eEF1A1 and SET is redistributed by TCE. SET is redistributed from the nucleus to the cytoplasm, while eFE1A1 is translocated from the cytoplasm to the nucleus. Moreover, we find by Co-IP that TCE exposure significantly increases the interaction of SET with eEF1A2. Our data not only provide insights into the physiological functions of SET/TAF-Iα and complement the SET interaction networks, but also demonstrate that TCE exposure induces alterations in the expression, distribution and interactions of SET and its binding partners. These alterations may constitute the mechanisms of TCE cytotoxicity. -- Highlights: ► Identify 62 SET/TAF-Iα-associated proteins in human L-02 cells ► Trichloroethylene (TCE) alters the interaction of SET with eEF1A1 and eEF1A2. ► TCE induces the translocation and up-regulation of SET. ► TCE induces the translocation and up-regulation of eEF1A.

  17. Addendum 1 - A5 CA

    National Nuclear Security Administration (NNSA)

    ... Bourcier, Andrew F. B., Carol J. Bruton, Steven F. Carl, Annie B. Kersting, Gayle A. Pawloski, Joseph A. Rard, Dana E. Shumaker, David K. Smith, and Andrew F. B. Tompson, March 23, ...

  18. Page1A.PDF

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Probabilistic Mechanics and Structural and Geotechnical Reliability, Y.K. Lin ed., ASCE, July 1992. Fatigue Life Variability and Reliability Analysis of a Wind Turbine Blade* Paul...

  19. c1a.xls

    Gasoline and Diesel Fuel Update (EIA)

    EIA-871A, C, and E of the 2003 Commercial Buildings Energy Consumption Survey. See "Guide to the Tables" or "Glossary" for further explanations of the terms used in this table....

  20. c1a.xls

    Gasoline and Diesel Fuel Update (EIA)

    ... 3,825 63,560 6,149 10,402 3,445 1,987 181 536 Buildings with Water Heating ... 3,659 62,827 6,158 10,202 3,379 2,035 218 525 Notes: Site...

  1. Evaluation of Carrying Capacity : Measure 7.1A of the Northwest Power Planning Council`s 1994 Fish and Wildlife Program : Report 1 of 4, Final Report.

    SciTech Connect (OSTI)

    Neitzel, Duane A.; Johnson, Gary E.

    1996-05-01

    This report is one of four that the Pacific Northwest National Laboratory (PNNL) staff prepared to address Measure 7.1A in the Northwest Power Planning Council's (Council) Fish and Wildlife Program (Program) dated december 1994 (NPPC 1994). Measure 7.1A calls for the Bonneville Power Administration (BPA) to fund an evaluation of salmon survival, ecology, carrying capacity, and limiting factors in freshwater, estuarine, and marine habitats. Additionally, the Measure asks for development of a study plan based on critical uncertainties and research needs identified during the evaluation. This report deals with the evaluation of carrying capacity. It describes the analysis of different views of capacity as it relates to salmon survival and abundance. The report ends with conclusions and recommendations for studying carrying capacity.

  2. C. A. Tulk,1, a) A. M. dos Santos,1 J. C. Neuefeind,1, b) J. J. Molaison,1 B. C. Sales,2 and V. Honkimaeki3

    Office of Scientific and Technical Information (OSTI)

    Density driven structural transformations in amorphous semiconductor clathrates C. A. Tulk,1, a) A. M. dos Santos,1 J. C. Neuefeind,1, b) J. J. Molaison,1 B. C. Sales,2 and V. Honkimaeki3 4) Neutron Sciences Directorate, Oak Ridge National Laboratory, Oak Ridge TN 37831, USA 2) Materials Science and Technology Division, Oak Ridge National Laboratory, Oak Ridge TN 37831, USA 3) European Synchrotron Radiation Facility, F-38043 Grenoble, France (Dated: 20 November 2014) The pressure induced

  3. High Throughput Combinatorial Screening of Biometic Metal-Organic Materials for Military Hydrogen-Storage Materials (New Joint Miami U/NREL DoD/DLA Project) (presentation)

    Broader source: Energy.gov [DOE]

    Presented at the U.S. Department of Energy's Hydrogen Storage Meeting held June 26, 2007 in Bethesda, Maryland.

  4. Hypoxia perturbs aryl hydrocarbon receptor signaling and CYP1A1 expression induced by PCB 126 in human skin and liver-derived cell lines

    SciTech Connect (OSTI)

    Vorrink, Sabine U.; Severson, Paul L.; Kulak, Mikhail V.; Futscher, Bernard W.; Domann, Frederick E.

    2014-02-01

    The aryl hydrocarbon receptor (AhR) is an important mediator of toxic responses after exposure to xenobiotics including 2,3,7,8-tetrachlorodibenzo-p-dioxin (TCDD) and dioxin-like polychlorinated biphenyls (PCBs). Activation of AhR responsive genes requires AhR dimerization with the aryl hydrocarbon receptor nuclear translocator (ARNT), a heterodimeric partner also shared by the hypoxia-inducible factor-1α (HIF-1α) protein. TCDD-stimulated AhR transcriptional activity can be influenced by hypoxia; however, it less well known whether hypoxia interferes with AhR transcriptional transactivation in the context of PCB-mediated AhR activation in human cells. Elucidation of this interaction is important in liver hepatocytes which extensively metabolize ingested PCBs and experience varying degrees of oxygen tension during normal physiologic function. This study was designed to assess the effect of hypoxia on AhR transcriptional responses after exposure to 3,3′,4,4′,5-pentachlorobiphenyl (PCB 126). Exposure to 1% O{sub 2} prior to PCB 126 treatment significantly inhibited CYP1A1 mRNA and protein expression in human HepG2 and HaCaT cells. CYP1A1 transcriptional activation was significantly decreased upon PCB 126 stimulation under conditions of hypoxia. Additionally, hypoxia pre-treatment reduced PCB 126 induced AhR binding to CYP1 target gene promoters. Importantly, ARNT overexpression rescued cells from the inhibitory effect of hypoxia on XRE-luciferase reporter activity. Therefore, the mechanism of interference of the signaling crosstalk between the AhR and hypoxia pathways appears to be at least in part dependent on ARNT availability. Our results show that AhR activation and CYP1A1 expression induced by PCB 126 were significantly inhibited by hypoxia and hypoxia might therefore play an important role in PCB metabolism and toxicity. - Highlights: • Significant crosstalk exists between AhR and HIF-1α signaling. • Hypoxia perturbs PCB 126 induced AhR function and target gene expression. • PCB 126 mediated activation of AhR activity inhibits HIF-1α signaling. • AhR binding to CYP1A1 and CYP1B1 promoters is inhibited by hypoxia. • ARNT overexpression relieves hypoxic inhibition of AhR function.

  5. Collaborating CPU and GPU for large-scale high-order CFD simulations with complex grids on the TianHe-1A supercomputer

    SciTech Connect (OSTI)

    Xu, Chuanfu, E-mail: xuchuanfu@nudt.edu.cn [College of Computer Science, National University of Defense Technology, Changsha 410073 (China); Deng, Xiaogang; Zhang, Lilun [College of Computer Science, National University of Defense Technology, Changsha 410073 (China); Fang, Jianbin [Parallel and Distributed Systems Group, Delft University of Technology, Delft 2628CD (Netherlands); Wang, Guangxue; Jiang, Yi [State Key Laboratory of Aerodynamics, P.O. Box 211, Mianyang 621000 (China); Cao, Wei; Che, Yonggang; Wang, Yongxian; Wang, Zhenghua; Liu, Wei; Cheng, Xinghua [College of Computer Science, National University of Defense Technology, Changsha 410073 (China)

    2014-12-01

    Programming and optimizing complex, real-world CFD codes on current many-core accelerated HPC systems is very challenging, especially when collaborating CPUs and accelerators to fully tap the potential of heterogeneous systems. In this paper, with a tri-level hybrid and heterogeneous programming model using MPI + OpenMP + CUDA, we port and optimize our high-order multi-block structured CFD software HOSTA on the GPU-accelerated TianHe-1A supercomputer. HOSTA adopts two self-developed high-order compact definite difference schemes WCNS and HDCS that can simulate flows with complex geometries. We present a dual-level parallelization scheme for efficient multi-block computation on GPUs and perform particular kernel optimizations for high-order CFD schemes. The GPU-only approach achieves a speedup of about 1.3 when comparing one Tesla M2050 GPU with two Xeon X5670 CPUs. To achieve a greater speedup, we collaborate CPU and GPU for HOSTA instead of using a naive GPU-only approach. We present a novel scheme to balance the loads between the store-poor GPU and the store-rich CPU. Taking CPU and GPU load balance into account, we improve the maximum simulation problem size per TianHe-1A node for HOSTA by 2.3, meanwhile the collaborative approach can improve the performance by around 45% compared to the GPU-only approach. Further, to scale HOSTA on TianHe-1A, we propose a gather/scatter optimization to minimize PCI-e data transfer times for ghost and singularity data of 3D grid blocks, and overlap the collaborative computation and communication as far as possible using some advanced CUDA and MPI features. Scalability tests show that HOSTA can achieve a parallel efficiency of above 60% on 1024 TianHe-1A nodes. With our method, we have successfully simulated an EET high-lift airfoil configuration containing 800M cells and China's large civil airplane configuration containing 150M cells. To our best knowledge, those are the largest-scale CPUGPU collaborative simulations that solve realistic CFD problems with both complex configurations and high-order schemes.

  6. Proceedings of the Third NRC/ASME Symposium on Valve and Pump Testing. Session 1A--Session 2C: Volume 1

    SciTech Connect (OSTI)

    Not Available

    1994-07-01

    The 1994 Symposium on Valve and Pump Testing, jointly sponsored by the Board of Nuclear Codes and Standards of the American Society of Mechanical Engineers and by the Nuclear Regulatory Commission, provides a forum for the discussion of current programs and methods for inservice testing and motor-operated valve testing at nuclear power plants. The symposium also provides an opportunity to discuss the need to improve that testing in order to help ensure the reliable performance of pumps and valves. The participation of industry representatives, regulators, and consultants results in the discussion of a broad spectrum of ideas and perspectives regarding the improvement of inservice testing of pumps and valves at nuclear power plants. This document, Volume 1, covers sessions 1A through session 2C. The individual papers have been cataloged separately.

  7. Preparation of the Crystal Complex of Phosphopantetheine Adenylyltransferase from Mycobacterium tuberculosis with Coenzyme A and Investigation of Its Three-Dimensional Structure at 2.1-A Resolution

    SciTech Connect (OSTI)

    Timofeev, V. I.; Smirnova, E. A.; Chupova, L. A.; Esipov, R. S.; Kuranova, I. P.

    2010-11-15

    Recombinant phosphopantetheine adenylyltransferase from Mycobacterium tuberculosis (PPAT Mt), which was produced by a high-producing strain and purified to 99%, was used for the crystal growth of the complex of the enzyme with coenzyme A (CoA). Crystals suitable for X-ray diffraction study were obtained by cocrystallization. The crystals belong to sp. gr. R32 and have the unit-cell parameters a = b = 98.840 A, c = 112.880 A, {alpha} = {beta} = 90.00{sup o}, and {gamma} = 120.00{sup o}. The three-dimensional structure of the complex was determined based on X-ray diffraction data collected from the crystals to 2.1 A resolution and refined to Rf = 22.7% and Rfree = 25.93%. Active-site bound coenzyme A was found, and its nearest environment was described. The conformational changes of the enzyme due to ligand binding were revealed. The binding of CoA by tuberculosis phosphopantetheine adenylyltransferase was characterized by comparing the structures of the title complex to a similar complex of PPAT from E. coli (PPAT Ec).

  8. CX-003732: Categorical Exclusion Determination

    Broader source: Energy.gov [DOE]

    Miami Children's Museum Going Green InitiativeCX(s) Applied: A9, A11, B5.1Date: 09/03/2010Location(s): Miami, FloridaOffice(s): Energy Efficiency and Renewable Energy, National Energy Technology Laboratory

  9. Saline County, Missouri: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    Malta Bend, Missouri Marshall, Missouri Miami, Missouri Mount Leonard, Missouri Nelson, Missouri Slater, Missouri Sweet Springs, Missouri Retrieved from "http:...

  10. Mobile Source Enforcement Memorandum No. 1a

    Alternative Fuels and Advanced Vehicles Data Center [Office of Energy Efficiency and Renewable Energy (EERE)]

  11. Microsoft Word - 4CO 11 1a

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    each model for the modules tested. The equivalent circuit diode models (e.g., PVsyst, PV*SOL, CEC, etc.) are popular, but include technology-specific corrections and calibration is...

  12. NERC_Interconnection_1A.pdf

    Energy Savers [EERE]

  13. Target_Chamber_1A.dra

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

  14. First principles DFT study of ferromagnetism in SnO{sub 2} induced by doped group 1A and 2A non-magnetic elements X (X=Li, Na, K, Be, Mg, Ca)

    SciTech Connect (OSTI)

    Chakraborty, Brahmananda Ramaniah, Lavanya M.

    2014-04-24

    Transition metal - free - ferromagnetism in diluted magnetic semiconductors (DMS) is of much current interest in the search for more efficient DMS materials for spintronic applications. Here, we report the results of our first principles density functional theory (DFT) study on impurity - induced ferromagnetism in non-magnetic SnO{sub 2} by a non-magnetic impurity. The impurities considered are sp-type of group 1A and 2A elements X (X = Li, Na, K, Be, Mg, Ca). Even a single atom of the group 1A elements makes the system magnetic, whereas for the group 2A elements Ca and Mg, a higher doping is required to induce ferromagnetism. For all the elements studied, the magnetic moment appears to increase with the doping concentration, at least at certain impurity separations, which is a positive indicator for practical applications.

  15. Proceedings from a Workshop on Ecological Carrying Capacity of Salmonids in the Columbia River Basin : Measure 7.1A of the Northwest Power Planning Council`s 1994 Fish and Wildlife Program : Report 3 of 4, Final Report.

    SciTech Connect (OSTI)

    Johnson, Gary E.; Neitzel, D.A.; Mavros, William V.

    1996-05-01

    This report contains the proceedings of a workshop held during 1995 in Portland, Oregon. The objective of the workshop was to assemble a group of experts that could help us define carrying capacity for Columbia River Basin salmonids. The workshop was one activity designed to answer the questions asked in Measure 7.1A of the Council`s Fish and Wildlife Program. Based, in part, on the information we learned during the workshop we concluded that the approach inherent in 7.1A will not increase understanding of ecology, carrying capacity, or limiting factors that influence salmon under current conditions. Measure 7.1A requires a definition of carrying capacity and a list of determinants (limiting factors) of capacity. The implication or inference then follows that by asking what we know and do not know about the determinants will lead to research that increases our understanding of what is limiting salmon survival. It is then assumed that research results will point to management actions that can remove or repair the limiting factors. Most ecologists and fisheries scientists that have studied carrying capacity clearly conclude that this approach is an oversimplification of complex ecological processes. To pursue the capacity parameter, that is, a single number or set of numbers that quantify how many salmon the basin or any part of the basin can support, is meaningless by itself and will not provide useful information.

  16. 12-20-12-Signed-Chemetall-Foote-Silver-Peak-FONSI.pdf

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

  17. Multi-Axis Foot Reaction Force/Torque Sensor for Biomedical Applicatio...

    Office of Scientific and Technical Information (OSTI)

    Sponsoring Org: ORNL work for others Country of Publication: United States Language: English Subject: 60 APPLIED LIFE SCIENCES; ROBOTS; FEET; PROSTHESES; SENSORS; DESIGN; TORQUE ...

  18. Higher velocity, high-foot implosions on the National Ignition Facility laser

    DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

    Callahan, D. A.; Hurricane, O. A.; Hinkel, D. E.; Döppner, T.; Ma, T.; Park, H. -S.; Barrios Garcia, M. A.; Berzak Hopkins, L. F.; Casey, D. T.; Cerjan, C. J.; et al

    2015-05-15

    By increasing the velocity in “high foot” implosions [Dittrich et al., Phys. Rev. Lett. 112, 055002 (2014); Park et al., Phys. Rev. Lett. 112, 055001 (2014); Hurricane et al., Nature 506, 343 (2014); Hurricane et al., Phys. Plasmas 21, 056314 (2014)] on the National Ignition Facility laser, we have nearly doubled the neutron yield and the hotspot pressure as compared to the implosions reported upon last year. The implosion velocity has been increased using a combination of the laser (higher power and energy), the hohlraum (depleted uranium wall material with higher opacity and lower specific heat than gold hohlraums), andmore » the capsule (thinner capsules with less mass). We find that the neutron yield from these experiments scales systematically with a velocity-like parameter of the square root of the laser energy divided by the ablator mass. By connecting this parameter with the inferred implosion velocity (v), we find that for shots with primary yield >1e15 neutrons, the total yield ~ v⁹˙⁴. This increase is considerably faster than the expected dependence for implosions without alpha heating ( ~v⁵˙⁹) and is additional evidence that these experiments have significant alpha heating.« less

  19. Induction of cytochromes P450 1A1 and 1A2 by tanshinones in human...

    Office of Scientific and Technical Information (OSTI)

    ... Resource Type: Journal Article Resource Relation: Journal Name: Toxicology and Applied Pharmacology; Journal Volume: 252; Journal Issue: 1; Other Information: DOI: 10.1016...

  20. Manilla Bay 1, 1A, 1A sidetrack; success against all odds

    SciTech Connect (OSTI)

    Durkee, E.F.; Rillera, F.G. )

    1996-01-01

    The discovery of gas in Manila Bay is one of the more significant exploration discoveries in the Western Pacific in recent years. Within the Philippine Archipelago there is no better geographic or economic location to discover gas than at Manila Bay. Geologically, the well has proven that new concepts applied to old areas, in opposition to past beliefs and dogmas is still a valid way to find hydrocarbons. This is especially true re the western margin of the Central Valley of Luzon. New Venture reviewers (more than 100) were generally negative about the possibility of limestone objectives at this setting. The operators eventually drilled the prospect by themselves. The Manila Bay discovery well is on a large basement uplift with more than 2000 feet of vertical closure and 8,000 acres of areal closure at Miocene levels. The geological surprise was that the well drilled through a Pliocene Limestone (700 feet) charged with gas. An estimated in place resource of up to 2 TCF is possible. This is economically very significant for the Philippines as it is only 30 km from downtown Manila, a city of some 10 million people without any indigenous energy supply. Over-pressured fresh water sands induced drilling problems in the initial well MB-1AST and the deeper primary objectives in Middle to Lower Miocene, also predicted to be carbonates, were not reached. A second well to appraise the Pliocene and explore the deep zones will be drilled in early 1996.

  1. Manilla Bay 1, 1A, 1A sidetrack; success against all odds

    SciTech Connect (OSTI)

    Durkee, E.F.; Rillera, F.G.

    1996-12-31

    The discovery of gas in Manila Bay is one of the more significant exploration discoveries in the Western Pacific in recent years. Within the Philippine Archipelago there is no better geographic or economic location to discover gas than at Manila Bay. Geologically, the well has proven that new concepts applied to old areas, in opposition to past beliefs and dogmas is still a valid way to find hydrocarbons. This is especially true re the western margin of the Central Valley of Luzon. New Venture reviewers (more than 100) were generally negative about the possibility of limestone objectives at this setting. The operators eventually drilled the prospect by themselves. The Manila Bay discovery well is on a large basement uplift with more than 2000 feet of vertical closure and 8,000 acres of areal closure at Miocene levels. The geological surprise was that the well drilled through a Pliocene Limestone (700 feet) charged with gas. An estimated in place resource of up to 2 TCF is possible. This is economically very significant for the Philippines as it is only 30 km from downtown Manila, a city of some 10 million people without any indigenous energy supply. Over-pressured fresh water sands induced drilling problems in the initial well MB-1AST and the deeper primary objectives in Middle to Lower Miocene, also predicted to be carbonates, were not reached. A second well to appraise the Pliocene and explore the deep zones will be drilled in early 1996.

