National Library of Energy BETA

Sample records for fax postal mail

  1. Mailing List Subscription

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mail and Distribution Mail and Distribution The DOE Mail Center provides a variety of mail services for all official and other authorized mail for the Department of Energy and its employees. The services provided include the processing of all incoming postal mail, outgoing official mail, internal mail processing, accountable mail processing, pouch mail, a variety of overnight express mail services, directory services, and pick-up and delivery services. The Mail Management Memorandum (pdf)

  2. Mail and Distribution | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Mail and Distribution Mail and Distribution The DOE Mail Center provides a variety of mail services for all official and other authorized mail for the Department of Energy and its employees. The services provided include the processing of all incoming postal mail, outgoing official mail, internal mail processing, accountable mail processing, pouch mail, a variety of overnight express mail services, directory services, and pick-up and delivery services. The Mail Management Memorandum (pdf)

  3. Printing and Mail Managers Exchange Forum Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    May 16, 2013 Mail discussion Joe Whitford opened the meeting by introducing Al Majors to talk about mail related items. 1) Update on the USPS mail name changes. If approved by the Postal Regulatory Commission the following name changes will go into effective July 28, 2013: a. Express Mail will be called Priority Mail Express b. Express Mail International will be Priority Mail International c. Express Mail Corporate Account will become USPS Express Corporate Account Only the names of these

  4. FAX

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    FATIGUE DESIGN CURVES FOR 6061-T6 ALUMINUM* G . T . Yahr Engineering Technology Division Oak Ridge National Laboratory Oak Ridge, Tennessee 37831-8051 ABSTRACT A request has been made to the ASME Boiler and Pressure Vessel Committee that 6061-T6 aluminum be approved for use in the construction of Class 1 welded nuclear vessels so it can be used for the pressure vessel of the Advanced Neutron Source research reactor. Fatigue design curves with and without mean stress effects have been proposed. A

  5. Mail Services User's Guide

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]


    This Guide provides information on using Department of Energy (DOE) mail services in accordance with U.S. Postal Service, General Services Administration (GSA), and DOE regulations. Cancels DOE M 573.1-1. Canceled by DOE N 251.89.

  6. This form may be submitted to the EIA by mail, fax, e-mail, or...

    U.S. Energy Information Administration (EIA) Indexed Site

    business on the web.) To use this service, we recommend the use of Microsoft Internet Explorer 5.5 or later or Netscape 4.77 or later. Send your surveys using this secure...

  7. This form may be submitted to the EIA by mail, fax, e-mail, or...

    U.S. Energy Information Administration (EIA) Indexed Site

    over the web using secure, encrypted processes. (It is the same method that commercial companies communicate with customers when transacting business on the web.) To use this ...

  8. This form may be submitted to the EIA by mail, fax, e-mail, or...

    U.S. Energy Information Administration (EIA) Indexed Site

    over the web using secure, encrypted processes. (It is the same method that commercial companies use to communicate with customers when transacting business on the web.) To use ...

  9. This form may be submitted to the EIA by mail, fax, e-mail, or...

    U.S. Energy Information Administration (EIA) Indexed Site

    month." " since the last report, enter an ""X"" in the block:" " ",,,..."Mo",,,"Yea... "If this is a resubmission, enter an ""X"" in the block:",,,...

  10. This form may be submitted to the EIA by mail, fax, e-mail, or...

    U.S. Energy Information Administration (EIA) Indexed Site

    ,,," Version No: 2014.001" "ANNUAL REPORT OF THE ORIGIN OF NATURAL GAS LIQUIDS PRODUCTION" "FORM EIA-64A" "REPORT YEAR 2014" "This report is...

  11. This form may be submitted to the EIA by mail, fax, e-mail, or...

    U.S. Energy Information Administration (EIA) Indexed Site

    ...www.eia.govsurveyformeia782alist782a.pdf" "Phone No.:",,,..."Ex... you are reporting:" "Type of Report (Check One):" ,,"Original",,,..."Mo",,,"Da...

  12. This form may be submitted to the EIA by mail, fax, e-mail, or...

    U.S. Energy Information Administration (EIA) Indexed Site

    under the Federal Energy Administration Act of 1974 (Public Law 93-275). Failure to comply may result in criminal fines, civil penalties and other sanctions as provided by law. ...

  13. This form may be submitted to the EIA by mail, fax, e-mail, or...

    U.S. Energy Information Administration (EIA) Indexed Site

    Failure to comply may result in criminal fines, civil penalties and other sanctions as provided by law. Title 18 USC 1001 makes it a criminal offense for any person knowingly and ...

  14. This form may be submitted to the EIA by mail, fax, e-mail, or...

    U.S. Energy Information Administration (EIA) Indexed Site

    "REPORT YEAR 2011" "This report is mandatory under Public Law 93-275. Failure to comply may result in criminal fines, civil penalties and other sanctions as provided by law. ...

  15. U.S. Postal Service BlueEarth Program - Personal Electronics Recycling

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Program | Department of Energy U.S. Postal Service BlueEarth Program - Personal Electronics Recycling Program U.S. Postal Service BlueEarth Program - Personal Electronics Recycling Program June 26, 2015 - 1:02pm Addthis Department of Energy (DOE) employees may use the U.S. Postal Service's BlueEarth program to mail-in their personally owned electronics and accessories for free recycling. Department of Energy (DOE) employees may use the U.S. Postal Service's BlueEarth program to mail-in their

  16. Electronic Mail Analysis Capability

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]


    Establishes the pilot program to test the Department of Energy (DOE) Electronic Mail Analysis Capability (EMAC), which will be used to monitor and analyze outgoing and incoming electronic mail (e-mail) from the National Nuclear Security Administration (NNSA) and DOE laboratories that are engaged in nuclear weapons design or work involving special nuclear material. No cancellation.

  17. Mail Services User's Manual

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]


    This Manual provides detailed information on using the Department of Energy (DOE) mail services. Canceled by DOE G 573.1-1.

  18. mail_paycheck_111609

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)


  19. Request Repository Mailing List

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Policies User Surveys NERSC Users Group User Announcements Help Staff Blogs Request Repository Mailing List Operations for: Passwords & Off-Hours Status 1-800-66-NERSC, option 1 or 510-486-6821 Account Support 1-800-66-NERSC, option 2 or 510-486-8612 Consulting 1-800-66-NERSC, option 3 or 510-486-8611 Home » For Users » Request Repository Mailing List Request Repository Mailing List Use this form to request a

  20. By Certified Mail May

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    By Certified Mail May 4,2012 Dorothy Riehle FOIA Office U.S. Department of Energy P. O. Box 550 Richland, WA 99352 Re: FOIA RequestLand Transfer Dear Ms. Riehle: Pursuant to the...

  1. By E-Mail

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    By E-Mail May 29, 2012 Dorothy Riehle FOIA Office U.S. Department of Energy P. O. Box 550 Richland, WA 99352 Re: FOIA RequestTank Inventories Dear Ms. Riehle: Pursuant to the...

  2. Mail Services | The Ames Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mail Management Memorandum, July 2, 2010 Mail Management Memorandum, July 2, 2010 Mail Management Memorandum prescribing policy and requirements for the effective, economical, and secure management of incoming, internal, and outgoing mail in Federal agencies. These requirements pertain to all DOE offices, and may also apply to national laboratories and other contractor facilities, depending on whether they qualify as Federal facilities as defined in the regulations. PDF icon Mail Management

  3. PDSF Mailing Lists

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mailing Lists PDSF Mailing Lists This is voluntary. You have to subscribe to it. This list can be chatty, since major and minor problems are sent to this list. Also multiple status updates will be sent for extended outages. Subscribe: Send email to with subscribe in the subject of the message. Unsubscribe: Send email to with unsubscribe in the subject of the message. Users are subscribed to

  4. Mailing List Subscription

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mailing List Subscription Jefferson Lab Home Search Contact JLab Descriptions A - C autocad: No description available briefs: On-Target Briefs cctest-alert: No description available clas_drift_chambers: Hall B Drift Chambers Group clas_offline: Discussion group for CLAS RECSIS group clas_slow_control: CLAS slow control working group clas_strangep: Hall B Strange Particles using CLAS discussion group clas_tof: CLAS Time of Flight Collaboration credit-card: List of JLab Credit Card buyers csc_all:

  5. U.S. Postal Service General Mail Facility, San Diego, California...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    to easily carry over their "best value" philosophy in considering energy consumption, ... Education: The former National Energy Coordinator for USPS published a paper (see ...

  6. LLNL E-Mail Utilities

    Energy Science and Technology Software Center (OSTI)


    The LLNL E-mail Utilities software library is a Java API that simplifies the creation and delivery of email in Java business applications. It consists of a database-driven template engine, various strategies for composing, queuing, dispatching email and a Java Swing GUI for creating and editing email templates.

  7. Mail Management Memorandum, July 2, 2010 | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Mail Management Memorandum, July 2, 2010 Mail Management Memorandum, July 2, 2010 Mail Management Memorandum prescribing policy and requirements for the effective, economical, and ...

  8. Minutes from the Print and Mail Managers Exchange Forum Teleconference...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Minutes from the Print and Mail Managers Exchange Forum Teleconferences Minutes from the Print and Mail Managers Exchange Forum Teleconferences Minutes from the Print and Mail...

  9. Microsoft Word - WD Proposed Plan D5 R8 MASTER 10-29-14 _final with reply mail_ rev 1

    Energy Savers [EERE]

    WD-PLN-0034, Rev. 8 1 DOE/PPPO/03-0312&D5 Aerial photo of the Portsmouth Gaseous Diffusion Plant showing the three large process buildings (center of photo) and other support facilities, facing southwest PUBLIC COMMENT PERIOD NOVEMBER 12, 2014 TO JANUARY 10, 2015 HOW YOU CAN PARTICIPATE Read this Proposed Plan and review related documents in the Administrative Record. Comment on this Proposed Plan by mail, email, or fax to: Ms. Kristi Wiehle Department of Energy P.O. Box 370 Piketon, Ohio

  10. Field Facilities Contacts for Printing and Mail

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Field Facilities Contacts for Printing and Mail Print and Mail Contacts Site Printing Contact Mail Contact NNSA, Albuquerque Deborah Miller (505) 845-6049 Thomas H. Clinkenbeard NNSA Service Center PO Box 5400 Albuquerque, NM 87185-5400 (505) 845-4602 ( Argonne National Laboratory Doreen Schoening Argonne National Laboratory U.S. Department of Energy 9700 South Cass Avenue Blvd 340 Lemonmt, IL 60439 (630) 840-6399

  11. Printing and Mail Managers Exchange Forum Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    November 21, 2013 Mail Managers discussion Joe Whitford opened the meeting by introducing Tony Nellums to talk about mail related items. 1) Mr. Nellums introduced Derek Milner, Policy Advisor from the GSA Office of Government-wide policy. a. Mr. Milner stated that he is being replaced as primary policy contact by Linda Willoughby ( or (202) 219-1083. b. Initiatives discussed by Mr. Milner included: Upcoming mail reports. The SMART system is online and available now.

  12. Minutes from the January 10, 2013 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    January 10, 2013 Mail discussion Al Majors opened the meeting by discussing the Mail Management Report and latest update on status. One final report is yet to be submitted, after which close out will be accomplished. Copies will be provided to the Mail Managers once completed. Al introduced Derrick Miliner, Program Manager from the General Services Administration, Office of Government-wide Policy, and acknowledged Mr. Miliner's role in completing the Mail Management Report. Mail Security Plans A

  13. Field Facilities Contacts for Printing and Mail | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Field Facilities Contacts for Printing and Mail Field Facilities Contacts for Printing and Mail This is the list of DOE field facilities contacts for Printing and Mail as of April 27, 2011. Go to Mail Services Go to Printing Services PDF icon Field_Facilities_Contacts_Print-Mail.pdf More Documents & Publications Director's Perspective by George Miller Tenant Education and Training Fire Safety Committee Membership List

  14. Full page fax print

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    ... Other major miscellaneous inputs Internal to the Tank Farm ... Salt crystallized from high-heat waste and low-heat waste is ... The rotary kiln primary combustion chamber will be used ...

  15. Full page fax print

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    5 (U) April 26, 1995 Westinghouse Savannah River Company Savannah River S~e Aiken, SC 29808 HLW-OVP-95-0031 @ Westinghouse Savannah River Company. April 27, 1995 A. B. Scoa, Jr. Va Preoident and General...,. Hgh Level Was .. ManagamenI DiviIion P. O. Box 61' Allen, SC 29602 HLW-OVP-95-0031 Keywords: Retention: High Level W88te SyslemPIan Production Plan 25 years, offer to NARA at end of retention. Disposal Auth: DOEF 1324.5 95-0002 Track .: 7605 File Record: 773-52A, Records Mr. Steven D.

  16. Fax Cover Sheet

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Council) Noah Horowitz (Natural Resources Defense Council) (by phone) Jennifer Thorne Amann (American Council for an Energy-Efficient Economy) Neal Goldberg (National Cable ...

  17. Full page fax print

    National Nuclear Security Administration (NNSA)

  18. Full page fax print

    National Nuclear Security Administration (NNSA)

  19. Full page fax print

    Office of Legacy Management (LM)

  20. Full page fax print

    Office of Scientific and Technical Information (OSTI)

    )lIJfjlHfllmj)mmllillruJt ((I(m(ti.JmlmmmlllWI ll .. . I*mw lffi )( HI I) SOVELEV RECELEV 40 40 Immlll1 illllmJil11)Immm lfm lli m l.lmillm(mj...

  1. Read Your E-mail | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Read Your E-mail All Argonne employees can read their e-mail through the web. Argonne E-Mail service is a robust, reliable electronic communication solution for supporting day-to-day business activities. Features include e-mail, calendar, task lists, and contact lists. While it is designed to work Microsoft Outlook, it also works with other POP- and IMAP-based clients. All employees can read their e-mail through the web. Use the login link at right to get started. Login to E-mail

  2. T-618: Debian update for exim4: Mail Transport Agent

    Broader source: [DOE]

    It was discovered that Exim, the default mail transport agent in Debian, uses DKIM data obtain from DNS directly in a format string, potentially allowing malicious mail senders to execute arbitrary code.

  3. Fuel Cell Experience & Opportunities: U.S. Postal Service | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Experience & Opportunities: U.S. Postal Service Fuel Cell Experience & Opportunities: U.S. Postal Service Overview of fuel cell experience and opportunities in installation, vechicle components, and vehicle programs PDF icon tspi_levinson.pdf More Documents & Publications Safety Analysis of Type 4 Tanks in CNG Vehicles State of the States: Fuel Cells in America 2010 The Business Case for Fuel Cells 2010: Why Top Companies are Purchasing Fuel Cells Today

  4. Minutes from the January 19, 2011 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    January 2010 Printing and Mail Managers Exchange Forum Teleconference Twenty-one individuals participated in the Printing and Mail Managers Exchange Forum, which included Printing and Mail Managers and Contractors Comments/Additions to last Months Minutes No comments. Printing Agenda Items......... Update on the Department-wide FY-2010 Three-Year Plan Dallas Woodruff, Headquarters in formed the group that the Department-wide Printing and Publishing Activities is currently in the concurrence

  5. Minutes from the January 20, 2010 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    , 2010 Printing and Mail Managers Exchange Forum Teleconference Twenty-one individuals participated in the Printing and Mail Managers Exchange Forum, which included Printing and Mail Managers and Contractors. Comments/Additions to last Months Minutes Dallas Woodruff, Headquarters opened the meeting by thanking everyone for participating in the today's teleconference. Printing Agenda Items... Update on the Department-wide Printing and Publishing Activities Report Three-Year Plan. Dallas Woodruff,

  6. Minutes from the July 21, 2010 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    July 21, 2010 Printing and Mail Managers Exchange Forum Teleconference Twenty-one individuals participated in the Printing and Mail Managers Exchange Forum, which included Printing and Mail Managers and Contractors. Comments/Additions to last Months Minutes Dallas Woodruff, Headquarters opened the meeting by thanking everyone for participating in the today's teleconference. Printing Agenda Items... Update on the Government Printing Office revisions to the Standard Form one (SF!), Twenty-five

  7. Minutes from the June 28, 2012 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    June 28, 2012 Mail discussion Al Majors opened the meeting by introducing United Parcel Service (UPS) Representative Shelly Scott. Ms. Scott's contact information is: Shelly Scott 404 402-9827 (cell) Ms. Scott discussed issues relating to various UPS services available to the department. Next Al introduced Michael R. Sanders, President and Chief Executive Officer of Intra-Mail Network, an innovative, information Technology Company that improves the delivery of mail or email

  8. Minutes from the May 26, 2010 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    26, 2010 Printing and Mail Managers Exchange Forum Teleconference Seventeen individuals participated in the Printing and Mail Managers Exchange Forum, which included Printing and Mail Managers and Contractors. Comments/Additions to last Months Minutes Dallas Woodruff, Headquarters opened the meeting by thanking everyone for participating in the today's teleconference. Printing Agenda Items... Update on the FY 2010, Congressional Joint Committee on Printing Commercial Printing Report "JCP

  9. Minutes from the November 01, 2012 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    November 1, 2012 Mail discussion Al Majors opened the meeting by introducing Derrick Milner, Program Manager from the General Services Administration, Office of Government-wide Policy. Mr. Majors and Mr. Miliner discussed the pending Official Mail Management Report for the FY-2012. The question on where to put data relating to certified and registered mail was addressed. It should be placed under the others section or under first class, standard delivery. Mr. Majors also discussed the pending

  10. Minutes from the November 17, 2010 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    November 17, 2010 Printing and Mail Managers Exchange Forum Teleconference Twenty seven individuals participated in the Printing and Mail Managers Exchange Forum, which included Printing and Mail Managers and Contractors Comments/Additions to last Months Minutes No comments. Printing Agenda Items......... Update on the Department-wide "Three-Year Plan" Dallas Woodruff, Headquarters opened the meeting by thanking everyone for providing their sites Three-Year Plan data to Headquarters in