  2. Mg II ABSORPTION SYSTEMS WITH W{sub 0} >= 0.1 A FOR A RADIO SELECTED SAMPLE OF 77 QUASI-STELLAR OBJECTS AND THEIR ASSOCIATED MAGNETIC FIELDS AT HIGH REDSHIFT

    SciTech Connect (OSTI)

    Bernet, M. L.; Miniati, F.; Lilly, S. J. E-mail: fm@phys.ethz.c

    2010-03-01

    We present a catalog of Mg II absorption systems obtained from high-resolution Ultraviolet and Visual Echelle Spectrograph/VLT data of 77 quasi-stellar objects in the redshift range 0.6 < z < 2.0, and down to an equivalent width W{sub 0} >= 0.1 A. The statistical properties of our sample are found to be in agreement with those from the previous work in the literature. However, we point out that the previously observed increase with redshift of partial derivN/partial derivz for weak absorbers pertains exclusively to very weak absorbers with W{sub 0} < 0.1 A. Instead, partial derivN/partial derivz for absorbers with W{sub 0} in the range 0.1-0.3 A actually decreases with redshift, similar to the case of strong absorbers. We then use this catalog to extend our earlier analysis of the links between the Faraday rotation measure (RM) of the quasars and the presence of intervening Mg II absorbing systems in their spectra. In contrast to the case with strong Mg II absorption systems (W{sub 0} > 0.3 A), the weaker systems do not contribute significantly to the observed RM of the background quasars. This is possibly due to the higher impact parameters of the weak systems compared to strong ones, suggesting that the high column density magnetized material that is responsible for the Faraday rotation is located within about 50 kpc of the galaxies. Finally, we show that this result also rules out the possibility that some unexpected secondary correlation between the quasar redshift and its intrinsic RM is responsible for the association of high RM and strong intervening Mg II absorption that we have presented elsewhere, since this would have produced an equal effect for the weak absorption line systems, which exhibit a very similar distribution of quasar redshifts.

  3. Turbines in the ocean

    SciTech Connect (OSTI)

    Smith, F.G.W.; Charlier, R.H.

    1981-09-01

    It is noted that the relatively high-speed ocean currents flowing northward along the east coast of the U.S. may be able to supply a significant proportion of the future electric power requirements of urban areas. The Gulf Stream core lies only about 20 miles east of Miami here its near-surface water reaches velocities of 4.3 miles per hour. Attention is called to the estimate that the energy available in the current of the Gulf Stream adjacent to Florida is approximately equivalent to that generated by 25 1,000-megawatt power plants. It is also contended that this power could be produced at competitive prices during the 1980s using large turbines moored below the ocean surface near the center of the Stream. Assuming an average ocean-current speed between 4 and 5 knots at the current core, the power density of a hydroturbine could reach 410 watts per square foot, about 100 times that of a wind-driven device of similar scale operating in an airflow of approximately 11 knots.

  4. Franck-Condon factors perturbed by damped harmonic oscillators: Solvent enhanced X {sup 1}A{sub g} ↔ A{sup 1}B{sub 1u} absorption and fluorescence spectra of perylene

    SciTech Connect (OSTI)

    Wang, Chen-Wen; Zhu, Chaoyuan Lin, Sheng-Hsien; Yang, Ling; Yu, Jian-Guo

    2014-08-28

    Damped harmonic oscillators are utilized to calculate Franck-Condon factors within displaced harmonic oscillator approximation. This is practically done by scaling unperturbed Hessian matrix that represents local modes of force constants for molecule in gaseous phase, and then by diagonalizing perturbed Hessian matrix it results in direct modification of Huang–Rhys factors which represent normal modes of solute molecule perturbed by solvent environment. Scaling parameters are empirically introduced for simulating absorption and fluorescence spectra of an isolated solute molecule in solution. The present method is especially useful for simulating vibronic spectra of polycyclic aromatic hydrocarbon molecules in which hydrogen atom vibrations in solution can be scaled equally, namely the same scaling factor being applied to all hydrogen atoms in polycyclic aromatic hydrocarbons. The present method is demonstrated in simulating solvent enhanced X {sup 1}A{sub g} ↔ A{sup 1}B{sub 1u} absorption and fluorescence spectra of perylene (medium-sized polycyclic aromatic hydrocarbon) in benzene solution. It is found that one of six active normal modes v{sub 10} is actually responsible to the solvent enhancement of spectra observed in experiment. Simulations from all functionals (TD) B3LYP, (TD) B3LYP35, (TD) B3LYP50, and (TD) B3LYP100 draw the same conclusion. Hence, the present method is able to adequately reproduce experimental absorption and fluorescence spectra in both gas and solution phases.

  5. miR-7 and miR-218 epigenetically control tumor suppressor genes RASSF1A and Claudin-6 by targeting HoxB3 in breast cancer

    SciTech Connect (OSTI)

    Li, Qiaoyan; Zhu, Fufan; Chen, Puxiang

    2012-07-20

    Highlights: Black-Right-Pointing-Pointer Both miR-7 and miR-218 down-regulates HoxB3 expression by targeting the 3 Prime -UTR of HoxB3 mRNA. Black-Right-Pointing-Pointer A reverse correlation between the levels of endogenous miR-7, miR218 and HoxB3 expression. Black-Right-Pointing-Pointer Epigenetic changes involve in the reactivation of HoxB3. Black-Right-Pointing-Pointer Both miRNAs inhibits the cell cycle and clone formation of breast cancer cells. -- Abstract: Many microRNAs have been implicated as key regulators of cellular growth and differentiation and have been found to dysregulate proliferation in human tumors, including breast cancer. Cancer-linked microRNAs also alter the epigenetic landscape by way of DNA methylation and post-translational modifications of histones. Aberrations in Hox gene expression are important for oncogene or tumor suppressor during abnormal development and malignancy. Although recent studies suggest that HoxB3 is critical in breast cancer, the putative role(s) of microRNAs impinging on HoxB3 is not yet fully understood. In this study, we found that the expression levels of miR-7 and miR-218 were strongly and reversely associated with HoxB3 expression. Stable overexpression of miR-7 and miR-218 was accompanied by reactivation of tumor suppressor genes including RASSF1A and Claudin-6 by means of epigenetic switches in DNA methylation and histone modification, giving rise to inhibition of the cell cycle and clone formation of breast cancer cells. The current study provides a novel link between overexpression of collinear Hox genes and multiple microRNAs in human breast malignancy.

  6. Arsenic-related skin lesions and glutathione S-transferase P1 A1578G (lle105Val) polymorphism in two ethnic clans exposed to indoor combustion of high arsenic coal in one village

    SciTech Connect (OSTI)

    Lin, G.F.; Du, H.; Chen, J.G.; Lu, H.C.; Guo, W.C.; Meng, H.; Zhang, T.B.; Zhang, X.J.; Lu, D.R.; Golka, K.; Shen, J.H. [Chinese Academy of Sciences, Shanghai (China)

    2006-12-15

    A total of 2402 patients with arsenic-related skin lesions, such as hyperkeratosis, hyperpigmentation or hypopigmentation, or even skin cancer in a few villages in Southwest Guizhou Autonomous Prefecture, China represent a unique case of endemic arsenism related with indoor combustion of high arsenic coal. This study aimed to investigate the cluster of arsenism cases and the possible relevant factors including GSTP1 polymorphism in two clans of different ethnic origin living in one village for generations. Arsenism morbidity in Miao clan P was significantly lower than in the neighbouring Han clan G1 (5.9 vs. 32.7%, odds ratio (OR)=0.13, 95% confidence interval (CI): 0.06-0.27, P < 0.0001). No sex differences were confirmed inside both clans. Analyses of the environmental samples indicated that Miao clan P members were exposed to higher amounts of arsenic via inhalation and food ingestion. Hair and urine samples also proved a higher arsenic body burden in ethnic Miao individuals. No corresponding differences by sex were found. Higher frequencies of combined mutant genotype G/G1578 and A/G1578 (OR=4.72, 95% CI: 2.34-9.54, P < 0.0001) and of mutant allele G1578 (OR=3.22, 95% CI: 2.00-5.18, P < 0.0001) were detected in diagnosed arsenism patients than in non-diseased individuals. The Miao individuals showed a lower percentage of combined mutant genotypes (30.6 vs. 52.7%, OR=0.40, 95% CI: 0.19-0.84, P=0.015) as well as of mutant allele G1578 (OR=0.46, 95% CI: 0.24-0.88, P=0.017) than their Han neighbours. Conclusions Genetic predisposition influences dermal arsenism toxicity. The GSTP1 A1578G (IIe105Val) status might be a susceptibility factor for arsenic-related skin lesions.

  7. Indian Creek, Florida: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    it. Indian Creek is a village in Miami-Dade County, Florida. It falls under Florida's 20th congressional district.12 References US Census Bureau Incorporated place and...

  8. Golden Beach, Florida: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    it. Golden Beach is a town in Miami-Dade County, Florida. It falls under Florida's 20th congressional district.12 References US Census Bureau Incorporated place and...

  9. Bay Harbor Islands, Florida: Energy Resources | Open Energy Informatio...

    Open Energy Info (EERE)

    Bay Harbor Islands is a town in Miami-Dade County, Florida. It falls under Florida's 20th congressional district.12 References US Census Bureau Incorporated place and...

  10. Lennar Homes & Lennar Urban | Open Energy Information

    Open Energy Info (EERE)

    Lennar Homes & Lennar Urban Jump to: navigation, search Name: Lennar Homes & Lennar Urban Place: Miami, FL Information About Partnership with NREL Partnership with NREL Yes...

  11. 5th International REAC/TS Symposium: The Medical Basis for Radiation...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    The Medical Basis for Radiation Accident Preparedness Skip site navigation and ... The Medical Basis for Radiation Accident Preparedness Sept. 27-29, 2011 | Miami, ...

  12. 2004 ORAU/ORISE Bibliography

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    ... Mississippi; Huston- Tillotson College, Austin, Texas; Florida A&M University, Tallahassee, Florida; and Florida Memorial College, Miami, Florida. 2004. National Security ...

  13. PACE Financing | Open Energy Information

    Open Energy Info (EERE)

    Water Heat Wind Energy Storage Dehumidifiers Yes Miami-Dade County - Voluntary Energy Efficiency and Renewable Energy Program (Florida) PACE Financing Florida Commercial...

  14. High Throughput Combinatorial Screening of Biometic Metal-Organic...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ...Organic Materials for Military Hydrogen-Storage Materials (New Joint Miami UNREL DoDDLA Project) (presentation) High Throughput Combinatorial Screening of Biometic Metal-Organic ...

  15. Carbon Dioxide (CO2) Capture Project Phase 2 (CCP2) - Storage...

    Open Energy Info (EERE)

    Clean Fossil Energy Topics: System & Application Design Website: www.sciencedirect.comscience?obMiamiImageURL&cid277910&user10& Equivalent URI: cleanenergysolutions.org...

  16. Butler County, Ohio: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    Middletown, Ohio Millville, Ohio Monroe, Ohio New Miami, Ohio Olde West Chester, Ohio Oxford, Ohio Ross, Ohio Seven Mile, Ohio Sharonville, Ohio Somerville, Ohio South Middletown,...

  17. 1,"General James M Gavin","Coal","AEP Generation Resources Inc...

    U.S. Energy Information Administration (EIA) Indexed Site

    8,"Hanging Rock Energy Facility","Natural gas","Duke Energy Commercial Asset Management",1252 9,"Perry","Nuclear","FirstEnergy Nuclear Operating Company",1240 10,"Miami ...

  18. Microsoft Word - Chap - 5-15-05.doc

    Office of Legacy Management (LM)

    ... Great Miami Aquifer, permitting contaminants to be transported to the aquifer as well. ... impact of operations on the surrounding environment, in accordance with DOE requirements. ...

  19. Project Startup: Evaluating the Performance of Hydraulic Hybrid...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    custom cycles that best represent Miami-Dade's residential operation. NREL will use the Drive-Cycle Rapid Investigation, Visualization, and Evaluation (DRIVE) analysis tool to...

  20. Gila County, Arizona: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    Day, Arizona Central Heights-Midland City, Arizona Claypool, Arizona Gisela, Arizona Globe, Arizona Hayden, Arizona Miami, Arizona Payson, Arizona Peridot, Arizona Pine, Arizona...

  1. Electron Solar Energy Formerly Envigra Inc | Open Energy Information

    Open Energy Info (EERE)

    Solar Energy Formerly Envigra Inc Jump to: navigation, search Name: Electron Solar Energy (Formerly Envigra Inc) Place: Miami, Florida Zip: 33137 Sector: Solar Product: US-based...

  2. Browse by Discipline -- E-print Network Subject Pathways: Renewable...

    Office of Scientific and Technical Information (OSTI)

    Sullivan Sealey) - Department of Biology, University of Miami Shultis, J. Kenneth (J. Kenneth Shultis) - Department of Mechanical and Nuclear Engineering, Kansas State ...

  3. Ottawa County, Oklahoma: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    Zone Subtype A. Places in Ottawa County, Oklahoma Afton, Oklahoma Cardin, Oklahoma Commerce, Oklahoma Dotyville, Oklahoma Fairland, Oklahoma Miami, Oklahoma Narcissa, Oklahoma...

  4. Biofuels Digest | Open Energy Information

    Open Energy Info (EERE)

    Digest Jump to: navigation, search Name: Biofuels Digest Address: 801 Brickell Avenue Suite 900 Place: Miami, Florida Zip: 33131 Sector: Services Product: Information Year Founded:...

  5. Search for: All records | SciTech Connect

    Office of Scientific and Technical Information (OSTI)

    Department of Physics, University of Miami, Coral Gables, Florida 33124-8046" Name Name ORCID Search Authors Type: All BookMonograph ConferenceEvent Journal Article Miscellaneous...

  6. EECBG Success Story: New Choctaw Nation Recycling Center Posts...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    stewardship of the land and environment. Learn more. Addthis Related Articles Ajani Stewart was close to losing his job as environmental coordinator for the city of Miami before...

  7. Grant Improves Comfort for Nevada City's Employees | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Articles EECBG Success Story: Grant Improves Comfort for Nevada City's Employees Ajani Stewart was close to losing his job as environmental coordinator for the city of Miami before...

  8. EECBG Success Story: New Sustainability Manager Delivers Savings...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    EECBG Success Story: Ormond Beach Triples Energy Cost Savings Projections Ajani Stewart was close to losing his job as environmental coordinator for the city of Miami before...

  9. ClimeCo Corporation | Open Energy Information

    Open Energy Info (EERE)

    Florida Zip: FL 33131 Product: Miami-based company developing, operating and monitoring CO2 emissions reduction projects in the US and international markets. Coordinates:...

  10. ARM - Publications: Science Team Meeting Documents: An Arctic...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    An Arctic Springtime Mixed-Phase Cloudy Boundary Layer observed during SHEBA Zuidema, Paquita RSMASMPO University of Miami Han, Yong NASA Goddard Space Flight Center Intrieri,...

  11. Cambridge Project Development | Open Energy Information

    Open Energy Info (EERE)

    Project Development Jump to: navigation, search Name: Cambridge Project Development Place: Miami, Florida Product: Florida-based firm that builds wate management and waste to...

  12. PRESS RELEASE FOR IMMEDIATE RELEASE: PATRICK A. WESTOVER HONORED...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    A. Westover of Savannah River National Laboratory was awarded the American Glovebox Society (AGS) Keystone Award at the 2014 AGS Annual Conference held in Miami Beach, Florida....

  13. ARM - Publications: Science Team Meeting Documents: AIRS retrievals...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AIRS retrievals of atmospheric profiles of temperature and humidity - comparisons with radiosondes and ship-based remote sensing during AEROSE Minnett, Peter University of Miami...

  14. Huber Heights, Ohio: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    by expanding it. Huber Heights is a city in Greene County and Miami County and Montgomery County, Ohio. It falls under Ohio's 8th congressional district.12 References ...

  15. Bayesian approaches for combining computational model output...

    Office of Scientific and Technical Information (OSTI)

    DOE Contract Number: AC52-06NA25396 Resource Type: Conference Resource Relation: Conference: Joint Statistical Meetings ; August 2, 2011 ; Miami, FL Research Org: Los Alamos ...

  16. SRT Group Inc | Open Energy Information

    Open Energy Info (EERE)

    search Name: SRT Group Inc Place: Miami, Florida Zip: 33133 Sector: Hydro, Hydrogen Product: Has developed and patented an electrical energy storage and hydrogen...

  17. Recovery Act Weekly Video: 200 Area Asbestos Removal, U-Ancillary Demolition, 200 West Transfer Building Footings

    ScienceCinema (OSTI)

    None

    2012-06-14

    A weekly update of the Recovery Act at work. Demolition of U-Ancillary that was contaminated with uranium and asbestos as well as removing asbestos from the Steam Generation Plant in the 200 East Area.

  18. CX-001351: Categorical Exclusion Determination

    Broader source: Energy.gov [DOE]

    Space Geodesy and Geochemistry Applied to the Monitoring, Verification of Carbon Capture and Storage - MiamiCX(s) Applied: A9, B3.1Date: 03/15/2010Location(s): Miami, FloridaOffice(s): Fossil Energy, National Energy Technology Laboratory

  19. CX-001535: Categorical Exclusion Determination

    Broader source: Energy.gov [DOE]

    County of Miami-Dade, Florida Energy Efficiency and Conservation Block GrantCX(s) Applied: A9, A11, B5.1Date: 03/31/2010Location(s): Miami-Dade County, FloridaOffice(s): Energy Efficiency and Renewable Energy, Golden Field Office

  20. Management and Independent Assessments Guide for Use with 10 CFR Part 830, Subpart A, and DOE O 414.1C, Quality Assurance; DOE M 450.4 -1, Integrated Safety Management System Manual; and DOE O 226.1A, Implementation of DOE Oversight Policy

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    2007-09-27

    This Guide provides information on establishing processes for performing effective assessments. The revision to Guide reflects updated assessment practices, international standards, and changes in DOE expectations. Cancels DOE G 414.1-1A. Certified 11-18-10. Canceled by DOE G 414.1-1C.

  1. Management and Independent Assessments Guide for Use with 10 CFR, Part 830, Subpart A, and DOE O 414.1C, Quality Assurance; DOE M 450.4-1, Integrated Safety Management System Manual; and DOE O 226.1A

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    2013-04-18

    Management and Independent Assessments Guide for Use with 10 CFR, Part 830, Subpart A, and DOE O 414.1C, Quality Assurance; DOE M 450.4-1, Integrated Safety Management System Manual; and DOE O 226.1A

  2. Notice of Intent to Revise DOE G 414.1-1B, Management and Independent Assessments Guide for Use with 10 CFR, Part 830, Subpart A, and DOE O 414.1C, Quality Assurance; DOE M 450.4-1, Integrated Safety Management System Manual; and DOE O 226.1A

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    2013-04-18

    This memorandum provides justification for revising DOE G 414.1-1B, Management and Independent Assessments Guide for Use With 10 CFR, Part 830, Subpart A, and DOE O 414.1C, Quality Assurance; DOE M 450.4-1, Integrated Safety Management System Manual; and DOE O 226.1A, Implementation of Department of Energy Oversight Policy.

  3. Draft - DOE O 436.1A, Departmental Sustainability

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    The order defines requirements and responsibilities for managing sustainability DOE to ensure that the Department carries out its missions in a sustainable manner that addresses national energy security and global environmental challenges, and advances sustainable, efficient and reliable energy for the future; institute wholesale cultural change to factor sustainability and greenhouse gas (GHG) reductions into all DOE corporate management decisions; and ensure that DOE achieves the sustainability goals established in its Strategic Sustainability Performance Plan.

  4. Revision to Addendum to Mobile Source Enforcement Memorandum 1A

    Alternative Fuels and Advanced Vehicles Data Center [Office of Energy Efficiency and Renewable Energy (EERE)]

  5. DOE O 200.1A | Department of Energy

    Energy Savers [EERE]

    About Us » News » Congressional Testimony Congressional Testimony October 6, 2011 Statement Before the Subcommittee on Children's Health and Environmental Responsibility, Committee on Environment and Public Works, United States Senate (10/6/2011) Statement Before the Subcommittee on Children's Health and Environmental Responsibility, Committee on Environment and Public Works, United States Senate By: David Geiser, Director, Office of Legacy Management, Department of Energy Subject: UMTRCA

  6. DOE O 252.1A Technical Standards Program

    Broader source: Energy.gov [DOE]

    On February 23, 2011, the Department issued a Contractor Requirements Document (CRD) to the above listed Directive.

  7. Table 1a. Effective, Occupied, and Vacant Square Footage, 1992

    U.S. Energy Information Administration (EIA) Indexed Site

    12,100 944 92 Midwest 1,196 17,117 15,691 1,425 91 South 1,953 24,401 22,300 2,101 91 West 866 12,508 11,233 1,274 89 Energy Sources (more than one may apply) Electricity 4,590...

  8. CV-1a: Magmatic - Extrusive | Open Energy Information

    Open Energy Info (EERE)

    95,000,000 W 95,000,000,000 mW 0.095 GW 9.5e-5 TW 503.15 K230 C 446 F 905.67 R Bac-Man Laguna Geothermal Area Philippine Island Arc Fault Intersection Volcanic 150 MW150,000...

  9. CTVI-1-A Wholesale Power Rate Schedule | Department of Energy

    Office of Environmental Management (EM)

    Center Hill, Wolf Creek, Old Hickory, Cheatham, Barkley, J. Percy Priest, and Cordell Hull Projects (all of such projects being hereafter called collectively the "Cumberland...

  10. Pump-1-A Wholesale Power Rate Schedule | Department of Energy

    Energy Savers [EERE]

    Pump Systems Pump Systems Dramatic energy and cost savings can be achieved in pump systems by applying best energy management practices and purchasing energy-efficiency equipment. Use the software tools, training, and publications listed below to save energy in pump systems. Pumps Tools Tools to Assess Your Energy System Pumping System Assessment Tool (PSAT) Qualified Specialists Qualified Specialists have passed a rigorous competency examination on a specific industrial system assessment tool.

  11. Shared Communications: Volume 1. A Summary and Literature Review

    SciTech Connect (OSTI)

    Franzese, O

    2004-09-22

    This paper provides a review of examples from the literature of shared communication resources and of agencies and/or organizations that share communication resources. The primary emphasis is on rural, intelligent transportation system communications involving transit. Citations will not be limited, however, to rural activities, or to ITS implementation, or even to transit. In addition, the term ''communication'' will be broadly applied to include all information resources. Literature references to issues that contribute to both successful and failed efforts at sharing communication resources are reviewed. The findings of this literature review indicate that: (1) The most frequently shared communication resources are information/data resources, (2) Telecommunications infrastructure and technologies are the next most frequently shared resources, (3) When resources are successfully shared, all parties benefit, (4) A few unsuccessful attempts of sharing resources have been recorded, along with lessons learned, (5) Impediments to sharing include security issues, concerns over system availability and reliability, service quality and performance, and institutional barriers, (6) Advantages of sharing include financial benefits to agencies from using shared resources and benefits to the public in terms of congestion mitigation, information transfer (e.g., traveler information systems), mobility (e.g., welfare-to-work paratransit), and safety (e.g., speed of incident response, incident avoidance), (7) Technology-based solutions exist to address technology-based concerns, and (8) Institutional issues can be addressed through leadership, enhanced knowledge and skills, open communication, responsiveness, and attractive pricing structures.

  12. Madelyn Creedon visits NNSS U1a underground complex | National...

    National Nuclear Security Administration (NNSA)

    experiments and to improve the conditional codes that help assure the safety and reliability of the nuclear stockpile without nuclear weapons testing. In the photo, from left to ...

  13. NEW - DOE O 227.1A, Independent Oversight Program

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    The order prescribes the requirements and responsibilities for the DOE Independent Oversight Program.

  14. Cancellation of DOE HQ O 344.1A

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    2010-10-08

    Effectively immediately, HQ O 344.1, Parking, dated 11-2-01, is canceled as is Chg. 1 dated 11-19-04.

  15. Database for Regional Geology, Phase 1- A Tool for informing...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    and 3) rock properties and in-situ conditions for shale estimated from sonic velocity measurements, and 4) other aspects important to potential future site evaluation exercises. ...

  16. New England (PADD 1A) Gasoline and Diesel Retail Prices

    U.S. Energy Information Administration (EIA) Indexed Site

    53 2.284 2.345 2.366 2.359 2.407 1993-2016 All Grades - Conventional Areas 2.300 2.318 2.375 2.389 2.384 2.427 1994-2016 All Grades - Reformulated Areas 2.241 2.276 2.337 2.360 ...

  17. NEW - DOE G 580.1-1A, Personal Property

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    This Guide provides non-regulatory guidance and information to assist DOE organizations and contractors in implementing the DOE-wide and site-specific personal property management programs.

  18. DRAFT - DOE G 580.1-1A, Personal Property

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    This Guide provides non-regulatory guidance and information to assist DOE organizations and contractors in implementing the DOE-wide and site-specific personal property management programs. It supplements the policy, requirements, and responsibilities information contained in the DOE Order cited above and clarifies the regulatory requirements contained in the Federal Property Management Regulation (FMR) and specific contracts.

  19. Recommendation 201: Cleanup of Tank W1-A

    Broader source: Energy.gov [DOE]

    ORSSAB recommends to DOE specific procedure at Liquid Low-Level Waste Pipelines Northern Characterization Study Area.

  20. DOE/PPPO/03-0098&D1/A1

    Office of Environmental Management (EM)

    ... The average annual temperature is 12.7 o C (55 o F). Record high and low temperatures are 39.4 o C (103 o F) and ... purposes, including a water treatment plant, holding ponds, ...

  1. Maple Ridge 1a Wind Farm | Open Energy Information

    Open Energy Info (EERE)

    Developer PPM EnergyHorizon Wind Energy Energy Purchaser NYSERDAMarket Location Lewis County NY Coordinates 43.775565, -75.584614 Show Map Loading map......

  2. Microsoft Word - TR06-26.doc

    Office of Legacy Management (LM)

    ... PL-10 330 100 foot level Rectifier control panel, 100-foot level. CondorprojectsLM... insulation, 79-foot level. PIQ 42008. PL-10. Rectifier control panel, 100-foot level.

  3. A Literature Review, Bibliographic Listing, and Organization of Selected References Relative to Pacific salmon (Oncorhynchus spp.) and Abiotic and Biotic Attributes of the Columbia River Estuary and Adjacent Marine and Riverine Environs for Various Historical Periods : Measure 7.1A of the Northwest Power Planning Council`s 1994 Fish and Wildlife Program : Report 4 of 4, Final Report.

    SciTech Connect (OSTI)

    Costello, Ronald J.

    1996-05-01

    This report contains the results of a literature review on the carrying capacity of Pacific salmon in the Columbia River Basin. The objective of the review was to find the information gaps relative to the determinants of salmon carrying capacity in the Columbia River Basin. The review was one activity designed to answer questions asked in Measure 7.1A of the Councils Fish and Wildlife Program. Based, in part, on the information learned during the literature review and the other work accomplished during this study the Pacific Northwest National Laboratory (PNNL) state concluded that the approach inherent in 7.1A will not increase understanding of ecology, carrying capacity, or limiting factors that influence salmon under current conditions. To increase understanding of ecology, carring capacity, and limiting factors, it is necessary to deal with the complexity of the sustained performance of salmon in the Columbia River Basin. The PNNL team suggests that the regions evaluated carrying capacity from more than one view point. The PNNL team recommends that the region use the contextualistic view for evaluating capacity.

  4. Synthesis and structural characterization of new defect pyrochlore type A{sub x}Ln{sub y}Sb{sub 2}O{sub 6+z} antimoniates (01; A = Rb, Cs, Tl; Ln = Eu, Gd, and Y) prepared by coprecipitation

    SciTech Connect (OSTI)

    El Haimouti, A.; Zambon, D.; El-Ghozzi, M.; Avignant, D.; Leroux, F.; El Aatmani, M.; Daoud, M

    2003-07-14

    New cubic defect pyrochlore type A{sub x}Ln{sub y}Sb{sub 2}O{sub 6+z} antimoniates (01; A=Rb, Cs, Tl; Ln=Eu, Gd, and Y) (space group Fd3m) were prepared by calcination in air at 650 deg. C of compositions obtained by a coprecipitation method. Their crystal structures were refined by the Rietveld procedure and further confirmed by X-ray absorption spectroscopy (EXAFS) experiments. Refinements of the X-ray powder diffraction data show a partial and statistical occupation of the 8b site by alkaline or thallous ions and oxygen and lead to values close to 0.33 for the only refinable positional x parameter of the 48f oxygenated site.

  5. North Bay Village, Florida: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    it. North Bay Village is a city in Miami-Dade County, Florida. It falls under Florida's 20th congressional district.12 References US Census Bureau Incorporated place and...

  6. University Park, Florida: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    Hide Map This article is a stub. You can help OpenEI by expanding it. University Park is a census-designated place in Miami-Dade County, Florida.1 References US Census...

  7. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Sizes, Fractional Coverage, and Radar Doppler Moments Profiles of Fair-Weather Cumulus Clouds at the TWP ARM Site Kollias, P., Albrecht B.A., and Dow B.J., University of Miami...

  8. BIOENERGIZEME INFOGRAPHIC CHALLENGE: Oil Future of the World

    Broader source: Energy.gov [DOE]

    This infographic was created by students from Miami Palmetto Senior High School in Pinecrest, FL, as part of the U.S. Department of Energy-BioenergizeME Infographic Challenge. The BioenergizeME...

  9. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Forcing Over the Beaufort Sea and North Slope of Alaska Key, E.L.(a), Minnett, P.J.(a), Evans, R.H.(a), and Papakyriakou, T.N.(b), University of Miami, RSMAS (a), University of...

  10. Spring Hill, Kansas: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    This article is a stub. You can help OpenEI by expanding it. Spring Hill is a city in Johnson County and Miami County, Kansas. It falls under Kansas's 3rd congressional district...

  11. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Large Eddy Simulations of Fair-Weather Cumulus Case at SGP Site Zhu, P. and Albrecht, B.A., University of Miami Twelfth Atmospheric Radiation Measurement (ARM) Science Team Meeting...

  12. DOE International Energy Advisors | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Stuttgart, Germany USNORTHCOM: U.S. Northern Command Peterson Air Force Base, CO USPACOM: U.S. Pacific Command Camp H.M. Smith, HI USSOUTHCOM: U.S. Southern Command Miami, FL

  13. ARM - Campaign Instrument - sfcmetumiami

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    govInstrumentssfcmetumiami Comments? We would love to hear from you Send us a note below or call us at 1-888-ARM-DATA. Send Campaign Instrument : University of Miami Surface...

  14. El Portal, Florida: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    Hide Map This article is a stub. You can help OpenEI by expanding it. El Portal is a village in Miami-Dade County, Florida. It falls under Florida's 17th...

  15. Existing Generating Unit in the United States by State and Energy...

    U.S. Energy Information Administration (EIA) Indexed Site

    ..."BIT",,9,1977,"OP","N" "OH","Hamilton",3542,"Cincinnati Gas & Electric Co",2832,"Miami Fort",22,5,100,80,80,"ST","BIT",,12,1949,"OP","N" "OH","Hamilton",3542,"Cincinnati Gas & ...

  16. Existing Generating Unit in the United States by State and Energy...

    U.S. Energy Information Administration (EIA) Indexed Site

    ..."BIT",,7,1969,"OP","N" "OH","Hamilton",3542,"Cincinnati Gas & Electric Co",2832,"Miami Fort",22,5,100,80,80,"ST","BIT",,12,1949,"OP","N" "OH","Hamilton",3542,"Cincinnati Gas & ...

  17. EECBG Success Story: Saving Energy and Keeping Seniors Warm This...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Safer Streets Ajani Stewart was close to losing his job as environmental coordinator for the city of Miami before a change to the city's EECBG allowed Stewart to retain his ...

  18. EECBG Success Story: CNG in OKC: Improving Efficiency at the...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Related Articles Ajani Stewart was close to losing his job as environmental coordinator for the city of Miami before a change to the city's EECBG allowed Stewart to retain his ...

  19. Biodiesel of South Florida LLC | Open Energy Information

    Open Energy Info (EERE)

    of South Florida LLC Jump to: navigation, search Name: Biodiesel of South Florida, LLC Place: Miami, Florida Zip: 33176 Product: Florida-based wholesale marketer of soy-based...

  20. Global Ocean Circulation Modeling with an Isopycnic Coordinate Model. Final Report for May 1, 1998 - April 30, 2002

    SciTech Connect (OSTI)

    Bleck, R.

    2004-05-19

    The overall aim of this project was to continue development of a global version of the Miami Isopycnic Coordinate Ocean Model (MICOM) with the intent of turning it into a full-fledged oceanic component of an earth system model.

  1. schmid-99.PDF

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Miami, Florida P. Formenti and M. O. Andreae Max Planck Institute for Chemistry Mainz, Germany V. N. Kapustin University of Hawaii Honolulu, Hawaii T. S. Bates and P. K. Quinn...

  2. EECBG Success Story: Projects and Savings Back on Track in Virginia...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Sensors Ajani Stewart was close to losing his job as environmental coordinator for the city of Miami before a change to the city's EECBG allowed Stewart to retain his ...

  3. 24 Universities Receiving Funding to Train Next Generation of...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    San Francisco, CA 1,143,093 San Diego State University Research Foundation San Diego, CA ... University of Miami Coral Gables, FL 1,000,000 Iowa State University of Science and ...

  4. Virginia Gardens, Florida: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    Hide Map This article is a stub. You can help OpenEI by expanding it. Virginia Gardens is a village in Miami-Dade County, Florida. It falls under Florida's 21st...

  5. Ormond Beach Triples Energy Cost Savings Projections | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    costs. | Photo courtesy of the City of Dallas. Dallas: Building a Greener City Ajani Stewart was close to losing his job as environmental coordinator for the city of Miami before...

  6. EECBG Success Story: Grant Improves Comfort for Nevada City's...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Delray Beach Ajani Stewart was close to losing his job as environmental coordinator for the city of Miami before a change to the city's EECBG allowed Stewart to retain his ...

  7. Fisher Island, Florida: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    Hide Map This article is a stub. You can help OpenEI by expanding it. Fisher Island is a census-designated place in Miami-Dade County, Florida.1 References ...

  8. Pleasant Hill, Ohio: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    Hide Map This article is a stub. You can help OpenEI by expanding it. Pleasant Hill is a village in Miami County, Ohio. It falls under Ohio's 8th congressional...

  9. Layered Atlantic Smoke Interactions with Clouds (LASIC) Science...

    Office of Scientific and Technical Information (OSTI)

    G 10 ; Haywood, JM ; Lewis, ER 11 ; McComiskey, A 12 ; Redemann, J 13 ; Turner, DD 12 ; Wood, R 14 ; Zhu, P 15 + Show Author Affiliations University of Miami ...

  10. Effect of Sea Level Rise on Energy Infrastructure in Four Major...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    The study focused on the four major metropolitan statistical areas of New York City, Houston, Miami, and Los Angeles. These areas were chosen because of their proximity to the ...

  11. General Merchandise 2009 TSD Chicago Low Plug Load 50% Energy...

    Open Energy Info (EERE)

    90.1 2004 Model Year 2009 IDF file http:apps1.eere.energy.govbuildingsenergyplusmodelsMiami2009TSDGeneralMerchLPL50percent.idf XML file http:apps1.eere.energy.gov...

  12. General Merchandise 2009 TSD Chicago Low Plug Load Baseline ...

    Open Energy Info (EERE)

    90.1 2004 Model Year 2009 IDF file http:apps1.eere.energy.govbuildingsenergyplusmodelsMiami2009TSDGeneralMerchLPLBaseline.idf XML file http:apps1.eere.energy.gov...

  13. Palm Springs North, Florida: Energy Resources | Open Energy Informatio...

    Open Energy Info (EERE)

    Hide Map This article is a stub. You can help OpenEI by expanding it. Palm Springs North is a census-designated place in Miami-Dade County, Florida.1 References ...

  14. Videos | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Costs in Miami-Dade County, Florida How Energy Efficiency is Adding Jobs in St. Paul, Minnesota Charging Up in King County, Washington ARPA-E 2011 Keynote: Secretary Steven...

  15. Groundwater Cleanup Operational Changes Are Being Implemented at Fernald Preserve

    Broader source: Energy.gov [DOE]

    Uranium contamination in the Great Miami Aquifer—at the Fernald Preserve, Ohio, Site—is being removed from the groundwater through a pump-and-treatment operation, which until this year, involved...

  16. Weatherization and Intergovernmental Program Success Stories...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    by the American Recovery and Reinvestment Act. Learn more. June 24, 2010 Ajani Stewart was close to losing his job as environmental coordinator for the city of Miami before...

  17. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    on weekly cruises originating from Miami Florida with port calls in the Bahamas, Haiti, Puerto Rico, and St. Thomas. The repeat track of the cruise provides for long-term...

  18. West Little River, Florida: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    Hide Map This article is a stub. You can help OpenEI by expanding it. West Little River is a census-designated place in Miami-Dade County, Florida.1 References...

  19. West Perrine, Florida: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    Hide Map This article is a stub. You can help OpenEI by expanding it. West Perrine is a census-designated place in Miami-Dade County, Florida.1 References ...

  20. Coral Terrace, Florida: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    Hide Map This article is a stub. You can help OpenEI by expanding it. Coral Terrace is a census-designated place in Miami-Dade County, Florida.1 References ...

  1. Richmond Heights, Florida: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    Hide Map This article is a stub. You can help OpenEI by expanding it. Richmond Heights is a census-designated place in Miami-Dade County, Florida.1 References ...

  2. CX-100107 Categorical Exclusion Determination

    Broader source: Energy.gov [DOE]

    Green Miami Children’s Museum Going Green Initiative (FL) Award Number: DE-EE0003655 CX(s) Applied: B5.1 Date: 10/23/2014 Location(s): Florida Office(s): Golden Field Office

  3. CX-002950: Categorical Exclusion Determination

    Broader source: Energy.gov [DOE]

    Energy Efficient Lighting on Green Roadway Demonstration ProjectCX(s) Applied: B5.1Date: 07/12/2010Location(s): Miami-Dade County, FloridaOffice(s): Energy Efficiency and Renewable Energy, Golden Field Office

  4. Celebrating Achievement and Potential at the Presidential Early...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ... Carole Dabney-Smith of Miami University in Ohio is trying to better understand how plants assemble their "solar panels," the energy-harvesting complexes of photosynthesis. Wei-Jun ...

  5. Union, Ohio: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    is a stub. You can help OpenEI by expanding it. Union is a city in Miami County and Montgomery County, Ohio. It falls under Ohio's 8th congressional district and Ohio's 3rd...

  6. Fletcher, Ohio: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    Hide Map This article is a stub. You can help OpenEI by expanding it. Fletcher is a village in Miami County, Ohio. It falls under Ohio's 8th congressional...