  11. Minutes from the September 15, 2010 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    September 15, 2010 Printing and Mail Managers Exchange Forum Teleconference Twenty-four individuals participated in the Printing and Mail Managers Exchange Forum, which included Printing and Mail Managers and Contractors. Comments/Additions to last Months Minutes Dallas Woodruff, Headquarters opened the meeting by thanking everyone for participating in the today's teleconference. Printing Agenda Items... Upcoming FY 2010 Department-wide Three-Year Plan Dallas Woodruff, Headquarters informed the

  12. Headquarters Program & Staff Office Mailing Addresses | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Headquarters Program & Staff Office Mailing Addresses Headquarters Program & Staff Office Mailing Addresses The following addresses are for delivery of regular mail and small packages: Delivery to the Headquarters buildings in Washington, DC: Name of Individual Title Routing Symbol/Forrestal Building U.S. Department of Energy 1000 Independence Ave., S.W. Washington, DC 20585 Name of Individual Title Routing Symbol/L'Enfant Plaza Building U.S. Department of Energy 1000

  13. Mail-Order Metal-Organic Frameworks (MOFs): Designing Isoreticular...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mail-Order Metal-Organic Frameworks (MOFs): Designing Isoreticular MOF-5 Analogues Comprising Commercially Available Organic Molecules Previous Next List R. L. Martin, L.-C. Lin,...

  14. Minutes from the Print and Mail Managers Exchange Forum Teleconferences

    Broader source: [DOE]

    Minutes from the Print and Mail Managers Exchange Forum Teleconferences.  Contact the Office of Administrative Management and Support at (202) 586-4318 with any questions.

  15. Minutes from the May 3, 2012 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    http:www.gsa.govmailpolicy (for training options) ... discussion Brainstorming discussion on methodsapproaches to reduce printing expenses: ...

  16. Minutes from the October 26, 2011 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Woodruff also said the files are due back to Headquarters no later November 11, 2011, and the report is due to congress by February 10, 2012. Mail Agenda Items...... Fiscal ...

  17. The Future of Electric Vehicles and Arizona State University's MAIL

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Battery | Department of Energy The Future of Electric Vehicles and Arizona State University's MAIL Battery The Future of Electric Vehicles and Arizona State University's MAIL Battery August 11, 2010 - 4:26pm Addthis Cody Friesen and his team at Arizona State University | Photo Credit Arizona State University Cody Friesen and his team at Arizona State University | Photo Credit Arizona State University Andy Oare Andy Oare Former New Media Strategist, Office of Public Affairs What does this

  18. Minutes from the March 14, 2013 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    March 14, 2013 Mail discussion Al Majors is on leave today. Ellsworth Howell Jr. and Tony Nellums are sitting for Al. There are no agenda items for the Mail portion. A discussion period for questions, comments, or suggestions was opened without response Printing discussion Discussed suggestions for reducing printing expenses Presidential Executive Order 13589 and reducing hard copy printing in favor of electronic publishing Sec. 5. Printing. Agencies are encouraged to limit the publication and

  19. Using Energy Information Systems (EIS): A Guidebook for the U.S. Postal Service

    SciTech Connect (OSTI)

    Foster, Dale; Hough, Ben; Barbose, Galen; Golove, William; Goldman, Charles


    The U.S. Postal Service (Postal Service) recently installed Energy Information Systems (EIS) at 30 facilities in California. These systems integrate electric utility meter data acquisition hardware, software, and communication systems to collect, archive, analyze, and display whole-facility energy consumption data. At some point in the future, these systems could also be integrated with sub-meters that measure the electricity consumption of key end-use equipment. The purpose of this guidebook is to help Postal Service facility managers interpret and act upon energy data available from their EIS, translating the abundance of information these systems provide into knowledge that can be used to reduce energy use and costs. The guidebook first describes basic EIS capabilities and explains the data and reports that Postal Service EIS provide. It outlines a set of strategies for utilizing this information to improve operations and maintenance of building energy use equipment and for facilitating demand response. Finally, the guidebook offers suggestions on creating a routine for tracking and analyzing energy data and integrating this information into regular energy management activities.

  20. Mailing Addresses and Information Numbers for Operations, Field, and Site

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Offices | Department of Energy About » Mailing Addresses and Information Numbers for Operations, Field, and Site Offices Mailing Addresses and Information Numbers for Operations, Field, and Site Offices Name Telephone Number U.S. Department of Energy Ames Site Office 111 TASF, Iowa State University Ames, Iowa 50011 515-294-9557 U.S. Department of Energy Argonne Site Office 9800 S. Cass Avenue Argonne, IL 60439 630-252-2000 U.S. Department of Energy Berkeley Site Office Berkeley

  1. E-mail et Web : pour une navigation sans risque

    ScienceCinema (OSTI)



    Présentation orale en français, support visuel en anglais. À travers des exemples concrets, vous consoliderez vos connaissances et pourrez ainsi réajuster vos habitudes concernant l?utilisation sécurisée de votre boîte e-mail et de votre navigateur Web.

  2. V-147: IBM Lotus Notes Mail Client Lets Remote Users Execute...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    7: IBM Lotus Notes Mail Client Lets Remote Users Execute Java Applets V-147: IBM Lotus Notes Mail Client Lets Remote Users Execute Java Applets May 2, 2013 - 6:00am Addthis...

  3. Notices

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    901 Federal Register / Vol. 78, No. 100 / Thursday, May 23, 2013 / Notices DATES: Interested persons are invited to submit comments on or before June 24, 2013. ADDRESSES: Comments submitted in response to this notice should be submitted electronically through the Federal eRulemaking Portal at http:// by selecting Docket ID number ED-2013-ICCD-0067 or via postal mail, commercial delivery, or hand delivery. Please note that comments submitted by fax or email and those submitted

  4. Notices

    Energy Savers [EERE]

    901 Federal Register / Vol. 78, No. 100 / Thursday, May 23, 2013 / Notices DATES: Interested persons are invited to submit comments on or before June 24, 2013. ADDRESSES: Comments submitted in response to this notice should be submitted electronically through the Federal eRulemaking Portal at http:// by selecting Docket ID number ED-2013-ICCD-0067 or via postal mail, commercial delivery, or hand delivery. Please note that comments submitted by fax or email and those submitted

  5. Notices

    Energy Savers [EERE]

    725 Federal Register / Vol. 80, No. 189 / Wednesday, September 30, 2015 / Notices collection listed in this notice, please use by searching the Docket ID number ED- 2015-ICCD-0114. Comments submitted in response to this notice should be submitted electronically through the Federal eRulemaking Portal at http:// by selecting the Docket ID number or via postal mail, commercial delivery, or hand delivery. Please note that comments submitted by fax or

  6. Mail-Order Metal-Organic Frameworks (MOFs) | Center for Gas

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    SeparationsRelevant to Clean Energy Technologies | Blandine Jerome Mail-Order Metal-Organic Frameworks (MOFs)

  7. Minutes from the February 23, 2012 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Minutes Printing and Mail Managers Exchange Forum Teleconference February 23, 2012 Participants: Headquarters (5) National Energy Technology Laboratory, PA National Security Complex Y-12 (2) Oak Ridge National Laboratory Y-12 Site Office (2) Hanford Site Office Oak Ridge Association University Oak Ridge Operations Office BWXT Pantex Site Office JanTec Corporation, Richland, Washington Los Alamos National Laboratory Chicago Office Bettis Atomic Power Laboratory National Security Technology C1,

  8. Application of a radiophotoluminescent glass dosimeter to nonreference condition dosimetry in the postal dose audit system

    SciTech Connect (OSTI)

    Mizuno, Hideyuki, E-mail:; Fukumura, Akifumi; Fukahori, Mai [National Institute of Radiological Sciences, 4-9-1, Anagawa, Inage-ku, Chiba-shi 263-8555 (Japan); Sakata, Suoh; Yamashita, Wataru; Takase, Nobuhiro [Association for Nuclear Technology in Medicine, 7-16, Nihonbashikodenmacho, Chuou-ku, Tokyo 103-0001 (Japan); Yajima, Kaori [Toho University Omori Medical Center, 6-11-1 Omori-Nishi, Ota-ku, Tokyo 143-8541 (Japan); Katayose, Tetsurou [Chiba Cancer Center, 666-2 Nitona-Cho, Chuoh-ku, Chiba-shi, Chiba 260-8717 (Japan); Abe-Sakama, Kyoko; Kanai, Tatsuaki [Gunma University, Heavy Ion Medical Research Center, 4-2, Aramaki-machi, Maebashi City, Gunma 371-8510 (Japan); Kusano, Yohsuke [Kanagawa Cancer Center, 1-1-2 Nakao, Asahi-ku, Yokohama-shi, Kanagawa 241-8515 (Japan); Shimbo, Munefumi [Saitama Medical Center, 1981, Kamoda, Kawagoe-shi, Saitama 350-8550 (Japan)


    Purpose: The purpose of this study was to obtain a set of correction factors of the radiophotoluminescent glass dosimeter (RGD) output for field size changes and wedge insertions. Methods: Several linear accelerators were used for irradiation of the RGDs. The field sizes were changed from 5 5 cm to 25 25 cm for 4, 6, 10, and 15 MV x-ray beams. The wedge angles were 15, 30, 45, and 60. In addition to physical wedge irradiation, nonphysical (dynamic/virtual) wedge irradiations were performed. Results: The obtained data were fitted with a single line for each energy, and correction factors were determined. Compared with ionization chamber outputs, the RGD outputs gradually increased with increasing field size, because of the higher RGD response to scattered low-energy photons. The output increase was about 1% per 10 cm increase in field size, with a slight difference dependent on the beam energy. For both physical and nonphysical wedged beam irradiation, there were no systematic trends in the RGD outputs, such as monotonic increase or decrease depending on the wedge angle change if the authors consider the uncertainty, which is approximately 0.6% for each set of measured points. Therefore, no correction factor was needed for all inserted wedges. Based on this work, postal dose audits using RGDs for the nonreference condition were initiated in 2010. The postal dose audit results between 2010 and 2012 were analyzed. The mean difference between the measured and stated doses was within 0.5% for all fields with field sizes between 5 5 cm and 25 25 cm and with wedge angles from 15 to 60. The standard deviations (SDs) of the difference distribution were within the estimated uncertainty (1SD) except for the 25 25 cm field size data, which were not reliable because of poor statistics (n = 16). Conclusions: A set of RGD output correction factors was determined for field size changes and wedge insertions. The results obtained from recent postal dose audits were analyzed, and the mean differences between the measured and stated doses were within 0.5% for every field size and wedge angle. The SDs of the distribution were within the estimated uncertainty, except for one condition that was not reliable because of poor statistics.


    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    HQ F 1410.2 (06-93) U.S. DEPARTMENT OF ENERGY RECEIPT FOR CONTROLLED MAIL PARCEL SERVICE (Receipt No.) MAIL STATION: DATE: TO: NAME: ROUTING SYMBOL: FROM: DOE Mail Facility, Office of Administration Services 1. 2. 3. 4. 5. 6. 7. 8. 9. 10. 11. 12. 13. 14. 15. 16. 17. 18. ITEM NO. ITEM NO. ITEM NO. SIGN AND RETURN WITHIN 24 HOURS TO AVOID TRACER ACTION TO DOE MAIL FACILITY (Stamp Location) RECEIVED BY: DATE: Printed with soy ink on recycled paper

  10. U-157: Ruby Mail Gem Directory Traversal and Shell Command Injection Vulnerabilities

    Broader source: [DOE]

    Some vulnerabilities have been reported in the Mail gem for Ruby, which can be exploited by malicious people to manipulate certain data and compromise a vulnerable system.

  11. {open_quotes}Media-On-Demand{close_quotes} multimedia electronic mail: A tool for collaboration on the web

    SciTech Connect (OSTI)

    Tsoi, Kei Nam; Rahman, S.M.


    Undoubtedly, multimedia electronic mail has many advantages in exchanging information electronically in a collaborative work. The existing design of e-mail systems architecture is inefficient in exchanging multimedia message which has much larger volume, and requires more bandwidth and storage space than the text-only messages. This paper presents an innovative method for exchanging multimedia mail messages in a heterogeneous environment to support collaborative work over YAW on the Internet. We propose a {open_quotes}Parcel Collection{close_quotes} approach for exchanging multimedia electronic mail messages. This approach for exchanging multimedia electronic mail messages integrates the current WWW technologies with the existing electronic mail systems.

  12. U.S. Postal Service radon assessment and mitigation program. Progress report, September 1993--November 1994

    SciTech Connect (OSTI)

    Velazquez, L.E.; Petty, J.L. Jr.


    In 1992, the US Postal Service (USPS) entered into an Interagency Agreement with the Department of Energy (DOE) whereby DOE would provide technical assistance in support of the USPS Radon Assessment and Mitigation Program. To aid in this effort, DOE tasked the Hazardous Waste Remedial Actions Program (HAZWRAP), which is managed by Martin Marietta Energy Systems, Inc., for DOE under contract AC05-84OR21400. Since that time, HAZWRAP has developed and finalized the sampling protocol, mitigation diagnostic protocol, and the quality assurance and quality control procedures. These procedures were validated during the Protocol Validation (1992-1993) and Pilot Study (1993-1994) phases of the program. To date, HAZWRAP has performed approximately 16,000 radon measurements in 250 USPS buildings. Mitigation diagnostics have been performed in 27 buildings. Thus far, 13% of the measurements have been above the Environmental Protection Agency action level of 4 pCi/L. This report summarizes the pilot program radon testing data and mitigation diagnostic data for 22 sites and contains recommendations for mitigation diagnostics.

  13. Data-Driven Mailing Helps Heat Up Untapped Seattle Market | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Data-Driven Mailing Helps Heat Up Untapped Seattle Market Abridged transcript of an interview with Community Power Works Project Manager Ruth Bell and ProgramSystem Analyst Vince ...

  14. Data-Driven Mailing Helps Heat Up Untapped Seattle Market | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Data-Driven Mailing Helps Heat Up Untapped Seattle Market Data-Driven Mailing Helps Heat Up Untapped Seattle Market Abridged transcript of an interview with Community Power Works Project Manager Ruth Bell and Program/System Analyst Vince Schueler of the Washington State University Energy Program. PDF icon Seattle Focus Series More Documents & Publications The Better Buildings Neighborhood View -- January 2013 howtodesignandmarketenergyefficiencyprogramstospecificneighborhoods.doc

  15. Sign Up for E-mail Updates | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    Sign Up for E-mail Updates Materials Sciences and Engineering (MSE) Division MSE Home About Staff What's New Research Areas Reports and Activities Science Highlights Principal Investigators' Meetings BES Home What's New Sign Up for E-mail Updates Print Text Size: A A A FeedbackShare Page The Division has a "Dear Colleague" email list, which is used to circulate general information such as funding opportunity announcements and administrative information such as position openings. To

  16. Legal and policy issues associated with monitoring employee E-mail

    SciTech Connect (OSTI)

    Segura, M.A.; Rither, A.C.


    This paper examines the legal issues involved with employer monitoring of employee e-mail. In addition to identifying pertinent legal issues, the paper provides guidelines that will help the Pacific Northwest National Laboratory (PNNL) establish a program for monitoring outgoing e-mail to insure compliance with company policies, particularly those regarding protection of trade secrets and proprietary information, and to comply with the Department of Energy`s (DOE) procedures for protecting Export Controlled Information (ECI). Electronic communication has allowed companies to enhance efficiency, responsiveness and effectiveness. E-mail allows employees to transmit all types of data to other individuals inside and outside of their companies. The ease with which information can be transmitted by e-mail has placed trade secrets, proprietary information, and other sensitive data at risk from inadvertent disclosure by employees. As employers attempt to protect their interests through measures such as monitoring e-mail, they may expose themselves to liability under federal and state laws for violating employee privacy. Business use of e-mail has proliferated so rapidly that the federal and state legal systems have not been able to adequately address the issues arising out of its use in the workplace.

  17. How to Submit a Freedom of Information Act Request

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    and the Fax number will change to: (720)356-1780 Email: Please clearly mark the mailing envelope, fax or subject line of e-mail "Freedom of ...


    National Nuclear Security Administration (NNSA)

    Department Mailing PhoneFax Email or web site California California Department of ... Department Mailing PhoneFax Email or web site New York New York State Division of ...

  19. Eva Stringer | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Administrative Secretary Eva Stringer Telephone 630.252.6889 Fax 630.252.4646 E-mail stringer

  20. Nozomi Shirato | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Assistant Physicst Nozomi Shirato Telephone 630.252.3605 Fax 630.252.5739 E-mail nshirato

  1. Kathy Vanoskey | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Kathy Vanoskey Administrative Secretary Telephone 630.252.4106 Fax 630. 252.6866 E-mail kvanoskey

  2. Supratik Guha | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Supratik Guha NST Division Director Telephone 630.252.7740 Fax 630.252.6866 E-mail sguha

  3. Rachel Mirelez | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Administrative Secretary Rachel Mirelez Telephone 630.252.4651 Fax 630.252.6866 E-mail rmirelez

  4. Naryanan (Bobby) Kasthuri | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Neuroscience Researcher Naryanan (Bobby) Kasthuri Telephone 630.252.4966 Fax 630.252.5739 E-mail bobbykasthuri...