  7. NREL Evaluates Performance of Hydraulic Hybrid Refuse Vehicles (Fact Sheet), Highlights in Research & Development, NREL (National Renewable Energy Laboratory)

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    National Renewable Energy Laboratory (NREL) is evaluating the in-service performance of hydraulic hybrid vehicles (HHVs) and comparable conven- tional diesel vehicles operated by Miami- Dade County's Public Works and Waste Management Department in Florida. Launched in March 2015, the study aims to improve understanding of the overall usage and effectiveness of HHVs in refuse operation. The study was designed to help Miami- Dade County determine the ideal routes for maximizing the fuel-saving

  8. 1

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Six-Year Climatology of Boundary Layer Clouds at the ARM SGP Site B.A. Albrecht and D. Reid University of Miami Miami, Florida P. Kollias Cooperative Institute for Research in Environmental Science/ Environmental Technology Laboratory University of Colorado Boulder, Colorado J. Gottshalck Goddard Earth Sciences and Technology Center, National Aeronautics and Space Administration University of Maryland Baltimore County Baltimore, Maryland Introduction Low-level stratus clouds cover a large area

  9. 1

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Boundary Layer Cloud Climatology at the ARM TWP Nauru Site P. Kollias Cooperative Institute for Research in Environmental Science/ Environmental Technology Laboratory University of Colorado Boulder, Colorado B.A. Albrecht University of Miami Miami, Florida Introduction Boundary layer (BL) clouds are fundamental in regulating the vertical structure of water vapor and entropy in the lowest 2 km of the Earth's atmosphere. Data on fair-weather cumuli have also received relatively little recent

  10. barr(1)-98.pdf

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    3 GMS-5 IR and Visible Imagery for November 1996- February 1997 from the ARM External Data Center S. A. Barr-Kumarakulasinghe, L. Ma, R. Wagener, L. Gregory, and J. L. Tichler Department of Applied Sciences Brookhaven National Laboratory Upton, New York P. J. Minnett Rosenstiel School of Marine and Atmospheric Sciences University of Miami Miami, Florida Introduction The El-Nino Southern Oscillation (ENSO) and Madden Julian Oscillations (MJO) are strongly influenced by radia- tive and other

  11. dong(2)-98.pdf

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    5 Validation of Cloud Microphysical Retrievals from Surface- and Satellite-Based Measurements Obtained During the Fall of 96 Penn State Aircraft Experiment X. Dong Analytical Services and Materials, Inc., Hampton, Virginia E. E. Clothiaux, N. Miles, J. Verlinde, and T. P. Ackerman The Pennsylvania State University University Park, Pennsylvania P. Minnis NASA-Langley Research Center Hampton, Virginia B. A. Albrecht University of Miami Miami, Florida Introduction Comparisons with aircraft in situ

  12. gottschalck(1)-99

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Macroscopic Cloud and Boundary Layer Properties for Continental Stratus at the SGP CART Site During 1997 J. C. Gottschalck and B. A. Albrecht University of Miami Miami, Florida Introduction Stratus and stratocumulus clouds are important in the regulation of the earth's radiation budget and thus play an important role in climate over both the land and ocean (Ramanathan et al. 1989). Consequently, there is a great need for accurate boundary layer cloud parameterizations in climate models (Slingo

  13. gottschalck(2)-99.PDF

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mesoscale Variability of a Continental Stratus Cloud Event at the SGP CART Site During 1999 J. C. Gottschalck and B. A. Albrecht University of Miami Miami, Florida Introduction Current observational data bases of continental stratus are mainly composed of observations from a single location. It has been shown, however, that marine stratus decks show both mesoscale and diurnal variability (Albrecht et al. 1988; Albrecht et al. 1995; Miller and Albrecht 1995; Miller et al. 1998). Such variability

  14. kollias-98.pdf

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    7 High Resolution Doppler Radar Observations in Continental Stratus Clouds P. Kollias and B. A. Albrecht University of Miami Miami, Florida Introduction Vertical mixing is a key factor in determining the macroscopic and microscopic structure of stratus clouds. The vertical velocities resolved from millimeter-wavelength radars can be used to define the turbulence structure within such clouds (Frisch et al. 1995). To illustrate the utility of such radar measurements for studying the turbulence

  15. kollias-99.PDF

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mass Flux Representations of Vertical Velocity Fluctuations in Continental Stratus Clouds Using a mm-Wavelength Doppler Radar P. Kollias and B. A. Albrecht University of Miami Miami, Florida Introduction A cloud mass flux representation of the vertical turbulent fluxes provides a physical framework for understanding the effects of shallow convection in maintaining the vertical structure of the boundary layer. This approach is based on the assumption that coherent updrafts and downdraft

  16. Evolution in Cloud Population Statistics of the MJO: From AMIE Field Observations to Global Cloud-Permitting Models

    SciTech Connect (OSTI)

    Dudhia, Jimy

    2015-10-05

    The NCAR role in this project was to host a visiting PostDoc from the University of Miami. The NCAR PI (Jimy Dudhia) provided oversight of the PostDoc's work and mentoring and guidance as needed throughout the duration of the project. The University of Miami (the lead of this project), will provide the final technical report on the main work carried out under this proposal, which will be submitted once their no-cost extension period is completed.

  17. Joe Garcia | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Joe Garcia About Us Joe Garcia - Congressman Representing the 26th District of Florida Joe Garcia Congressman Joe Garcia was elected to the United States House of Representatives in 2012. He is a dedicated public servant who has called South Florida home for his entire life. With scholarships and money he had saved from cutting grass with his grandfather on weekends, Congressman Garcia put himself through Miami Dade College and later the University of Miami where he completed his undergraduate

  18. Research Highlight

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    All Mixed Up-Probing Large and Small Scale Turbulence Structures in Continental Stratocumulus Clouds Download a printable PDF Submitter: Fang, M., University of Miami Albrecht, B. A., University of Miami Area of Research: Radiation Processes Working Group(s): Cloud Life Cycle Journal Reference: Fang M, BA Albrecht, VP Ghate, and P Kollias. 2013. "Turbulence in continental stratocumulus, Part I: External forcings and turbulence structures." Boundary-Layer Meteorology, 149(454),

  19. zhu-99.PDF

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Formation and Development of Nocturnal Boundary Layer Clouds over the Southern Great Plains P. Zhu, B. A. Albrecht, and J. C. Gottschalck RSMAS/MPO University of Miami Miami, Florida Introduction Boundary layer clouds are important for modulating the earth's radiation budget, affecting local weather and interacting with trace gases to complicate air pollution problems. Previous studies show that some physical processes are critical to the development, maintenance, and dissipation of these

  20. Chris Golubieski | Bioenergy | NREL

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Chris Golubieski Research Technician Christopher.Golubieski@nrel.gov | 303-384-6341 Areas of Expertise Instrumentation Soldering Electrical (AC and DC) Rigging and Fall Protection Education B.A., Geology, Miami University, 1997 B.S., Areonautics/Meterology, Miami University, 1997 Professional Experience Research Technician, Thermochemical Process Development Unit, National Renewable Energy Laboratory, 2014-present Research Technician, National Center for Atmospheric Research, 2004--2014 Research

  1. ARM - Publications: Science Team Meeting Documents: Measurements of

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    atmospheric water vapor over the oceans Measurements of atmospheric water vapor over the oceans Szczodrak, Malgorzata University of Miami Minnett, Peter University of Miami Feltz, Wayne University of Wisconsin Atmospheric water vapor is an important part of the Earth's hydrological cycle and plays a crucial role in many aspects of the climate system. The main source of the atmospheric moisture are the oceans, but the information we have about the distribution of atmospheric water vapor over

  2. ARM - Publications: Science Team Meeting Documents: The First Deployment of

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    the ARM Mobile Facility; Investigating Marine Stratus at Pt. Reyes, CA The First Deployment of the ARM Mobile Facility; Investigating Marine Stratus at Pt. Reyes, CA Bartholomew, Mary Jane Brookhaven National Laboratory Miller, Mark Brookhaven National Laboratory Bucholtz, Anthony Naval Research Laboratory Albrecht, Bruce University of Miami Kollias, Pavlos RSMAS/University of Miami Sisterson, Douglas Argonne National Laboratory Widener, Kevin Pacific Northwest National Laboratory Jones,

  3. ARM - Events Article

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    ARM Shares Information at State of the Arctic Conference in... Miami? Bookmark and Share ARM user Eugene Clothiaux graciously agreed to be interviewed by St. Mark Catholic School 8th graders, who participated in the meeting's poster session. Representatives from the ARM Climate Research Facility joined over 430 students, scientists, and policymakers in Miami at the first State of the Arctic Conference from March 16-19. While sunny Florida may seem a strange backdrop to topics like historical and

  4. SOLAR MERIDIONAL CIRCULATION FROM DOPPLER SHIFTS OF THE Fe I LINE AT 5250 A AS MEASURED BY THE 150-FOOT SOLAR TOWER TELESCOPE AT THE MT. WILSON OBSERVATORY

    SciTech Connect (OSTI)

    Ulrich, Roger K.

    2010-12-10

    Doppler shifts of the Fe I spectral line at 5250 A from the full solar disk obtained over the period 1986 to 2009 are analyzed to determine the circulation velocity of the solar surface along meridional planes. Simultaneous measurements of the Zeeman splitting of this line are used to obtain measurements of the solar magnetic field that are used to select low field points and impose corrections for the magnetically induced Doppler shift. The data utilized is from a new reduction that preserves the full spatial resolution of the original observations so that the circulation flow can be followed to latitudes of 80{sup 0} N/S. The deduced meridional flow is shown to differ from the circulation velocities derived from magnetic pattern movements. A reversed circulation pattern is seen in polar regions for three successive solar minima. A surge in circulation velocity at low latitudes is seen during the rising phases of cycles 22 and 23.

  5. Ecological evaluation of proposed discharge of dredged material from Oakland Harbor into ocean waters (Phase 3 B of -42-foot project)

    SciTech Connect (OSTI)

    Kohn, N.P.; Ward, J.A.; Mayhew, H.L.; Word, J.Q.; Barrows, E.S.; Goodwin, S.M.; Lefkovitz, L.F. )

    1992-06-01

    The Water Resources Development Act of 1986 (Public Law 99-662) authorized the US Army Corps of Engineers (USACE) San Francisco District, to deepen and widen the navigational channels of the Oakland Inner and Outer Harbors to accomodate deeper-draft vessels. The USACE is considering several disposal options for the dredged material removed during these channel improvements including open-water disposal. Dredged material proposed for open-water disposal must be evaluated to determine the potential impacts of the disposal activity on the water column and disposal site enviromments. The USACE requested that Battelle/Marine Sciences Laboratory (MSL) conduct studies to evaluate open-water disposal options for Oakland Harbor sediments. This request developed into the Oakland Harbor Phase III Program. This is Volume 1 of a two-volume report that presents information gathered to determine the suitability of ocean disposal of sediments dredged from Oakland Harbor. This volume contains project background, materials and methods, results, discussion, and conclusions.

  6. Ecological evaluation of proposed discharge of dredged material from Oakland Harbor into ocean waters (Phase 3 B of -42-foot project). Volume 1, Analyses and discussion

    SciTech Connect (OSTI)

    Kohn, N.P.; Ward, J.A.; Mayhew, H.L.; Word, J.Q.; Barrows, E.S.; Goodwin, S.M.; Lefkovitz, L.F.

    1992-06-01

    The Water Resources Development Act of 1986 (Public Law 99-662) authorized the US Army Corps of Engineers (USACE) San Francisco District, to deepen and widen the navigational channels of the Oakland Inner and Outer Harbors to accomodate deeper-draft vessels. The USACE is considering several disposal options for the dredged material removed during these channel improvements including open-water disposal. Dredged material proposed for open-water disposal must be evaluated to determine the potential impacts of the disposal activity on the water column and disposal site enviromments. The USACE requested that Battelle/Marine Sciences Laboratory (MSL) conduct studies to evaluate open-water disposal options for Oakland Harbor sediments. This request developed into the Oakland Harbor Phase III Program. This is Volume 1 of a two-volume report that presents information gathered to determine the suitability of ocean disposal of sediments dredged from Oakland Harbor. This volume contains project background, materials and methods, results, discussion, and conclusions.

  7. INTERVALS OF RADIAL INTERPLANETARY MAGNETIC FIELDS AT 1 AU, THEIR ASSOCIATION WITH RAREFACTION REGIONS, AND THEIR APPARENT MAGNETIC FOOT POINTS AT THE SUN

    SciTech Connect (OSTI)

    Orlove, Steven T.; Smith, Charles W.; Vasquez, Bernard J.; Schwadron, Nathan A.; Skoug, Ruth M.; Zurbuchen, Thomas H.; Zhao Liang E-mail: Charles.Smith@unh.edu E-mail: N.Schwadron@unh.edu E-mail: thomasz@umich.edu

    2013-09-01

    We have examined 226 intervals of nearly radial interplanetary magnetic field orientations at 1 AU lasting in excess of 6 hr. They are found within rarefaction regions as are the previously reported high-latitude observations. We show that these rarefactions typically do not involve high-speed wind such as that seen by Ulysses at high latitudes during solar minimum. We have examined both the wind speeds and the thermal ion composition before, during and after the rarefaction in an effort to establish the source of the flow that leads to the formation of the rarefaction. We find that the bulk of the measurements, both fast- and slow-wind intervals, possess both wind speeds and thermal ion compositions that suggest they come from typical low-latitude sources that are nominally considered slow-wind sources. In other words, we find relatively little evidence of polar coronal hole sources even when we examine the faster wind ahead of the rarefaction regions. While this is in contrast to high-latitude observations, we argue that this is to be expected of low-latitude observations where polar coronal hole sources are less prevalent. As with the previous high-latitude observations, we contend that the best explanation for these periods of radial magnetic field is interchange reconnection between two sources of different wind speed.

  8. c21.xls

    U.S. Energy Information Administration (EIA) Indexed Site

    per Building (gallons) per Square Foot (gallons) per Worker (gallons) per Building (thousand dollars) per Square Foot (dollars) per Gallon (dollars) All Buildings...

  9. C16DIV.xls

    U.S. Energy Information Administration (EIA) Indexed Site

    cubic feet) per Square Foot (cubic feet) per Worker (thousand cubic feet) per Building (thousand dollars) per Square Foot (dollars) per Thousand Cubic Feet (dollars) NEW...

  10. c25.xls

    U.S. Energy Information Administration (EIA) Indexed Site

    per Building (million Btu) per Square Foot (thousand Btu) per Worker (million Btu) per Building (thousand dollars) per Square Foot (dollars) per Thousand Pounds (dollars) All...

  11. Energy Information Administration - Commercial Energy Consumption...

    U.S. Energy Information Administration (EIA) Indexed Site

    Gas Consumption Natural Gas Expenditures per Building (thousand cubic feet) per Square Foot (cubic feet) Distribution of Building-Level Intensities (cubic feetsquare foot) 25th...

  12. c26.xls

    U.S. Energy Information Administration (EIA) Indexed Site

    Btu) per Square Foot (thousand Btu) per Worker (million Btu) per Building (thousand dollars) per Square Foot (dollars) per Thousand Pounds (dollars) All Buildings...

  13. SUMMARY REPORT For MONITORTNG AND MITIGATlON OF MESA VERDE CACTUS

    Office of Legacy Management (LM)

    ... following contact on October 8, 2002 by Fred Smith, SMSC Construction Supervisor. ... At the request of Mr. Smith, an approximately 10 foot by 15 foot area at approximately ...

  14. LM Environmental Policy (PO 436.1a) | Department of Energy

    Energy Savers [EERE]

    Energy Co-Hosts Internatonal Workshop on Uranium Legacy Sites LM Co-Hosts Internatonal Workshop on Uranium Legacy Sites October 16, 2012 - 1:51pm Addthis LM Co-Hosts Internatonal Workshop on Uranium Legacy Sites LM Co-Hosts Internatonal Workshop on Uranium Legacy Sites LM Co-Hosts Internatonal Workshop on Uranium Legacy Sites LM Co-Hosts Internatonal Workshop on Uranium Legacy Sites What does this project do? Goal 1. Protect human health and the environment The U.S. Department of Energy

  15. Table 5.1a Petroleum and Other Liquids Overview, 1949-2011

    U.S. Energy Information Administration (EIA) Indexed Site

    a Petroleum and Other Liquids Overview, 1949-2011 Year Production 1 Production as Share of Estimated Consumption Net Imports 2 Net Imports as Share of Estimated Consumption Balancing Item 3 Estimated Consumption 4 Thousand Barrels Percent Thousand Barrels Percent Thousand Barrels 1949 1,998,441 95.0 116,183 5.5 -11,115 2,103,509 1950 2,156,247 91.5 198,955 8.4 1,938 2,357,140 1951 2,455,113 95.9 154,142 6.0 -48,367 2,560,888 1952 2,515,903 94.6 190,319 7.2 -45,542 2,660,680 1953 2,602,845 93.8

  16. Table HC1-1a. Housing Unit Characteristics by Climate Zone,

    U.S. Energy Information Administration (EIA) Indexed Site

    a. Housing Unit Characteristics by Climate Zone, Million U.S. Households, 2001 Housing Unit Characteristics RSE Column Factor: Total Climate Zone 1 RSE Row Factors Fewer than 2,000 CDD and -- 2,000 CDD or More and Fewer than 4,000 HDD More than 7,000 HDD 5,500 to 7,000 HDD 4,000 to 5,499 HDD Fewer than 4,000 HDD 0.4 1.8 1.0 1.1 1.2 1.1 Total ............................................... 107.0 9.2 28.6 24.0 21.0 24.1 8.0 Census Region and Division Northeast

  17. DOE Order 442.1 A: Department of Energy Employee Concerns Program...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    In accomplishing its goals, the ECP must meet the following criteria. (1) The ECP must possess interfaces with the following organizations: (a) Other DOE, including NNSA and DOE ...

  18. Spinning Chen Zhou1, a), Kewei Sun3, Frederick E. Pinkerton2...

    Office of Scientific and Technical Information (OSTI)

    ... Phys. 76 (10), 6056-6058 (1994). 13.J. J. Croat, J. F. Herbst, R. W. Lee and F. E. Pinkerton, Appl. Phys. Lett. 44 (1), 148-149 (1984). 14.J. F. Herbst, Reviews of Modern Physics ...

  19. Code requirements document: MODFLOW 2.1: A program for predicting moderator flow patterns

    SciTech Connect (OSTI)

    Peterson, P.F.; Paik, I.K.

    1992-03-01

    Sudden changes in the temperature of flowing liquids can result in transient buoyancy forces which strongly impact the flow hydrodynamics via flow stratification. These effects have been studied for the case of potential flow of stratified liquids to line sinks, but not for moderator flow in SRS reactors. Standard codes, such as TRAC and COMMIX, do not have the capability to capture the stratification effect, due to strong numerical diffusion which smears away the hot/cold fluid interface. A related problem with standard codes is the inability to track plumes injected into the liquid flow, again due to numerical diffusion. The combined effects of buoyant stratification and plume dispersion have been identified as being important in operation of the Supplementary Safety System which injects neutron-poison ink into SRS reactors to provide safe shutdown in the event of safety rod failure. The MODFLOW code discussed here provides transient moderator flow pattern information with stratification effects, and tracks the location of ink plumes in the reactor. The code, written in Fortran, is compiled for Macintosh II computers, and includes subroutines for interactive control and graphical output. Removing the graphics capabilities, the code can also be compiled on other computers. With graphics, in addition to the capability to perform safety related computations, MODFLOW also provides an easy tool for becoming familiar with flow distributions in SRS reactors.

  20. Code requirements document: MODFLOW 2. 1: A program for predicting moderator flow patterns

    SciTech Connect (OSTI)

    Peterson, P.F. . Dept. of Nuclear Engineering); Paik, I.K. )

    1992-03-01

    Sudden changes in the temperature of flowing liquids can result in transient buoyancy forces which strongly impact the flow hydrodynamics via flow stratification. These effects have been studied for the case of potential flow of stratified liquids to line sinks, but not for moderator flow in SRS reactors. Standard codes, such as TRAC and COMMIX, do not have the capability to capture the stratification effect, due to strong numerical diffusion which smears away the hot/cold fluid interface. A related problem with standard codes is the inability to track plumes injected into the liquid flow, again due to numerical diffusion. The combined effects of buoyant stratification and plume dispersion have been identified as being important in operation of the Supplementary Safety System which injects neutron-poison ink into SRS reactors to provide safe shutdown in the event of safety rod failure. The MODFLOW code discussed here provides transient moderator flow pattern information with stratification effects, and tracks the location of ink plumes in the reactor. The code, written in Fortran, is compiled for Macintosh II computers, and includes subroutines for interactive control and graphical output. Removing the graphics capabilities, the code can also be compiled on other computers. With graphics, in addition to the capability to perform safety related computations, MODFLOW also provides an easy tool for becoming familiar with flow distributions in SRS reactors.

  1. Nuclear facility decommissioning and site remedial actions. Volume 1. A selected bibliography

    SciTech Connect (OSTI)

    Faust, R.A.; Fore, C.S.; Knox, N.P.

    1980-09-01

    This bibliography of 633 references represents the first in a series to be produced by the Remedial Actions Program Information Center (RAPIC) containing scientific, technical, economic, and regulatory information concerning the decommissioning of nuclear facilities. Major chapters selected for this bibliography are Facility Decommissioning, Uranium Mill Tailings Cleanup, Contaminated Site Restoration, and Criteria and Standards. The references within each chapter are arranged alphabetically by leading author, corporate affiliation, or title of the document. When the author is not given, the corporate affiliation appears first. If these two levels of authorship are not given, the title of the document is used as the identifying level. Indexes are provided for (1) author(s), (2) keywords, (3) title, (4) technology development, and (5) publication description. An appendix of 123 entries lists recently acquired references relevant to decommissioning of nuclear facilities. These references are also arranged according to one of the four subject categories and followed by author, title, and publication description indexes. The bibliography was compiled from a specialized data base established and maintained by RAPIC to provide information support for the Department of Energy's Remedial Actions Program, under the cosponsorship of its three major components: Surplus Facilities Management Program, Uranium Mill Tailings Remedial Actions Program, and Formerly Utilized Sites Remedial Actions Program. RAPIC is part of the Ecological Sciences Information Center within the Information Center Complex at Oak Ridge National Laboratory.