  5. DOE - NNSA/NFO -- Nevada Test Tour Form

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    NTS Tour Forms NNSA/NFO Language Options U.S. DOE/NNSA - Nevada Field Office Nevada National Security Site Tour Forms Groups and individuals wishing to tour the approximately 1,375-square-mile Nevada National Security Site should complete the Nevada National Security Site Tour Badging Form below and submit it via fax or postal mail to the Nevada Field Office's, Office of Public Affairs, Visit Coordination Staff. Click the document title to view or download the Adobe PDF file marked with this

  6. UNCLASSIFIED UNCLASSIFIED Nuclear Materials Management & Safeguards System

    National Nuclear Security Administration (NNSA)

    UNCLASSIFIED Nuclear Materials Management & Safeguards System CONTACT INFORMATION UPDATE REPORTING IDENTIFICATION SYMBOL (RIS) RIS: Address: Facility Name: CONTACTS Name Email: Phone/Fax Name Email: Phone/Fax Name Email: Phone/Fax Name Email: Phone/Fax Return Via Mail To: U.S Department Of Energy ATTN: NMMSS Staff NA-73, GTN 1000 Independence Avenue, SW Washington, DC 20585-1290 Return Via Fax To: 301-903-1998 Return Via E-Mail To:

  7. By E-Mail Daniel Cohen Assistant General Counsel for Legislation, Regulation, and Energy Efficiency

    Energy Savers [EERE]

    June 19, 2012 By E-Mail Daniel Cohen Assistant General Counsel for Legislation, Regulation, and Energy Efficiency U.S. Department of Energy Office of the General Counsel 1000 Independence Ave., SW Washington, D.C. 20585 Re: Regulatory Burden RFI Dear Mr. Cohen: The Association of Home Appliance Manufacturers (AHAM) respectfully submits the following comments to the Department of Energy (DOE) on its Regulatory Burden RFI, 77 Fed. Reg. 28518 (May 15, 2012). AHAM

  8. Extremely High-Frequency Holographic Radar Imaging of Personnel and Mail

    SciTech Connect (OSTI)

    McMakin, Douglas L.; Sheen, David M.; Griffin, Jeffrey W.; Lechelt, Wayne M.


    The awareness of terrorists covertly transporting chemical warfare (CW) and biological warfare (BW) agents into government, military, and civilian facilities to harm the occupants has increased dramatically since the attacks of 9/11. Government and civilian security personnel have a need for innovative surveillance technology that can rapidly detect these lethal agents, even when they are hidden away in sealed containers and concealed either under clothing or in hand-carried items such as mailed packages or handbags. Sensor technology that detects BW and CW agents in mail or sealed containers carried under the clothing are under development. One promising sensor technology presently under development to defeat these threats is active millimeter-wave holographic radar imaging, which can readily image concealed items behind paper, cardboard, and clothing. Feasibility imaging studies at frequencies greater than 40 GHz have been conducted to determine whether simulated biological or chemical agents concealed in mail packages or under clothing could be detected using this extremely high-frequency imaging technique. The results of this imaging study will be presented in this paper.

  9. EIA-Voluntary Reporting of Greenhouse Gases Program - Contact

    U.S. Energy Information Administration (EIA) Indexed Site

    Contact Voluntary Reporting of Greenhouse Gases Program Contact For more information on the Voluntary Reporting of Greenhouse Gases Program, contact us via e-mail, phone, fax, or ...

  10. Brandon Fisher | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Engineering Specialist Senior Brandon Fisher News Atomically Thin Metallic Boron Telephone 630.252.5324 Fax 630.252.4646 E-mail

  11. Jonathan Logan | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Postdoctoral Appointee (Supervisor, Ian McNulty) Jonathan Logan Telephone 630.252.4874 Fax 630.252.5739 E-mail jmlogan

  12. Nancy Dietz-Rago | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Materials Scientist Nancy Dietz-Rago Telephone 630.252.9798 Fax 630.252.5739 E-mail

  13. Tal Heilpern | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Postdoctoral Appointee (Supervisor, Stephen Gray) Tal Heilpern Telephone 630.252.5884 Fax 630.252.4646 E-mail theilpern

  14. Department

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Address: country Phone Number: Fax Number: E-mail: 20111110100931 Evan J. Kaufman Robbins Geller Rudman &38; Dowd LLP 58 South Service Road, Suite 200 Melville, NY 11747...

  15. HAN F OR

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Fax Number: E-mail: United States na na Reasonably Describe Records: Description: Industrial Hygiene Chemical Vapor Technical Basis RPP-22491 Revision 1 Optional...

  16. BPA-2015-00051-FOIA Request

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    on this form. Name Carrie Henderson Email Organiz ation Mailing Address City State Phone FAX Ex. xxx-xxx-xxxx Date Redd: 1082014 Due Date: 1162014 Tracking Number;...


    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Code: Phone Number: ext. Fax: E-mail: Report Contact (Monthly Reports) Information: First Name: Last Name: Middle Initial: PositionTitle: Country: Street: City: StateProvince:...

  18. Laurie Eichberger | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Executive Secretary Laurie Eichberger Telephone 630.252.7570 Fax 630.252.6866 E-mail

  19. Dean Carbaugh | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Senior Technician Dean Carbaugh Telephone 630.252.4833 Fax 630.252.5739 E-mail

  20. Deborah O'Rourke | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Deborah O'Rourke NST Assistant Division Director Telephone 630.252.3810 Fax 630.252.6866 E-mail dorourke

  1. Joonseok Lee | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Fellow (Supervisor, Elena Roshkova) News Piezoelectrically enhanced ferroelectric polymers via nanoscale mechanical annealing Telephone 630.252.7317 Fax 630.252.4646 E-mail...

  2. EM SSAB Local Board Contacts | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    EM SSAB Local Board Contacts EM SSAB Local Board Contacts EM SSAB Federal Coordinators Hanford Kristen Skopeck Phone: (509) 376-5803 Fax: (509) 376-1563 E-mail: Oak Ridge Melyssa Noe Phone: (865) 241-3315 Fax: (865) 241-6932 E-mail: Idaho Robert Pence Phone: (208) 526-6518 Fax: (208) 526-8789 E-mail: Paducah Robert Smith Phone: (270) 441-6821 Fax: (270) 441-6801 E-mail: Nevada Kelly Snyder Phone: (702)

  3. Microsoft Word - 1897.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Identification Device User print name Government AgencySponsored Company Visitor's Z Number or ID Number Email Address Phone Number Fax Number Mail Stop and Office Location...

  4. Alper Kinaci | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Postdoctoral Appointee (Supervisor, Maria Chan) Alper Kinaci Telephone 630.252.5378 Fax 630.252.4646 E-mail akinaci

  5. Property:Incentive/ContFax | Open Energy Information

    Open Energy Info (EERE)

    Regulations: No.27 - Control of Nitrogen Oxide Emissions (Rhode Island) + 401-222-2017 + Air Quality (Nova Scotia, Canada) + (902) 424-0503 + Air Quality Approvals and Permits...

  6. First Name: Last Name: Title: Telephone: Fax: Email: First Name...

    U.S. Energy Information Administration (EIA) Indexed Site

    NOTICE: This report is mandatory under the Federal Energy Administration Act of 1974 (Public Law 93-275). Failure to comply may result in criminal fines, civil penalties and other ...

  7. Fax and Evaluation Letter: Fax transmits the following letter: Post-Cleanup Evaluation for the Southeast Drainage, February 12, 1999.

    Office of Legacy Management (LM)

  8. Site Office Contracting Officer E-mail address Ames Site Office Jackie York

    National Nuclear Security Administration (NNSA)

    Site Office Contracting Officer E-mail address Ames Site Office Jackie York Argonne Site Office Jacquelyn York Brookhaven Site Office Evelyn Landini Jennifer Hartmann Idaho Site Office Paul Allen Kansas City Site Office Ralph Tennant Lawrence Livermore Site Office Homer Williamson Los Alamos Site Office Barbara Romero Robert M. Poole

  9. Contact information | Center for Bio-Inspired Solar Fuel Production

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Email: Phone: (480) 965-1548 Fax: (480) 965-5927 Mailing address (US mail): Center for Bio-Inspired Solar Fuel Production Arizona State University ...

  10. Microsoft Word -

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    unless changed by holiday. Mail to: Dept. 3651, MS 0165 Fax to: 844-0645 Email: In your Word document, click on FileSend and click on "send."...

  11. MailedForm.pptx

    National Nuclear Security Administration (NNSA)

    Businesses using high-activity radioactive sources (Cesium-137, Cobalt-60, Americium-241, ... to: Kristina Hatcher, U.S. Department of Energy, 1000 Independence Ave., S.W., ...

  12. QROU Questions Fax: Fax transmits questions on the Quarry Residuals Operable Unit - Remedial Investigation Report (QROU - RI) for technical meeting set for August 14, 1997.

    Office of Legacy Management (LM)

  13. EE/CA Letter and Fax: Fax transmits a copy of a Weldon Spring Citizens Commission letter regarding the Engineering Evaluation Cost Assessment on the Southeast Drainage.

    Office of Legacy Management (LM)

  14. --No Title--

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    575 Sand Hill Road * Mail Stop 103 * Menlo Park, CA 94025-7015 650-926-2288 * Fax 650-926-4695 SLAC is operated by Stanford University for the U.S. Department of Energy SLAC...

  15. Marcia A. Wood | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Marcia A. Wood Group Leader, Information Solutions and Technology Assurance B.S. Computer Science, University of St. Francis Telephone 630.252.4656 Fax 630.252.6866 E-mail...