  2. Microsoft Word - M108 DOE O226 1A.DOC

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of Offers is extended, is not...

  3. Illinois department of public health H1N1/A pandemic communications evaluation survey.

    SciTech Connect (OSTI)

    Walsh, D.; Decision and Information Sciences

    2010-09-16

    Because of heightened media coverage, a 24-hour news cycle and the potential miscommunication of health messages across all levels of government during the onset of the H1N1 influenza outbreak in spring 2009, the Illinois Department of Public Health (IDPH) decided to evaluate its H1N1 influenza A communications system. IDPH wanted to confirm its disease information and instructions were helping stakeholders prepare for and respond to a novel influenza outbreak. In addition, the time commitment involved in preparing, issuing, monitoring, updating, and responding to H1N1 federal guidelines/updates and media stories became a heavy burden for IDPH staff. The process and results of the H1N1 messaging survey represent a best practice that other health departments and emergency management agencies can replicate to improve coordination efforts with stakeholder groups during both emergency preparedness and response phases. Importantly, the H1N1 survey confirmed IDPH's messages were influencing stakeholders decisions to activate their pandemic plans and initiate response operations. While there was some dissatisfaction with IDPH's delivery of information and communication tools, such as the fax system, this report should demonstrate to IDPH that its core partners believe it has the ability and expertise to issue timely and accurate instructions that can help them respond to a large-scale disease outbreak in Illinois. The conclusion will focus on three main areas: (1) the survey development process, (2) survey results: best practices and areas for improvement and (3) recommendations: next steps.

  4. Policy Flash 2014-40 Implementation of DOE O 580.1A, DOE Energy...

    Broader source: Energy.gov (indexed) [DOE]

    Questions may be referred to Scott Whiteford (202) 287-1563 or scott.whiteford@hq.doe.gov POLICYFLASHFinal.pdf More Documents & Publications Policy Flashes 2014 Personal Property...

  5. Systematic Effects in Type-1a Supernovae Surveys from Host Galaxy...

    Office of Scientific and Technical Information (OSTI)

    This grant found strong evidence for two distinct populations of supernovae, and correlations between the progenitor stellar populations and the nature of the supernova light ...

  6. MACCS version 1.5.11.1: A maintenance release of the code

    SciTech Connect (OSTI)

    Chanin, D.; Foster, J.; Rollstin, J.; Miller, L.

    1993-10-01

    A new version of the MACCS code (version 1.5.11.1) has been developed by Sandia National Laboratories under sponsorship of the US Nuclear Regulatory Commission. MACCS was developed to support evaluations of the off-site consequences from hypothetical severe accidents at commercial power plants. MACCS is the only current public domain code in the US that embodies all of the following modeling capabilities: (1) weather sampling using a year of recorded weather data; (2) mitigative actions such as evacuation, sheltering, relocation, decontamination, and interdiction; (3) economic costs of mitigative actions; (4) cloudshine, groundshine, and inhalation pathways as well as food and water ingestion; (5) calculation of both individual and societal doses to various organs; and (6) calculation of both acute (nonstochastic) and latent (stochastic) health effects and risks of health effects. All of the consequence measures may be fun generated in the form of a complementary cumulative distribution function (CCDF). The current version implements a revised cancer model consistent with recent reports such as BEIR V and ICRP 60. In addition, a number of error corrections and portability enhancements have been implemented. This report describes only the changes made in creating the new version. Users of the code will need to obtain the code`s original documentation, NUREG/CR-4691.

  7. Understanding the Mechanism of Human P450 CYP1A2 Using Coupled...

    Office of Scientific and Technical Information (OSTI)

    Authors: Draeger, E W ; Bennion, B ; Gygi, F ; Lightstone, F Publication Date: 2006-02-10 OSTI Identifier: 899113 Report Number(s): UCRL-TR-219003 TRN: US200708%%159 DOE Contract ...

  8. National Geothermal Data System State Submissions by Date (Appendix A-1-a)

    SciTech Connect (OSTI)

    Love, Diane

    2015-12-20

    This multipaged spreadsheet tracks submissions of all data records to the State Geological Survey Contributions to the National Geothermal Data System by state and by type.

  9. DOE-CX00080-Rev-1A_Relocation_of_Buildings.pdf

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

  10. Implementation Guide for Use with DOE O 460.1A, Packaging and Transportation Safety

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    1997-06-05

    This Guide provides information concerning the use of current principles and practices, including regulatory guidance from the U. S. Department of Transportation and the U. S. Nuclear Regulatory Commission, where available, to establish and implement effective packaging and transportation safety programs. Does not cancel/supersede other directives. The guide and attachments have been combined into one document.

  11. EVMS Training Snippet: 3.1A Integrated Master Schedule (IMS) Initial Baseline Review

    Broader source: Energy.gov [DOE]

    This EVMS Training Snippet, sponsored by the Office of Project Management (PM) covers how to review an Integrated Master Schedule (IMS) and highlights common areas of non-compliance with ANSI/EIA...

  12. Microsoft PowerPoint - Snippet 3.1A IMS Initial Baseline Review...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    and risk. This snippet is recommended whenever a schedule baseline is created or revised. 1 The Contract is the prevailing document regarding what Earned Value Management ...

  13. Supplement Directive NA-1 M 410.1A.PDF

    National Nuclear Security Administration (NNSA)

  14. DRAFT - DOE O 329.1A, Excepted Service Authorities for EJ and EK Pay Plans

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    To establish requirements and responsibilities for the employment and compensation of individuals when using the following DOE excepted service authority: a. Section 621(d) of the DOE Organization Act (42 United States Code (U.S.C.), section 7231(d), hereafter referred to as pay plan EJ. b. Section 3161(a) of the National Defense Authorization Act for Fiscal Year 1995 (Public Law 103-337, October 5, 1994) and renewals, hereafter referred to as pay plan EK.

  15. PRAD1, a candidate BCL1 oncogene: Mapping and expression in centrocytic lymphoma

    SciTech Connect (OSTI)

    Rosenberg, C.L.; Arnold, A.; Harris, N.L. (Massachusetts General Hospital, Boston, MA (United States) Harvard Medical School, Boston, MA (United States)); Wong, E.; Petty, E.M.; Bale, A.E. (Yale Univ., New Haven, CT (United States)); Tsujimoto, Yoshihide (Wistar Inst., Philadelphia, PA (United States))

    1991-11-01

    Rearrangement of the BCL1 (B-cell lymphoma 1) region on chromosome 11q13 appears to be highly characteristic of centrocytic lymphoma and also is found infrequently in other B-cell neoplasma. Rearrangement is thought to deregulate a nearby protooncogene, but transcribed sequences in the immediate vicinity of BCL1 breakpoints had not been identified. PRAD1, previously designated D11S287E, was identified on 11q13 as a chromosomal breakpoint region rearranged with the parathyroid hormone gene in a subset of parathyroid adenomas; this highly conserved putative oncogene, which encodes a novel cyclin, has been linked to BCL1 and implicated also in subsets of breast and squamous cell neoplasms with 11q13 amplification. The authors report pulsed-field gel electrophoresis data showing BCL1 and PRAD1 to be no more than 130 kilobases apart. PRAD1 mRNA is abundantly expressed in seven of seven centrocytic lymphomas (Kiel classification), in contrast to 13 closely related but noncentrocytic lymphomas. Three of the seven centrocytic lymphomas had detectable BCL1 DNA rearrangement. Also, two unusual cases of CLL and BCL1 rearrangement overexpressed PRAD1, in contrast to five CLL controls. Thus, PRAD1 is an excellent candidate BCL1 oncogene. Its overexpression may be a key consequence of rearrangement of the BCL1 vicinity in B-cell neoplasms and a unifying pathogenetic feature in centrocytic lymphoma.

  16. Phase 1A Final Report for the AREVA Team Enhanced Accident Tolerant Fuels Concepts

    SciTech Connect (OSTI)

    Morrell, Mike E.

    2015-03-19

    In response to the Department of Energy (DOE) funded initiative to develop and deploy lead fuel assemblies (LFAs) of Enhanced Accident Tolerant Fuel (EATF) into a US reactor within 10 years, AREVA put together a team to develop promising technologies for improved fuel performance during off normal operations. This team consisted of the University of Florida (UF) and the University of Wisconsin (UW), Savannah River National Laboratory (SRNL), Duke Energy and Tennessee Valley Authority (TVA). This team brought broad experience and expertise to bear on EATF development. AREVA has been designing; manufacturing and testing nuclear fuel for over 50 years and is one of the 3 large international companies supplying fuel to the nuclear industry. The university and National Laboratory team members brought expertise in nuclear fuel concepts and materials development. Duke and TVA brought practical utility operating experience. This report documents the results from the initial “discovery phase” where the team explored options for EATF concepts that provide enhanced accident tolerance for both Design Basis (DB) and Beyond Design Basis Events (BDB). The main driver for the concepts under development were that they could be implemented in a 10 year time frame and be economically viable and acceptable to the nuclear fuel marketplace. The economics of fuel design make this DOE funded project very important to the nuclear industry. Even incremental changes to an existing fuel design can cost in the range of $100M to implement through to LFAs. If this money is invested evenly over 10 years then it can take the fuel vendor several decades after the start of the project to recover their initial investment and reach a breakeven point on the initial investment. Step or radical changes to a fuel assembly design can cost upwards of $500M and will take even longer for the fuel vendor to recover their investment. With the projected lifetimes of the current generation of nuclear power plants large scale investment by the fuel vendors is difficult to justify. Specific EATF enhancements considered by the AREVA team were; Improved performance in DB and BDB conditions; Reduced release to the environment in a catastrophic accident; Improved performance during normal operating conditions; Improved performance if US reactors start to load follow; Equal or improved economics of the fuel; and Improvements to the fuel behavior to support future transportation and storage of the used nuclear fuel (UNF). In pursuit of the above enhancements, EATF technology concepts that our team considered were; Additives to the fuel pellets which included; Chromia doping to increase fission gas retention. Chromia doping has the potential to improve load following characteristics, improve performance of the fuel pellet during clad failure, and potentially lock up cesium into the fuel matrix; Silicon Carbide (SiC) Fibers to improve thermal heat transfer in normal operating conditions which also improves margin in accident conditions and the potential to lock up iodine into the fuel matrix; Nano-diamond particles to enhance thermal conductivity; Coatings on the fuel cladding; and Nine coatings on the existing Zircaloy cladding to increase coping time and reduce clad oxidation and hydrogen generation during accident conditions, as well as reduce hydrogen pickup and mitigate hydride reorientation in the cladding. To facilitate the development process AREVA adopted a formal “Gate Review Process” (GR) that was used to review results and focus resources onto promising technologies to reduce costs and identify the technologies that would potentially be carried forward to LFAs within a 10 year period. During the initial discovery phase of the project AREVA took the decision to be relatively hands off and allow our university and National Laboratory partners to be free thinking and consider options that would not be constrained by preconceived ideas from the fuel vendor. To counter this and to keep the partners focused, the GR process was utilized. During this GR process each of the team members presented their findings to a board made up of technical experts from utilities, fuel manufacturing experts, fuel technical experts, and fuel research and development (R&D) experts. During the initial 2 years of the project there were several major accomplishments. These accomplishments, along with the implications for successfully implementing EATF, are; The experimental spark plasma sintering process (SPS) process was successfully used to produce fuel pellets containing either 10% SiC whiskers or nano-diamond particles. The ability to use this process enables the thermal margin enhancements of the fuel additives to be realized. Without the SPS process, the conventional process cannot support adding pellet additives in the required quantities; Coatings of Ti2AlC were successfully applied to Zircaloy-4 cladding. Testing of Ti2AlC coatings at Loss of Cooling Accident (LOCA) conditions showed reduced cladding oxidation compared to present un-coated Zircaloy-4 cladding. This achievement allows the presently used cladding system to be retained so that the 10 year schedule can be met. Having to implement a new cladding material will extend the development schedule beyond 10 years; Several documents were produced to support future development, testing, and licensing of EATF, including a design requirements traceability matrix, a draft business plan, a draft test plan, a draft regulatory plan, and the acceptance criteria for lead fuel assembly insertion into a commercial reactor. This preparatory work lays the foundation for ensuring the future development plans address all the areas required to test, license, and manufacture the new EATF; and In addition, the high velocity oxy-fuel and electrophoretic deposition (EPD) coating application processes were dropped from further consideration due to their inability to meet manufacturing criteria. This allows the resources to be focused on the most promising EATF concepts identified. Future development opportunities that were identified during this work include; The use of SiC or diamond requires that a new pellet production technique (Spark Plasma Sintering), be developed. This entails investment in developing, proving and implementing a new commercial pellet production process. Development of the process to apply thinner coatings is required; Coatings cannot be too “thick” or they will displace a significant volume of water in the core resulting in reduced thermal hydraulic characteristics; Application of the coating at high temperature can affect the Zircaloy substrate. This will require the development and implementation of a new cladding coating manufacturing process; and Replace the Cold Spray (CS) cladding coating application with the Physical Vapor Deposition (PVD) process to eliminate duplication of work and provide greater control over coating thicknesses. This can result in a reduction in the final cycle economic penalty of coatings.

  17. Notice of Intent to Revise DOE P 470.1A, Safeguards and Security Program

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    2015-08-06

    The proposed revision of this directive will realign this policy to create an integrated security enterprise that effectively protects the Department's assets to institute enterprise-wide solutions to common challenges across the complex.

  18. Policy Flash 2014-30 DOE Order 412.1a, Work Authorization System...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    concerning this policy flash should be directed to Mike Dombrowski, of the Office of Acquisition and Project Management Policy at 202-287-1828 or at michael.dombrowski@hq.doe....

  19. Draft - DOE O 522.1A, Pricing of Departmental Materials and Services

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    The order establishes DOE requirements for prices and charges for materials and services sold or provided to external organizations, other Federal agencies, or the private sector either directly or through a Departmental site/facility management contract.

  20. Microsoft Word - CRADA Agreement Boilerplate Approved 6-2014 (DOE O 483.1A)

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    STEVENSON-WYDLER (15 U.S.C. 3710a) COOPERATIVE RESEARCH AND DEVELOPMENT AGREEMENT (hereinafter "CRADA") No. AL-C- - BETWEEN Ames Laboratory, Iowa State University under its U.S. Department of Energy Contract No. DE-AC02-07CH11358 (hereinafter "Contractor") AND __________________________________________________ (hereinafter "Participant"), both being hereinafter jointly referred to as the "Parties." ARTICLE I: DEFINITIONS A. "Background Intellectual

  1. Database for Regional Geology, Phase 1- A Tool for informing Regional

    Energy Savers [EERE]

    Energy Data-Driven Mailing Helps Heat Up Untapped Seattle Market Data-Driven Mailing Helps Heat Up Untapped Seattle Market Abridged transcript of an interview with Community Power Works Project Manager Ruth Bell and Program/System Analyst Vince Schueler of the Washington State University Energy Program. PDF icon Seattle Focus Series More Documents & Publications The Better Buildings Neighborhood View -- January 2013 howtodesignandmarketenergyefficiencyprogramstospecificneighborhoods.doc

  2. EVMS Training Snippet: 3.1A Integrated Master Schedule (IMS)...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    and critical path the DOE can rely on to assess schedule performance, predictive analysis, and risk. This snippet is recommended whenever a schedule baseline is created or revised. ...

  3. Notice of Intent to Revise DOE O 200.1A, Information Technology Management

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    2013-11-21

    This revised Order is needed to clarify the roles and responsibilities, policies, and procedures for effectively managing IT investments to ensure mission success.

  4. Inverter Load Rejection Over-Voltage Testing: SolarCity CRADA Task 1a Final Report

    SciTech Connect (OSTI)

    Nelson, A.; Hoke, A.; Chakraborty, S.; Chebahtah, J.; Wang, T.; Zimmerly, B.

    2015-02-01

    Various interconnection challenges exist when connecting distributed PV into the electrical distribution grid in terms of safety, reliability, and stability of electric power systems. One of the urgent areas for additional research - as identified by inverter manufacturers, installers, and utilities - is the potential for transient over-voltage from PV inverters. In one stage of a cooperative tests were repeated a total of seven times. The maximum over-voltage measured in any test did not exceed 200% of nominal, and typical over-voltage levels were significantly lower. The total voltage duration and the maximum continuous time above each threshold are presented here, as well as the time to disconnect for each test. Finally, we present a brief investigation into the effect of DC input voltage as well as a series of no-load tests. This report describes testing conducted at NREL to determine the duration and magnitude of transient over-voltages created by several commercial PV inverters during load-rejection conditions. For this work, a test plan that is currently under development by the Forum on Inverter Grid Integration Issues (FIGII) has been implemented in a custom test setup at NREL. Through a cooperative research and development agreement, NREL is working with SolarCity to address two specific types of transient overvoltage: load rejection overvoltage (LRO) and ground fault overvoltage (GFO). Additional partners in this effort include the Hawaiian Electric Companies, Northern Plains Power Technologies, and the Electric Power Research Institute.

  5. Deep Blue No.1-A Slimhole Geothermal Discovery At Blue Mountain...

    Open Energy Info (EERE)

    Area (Fairbank & Niggemann, 2004) Slim Holes At Blue Mountain Geothermal Area (Fairbank Engineering Ltd, 2003) Thermal Gradient Holes At Blue Mountain Geothermal Area (Fairbank &...

  6. Microsoft Word - m460.2-1aFinal6-4-08.doc

    National Nuclear Security Administration (NNSA)

    ... Office of Inspector General, Bonneville Power Administration, Southeastern Power ... to ensure that shipments use high quality carriers and drivers; * Shipment ...

  7. Microsoft PowerPoint - 1-A-3-Beaudry-LOSIQUE-Brief to Blade Workshop...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    ... Energy Capture Efficiency Tower 2020 LCOE Target FY10 Budget for COE reductions ... Modeled cost of energy to reflect impact of DOE R&D; lower than actual market prices Rotor ...

  8. \\\\Athena\\tsoshare\\Dosimetry\\Dosimetry Forms\\RPR 1A RADIATION...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Int.: Previous (maiden) or other surnames known by: Permanent Address: Soc. Sec. No.: Sex: Male Female Birth date: Month Day Year Job Title or Duties: Department: Room Number:...

  9. SACO-1: a fast-running LMFBR accident-analysis code

    SciTech Connect (OSTI)

    Mueller, C.J.; Cahalan, J.E.; Vaurio, J.K.

    1980-01-01

    SACO is a fast-running computer code that simulates hypothetical accidents in liquid-metal fast breeder reactors to the point of permanent subcriticality or to the initiation of a prompt-critical excursion. In the tradition of the SAS codes, each subassembly is modeled by a representative fuel pin with three distinct axial regions to simulate the blanket and core regions. However, analytic and integral models are used wherever possible to cut down the computing time and storage requirements. The physical models and basic equations are described in detail. Comparisons of SACO results to analogous SAS3D results comprise the qualifications of SACO and are illustrated and discussed.

  10. R-MCJ10042201-1A_PADT_PhaseII-report-final

    SciTech Connect (OSTI)

    Johnson, Mark Christian

    2010-04-22

    The thrust of this R&D effort was to develop technology that serves the SOFC industry and help developers in this industry to succeed. In particular this project focused on fluid handling equipment that supported the SOFC stack. Two devices were developed: the Hot Anode Recycle Blower (HARB) blower which will serve hot anode gas requirements in FutureGen demonstration units, and the small multi stage (SMS) blower which will serve warm anode and cathode gas requirements for SOFC and other fuel cell industries.

  11. Policy Flash 2014-30 DOE Order 412.1a, Work Authorization System Administrative Change

    Office of Energy Efficiency and Renewable Energy (EERE)

    Questions concerning this policy flash should be directed to Mike Dombrowski, of the Office of Acquisition and Project Management Policy at 202-287-1828 or at michael.dombrowski@hq.doe.gov.

  12. Understanding the Mechanism of Human P450 CYP1A2 Using Coupled...

    Office of Scientific and Technical Information (OSTI)

    Despite extensive experimental research on this enzyme system, key questions regarding its catalytic cycle and oxygen activation mechanism remain unanswered. In order to elucidate ...

  13. Friedman-FES_NERSC-2013slides-v1a.ppt

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Sciences Program! and! Heavy Ion Fusion Science ! Virtual National Laboratory! ! Workshop on Large Scale Production Computing and Storage Requirements 
 for Fusion Energy Sciences" Rockville, MD, March 19-20, 2013 * This work was performed under the auspices of the U.S. Department of Energy by Lawrence Livermore National Security, LLC, Lawrence Livermore National Laboratory under Contract DE-AC52-07NA27344, by LBNL under Contract DE-AC02-05CH11231, and by PPPL under Contract

  14. Microsoft Word - DRAFT SRSPM 250-1-1A.docx

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    (items that are prohibited from SRS include weapons, simulated weapons, firearms, stun guns, ammunition andor incendiaries, explosive materialsdevices, chemical irritants,...

  15. Structure of a Thiol Monolayer-Protected Gold Nanoparticle at 1.1 A

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Resolution Thiol Monolayer-protected Gold Nanoparticle at 1.1 Å Resolution Nanometer-size metal particles are of fundamental interest for their chemical and quantum electronic properties, and of practical interest for many potential applications [1, 2]. Historically gold nanoparticles are the best studied, dating back to ancient Rome where colloidal gold was thought to have medicinal properties due to its blood red color. Gold has proven to have applications in medicine with some modern

  16. Syntaxin 1a Variants Lacking an N-peptide or Bearing the LE Mutation...

    Office of Scientific and Technical Information (OSTI)

    Research Org: SLAC National Accelerator Laboratory (SLAC) Sponsoring Org: US DOE Office of Science (DOE SC) Country of Publication: United States Language: English Subject: BIO ...

  17. DOE O 580.1A Department of Energy Personal Property Management Program

    Broader source: Energy.gov [DOE]

    The Department issued a Contractor Requirements Document (CRD) for the subject Directive on March 30, 2012.

  18. Systematic Effects in Type-1a Supernovae Surveys from Host Galaxy...

    Office of Scientific and Technical Information (OSTI)

    of supernovae, and correlations between the progenitor stellar populations and the nature of the supernova light curves. Authors: Strauss, Michael A. 1 + Show Author...

  19. Deep Blue No. 1-A Slimhole Geothermal Discovery at Blue Mountain...

    Open Energy Info (EERE)

    drilling of Deep Blue No.1. This well was sited on the basis of proximity to numerous gold exploration holes that indicated thermal water, high temperature gradients recorded in...

  20. Prospects for the study of the {tau}-tilde system in SPS1a' at...

    Office of Scientific and Technical Information (OSTI)

    The prospects for the analysis of tau channels at the supersymmetry (SUSY) benchmark ... Linear Collider. All accessible SUSY channels as well as all standard model ...

  1. --No Title--

    U.S. Energy Information Administration (EIA) Indexed Site

    |Natural Gas Energy Intensity | | | (billion cubic feet) | square feet) | (cubic feetsquare foot) | | |---+---+---...

  2. --No Title--

    U.S. Energy Information Administration (EIA) Indexed Site

    Using Electricity (million |Electricity Energy Intensity | | | (billion kWh) | square feet | (kWhsquare foot) | | |---+---...

  3. --No Title--

    U.S. Energy Information Administration (EIA) Indexed Site

    (million square | Fuel Oil Energy Intensity | | | (million gallons) | feet) | (gallonssquare foot) | | |---+---+---...

  4. --No Title--

    U.S. Energy Information Administration (EIA) Indexed Site

    | Natural Gas Energy Intensity | | | (billion cubic feet) | square feet) | (cubic feetsquare foot) | | |---+---+---...

  5. Washington Closure Hanford Report of Settlement Monitoring of the ERDF Landfill

    SciTech Connect (OSTI)

    J. T. Cameron

    2008-07-30

    This report summarizes the results of the ERDF Settlement Monitoring Program conducted between August 9, 2007, and April 29, 2008, on the 35-foot and 70-foot levels of the ERDF landfill. The purpose of this monitoring program was to verify that the materials already placed under the 35-foot and 70-foot levels satisfy the settlement criteria of the conceptual cap design.

  6. Annual Report to Congress on Federal Government Energy Management...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ... 74 Q. National Aeronautics and Space Administration ......in Btu per Square Foot of Goal Building Space ......

  7. Buildings Energy Data Book: 3.1 Commercial Sector Energy Consumption

    Buildings Energy Data Book [EERE]

    8 Commercial Delivered Energy Consumption Intensities, by Vintage Consumption per Year Constructed Square Foot (thousand Btu/SF) Prior to 1960 84.4 23% 1960 to 1969 91.5 12% 1970 to 1979 97.0 18% 1980 to 1989 100.0 19% 1990 to 1999 90.3 19% 2000 to 2003 81.6 8% Average 91.0 Source(s): EIA, 2003 Commercial Buildings Energy Consumption and Expenditures: Consumption and Expenditures Tables, Oct. 2006, Table C1a

  8. Buildings Energy Data Book: 7.6 Efficiency Standards for Lighting

    Buildings Energy Data Book [EERE]

    1 Efficiency Standards for General Service Fluorescent Lamps Effective for products manufactured before July 14, 2012 Minimum Nominal Lamp Average Lamp Lamp Type (1) Wattage (W) Minimum CRI Efficacy (lm/W) Effective Date 4-Foot Medium Bipin >35 69 75.0 November 1, 1995 4-Foot Medium Bipin ≤35 45 75.0 November 1, 1995 2-Foot U-Shaped >35 69 68.0 November 1, 1995 2-Foot U-Shaped ≤35 45 64.0 November 1, 1995 8-Foot Slimline >65 69 80.0 May 1, 1994 8-Foot Slimline ≤65 45 80.0 May 1,

  9. Generating Unit Retirements in the United States by State, 2008

    U.S. Energy Information Administration (EIA) Indexed Site

    ... of Lebanon",2921,"Lebanon",22,4,1.2,1.3,1.3,,"IC","DFO",,12,2008 "OH","Hamilton",3542,"Duke Energy Ohio Inc",2832,"Miami Fort",22,5,100,80,80,,"ST","BIT",,1,2008 ...

  10. Operable Generating Units in the United States by State and Energy...

    U.S. Energy Information Administration (EIA) Indexed Site

    ...,420,22,"ST","BIT",,7,1969 "OH","Hamilton",3542,"Duke Energy Ohio Inc",2832,"Miami Fort",6,,"OP",163.2,163,163,22,"ST","BIT",,11,1960 "OH","Hamilton",3542,"Duke Energy Ohio ...

  11. Lead Emissions from the Use of Leaded Aviation Gasoline in the...

    National Nuclear Security Administration (NNSA)

    ... FIEL 19 0.021 29083 GLY MO HENRY CLINTON MEMORIAL 19 0.021 18103 I76 IN MIAMI PERU MUNI 19 0.021 30041 HVR MT HILL HAVRE CITY-COUNTY 19 0.021 37117 MCZ NC MARTIN MARTIN ...

  12. Fact #775: April 15, 2013 Top Ten Urban Areas for Fuel Wasted...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    (Million Gallons) 1 New York-Newark NY-NJ-CT 256 2 Los Angeles-Long Beach-Santa Ana CA 220 3 Chicago IL-IN 127 4 Miami FL 94 5 Washington DC-VA-MD 85 6 Philadelphia ...

  13. Improved blade profile loss and deviation angle models for advanced transonic compressor bladings. Part 1: A model for subsonic flow

    SciTech Connect (OSTI)

    Koenig, W.M.; Hennecke, D.K.; Fottner, L.

    1996-01-01

    New blading concepts as used in modern transonic axial-flow compressors require improved loss and deviation angle correlations. The new model presented in this paper incorporates several elements and treats blade-row flows having subsonic and supersonic inlet conditions separately. In the first part of this paper two proved and well-established profile loss correlations for subsonic flows are extended to quasi-two-dimensional conditions and to custom-tailored blade designs. Instead of a deviation angle correlation, a simple method based on singularities is utilized. The comparison between the new model and a recently published model demonstrates the improved accuracy in prediction of cascade performance achieved by the new model.

  14. Theory manual for FAROW version 1.1: A numerical analysis of the Fatigue And Reliability Of Wind turbine components

    SciTech Connect (OSTI)

    WUBTERSTEUBMSTEVEB R.; VEERS,PAUL S.

    2000-01-01

    Because the fatigue lifetime of wind turbine components depends on several factors that are highly variable, a numerical analysis tool called FAROW has been created to cast the problem of component fatigue life in a probabilistic framework. The probabilistic analysis is accomplished using methods of structural reliability (FORM/SORM). While the workings of the FAROW software package are defined in the user's manual, this theory manual outlines the mathematical basis. A deterministic solution for the time to failure is made possible by assuming analytical forms for the basic inputs of wind speed, stress response, and material resistance. Each parameter of the assumed forms for the inputs can be defined to be a random variable. The analytical framework is described and the solution for time to failure is derived.

  15. COMBINE7.1 - A Portable ENDF/B-VII.0 Based Neutron Spectrum and Cross-Section Generation Program

    SciTech Connect (OSTI)

    Woo Y. Yoon; David W. Nigg

    2009-08-01

    COMBINE7.1 is a FORTRAN 90 computer code that generates multigroup neutron constants for use in the deterministic diffusion and transport theory neutronics analysis. The cross-section database used by COMBINE7.1 is derived from the Evaluated Nuclear Data Files (ENDF/B-VII.0). The neutron energy range covered is from 20 MeV to 1.0E-5 eV. The Los Alamos National Laboratory NJOY code is used as the processing code to generate a 167 fine-group cross-section library in MATXS format for Bondarenko self-shielding treatment. Resolved resonance parameters are extracted from ENDF/B-VII.0 File 2 for a separate library to be used in an alternate Nordheim self-shielding treatment in the resolved resonance energy range. The equations solved for energy dependent neutron spectrum in the 167 fine-group structure are the B-3 or B-1 approximations to the transport equation. The fine group cross sections needed for the spectrum calculation are first prepared by Bondarenko self-shielding interpolation in terms of background cross section and temperature. The geometric lump effect, when present, is accounted for by augmenting the background cross section. Nordheim self-shielded fine group cross sections for a material having resolved resonance parameters overwrite correspondingly the existing self-shielded fine group cross sections when this option is used. The fine group cross sections in the thermal energy range are replaced by those self-shielded with the Amouyal/Benoist/Horowitz method in the three region geometry when this option is requested. COMBINE7.1 coalesces fine group cross sections into broad group macroscopic and microscopic constants. The coalescing is performed by utilizing fine-group fluxes and/or currents obtained by spectrum calculation as the weighting functions. The multigroup constant may be output in any of several standard formats including ANISN 14** free format, CCCC ISOTXS format, and AMPX working library format. ANISN-PC, a one-dimensional, discrete-ordinate transport code, is incoprated into COMBINE7.1. As an option, the 167 fine-group constants generated by COMBINE portion in the program can be used to cacluate regionwise spectra in the ANISN portion, all internally to reflect the one-dimensional transport correction. Results for the criticality validation calculations are included as a part of verification and validation.

  16. COMBINE7.1 - A Portable ENDF/B-VII.0 Based Neutron Spectrum and Cross-Section Generation Program

    SciTech Connect (OSTI)

    Woo Y. Yoon; David W. Nigg

    2011-09-01

    COMBINE7.1 is a FORTRAN 90 computer code that generates multigroup neutron constants for use in the deterministic diffusion and transport theory neutronics analysis. The cross-section database used by COMBINE7.1 is derived from the Evaluated Nuclear Data Files (ENDF/B-VII.0). The neutron energy range covered is from 20 MeV to 1.0E-5 eV. The Los Alamos National Laboratory NJOY code is used as the processing code to generate a 167 fine-group cross-section library in MATXS format for Bondarenko self-shielding treatment. Resolved resonance parameters are extracted from ENDF/B-VII.0 File 2 for a separate library to be used in an alternate Nordheim self-shielding treatment in the resolved resonance energy range. The equations solved for energy dependent neutron spectrum in the 167 fine-group structure are the B3 or B1 zero-dimensional approximations to the transport equation. The fine group cross sections needed for the spectrum calculation are first prepared by Bondarenko self-shielding interpolation in terms of background cross section and temperature. The geometric lump effect, when present, is accounted for by augmenting the background cross section. Nordheim self-shielded fine group cross sections for a material having resolved resonance parameters overwrite correspondingly the existing self-shielded fine group cross sections when this option is used. COMBINE7.1 coalesces fine group cross sections into broad group macroscopic and microscopic constants. The coalescing is performed by utilizing fine-group fluxes and/or currents obtained by spectrum calculation as the weighting functions. The multigroup constants may be output in any of several standard formats including INL format, ANISN 14** free format, CCCC ISOTXS format, and AMPX working library format. ANISN-PC, a one-dimensional (1-D) discrete-ordinate transport code, is incorporated into COMBINE7.1. As an option, the 167 fine-group constants generated by zero-dimensional COMBINE portion in the program can be used to calculate regionwise spectra in the 1-D ANISN portion, all internally to reflect the 1-D transport correction. The regionwise spectra are then used to generate mutigroup regionwise neutron constants. The 1-D neutron transport can be performed up to three stages, e.g., from a TRISO fuel to PEBBLE to 1-D full core wedge. In addition, COMBINE7.1 has now the capability of adjoint flux calculation through the 1-D ANISN transport. Photon transport capability is also added. For this, a photon production and photo-atomic cross section library, MATNG.LIB, was generated in MATXS format through NJOY code. The photon production cross section matrix is of 167 neutron - 18 photon groups. Photo-atomic cross sections, including heating, are in 18 energy groups.

  17. Microsoft Word - 1aDOE-ID-12-047 Westinghouse EC B3-6 NRC.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Title: Development of LWR Fuels Enhanced Accident Tolerance - Westinghouse Electric ... replace the currently used Zr + UO2 fuel system with and enhanced accident tolerant fuel. ...

  18. Microsoft Word - 1aDOE-ID-12-048 GE EC B3-6.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Title: Ferritic Martensitic Alloys as Accident Tolerant Fuel Cladding Material for ... for fuel cladding material in current light water reactors as accident tolerant fuel. ...

  19. Focusing of dipole radiation by a negative index chiral layer. 1. A thick layer as compared with the wavelength

    SciTech Connect (OSTI)

    Guzatov, D V; Klimov, V V

    2014-09-30

    We have derived and investigated the analytical expressions for the fields of scattered radiation of an electric dipole source by a chiral (bi-isotropic) layer with arbitrary permittivity and permeability and arbitrary thickness. It is shown that in the negativeindex chiral layer the focus spot of dipole radiation is split due to excitation of right- and left-hand circularly polarised waves. The conditions are found under which the waves with one of the polarisations can be suppressed, which leads to a substantial improvement of the focusing properties of the chiral layer. (metamaterials)

  20. Notice of Intent to Submit Page Changes to Revise DOE O 552.1A, Travel Policy and Procedures

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    2016-01-07

    A page change is being undertaken to reflect changes in responsibilities brought about by the August 2013 reorganization which transferred travel related functions and systems between the Office of Chief Financial Officer (OCFO) and the Office of Management (MA).

  1. DOE-CX-00084-Rev1A _Facility_Safety_and_Environmental_Improvements-CXB2.5.pdf

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

  2. Evaluation of cast carbon steel and aluminum for rack insert in MCO Mark 1A fuel basket

    SciTech Connect (OSTI)

    Graves, C.E., Fluor Daniel Hanford

    1997-03-21

    This document evaluates the effects ofusing a cast carbon steel or aluminum instead of 3O4L stainless steel in the construction ofthe fuel rack insert for the Spent Nuclear Fuel MCO Mark IA fuel baskets. The corrosion, structural, and cost effects are examined.

  3. Database for Regional Geology, Phase 1: A Tool for Informing Regional Evaluations of Alternative Geologic Media and Decision Making

    SciTech Connect (OSTI)

    Perry, Frank Vinton; Kelley, Richard E.; Birdsell, Suzanne M.; Lugo, Alexander Bryan; Dobson, Patrick; Houseworth, James

    2014-11-12

    Reported is progress in the following areas: Phase 1 and 2 websites for the regional geology GIS database; terrane maps of crystalline basement rocks; inventory of shale formations in the US; and rock properties and in-situ conditions for shale estimated from sonic velocity measurements.

  4. DRAFT - DOE O 313.1A, Management and Funding of the Departments Overseas Presence

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    This Order delineates DOE, including NNSA, requirements and responsibilities governing DOEs Overseas Presence in order to effectively meet national security objectives, including energy security, nuclear security, and scientific discovery and innovation, implemented outside the United States.

  5. Draft - DOE O 313.1A, Management and Funding of the Departments Overseas Presence

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    The Order delineates DOE and NNSA requirements and responsibilities governing DOE's Overseas Presence in order to effectively implement U.S. national security objectives concerning energy security, nuclear security, and scientific discovery and innovation overseas through the presence of qualified DOE employees and contractors.

  6. file://C:\\Documents%20and%20Settings\\VM3\\My%20Documents\\hc6-1a...

    U.S. Energy Information Administration (EIA) Indexed Site

    0.4 Q Q Q 0.2 Q | 33.7 | Adequacy of Insulation | Well Insulated...... 42.6 3.8 12.3 10.3 7.2 9.1 | 8.9 Adequately Insulated...... 43.1 3.6 ...

  7. Notice of Intent to Submit Page Changes to Revise DOE O 552.1A, Travel Policy and Procedures

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    2016-01-07

    A page-change is being undertaken to reflect changes in responsibilities brought about by the August 2013 reorganization which transferred travel related functions and systems between the Office of Chief Financial Officer (OCFO) and the Office of Management (MA).

  8. Review: United States DOE Five-Year Review (Type 1a), DOE/OR/21548-632

    Office of Legacy Management (LM)

  9. Cumulative hydrologic impact assessments on surface-water in northeastern Wyoming using HEC-1; a pilot study

    SciTech Connect (OSTI)

    Anderson, A.J.; Eastwood, D.C.; Anderson, M.E.

    1997-12-31

    The Surface Mining Control and Reclamation Act of 1977 requires that areas in which multiple mines will affect one watershed be analyzed and the cumulative impacts of all mining on the watershed be assessed. The purpose of the subject study was to conduct a cumulative hydrologic impact assessment (CHIA) for surface-water on a watershed in northeastern Wyoming that is currently being impacted by three mines. An assessment of the mining impact`s affect on the total discharge of the watershed is required to determine whether or not material damage to downstream water rights is likely to occur as a result of surface mining and reclamation. The surface-water model HEC-1 was used to model four separate rainfall-runoff events that occurred in the study basin over three years (1978-1980). Although these storms were used to represent pre-mining conditions, they occurred during the early stages of mining and the models were adjusted accordingly. The events were selected for completeness of record and antecedent moisture conditions (AMC). Models were calibrated to the study events and model inputs were altered to reflect post-mining conditions. The same events were then analyzed with the new model inputs. The results were compared with the pre-mining calibration. Peak flow, total discharge and timing of flows were compared for pre-mining and post-mining models. Data were turned over to the State of Wyoming for assessment of whether material damage to downstream water rights is likely to occur.

  10. Coastal energy transportation study, phase ii, volume 1: a study of OCS onshore support bases and coal export terminals

    SciTech Connect (OSTI)

    Cribbins, P.D.

    1981-08-01

    This study concentrates on siting alternatives for on-shore support bases for Outer Continental Shelf (OCS) oil and gas exploration and coal export terminals. Sixteen alternative OCS sites are described, and a parametric analysis is utilized to select the most promising sites. Site-specific recommendations regarding infrastructure requirements and transportation impacts are provided. Eleven alternative coal terminal sites are identified and assessed for their potential impacts.

  11. 1992 CBECS C&E Table 3.29

    U.S. Energy Information Administration (EIA) Indexed Site

    per Square Foot and Load Factors, 1992 Building Characteristics RSE Column Factor: All Demand-Metered Buildings Peak Watts per Square Foot Load Factor RSE Row Factor Number of...

  12. C10DIV.xls

    U.S. Energy Information Administration (EIA) Indexed Site

    Building (thousand kWh) per Square Foot (kWh) per Worker (thousand kWh) per Building (thousand dollars) per Square Foot (dollars) per kWh (dollars) NEW ENGLAND...

  13. -South Metallurgical Makes Electrical and Natural Gas System...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ... metal halide fixtures with 88 new 8-foot fixtures with 4 lamp F32T8 fluorescent bulbs. ... The assessment team determined that upgrading to 88 new 8-foot fxtures with 4 lamp F32T8 ...