  16. BPA-2014-01713-FOIA Request

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Kiley Scott Email Organizatio SNC Lavalin T&D n Mailing 150 Whitten Rd Address City Augusta State ME Phone 315-842-0999 Ex. xxx-xxx-xxxx FAX Ex....

  17. SSRLUO 2002 Executive Committee Members | Stanford Synchrotron...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Pingitore University of Texas at El Paso Environmental & Geosciences El Paso, TX 79968-0555 Phone: 915-747-5754 Fax: 915-747-5073 E-mail: MACROMOLECULAR...

  18. Muge Acik | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Muge Acik Argonne Scholar - ANL Named Postdoc (Joseph Katz Fellow); (Supervisor, Seth Darling) News Employee Spotlight: Muge Acik Telephone 630.252.2734 Fax 630.252.4646 E-mail...

  19. BPA-2015-01591-FOIA Request

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    o n this form. Name Email Organization Mailing Address City State Phone FAX William Campbell I 'b' '6' J J Zip Reasonably Describe Records Describe the specific record(s) you...

  20. STEAB Annual Report 2010-2011

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ... and promoting a culture of bottom-up change and ... of energy efficiency techniques and renewable energy ... Fax: 541-858-4790 Cell: 541-944-8992 E-mail: ...

  1. seca-core-tech-sofc-seal-meeting |

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    NETL Conference Services Information Conference Services National Energy Technology Laboratory Phone: (412) 386-6044 FAX: (412) 386-6486 E-mail:

  2. afe |

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Presentation NETL Conference Services Information National Energy Technology Laboratory Phone: (412) 386-6044 FAX: (412) 386-6486 E-mail: Disclaimer...

  3. seca-model-simul-team-integration-mtg |

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    NETL Conference Services Information Conference Services National Energy Technology Laboratory Phone: (412) 386-6044 FAX: (412) 386-6486 E-mail:

  4. sco2 workshop |

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Energy Technology Laboratory Phone: (412) 386-6044 FAX: (412) 386-6486 E-mail: Disclaimer This report was prepared as an account of work...

  5. Contact Us | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    NNSA Production Office Contact Us Contact Us NPO Public Affairs Manager Steven Wyatt (865) 576-9918 NPO Mailing Address NNSA Production Office PO Box 2050 Oak Ridge, TN 37831 Fax...

  6. Edward Barry | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Edward Barry Argonne Scholar - ANL Named Postdoc (Joseph Katz Fellow); (Supervisor, Seth Darling) Telephone 630.252.6289 Fax 630.252.4646 E-mail CV/Resume PDF icon Barry, Edward - Resume.pdf

  7. Min Chen | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Min Chen Min Chen Min Chen Min Chen Research Affiliate E-mail: Phone: +61 2 9036 5006 Fax: +61 2 9351 4119 Website: University of Sydney Research Affiliate...

  8. Michelle Liberton | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Michelle Liberton Michelle Liberton Michelle Liberton Michelle Liberton Research Scientist E-mail: Phone: 314.935.8133 Fax: 314.935.4432 Website: Washington...

  9. Gabriel Montao | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Gabriel Montao Gabriel Montao Gabriel Montao Gabriel Montao Principal Investigator E-mail: Phone: 505.284.8236 Fax: 505.284.7778 Website: Los Alamos National...

  10. Elizabeth Dorland | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Dorland Elizabeth Dorland Elizabeth Dorland Elizabeth Dorland Communications Director E-mail: Phone: 314.935.6094 Fax: 314.935.4925 Office: Brauer Hall 2023...

  11. Lisa Gerhardt

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Lisa Gerhardt Lisa Gerhardt Lisa Gerhardt Big Data Architect Phone: (510) 486-4680 Fax: (510) 486-4316 1 Cyclotron Road Mail Stop 943-256 Berkeley, CA 94720 ...

  12. Erin Plut | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Erin Plut Erin Plut Erin Plut Administrative Coordinator E-mail: Phone: 314.935.4499 Fax: 314.935.4925 Office: Seigle Hall 430 Website: PARC Steering Committee Operations Committee

  13. Iodine solubility in a low-activity waste borosilicate glass...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    4651; fax: +1 (509)372 5997. E-mail address: (B.J. Riley). Journal of Nuclear Materials 452 (2014) 178-188 Contents lists available at ScienceDirect...

  14. Iodine valence and local environments in borosilicate waste glasses...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    319 5226; fax: +1 (202) 319 4469. E-mail address: (D.A. McKeown). Journal of Nuclear Materials 456 (2015) 182-191 Contents lists available at ScienceDirect...

  15. Microsoft Word - Attach_A_Site Description 2007_Final.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    576-8401 Fax: (865) 576-5728 E-mail: DOENV25946--543-ATT-A ... and Abbreviations AA alluvial aquifer AEC Atomic Energy Commission ATCU argillic tuff ...

  16. Nevada Test Site Environmental Report Attachment A: Site Description

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    576-8401 Fax: (865) 576-5728 E-mail: DOENV25946--790-ATT A ... and Abbreviations AA alluvial aquifer AEC Atomic Energy Commission a.k.a. also known ...

  17. Microsoft Word - 1-SiteDescription Cover DisclaimerTitle Final...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    576-8401 Fax: (865) 576-5728 E-mail: DOENV25946--259 Nevada ... and Abbreviations AA alluvial aquifer AEC Atomic Energy Commission ATICU Ammonia ...

  18. Microsoft Word - Attachment A 2009 Final.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Phone: (865) 576-8401 Fax: (865) 576-5728 E-mail: New Name for the ... and Abbreviations AA alluvial aquifer AEC Atomic Energy Commission a.k.a. also known ...

  19. Document

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    90, Oak Ridge, TN 37831. Phone (865) 576-4025; Fax (865) 576-2347 or e-mail: or check the Web site at http:www.oakridge.doe.govem ssab. SUPPLEMENTARY...

  20. Microsoft Word -

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    BEAMTIME REQUEST FORM Please forward to Craig Stevens by Fax: 578-6954, or mail to CAMDLSU, 6980 Jefferson Highway, Baton Rouge, LA 70806, Room 107. Project Reference Number...

  1. David Keavney

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Publications Contact Us Ring Status Current Schedule David Keavney Argonne National Laboratory 9700 S. Cass Ave 431E002 Argonne, Il 60439 Phone: 252-7893 Fax: 252-7392 E-Mail:...

  2. Michael McDowell

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Publicatons Contact Us Ring Status Current Schedule David Gagliano Argonne National Laboratory 9700 S. Cass Ave 431E020 Argonne, IL 60439 Phone: 252-6422 Fax: 252-7392 E-Mail:...

  3. Phillip Ryan

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Publications Contact Us Ring Status Current Schedule Phillip Ryan Argonne National Laboratory 9700 S. Cass Ave 432B005 Argonne, Il 60439 Phone: 252-0252 Fax: 252-7392 E-Mail:...

  4. Daniel Haskel

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Daniel Haskel Argonne National Laboratory 9700 S. Cass Ave 431E008 Argonne, Il 60439 Phone: 252-7758 Fax: 252-7392 E-Mail: EducationExperience: University of...

  5. BPA-2016-00034-FOIA Request

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    the Privacy Act must be signed and, therefore, cannot be submitted on this form. Name Marina Brassfield Email (b)(6) Organization Mailing Address City State Phone FAX Ex. XXX*...

  6. LSU EFRC - Center for Atomic Level Catalyst Design - Contact...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Contact Us >> space control Center for Atomic-Level Catalyst Design (CALCD) 110 Chemical ... Telephone: 225.578.1426 Fax: 225.578.1476 E-mail: space control Webmaster ...

  7. BPA-2013-00104-FOIA Request

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Organization Gradient Mailing Address 20 University Road 5th Floor City Cambridge State MA Zip 02138 Phone 617-395-5570 Ex. xxx-xxx-xxxx FAX 617-395-5000 Ex....

  8. Rick Weber

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Rick Weber Argonne National Laboratory 9700 S. Cass Ave 432B003 Argonne, Il 60439 Phone: 252-4207 Fax: 252-7392 E-Mail: EducationExperience: 2007 - present: STA...


    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Send by post Name: E-mail Address: Phone: Fax: CORRESPONDENCE 242 Letter to Kevin Smith from Philip Gent dated 82415 re: Issuance of Approval Order DE11NWP-001, Rev 2 241...

  10. Haijun Liu | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Haijun Liu Haijun Liu Haijun Liu Postdoctoral Associate E-mail: Phone: 314.935.4899 Fax: 314.935.4432 Website: Washington University in St. Louis Postdoctoral Associates

  11. Aftab Ahmed | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Aftab Ahmed Postdoctoral Appointee (Supervisor, Jeff Guest) Telephone 630.252.2441 Fax 630.252.4646 E-mail CV/Resume PDF icon Ahmed, Aftab - Bio.pdf

  12. Dan Allen | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Dan Allen Dan Allen Dan Allen Dan Allen Multimedia Specialist E-mail: Phone: 314.935.9096 Fax: 314.935.4925 Office: Seigle Hall 431 Operations Committee


    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ... with Mentors and Protgs 11 LaTonya Poole Acquisition Specialist DOE ... (202) 586-3835 Fax: (202) 586-3075 E-mail: OSDBU Website:

  14. SSRLUO 1998 Executive Committee Members | Stanford Synchrotron...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Francisco CA 94080 Ph: (415) 225-2523 Fax: (415) 225-3734 E-mail: Joe Wong Dept of Chem & Mat Science PO Box 808, L-356 Livermore CA 94551 Work:(510) 423-6385...