  14. EA-0575: Fundamental Fluidization Research Project, Morgantown, West Virginia

    Broader source: Energy.gov [DOE]

    This EA evaluates the environmental impacts of a proposal to design, construct, and operate a 2-foot diameter, 50-foot high pressurized fluidization with particular emphasis on operation in the...

  15. Energy End-Use Intensities in Commercial Buildings

    U.S. Energy Information Administration (EIA) Indexed Site

    lighting intensities per lighted square foot-hour (Figure 23). * Food service and health care buildings had the highest water-heating intensities per square foot--more than...

  16. Utah Heat Content of Natural Gas Deliveries to Consumers (BTU...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Heat Content of Natural Gas Deliveries to Consumers (BTU per Cubic Foot) Utah Heat Content of Natural Gas Deliveries to Consumers (BTU per Cubic Foot) Year Jan Feb Mar Apr May Jun ...

  17. California Heat Content of Natural Gas Deliveries to Consumers...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Heat Content of Natural Gas Deliveries to Consumers (BTU per Cubic Foot) California Heat Content of Natural Gas Deliveries to Consumers (BTU per Cubic Foot) Year Jan Feb Mar Apr ...

  18. North Dakota Heat Content of Natural Gas Deliveries to Consumers...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Heat Content of Natural Gas Deliveries to Consumers (BTU per Cubic Foot) North Dakota Heat Content of Natural Gas Deliveries to Consumers (BTU per Cubic Foot) Year Jan Feb Mar Apr ...

  19. Georgia Heat Content of Natural Gas Deliveries to Consumers ...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Heat Content of Natural Gas Deliveries to Consumers (BTU per Cubic Foot) Georgia Heat Content of Natural Gas Deliveries to Consumers (BTU per Cubic Foot) Year Jan Feb Mar Apr May ...

  20. North Carolina Heat Content of Natural Gas Deliveries to Consumers...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Heat Content of Natural Gas Deliveries to Consumers (BTU per Cubic Foot) North Carolina Heat Content of Natural Gas Deliveries to Consumers (BTU per Cubic Foot) Year Jan Feb Mar ...

  1. South Carolina Heat Content of Natural Gas Deliveries to Consumers...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Heat Content of Natural Gas Deliveries to Consumers (BTU per Cubic Foot) South Carolina Heat Content of Natural Gas Deliveries to Consumers (BTU per Cubic Foot) Year Jan Feb Mar ...

  2. New York Heat Content of Natural Gas Deliveries to Consumers...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Heat Content of Natural Gas Deliveries to Consumers (BTU per Cubic Foot) New York Heat Content of Natural Gas Deliveries to Consumers (BTU per Cubic Foot) Year Jan Feb Mar Apr May ...

  3. Massachusetts Heat Content of Natural Gas Deliveries to Consumers...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Heat Content of Natural Gas Deliveries to Consumers (BTU per Cubic Foot) Massachusetts Heat Content of Natural Gas Deliveries to Consumers (BTU per Cubic Foot) Year Jan Feb Mar Apr ...

  4. U.S. Total Consumption of Heat Content of Natural Gas (BTU per...

    U.S. Energy Information Administration (EIA) Indexed Site

    Consumption of Heat Content of Natural Gas (BTU per Cubic Foot) U.S. Total Consumption of Heat Content of Natural Gas (BTU per Cubic Foot) Decade Year-0 Year-1 Year-2 Year-3 Year-4 ...

  5. Tennessee Heat Content of Natural Gas Deliveries to Consumers...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Heat Content of Natural Gas Deliveries to Consumers (BTU per Cubic Foot) Tennessee Heat Content of Natural Gas Deliveries to Consumers (BTU per Cubic Foot) Year Jan Feb Mar Apr May ...

  6. U.S. Heat Content of Natural Gas Deliveries to Consumers (BTU...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Heat Content of Natural Gas Deliveries to Consumers (BTU per Cubic Foot) U.S. Heat Content of Natural Gas Deliveries to Consumers (BTU per Cubic Foot) Year Jan Feb Mar Apr May Jun ...

  7. Michigan Heat Content of Natural Gas Deliveries to Consumers...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Heat Content of Natural Gas Deliveries to Consumers (BTU per Cubic Foot) Michigan Heat Content of Natural Gas Deliveries to Consumers (BTU per Cubic Foot) Year Jan Feb Mar Apr May ...

  8. New Hampshire Heat Content of Natural Gas Deliveries to Consumers...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Heat Content of Natural Gas Deliveries to Consumers (BTU per Cubic Foot) New Hampshire Heat Content of Natural Gas Deliveries to Consumers (BTU per Cubic Foot) Year Jan Feb Mar Apr ...

  9. New Jersey Heat Content of Natural Gas Deliveries to Consumers...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Heat Content of Natural Gas Deliveries to Consumers (BTU per Cubic Foot) New Jersey Heat Content of Natural Gas Deliveries to Consumers (BTU per Cubic Foot) Year Jan Feb Mar Apr ...

  10. District of Columbia Heat Content of Natural Gas Deliveries to...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Heat Content of Natural Gas Deliveries to Consumers (BTU per Cubic Foot) District of Columbia Heat Content of Natural Gas Deliveries to Consumers (BTU per Cubic Foot) Year Jan Feb ...

  11. South Dakota Heat Content of Natural Gas Deliveries to Consumers...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Heat Content of Natural Gas Deliveries to Consumers (BTU per Cubic Foot) South Dakota Heat Content of Natural Gas Deliveries to Consumers (BTU per Cubic Foot) Year Jan Feb Mar Apr ...

  12. Rhode Island Heat Content of Natural Gas Deliveries to Consumers...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Heat Content of Natural Gas Deliveries to Consumers (BTU per Cubic Foot) Rhode Island Heat Content of Natural Gas Deliveries to Consumers (BTU per Cubic Foot) Year Jan Feb Mar Apr ...

  13. Confined partial filament eruption and its reformation within a stable magnetic flux rope

    SciTech Connect (OSTI)

    Joshi, Navin Chandra; Kayshap, Pradeep; Uddin, Wahab; Srivastava, Abhishek K.; Dwivedi, B. N.; Filippov, Boris; Chandra, Ramesh; Choudhary, Debi Prasad E-mail: njoshi98@gmail.com

    2014-05-20

    We present observations of a confined partial eruption of a filament on 2012 August 4, which restores its initial shape within ?2 hr after eruption. From the Global Oscillation Network Group H? observations, we find that the filament plasma turns into dynamic motion at around 11:20 UT from the middle part of the filament toward the northwest direction with an average speed of ?105 km s{sup 1}. A little brightening underneath the filament possibly shows the signature of low-altitude reconnection below the filament eruptive part. In Solar Dynamics Observatory/Atmospheric Imaging Assembly 171 images, we observe an activation of right-handed helically twisted magnetic flux rope that contains the filament material and confines it during its dynamical motion. The motion of cool filament plasma stops after traveling a distance of ?215 Mm toward the northwest from the point of eruption. The plasma moves partly toward the right foot point of the flux rope, while most of the plasma returns after 12:20 UT toward the left foot point with an average speed of ?60 km s{sup 1} to reform the filament within the same stable magnetic structure. On the basis of the filament internal fine structure and its position relative to the photospheric magnetic fields, we find filament chirality to be sinistral, while the activated enveloping flux rope shows a clear right-handed twist. Thus, this dynamic event is an apparent example of one-to-one correspondence between the filament chirality (sinistral) and the enveloping flux rope helicity (positive). From the coronal magnetic field decay index, n, calculation near the flux rope axis, it is evident that the whole filament axis lies within the domain of stability (i.e., n < 1), which provides the filament stability despite strong disturbances at its eastern foot point.

  14. EA-1715: Final Environmental Assessment

    Broader source: Energy.gov [DOE]

    Chemetall Foote Corporation Electric Drive Vehicle Battery and Component Manufacturing Initiative Kings Mountain, NC and Silver Peak, Nevada

  15. Table 6a. Total Electricity Consumption per Effective Occupied...

    U.S. Energy Information Administration (EIA) Indexed Site

    a. Total Electricity Consumption per Effective Occupied Square Foot, 1992 Building Characteristics All Buildings Using Electricity (thousand) Total Electricity Consumption...

  16. Energy Information Administration - Commercial Energy Consumption...

    Gasoline and Diesel Fuel Update (EIA)

    square feet) Total (million dollars) per Building (thousand dollars) per Square Foot (dollars) per Million Btu (dollars) All Buildings ......

  17. EA-1715: Finding of No Significant Impact

    Broader source: Energy.gov [DOE]

    Chemetall Foote Corporation, Electric Drive Vehicle Battery and Component Manufacturing Initiative, Kings Mountain, North Carolina and Silver Peak, Nevada

  18. Buildings Energy Data Book: 7.7 Efficiency Standards for Lighting

    Buildings Energy Data Book [EERE]

    Efficiency Standards for Lighting March 2011 7.7.2 Efficiency Standards for General Service Fluorescent Lamps Effective for products manufactured before July 14, 2012 Minimum Nominal Lamp Average Lamp Lamp Type (1) Wattage (W) Minimum CRI Efficacy (lm/W) Effective Date 4-Foot Medium Bipin >35 69 75.0 November 1, 1995 4-Foot Medium Bipin 45 75.0 November 1, 1995 2-Foot U-Shaped >35 69 68.0 November 1, 1995 2-Foot U-Shaped 45 64.0 November 1, 1995 8-Foot Slimline >65 69 80.0 May 1, 1994

  19. Project Startup: Evaluating the Performance of Hydraulic Hybrid Refuse Vehicles

    SciTech Connect (OSTI)

    2015-09-01

    The Fleet Test and Evaluation Team at the National Renewable Energy Laboratory (NREL) is evaluating the in-service performance of 10 next-generation hydraulic hybrid refuse vehicles (HHVs), 8 previous-generation HHVs, and 8 comparable conventional diesel vehicles operated by Miami-Dade County's Public Works and Waste Management Department in southern Florida. The HHVs under study - Autocar E3 refuse trucks equipped with Parker Hannifin's RunWise Advanced Series Hybrid Drive systems - can recover as much as 70 percent of the energy typically lost during braking and reuse it to power the vehicle. NREL's evaluation will assess the performance of this technology in commercial operation and help Miami-Dade County determine the ideal routes for maximizing the fuel-saving potential of its HHVs.

  20. Molecular Foundry

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Tracy Mattox TMMattox Senior Scientific Engineering Associate, Inorganic Nanostructures TMMattox@lbl.gov 510.495.2649 Biography Education M.S. in Chemistry, Miami University, 2006 B.S. in Chemistry, University of Portland, 2003 Tracy Mattox has been a member of the Inorganic Facility at the Molecular Foundry as a Scientific Engineering Associate since 2007. Expertise Tracy's main focus is assisting users with their research projects (helping design reactions and analyze results). She is well

  1. Microbes as Engines of Ecosystem Function: When Does Community Structure enhance Predictions of Ecosystem Processes?

    Office of Scientific and Technical Information (OSTI)

    frontiers in Microbiology ORIGINAL RESEARCH published: 24 February 2016 doi: 10.3389/fmicb.2016.00214 OPEN ACCESS Edited by: Gary M. King, Louisiana State University, USA Reviewed by: Steffen Kolb, Landscape Biogeochemistry - Leibniz Centre for Agricultural Landscape Research, Germany Hongchen Jiang, Miami University, USA Kristen M. DeAngelis, University of Massachusetts Amherst, USA Correspondence: Emily B. Graham emily. graham@colorado.edu Specialty section: This article was submitted to

  2. The New ARSCL-micro VAP

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    The New ARSCL-micro VAP Kollias, Pavlos Brookhaven National Laboratory Clothiaux, Eugene The Pennsylvania State University Luke, Edward Brookhaven National Laboratory Johnson, Karen Brookhaven National Laboratory Miller, Mark Brookhaven National Laboratory Albrecht, Bruce University of Miami Category: Cloud Properties The changes in the MMCR operational modes have a substantial impact in the design and merge strategy of the Active Remote Sensing of Clouds (ARSCL) Value Added Product (VAP). A

  3. Workplace Charging Challenge Partner: Florida Power & Light Company |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy Florida Power & Light Company Workplace Charging Challenge Partner: Florida Power & Light Company Workplace Charging Challenge Partner: Florida Power & Light Company Joined the Challenge: November 2014 Headquarters: Juno Beach, FL Charging Locations: Juno Beach, FL; Jupiter, FL; West Palm Beach, FL; Plantation, FL; Miami, FL; Riviera Beach, FL; Homestead, FL; Jensen Beach, FL Domestic Employees: 8,700 As an early adopter of plug-in electric vehicles (PEVs),

  4. U.S. Department of Energy Tribal Energy Program 2010 Program Review

    Energy Savers [EERE]

    Tribal Energy Program 2010 Program Review Denver Colorado Introduction * Jason Dollarhide, Second Chief * Peoria Tribe of Indians of Oklahoma * Deputy Director, Housing Authority of the Peoria Tribe Summary of Tribe and Housing Authority * The Peoria Tribe is located in Miami, Oklahoma * We currently have an enrollment of 2,900 Tribal members * The Peoria Tribal operations and Housing Authority employ 39 persons. Cont'd * The Peoria Tribe and Housing Authority working in partnership with the

  5. Women @ Energy: Linda Silverman | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Linda Silverman Women @ Energy: Linda Silverman October 8, 2015 - 3:09pm Addthis Linda Silverman is a senior adviser in the Office of Energy Efficiency and Renewable Energy at DOE headquarters in Washington, D.C. Her hometown is Miami Beach, Florida, and she attended the University of Colorado and Johns Hopkins University. She has a bachelor of science degree in finance and international business and a master of arts in international relations. Linda Silverman is a senior adviser in the Office

  6. Research Highlight

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    How Well Are Shallow Convective Clouds Simulated in the CAM5 Model? Download a printable PDF Submitter: Chandra, A. S., University of Miami Area of Research: Cloud Distributions/Characterizations Working Group(s): Cloud Life Cycle Journal Reference: Chandra AS, C Zhang, SA Klein, and H Ma. 2015. "Low-cloud characteristics over the tropical western Pacific from ARM observations and CAM5 simulations." Journal of Geophysical Research - Atmospheres, 120, 52402, doi:10.1002/2015JD02.

  7. Priority Questions

    Energy Savers [EERE]

    Luminaires | Department of Energy Print-based Manufacturing of Integrated, Low Cost, High Performance SSL Luminaires Print-based Manufacturing of Integrated, Low Cost, High Performance SSL Luminaires Lead Performer: Eaton Corporation - Menomonee Falls, WI Partners: - Heraeus Materials Technology, LLC - Conshohocken, PA - Haiku Tech, Inc - Miami, FL - Eaton Cooper Lighting Innovation Center - Peachtree City, GA DOE Total Funding: $2,468,672 Cost Share: $2,468,676 Project Term: 9/15/2013 -

  8. Print-based Manufacturing of Integrated, Low Cost, High Performance SSL

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Luminaires | Department of Energy Print-based Manufacturing of Integrated, Low Cost, High Performance SSL Luminaires Print-based Manufacturing of Integrated, Low Cost, High Performance SSL Luminaires Lead Performer: Eaton Corporation - Menomonee Falls, WI Partners: - Heraeus Materials Technology, LLC - Conshohocken, PA - Haiku Tech, Inc - Miami, FL - Eaton Cooper Lighting Innovation Center - Peachtree City, GA DOE Total Funding: $2,468,672 Cost Share: $2,468,676 Project Term: 9/15/2013 -

  9. Research Highlight

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Exploring Stratocumulus Cloud-Top Entrainment Processes and Parameterizations by Using Doppler Download a printable PDF Submitter: Albrecht, B. A., University of Miami Area of Research: Cloud Processes Working Group(s): Cloud Life Cycle Journal Reference: Albrecht B, M Fang, and V Ghate. 2016. "Exploring Stratocumulus Cloud-Top Entrainment Processes and Parameterizations by Using Doppler Cloud Radar Observations." Journal of the Atmospheric Sciences, 73(2), 10.1175/JAS-D-15-0147.1.

  10. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    The Role of Cloud Scale Resolution on Radiative Properties of Oceanic Low-Level Clouds Kassianov, E.I.(a), Ackerman, T.P.(a), and Kollias P.(b), Pacific Northwest National Laboratory (a), University of Miami (b) Twelfth Atmospheric Radiation Measurement (ARM) Science Team Meeting Millimeter radars have been commonly used to examine the spatial/temporal evolution of clouds. To asses the impact of the cloud scale resolution on the solar radiative transfer, two sets of radiative experiments were

  11. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    A New Hyperspectral Imaging Interferometer for Measurements of Surface Albedo Minnett, P.J.(a) and Sellar, R.G.(b), Rosenstiel School of Marine and Atmospheric Sciences, University of Miami (a), Florida Space Institute (b) Twelfth Atmospheric Radiation Measurement (ARM) Science Team Meeting Uncertainties in the bidirectional reflection coefficient of the surface is a major component of the errors in the measurements of the surface radiation budget. A new instrument will be presented that

  12. Microsoft PowerPoint - arm_flare.ppt

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    NEW TECHNIQUE FOR STUDYING AEROSOL-CLOUD INTERACTIONS IN MARINE STRATOCUMULUS Virendra P. Ghate 1 , Bruce A. Albrecht 1 , Pavlos Kollias 2 1. MPO/RSMAS, Univ. of Miami, FL; 2. Brookhaven National Laboratory, NY 1. Introduction A cloud seeding experiment conducted offshore of Monterey, California in June 2006 aimed to study aerosol interaction with marine stratocumulus clouds. Instrument loaded Center for Interdisciplinary and Remotely Piloted Aircraft Studies (CIRPAS)'s Twin Otter Research

  13. Microsoft PowerPoint - wrf_les_2007_zhu.ppt [Compatibility Mode]

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    LES Testbed Prototype: ARM LES Testbed Prototype: Multi-Scale WRF Simulations of Boundary Layer Clouds Ping Zhu Florida International University Pavlos Kollias Brookhaven National Laboratory Bruce Albrecht University of Miami What is ARM-LES-Testbed ? It is structured to provide a framework for effectively organizing and using the extensive data generated by the ARM radars and other ARM observing systems for boundary layer cloud studies and for evaluating high resolution simulations. GCM/ PAR

  14. Piqua, Ohio, Decommissioned Reactor Site

    Office of Legacy Management (LM)

    Piqua, Ohio, Decommissioned Reactor Site This fact sheet provides information about the Piqua, Ohio, Decommissioned Reactor. This site is managed by the U.S. Department of Energy Office of Legacy Management under the DOE Defense Decontamination and Decommissioning (D&D) Program. Location of the Piqua Decommissioned Reactor Site Description and History The Piqua, Ohio, Decommissioned Reactor site is located in southwestern Ohio in the city of Piqua on the east bank of the Great Miami River,

  15. PowerPoint Presentation

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Simulations of Clouds and Boundary Layer Processes Image courtesy of Bjorn Stevens Yaosheng Chen, Pennsylvania State University Tobias Marke, University of Cologne Robert Schrom, Pennsylvania State University Hee-Jung Yang, University of Illinois Jianhao Zhang, University of Miami ARM Summer Training Final Presentation 24 July 2015 Motivation and Outline * What domains are needed to realistically simulate shallow cumulus? * What are the properties of the simulated cloud field? * What is the

  16. 1998 - 11 | Jefferson Lab

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    1 Nov 1998 Mon, 1998-11-23 00:00 Norfolk State: Research Results (Virginian-Pilot, Burrelle's) Tue, 1998-11-10 00:00 FIU to Host Physicists' Convention (Miami Herald, Burrelle's) Mon, 1998-11-02 00:00 A Better Probe for Cancer Detection (Pulse) Mon, 1998-11-02 00:00 Zapping Into the Future (Reedsburg Times-Press

  17. http://emdev.apps.em.doe.gov/EMDEV/Pages/groundwaterReport.aspx

    Office of Environmental Management (EM)

    Environmental Management Plume Name: Great Miami Aquifer Remediation Contractor: Unknown Report Last Updated: Unknown Contaminants Halogenated VOCs/SVOCs Present? Yes VOC Name Concentration (ppb) Regulatory Driver Cleanup Requirement TCE 58 No carbon disulfide 6 No Fuel Present? No Metals Present? Yes Metal Name Metal Concentration (ppb) Regulatory Driver Cleanup Requirement Mn 2000 No Mo 200 No U 845 No Ni 1540 No Zn 30 No Isotopes Present? Yes Isotope Name Isotope Activity (pCi/l) Regulatory

  18. Using ARM TWP Nauru Observations to Evaluate a Simple Thermodynamic Model

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    of the Subcloud Layer Under Fair-Weather Cumulus Conditions Using ARM TWP Nauru Observations to Evaluate a Simple Thermodynamic Model of the Subcloud Layer Under Fair-Weather Cumulus Conditions Albrecht, Bruce University of Miami Kollias, Pavlos Brookhaven National Laboratory Category: Modeling Marine boundary layer clouds are fundamental in regulating the vertical structure of water vapor and entropy in the lowest 2 km of the Earth's atmosphere. The observations from the ARM TWP-Nauru site

  19. An ARSCL-based cloud type climatology from retrievals and it's use in

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    model evaluation studies An ARSCL-based cloud type climatology from retrievals and it's use in model evaluation studies Tselioudis, George NASA/Goddard Institute for Space Studies Kollias, Pavlos Brookhaven National Laboratory Albrecht, Bruce University of Miami Category: Cloud Properties A climatology of cloud types is developed using long-term (6.5 years) ARSCL data at the ARM SGP site. The primary goal of the derived climatology is to be used in tandem with satellite observations for

  20. Light-Weight Radioisotope Heater Unit final safety analysis report (LWRHU-FSAR): Volume 1: A. Introduction and executive summary: B. Reference Design Document (RDD)

    SciTech Connect (OSTI)

    Johnson, E.W.