  15. SC e-journals Contact page

    Office of Scientific and Technical Information (OSTI)

    Contact Us If you have questions or are in need of assistance, please contact us at the following: E-Mail Phone: 865-576-1290 or 865-576-5600 Fax: 865-241-3826 ...

  16. James Craw

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    James Craw James Craw jcraw.jpg James (Jim ) M. Craw Risks and Energy Manager Phone: (510) 486-5920 Fax: (510) 486-4316 1 Cyclotron Road Mail Stop 943-256 Berkeley,...

  17. Submitting Organization Sandia National Laboratories

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    P.O. Box 5800 Albuquerque, NM 87185 Susan Brozik Address: P.O. Box 5800, MS 0892 City/State: Albuquerque, NM Zip/Postal Code: 87185 Country: USA Phone: 505-844-5105 Fax: 505-845-8161 Contact Person Glenn Kubiak Sandia National Laboratories Director, Biological and Materials Science Center Address: 7011 East Avenue, MS 9405 City/State: Livermore, CA Zip/Postal Code: 94551 Country: USA Phone: 925-294-3375 Fax: 925-294-3403 Email: Joint Entry University of New

  18. Submitting Organization Sandia National Laboratories

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Hongyou Fan Advanced Materials Laboratory 1001 University Boulevard SE Albuquerque, NM 87106 Country: USA Phone: 505-272-7128 Fax: 505-272-7336 Contact Person Glenn D. Kubiak, Director Sandia National Laboratories PO Box 969 Mail Stop 9405 Livermore, CA 94551-0969 USA Phone: 925-294-3375 Fax: 925- 294-3403 Joint Entry Lockheed Martin Aeronautics Mail Zone 2893, PO Box 748 City: Fort Worth, Texas 76101 USA Earl Stromberg Phone: (817) 763-7376 Fax: (817) 762-6911

  19. Municipal Solid Waste:

    U.S. Energy Information Administration (EIA) Indexed Site

    ... EIA in predicting the change in MSW composition over time. ... for purposes of the National Energy Information System. ... b Formerly called Third Class Mail by the U.S. Postal ...

  20. Staff

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Staff Staff Iwona Sakrejda PDSF Project Lead email: phone: 510/486-4078 fax: 510/486-4316 Mail Stop 943 Lawrence Berkeley National Laboratory 1 Cyclotron Rd. Berkeley, CA 94720 Larry Pezzaglia PDSF System Analyst email: phone: 510/495-2318 fax: 510/486-4316 Mail Stop 943 Lawrence Berkeley National Laboratory 1 Cyclotron Rd. Berkeley, CA 94720 Lisa Gerhardt PDSF User Support email: phone: 510/486-4680 Mail Stop 943 Lawrence Berkeley National

  1. FY2000 SSRLUO Executive Committee

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    SSRL USERS' ORGANIZATION 2001 EXECUTIVE COMMITTEE Comments and suggestions regarding user concerns that should be addressed by the Executive Committee are always welcome. Paul Alivisatos University of California at Berkeley Department of Chemistry Berkeley, CA 94720 Phone: 510-643-7371 Fax: 510-642-6911 E-mail: Cathy Knotts (SSRL Liaison) Stanford Synchrotron Radiation Laboratory, MS 99 2575 Sand Hill Rd. Menlo Park, CA 94025 Phone: 650-926-3191 Fax: 650-926-3600

  2. Center for Advanced Solar Photophysics | Contacts

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Contacts Victor Klimov - Center for Advnaced Solar Photoohysics Director Center Director Victor I. Klimov C-PCS, MS-J567, Chemistry Division Los Alamos National Laboratory Los Alamos, NM 87545 Office: (505) 665-8284 Cellular: (505) 699-7541 Fax: (505) 667-0440 E-mail: Artthur Nozik - Center for Advanced Solar Photophysics Associate Center Director Dr. Matthew C. Nozik Senior Scientist National Renewable Energy Laboratory, and University of Colorado, Boulder Ph: 303 384 6603 Fax:

  3. Contact Us | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Contact Us Contact Us Contact the IG Hotline BY INTERNET Web Form BY E-MAIL CORRESPONDENCE U.S. Department of Energy Office of Inspector General ATTN: IG Hotline 1000 Independence Avenue, SW Mail Stop 5D-031 Washington, DC 20585 BY PHONE D.C. Metro Area: (202) 586-4073 Toll free: (800) 541-1625 FAX: (202) 586-4902 Contact Us Office of Inspector General 
1000 Independence Avenue, SW 
Washington, DC 20585 Phone: 202-586-1818 Fax: 202-586-7851 Media Inquiries: 202-253-2162


    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Fax forms to Tammie Gilley at EnviroIssues Hanford Project Office (509) 942-1926 Document Request Form Dated March 28, 2016 HAB Document Request Form Send by e-mail Copy at meeting Name: E-mail Address: Phone: Fax: CORRESPONDENCE 206 Letter to Monica Regalbuto from Ken Niles dated 3/22/16 re: US DOE's Refusal to Unequivocally Commit that it will not Send Large Volumes of Waste to Hanford for Disposal 205 Letter to Stacy Charboneau from Suzanne Dahl dated 3/21/16 re: Request for Temporary

  5. Letter Temple

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    4 06/04/15 Note: Form must be filled out completely and signed prior to submittal to the following address: Nuclear Waste Partnership LLC PO Box 2078 GSA-207 Carlsbad, NM 88221 FAX: (575) 234-7050 Company Name: Address: Phone: City: State: Zip(+4): e-Mail: REMITTANCE ADDRESS (if different) Address: City: State: Zip(+4): e-Mail: Other: Address: City: State: Zip(+4): Country Code: COMPANY CONTACTS Manager Name: Sales Name: Phone: Cell: Phone: Cell: e-Mail e-Mail Service Name: Accounts Payable

  6. Bohdana Discher | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Bohdana Discher Bohdana Discher Bohdana Discher Bohdana Discher Research Associate E-mail: Phone: 215.898.5668 Fax: 215.898.0465 Office: 1004 Stellar-Chance Building Website: University of Pennsylvania Theme 3 Member Dr. Discher's research focuses on the biophysics of molecular self-assembly of natural membranes, amphiphillic maquettes, reproducing functional elements of biological energy transduction, and development of functional mimics of natural membrane

  7. P. Leslie Dutton | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    P. Leslie Dutton P. Leslie Dutton P. Leslie Dutton P. Leslie Dutton Principal Investigator E-mail: Phone: 215.898.0991 Fax: 215.573.2235 Office: 1005 Stellar-Chance Building Website: University of Pennsylvania Theme 3 Member Dr. Dutton designs and assembles artificial proteins as single or multiple structures equipped for light-harvesting and able to transfer the energy for conversion to other energy currency. Eldridge Reeves Johnson Professor of Biochemistry and


    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    (865) 574-2105 (Alternate) Miller, Ruth Oak Ridge Nat'l Laboratory ... Ashley, Tom CWI, Idaho Cleanup Project (208) 360-3552 McGary, ...

  9. Mail Management Memorandum, July 2, 2010

    Energy Savers [EERE]

  10. Printing and Mail Managers Exchange Forum Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    New reporting due date will be October 31 of each year starting in FY-2014. On-line ... Change to Schedule 5-1. Requirement is to now enter numbers rounded to the nearest dollar ...

  11. Widget:MailChimp | Open Energy Information

    Open Energy Info (EERE)

    source History View New Pages Recent Changes All Special Pages Semantic SearchQuerying Get Involved Help Apps Datasets Community Login | Sign Up Search Widget Edit History...