    1988-10-01

    The orbiter and probe portions of the National Aeronautics and Space Administration (NASA) Galileo spacecraft contain components which require auxiliary heat during the mission. To meet these needs, the Department of Energy's (DOE's) Office of Special Applications (OSA) has sponsored the design, fabrication, and testing of a one-watt encapsulated plutonium dioxide-fueled thermal heater named the Light-Weight Radioisotope Heater Unit (LWRHU). This report, prepared by Monsanto Research Corporation (MRC), addresses the radiological risks which might be encountered by people both at the launch area and worldwide should postulated mission failures or malfunctions occur, resulting in the release of the LWRHUs to the environment. Included are data from the design, mission descriptions, postulated accidents with their consequences, test data, and the derived source terms and personnel exposures for the various events. 11 refs., 44 figs., 11 tabs.

  1. Notice of Intent to Revise DOE Order 221.1A, Reporting Fraud, Waste and Abuse to the Office of Inspector General

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    2015-12-12

    It is necessary to update the current version of this directive due to a lack of consistent application and understanding of its provisions.

  2. NUSTAR AND XMM-NEWTON OBSERVATIONS OF THE EXTREME ULTRALUMINOUS X-RAY SOURCE NGC5907 ULX1: A VANISHING ACT

    SciTech Connect (OSTI)

    Walton, D. J.; Stern, D.; Harrison, F. A.; Fuerst, F.; Grefenstette, B. W.; Madsen, K. K.; Rana, V.; Bachetti, M.; Barret, D.; Webb, N.; Boggs, S. E.; Craig, W. W.; Christensen, F. E.; Hailey, C. J.; Middleton, M. J.; Roberts, T. P.; Sutton, A. D.; Zhang, W.

    2015-02-01

    We present results obtained from two broadband X-ray observations of the extreme ultraluminous X-ray source (ULX) NGC5907 ULX1, known to have a peak X-ray luminosity of ?5 10{sup 40} erg s{sup 1}. These XMM-Newton and NuSTAR observations, separated by only ?4 days, revealed an extreme level of short-term flux variability. In the first epoch, NGC5907 ULX1 was undetected by NuSTAR, and only weakly detected (if at all) with XMM-Newton, while in the second NGC5907 ULX1 was clearly detected at high luminosity by both missions. This implies an increase in flux of ?2 orders of magnitude or more during this ?4day window. We argue that this is likely due to a rapid rise in the mass accretion rate, rather than to a transition from an extremely obscured to an unobscured state. During the second epoch we observed the broadband 0.3-20.0keV X-ray luminosity to be (1.55 0.06) 10{sup 40} erg s{sup 1}, similar to the majority of the archival X-ray observations. The broadband X-ray spectrum obtained from the second epoch is inconsistent with the low/hard accretion state observed in Galactic black hole binaries, but is well modeled with a simple accretion disk model incorporating the effects of photon advection. This strongly suggests that when bright, NGC5907 ULX1 is a high-Eddington accretor.

  3. Notice of Intent to Revise DOE G 423.1-1A, Implementation Guide for Use in Developing Technical Safety Requirements

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    2014-06-05

    The purpose of this revision is to incorporate lessons learned as identified by DOE program offices.

  4. RCPO1 - A Monte Carlo program for solving neutron and photon transport problems in three dimensional geometry with detailed energy description and depletion capability

    SciTech Connect (OSTI)

    Ondis, L.A., II; Tyburski, L.J.; Moskowitz, B.S.

    2000-03-01

    The RCP01 Monte Carlo program is used to analyze many geometries of interest in nuclear design and analysis of light water moderated reactors such as the core in its pressure vessel with complex piping arrangement, fuel storage arrays, shipping and container arrangements, and neutron detector configurations. Written in FORTRAN and in use on a variety of computers, it is capable of estimating steady state neutron or photon reaction rates and neutron multiplication factors. The energy range covered in neutron calculations is that relevant to the fission process and subsequent slowing-down and thermalization, i.e., 20 MeV to 0 eV. The same energy range is covered for photon calculations.

  5. Refurbishment and modification of existing protective shipping packages (for 30-inch UF{sub 6} cylinders) per USDOT specification No. USA-DOT-21PF-1A

    SciTech Connect (OSTI)

    Housholder, W.R.

    1991-12-31

    This paper addresses the refurbishment procedures for existing shipping containers for 30-inch diameter UF{sub 6} cylinders in accordance with DOT Specification 21PF-1 and the criteria used to determine rejection when such packages are unsuitable for refurbishment.

  6. Data:2bc1a91a-517b-42a1-8f30-4d35cf7ce439 | Open Energy Information

    Open Energy Info (EERE)

    under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information...

  7. Economic effects of fracture in the United States. Part 1. A synopsis of the September 30, 1982 report to NBS by Battelle Columbus Laboratories

    SciTech Connect (OSTI)

    Reed, R.P.; Smith, J.H.; Christ, B.W.

    1983-03-01

    The National Bureau of Standards and Battelle Columbus Laboratories (BCL) have completed a study to assess the costs of material fracture to the United States for the year 1978. This exhaustive assessment used the econometric input-output model to identify contributions from the entire US economy. The study included all materials and all types of structures and included both fracture occurrence and fracture prevention costs. The costs were large. In 1982 dollars the total cost was estimated to be $119 billion per year, about 4 percent of the gross national product. An estimated $35 billion per year could be saved through the use of currently available technology. Costs could be further reduced by as much as $28 billion per year through fracture-related research. The costs are primarily associated with the transportation and construction industries: motor vehicles, aircraft, and the building of homes and non-residential construction. Metal structures contributed substantially larger costs than non-metal structures. A greater percentage of these costs were expended on fracture prevention than on fracture occurrence. The study concluded that substantial material, transportation, and capital investment costs could be saved if technology transfer, combined with research and development, succeeded in reducing the factors of uncertainty related to structural design. Equally safe or safer structures could be produced with substantial cost savings in material, transportation, and capital investment. This could be done by reducing the uncertainty currently related to structural design through better predictions of structural performance from materials properties, better process and quality control and in-service flaw monitoring, and less materials variability.

  8. ARM Climate Modeling Best Estimate from Darwin, AU with additional satellite product (ARMBE-CLDRAD TWPC3 V2.1a)

    DOE Data Explorer [Office of Scientific and Technical Information (OSTI)]

    McCoy, Renata; Xie, Shaocheng

    2011-02-07

    The ARM CMBE-ATM [Xie, McCoy, Klein et al.] data file contains a best estimate of several selected atmospheric quantities from ACRF observations and NWP analysis data.

  9. ARM Climate Modeling Best Estimate from Nauru with additional satellite product (ARMBE-CLDRAD TWPC2 V2.1a)

    DOE Data Explorer [Office of Scientific and Technical Information (OSTI)]

    McCoy, Renata; Xie, Shaocheng

    2011-02-07

    The ARM CMBE-ATM [Xie, McCoy, Klein et al.] data file contains a best estimate of several selected atmospheric quantities from ACRF observations and NWP analysis data.

  10. ARM Climate Modeling Best Estimate from Manus Island, PNG with additional satellite product (ARMBE-CLDRAD TWPC1 V2.1a)

    DOE Data Explorer [Office of Scientific and Technical Information (OSTI)]

    McCoy, Renata; Xie, Shaocheng

    2011-02-07

    The ARM CMBE-ATM [Xie, McCoy, Klein et al.] data file contains a best estimate of several selected atmospheric quantities from ACRF observations and NWP analysis data.

  11. ARM Climate Modeling Best Estimate Barrow, AK with additional satellite product (ARMBE-CLDRAD NSAC1 V2.1a)

    DOE Data Explorer [Office of Scientific and Technical Information (OSTI)]

    McCoy, Renata; Xie, Shaocheng

    2011-02-07

    The ARM CMBE-ATM [Xie, McCoy, Klein et al.] data file contains a best estimate of several selected atmospheric quantities from ACRF observations and NWP analysis data.

  12. Notice of Intent to Revise Department of Energy Policy 434.1A, Conduct and Approval of Select Agent and Toxin Work at Department of Energy Sites

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    2015-09-24

    A new United States Government (USG) policy for institutional oversight of life sciences dual use research of concern (DURC) became effective September 24, 2015. This policy is complementary to the March 2012 USG Policy for DURC and addresses institutional oversight of DURC for federally funded studies that involve 15 select pathogens and toxins. Institutional oversight will include policies, practices, and procedures to ensure DURC is identified and risk mitigation measures are implemented, where applicable. Institutional oversight of DURC is a critical component of a comprehensive oversight system since institutions are the most familiar with the life sciences research conducted in their facilities. Revisions will include minor administrative changes, as well as an additional sentence to consider the 2015 USG DURCPolicy and a reference to the new USG Policy in the references section. The USG Institutional DURCOversight Policy is available at www.phe.gov/s3/dualuse.

  13. A 1 A laser driver in 0.35 {mu}m complementary metal oxide semiconductor technology for a pulsed time-of-flight laser rangefinder

    SciTech Connect (OSTI)

    Nissinen, Jan; Kostamovaara, Juha

    2009-10-15

    An integrated complementary metal oxide semiconductor (CMOS) current pulse generator is presented which achieves an ampere-scale peak current pulse with a rise time and pulse width of less than 1 and 2.5 ns (pulse width at half maximum), respectively. The generator is implemented in a 0.35 {mu}m CMOS process and consists of four parallel n-type metal oxide semiconductor transistors driven by a scaled buffer chain to achieve fast switching.

  14. Site-directed mutagenesis and molecular modelling studies show the role of Asp82 and cysteines in rat acylase 1, a member of the M20 family

    SciTech Connect (OSTI)

    Herga, Sameh; Brutus, Alexandre; Vitale, Rosa Maria; Miche, Helene; Perrier, Josette; Puigserver, Antoine; Scaloni, Andrea; Giardina, Thierry . E-mail: thierry.giardina@univ.u-3mrs.fr

    2005-05-06

    Acylase 1 from rat kidney catalyzes the hydrolysis of acyl-amino acids. Sequence alignment has shown that this enzyme belongs to the metalloprotein family M20. Site-directed mutagenesis experiments led to the identification of one functionally important amino acid residue located near one of the zinc coordinating residues, which play a critical role in the enzymatic activity. The D82N- and D82E-substituted forms showed no significant activity and very low activity, respectively, along with a loss of zinc coordination. Molecular modelling investigations indicated a putative role of D82 in ensuring a proper protonation of catalytic histidine. In addition, none of the five cysteine residues present in the rat kidney acylase 1 sequence seemed involved in the catalytic process: the loss of activity induced by the C294A substitution was probably due to a conformational change in the 3D structure.

  15. C_Program FilesRightFaxRFaxGateINA23326efa-6848-4e70-881e-87e980cbdc1a.TIF

    Energy Savers [EERE]

  16. Nuclear facility decommissioning and site remedial actions: A selected bibliography, Volume 18. Part 1A: Citations with abstracts, sections 1 through 9

    SciTech Connect (OSTI)

    1997-09-01

    This bibliography contains 3,638 citations with abstracts of documents relevant to environmental restoration, nuclear facility decontamination and decommissioning (D and D), uranium mill tailings management, and site remedial actions. The bibliography contains scientific, technical, financial, and regulatory information that pertains to DOE environmental restoration programs. The citations are separated by topic into 16 sections, including (1) DOE Environmental Restoration program; (2) DOE D and D Program; (3) Nuclear Facilities Decommissioning; (4) DOE Formerly Utilized Sites Remedial Action Program; (5) NORM-Contaminated Site Restoration; (6) DOE Uranium Mill Tailings Remedial Action Project; (7) Uranium Mill Tailings Management; (8) DOE Site-Wide Remedial Actions; (9) DOE Onsite Remedial Action Projects; (10) Contaminated Site Remedial Actions; (11) DOE Underground Storage Tank Remediation; (12) DOE Technology Development, Demonstration, and Evaluation; (13) Soil Remediation; (14) Groundwater Remediation; (15) Environmental Measurements, Analysis, and Decision-Making; and (16) Environmental Management Issues.

  17. Data:9c1622f0-bd6d-42e7-8b1a-81a008ded31f | Open Energy Information

    Open Energy Info (EERE)

    It is currently under review by our subject matter experts. Jump to: navigation, search Utility Rate |OpenEIUtilityRateUtilityCity of Frankfort, Kentucky (Utility Company)...

  18. ARM Climate Modeling Best Estimate from Darwin, AU with additional satellite product (ARMBE-CLDRAD TWPC3 V2.1a)

    DOE Data Explorer [Office of Scientific and Technical Information (OSTI)]

    McCoy, Renata; Xie, Shaocheng

    The ARM CMBE-ATM [Xie, McCoy, Klein et al.] data file contains a best estimate of several selected atmospheric quantities from ACRF observations and NWP analysis data.

  19. ARM Climate Modeling Best Estimate from Manus Island, PNG with additional satellite product (ARMBE-CLDRAD TWPC1 V2.1a)

    DOE Data Explorer [Office of Scientific and Technical Information (OSTI)]

    McCoy, Renata; Xie, Shaocheng

    The ARM CMBE-ATM [Xie, McCoy, Klein et al.] data file contains a best estimate of several selected atmospheric quantities from ACRF observations and NWP analysis data.

  20. ARM Climate Modeling Best Estimate from Nauru with additional satellite product (ARMBE-CLDRAD TWPC2 V2.1a)

    DOE Data Explorer [Office of Scientific and Technical Information (OSTI)]

    McCoy, Renata; Xie, Shaocheng

    The ARM CMBE-ATM [Xie, McCoy, Klein et al.] data file contains a best estimate of several selected atmospheric quantities from ACRF observations and NWP analysis data.

  1. ARM Climate Modeling Best Estimate Barrow, AK with additional satellite product (ARMBE-CLDRAD NSAC1 V2.1a)

    DOE Data Explorer [Office of Scientific and Technical Information (OSTI)]

    McCoy, Renata; Xie, Shaocheng

    The ARM CMBE-ATM [Xie, McCoy, Klein et al.] data file contains a best estimate of several selected atmospheric quantities from ACRF observations and NWP analysis data.

  2. Microsoft Word - Buff Report Cover

    Office of Environmental Management (EM)

    from the baseline established in FY 2003. Energy intensity is calculated as the energy consumption in British Thermal Units (BTUs) per gross square foot of the Federal buildings. ...

  3. --No Title--

    Buildings Energy Data Book [EERE]

    2 2005 Residential Delivered Energy Consumption Intensities, by Vintage Per Square Per Household Per Household Percent of Year Built Foot (thousand Btu) (1) (million Btu) Member ...

  4. --No Title--

    Buildings Energy Data Book [EERE]

    1 2005 Residential Delivered Energy Consumption Intensities, by Housing Type Per Square Per Household Per Household Percent of Type Foot (thousand Btu) (1) (million Btu) Members ...

  5. April 2009 EMAB Recommendation Summary

    Office of Environmental Management (EM)

    the Secretary consider the issuance of a national policy and master plan for the Energy Park Initiative, which accounts for its interdependency on programmatic foot print reduction...

  6. Y-12 employee engineers success for disabled adults | Y-12 National...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    case management, training, housing, jobs and other services for adults with severe disabilities. The future 25,000 square foot building will house a medical and nursing center,...

  7. CX-003782: Categorical Exclusion Determination | Department of...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    The project is required as BPA is upgrading its internal communication technology from analog to digital. The project entails moving the existing antenna temporarily to a 25-foot ...

  8. Energy Efficient Thermoplastic Composite Manufacturing

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    thermoplastic composite aerospace structure with cycle ... produce due to material lay-down constraints and ... per lineal foot part to engineering accuracy; +- .030" per ...

  9. --No Title--

    Gasoline and Diesel Fuel Update (EIA)

    (trillion Btu) District Heat Energy Intensity (thousand Btusquare foot) Total Space Heating Water Heating Cook- ing Other Total Space Heating Water Heating Cook- ing Other All...

  10. Montage Builders - Northern Forest

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Montage Builders - Northern Forest SUNY College of Environmental Science and Forestry, Syracuse University, Onondaga Community College A 1,925 Square Foot Single Family Home: * 2 ...

  11. Table 3a. Total Natural Gas Consumption per Effective Occupied...

    Gasoline and Diesel Fuel Update (EIA)

    3a. Natural Gas Consumption per Sq Ft Table 3a. Total Natural Gas Consumption per Effective Occupied Square Foot, 1992 Building Characteristics All Buildings Using Natural Gas...

  12. Wind Power (pbl/generation)

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Generation Hydro Power Wind Power Monthly GSP BPA White Book Dry Year Tools Firstgov Wind Power (Updated June 16, 2014) Project Descriptions Foote Creek I Wind Project (Carbon...

  13. T.M. Bull Bennett, PhD | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    nigripes) as part of the National Black-Footed Ferret Conservation Center recovery program in conjunction with the US Fish and Wildlife Cooperative Research Unit. After Dr. ...

  14. Nature and Origin of the Cuprate Pseudogap

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    through HTSC cable. That same year, three 400-foot HTSC cables were installed for Detroit Edison at the Frisbie Substation that could deliver 100 million watts of power....

  15. LM Program Update Newsletter

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ... a 475-foot stretch of a stream on the Fernald Preserve property in Hamilton County, Ohio. ... Indian Orchard Niagara Falls Storage Site Vicinity Properties Adrian Oxford Hamilton ...

  16. ,"Fuel Oil Consumption",,,"Fuel Oil Expenditures"

    U.S. Energy Information Administration (EIA) Indexed Site

    4. Fuel Oil Consumption and Expenditure Intensities for Non-Mall Buildings, 2003" ,"Fuel Oil Consumption",,,"Fuel Oil Expenditures" ,"per Building (gallons)","per Square Foot...

  17. ,"Fuel Oil Consumption",,,"Fuel Oil Expenditures"

    U.S. Energy Information Administration (EIA) Indexed Site

    2. Fuel Oil Consumption and Expenditure Intensities, 1999" ,"Fuel Oil Consumption",,,"Fuel Oil Expenditures" ,"per Building (gallons)","per Square Foot (gallons)","per Worker...

  18. ,"Total Fuel Oil Expenditures

    U.S. Energy Information Administration (EIA) Indexed Site

    4. Fuel Oil Expenditures by Census Region, 1999" ,"Total Fuel Oil Expenditures (million dollars)",,,,"Fuel Oil Expenditures (dollars)" ,,,,,"per Gallon",,,,"per Square Foot"...

  19. Commercial Buildings Energy Consumption and Expenditures 1992...

    U.S. Energy Information Administration (EIA) Indexed Site

    with the national average of 81 thousand Btu per square foot), while buildings using solar energy or passive solar features used the major energy sources more intensively...

  20. Energy Information Administration - Commercial Energy Consumption...

    Gasoline and Diesel Fuel Update (EIA)

    (million square feet) Energy Intensity for Sum of Major Fuels (thousand Btu square foot) New England Middle Atlantic East North Central New England Middle Atlantic East North...