  12. Thomas Davis

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Thomas Davis Thomas Davis tdavis.jpg Thomas (Tom) A. Davis Environmental Systems, CSE Phone: (510) 486-4524 Fax: (510) 486-4316 1 Cyclotron Road Mail Stop 943-256 Berkeley, CA 94720 Last edited: 2016-04-29 11:34:5

  13. Tony Quan

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Tony Quan Tony Quan tquan.jpg Wing Sum (Tony) Quan HPC Technician Operations Technology Group Phone: (510) 486-6821 Fax: (510) 486-4316 1 Cyclotron Road Mail Stop 943-256 Berkeley, CA 94720 Last edited: 2012-10-23 12:44:05

  14. Benjamin Diroll | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Benjamin Diroll Argonne Scholar - Director's Postdoctoral Fellow (Supervisor, Richard Schaller) My research is focused on time-, temperature-, and pressure-resolved spectroscopy of nanoscale materials, especially inorganic colloidal nanocrystals. Telephone 630.252.5418 Fax 630.252.5739 E-mail CV/Resume PDF icon Diroll, Ben - CV

  15. Ji-sang Park | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Ji-sang Park Postdoctoral Appointee (Supervier, Maria Chan) Research focuses primarily on physical properties of semiconductors for transistor, light emitting diode, and solar cell applications. Telephone 630.252.4628 Fax 630.252.4646 E-mail CV/Resume File Park, Ji-Sang - Bio.docx

  16. Kiran Kumar Kovi | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Kumar Kovi Postdoctoral Appointee (Supervisor, Ani Sumant) Research is focused on Diamond based electronics with emphasis on high power devices. Other areas of interests include Valleytronics, 2D materials etc. Telephone 630.252.4258 Fax 630.252.5739 E-mail CV/Resume PDF icon Kiran_Kumar_Kovi

  17. Del Black

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Del Black Del Black dblack.jpg Del C. Black HPC Technician Operations Technology Group Phone: (510) 486-6821 Fax: (510) 486-4316 1 Cyclotron Road Mail Stop 943-256 Berkeley, CA 94720 Last edited: 2016-04-29 11:34:4

  18. Woo-Sun Yang

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Woo-Sun Yang Woo-Sun Yang Woo-Sun-Yang.jpg Woo-Sun Yang , Ph.D. HPC Consultant Phone: (510) 486-5735 Fax: (510) 486-4316 1 Cyclotron Road Mail Stop 943-256 Berkeley,...


    U.S. Energy Information Administration (EIA) Indexed Site

    Government Printing Office Main Order Desk (202) 512-1800 FAX: (202) 512-2250 8 a.m. to 4:30 p.m., eastern time, M-F All mail orders should be directed to: U.S. Government Printing...

  20. Morris, Alexander From: Sent: To: Subject: FOIA-Central@l1q,dOc...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Dr'ive, Suite 8 Petaluma, CA 94954 ij -, CdV',,,' "" t " ,, :,. ? FAX: 707-789-9580 Phone: 787-789-9575 mail: kbarorusasb 1. COlli Recor-d De s cr i p t i.on: June 2, 2010...

  1. Robert Neylan

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Robert Neylan Robert Neylan Robert-Neyland.jpg Robert J. Neylan HPC Technician Operations Technology Group Phone: (510) 486-6821 Fax: (510) 486-4316 1 Cyclotron Road Mail Stop 943-256 Berkeley, CA 94720 Last edited: 2016-04-29 11:35:2

  2. Matthew Sykes | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Matthew Sykes Postdoctoral Appointee (Supervisor, Gary Wiederrecht) Research focuses on characterizing ultrafast processes in metal and semiconductor hybrid nanomaterials for applications in energy conversion. Telephone 630.252.1572 Fax 630.252.4646 E-mail CV/Resume PDF icon Sykes, Matthew - 5-2016 Bio

  3. Aaron Garrett

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Aaron Garrett Aaron Garrett owetwoiethw.jpg Aaron G. Garrett Workstation Support Phone: (510) 495-2299 Fax: (510) 486-4316 1 Cyclotron Road Mail Stop 943-256 Berkeley, CA 94720 US Last edited: 2016-04-29 11:35:12

  4. Andrew Weaver

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Andrew Weaver Andrew Weaver WeaverA.jpg Andrew R. Weaver HPC Technician Operations Technology Group Phone: (510) 486-6821 Fax: (510) 486-4316 1 Cyclotron Road Mail Stop 943-256 Berkeley, CA 94720 Biographical Sketch Last edited: 2013-04-22 13:00:24

  5. Wilma Snider

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Wilma Snider Wilma Snider Wilma Snider Student Assistant Operations Technology Group Phone: (510) 486-6821 Fax: (510) 486-4316 1 Cyclotron Road Mail Stop 943-256 Berkeley, CA 94720 Last edited: 2014-09-24 14:34:11

  6. Leonidas E. Ocola | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Leonidas E. Ocola Physicist Ph.D., University of Wisconsin-Madison Novel nanofabrication techniques, micro- and nanofluidics, plasmonic optical devices, transparent capacitors, templated self-assembly, NEMS, electron-matter interactions, single molecule spectroscopy Telephone 630.252.6613 Fax 630.252.5739 E-mail CV/Resume PDF icon LO resume 4 color

  7. Liang Li | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Liang Li Postdoctoral Appointee (Supervisor, Maria Chan) Current research focuses on ab-initio theoretical studies on hybrid lithium-ion/lithium-oxygen battery materials and photocatalytic reduction of CO2. Telephone 630.252.2788 Fax 630.252.4646 E-mail CV/Resume PDF icon Liang_Li

  8. Dariusz (Darek) Niedzwiedzki | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Dariusz (Darek) Niedzwiedzki Dariusz (Darek) Niedzwiedzki Dariusz (Darek) Niedzwiedzki Research Scientist E-mail: Phone: 314.935.8483 Fax: 314.935.4925 Learn more about the Ultrafast Laser Facility Here 04/06/15:: Researchers find less expensive way to convert carbon dioxide Research and Technical Associates

  9. Dmitri Talapin | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Dmitri Talapin Scientist (Joint Appointment) & Professor, Chemistry, University of Chicago Telephone 773.834.2607 Fax 773.702.5863 E-mail CV/Resume Microsoft Office document icon Talapin Bio-Revised Jan 2016.doc

  10. David Paul

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    David Paul David Paul David-Paul.jpg David Paul Computational Systems Group Phone: (510) 495-2883 Fax: (510) 486-4316 1 Cyclotron Road Mail Stop 943-256 Berkeley, CA 94720 Last edited: 2013-01-30 16:46:21

  11. Anand Bhattacharya | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Anand Bhattacharya Physicist Ph.D., University of Minnesota Research focuses on correlated states that emerge in complex oxides at interfaces, in cation-ordered analogs, and due to nanoscale confinement. News Spintronics: spin current from a paramagnet Young scientist discovers magnetic material unnecessary to create spin current Telephone 630.252.6518 Fax 630.252.4646 E-mail anand

  12. About Us | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Us About Us Department of Energy Facilities By E-mail: You can send an email to the Secretary of Energy at By Phone: 202-586-5000 (Main Switchboard) or use the National Phone Directory For Hearing and/or Speech Impaired: Telephone Communication By Fax: 202-586-4403 *By Mail: U.S. Department of Energy 1000 Independence Ave., SW Washington, DC 20585 *Please note: mail may take up to 3 weeks to arrive. As such, we strongly encourage you to use the email address provided

  13. Contact Us | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Contact Us Contact Us By E-mail: You can send an email to the Secretary of Energy at By Phone: 202-586-5000 (Main Switchboard) or use the National Phone Directory For Hearing and/or Speech Impaired: 1-800-877-8339 By Fax: 202-586-4403 *By Mail: U.S. Department of Energy 1000 Independence Ave., SW Washington, DC 20585 *Please note: mail may take up to 3 weeks to arrive. As such, we strongly encourage you to use the email address provided above or the form provided below.

  14. Contact Information | Princeton Plasma Physics Lab

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Contact Information Head of Office of Technology Transfer: Laurie Bagley Princeton Plasma Physics Laboratory P.O. Box 451 Princeton, NJ 08543 Telephone: 609-243-2425 E-mail: PPPL Ombudsman: John C. Lacenere Princeton Plasma Physics Laboratory Mail Stop 08 P.O. Box 451 Princeton, NJ 08543 Telephone: 609-243-3308 E-mail: Fax: (609) 243-3030 Questions or comments? Please contact Laurie Bagley at . Associated Files: PDF icon Patent Awareness

  15. Slide 1

    Energy Savers [EERE]

    70.10 (2/2010) 09-95 editions may be used U.S. DEPARTMENT OF ENERGY CLASSIFIED MATTER RECEIPT POSTAL NUMBER DATE MAILED INSTRUCTIONS 1. Receipt MUST be Unclassified when completed. 2. Verify addressee's classified mailing address. 3. Describe document by subject or title and originator. See DOE Information Security directive for when this form is required. 4. Forward original and duplicate to addressee. 5. Retain copy of signed original pending return by addressee. 6. Issue Hand Carry copy of

  16. Southwestern Power Administration

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Contact Us U.S. Department of Energy Southwestern Power Administration Gore Maintenance Office Mailing Address: P.O. Box 728 Gore, OK 74435-0728 Delivery Address: 14165 East 143rd Street South Gore, OK 74435-5353 Voice: 918-489-5582 / Fax: 918-489-5527 Jonesboro Maintenance Office 305 North Floyd Street Jonesboro, AR 72401-1908 Voice: 870-972-4686 / Fax: 870-932-6153 Springfield Maintenance & Operations 2858 South Golden Avenue Springfield, MO 65807-3213 Maintenance Office Voice:

  17. New Mexico Non-Taxable Transaction Certificate (NM NTTC) Request

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mexico Non-Taxable Transaction Certificate (NM NTTC) Request This form is for vendors of Los Alamos National Laboratory. To request a NM Non-Taxable Transaction Certificate (NTTC), please provide the information requested below. Request can be submitted by mail, email or fax to: Los Alamos National Laboratory P.O. Box 1663 Accounts Payable, MS P240 Los Alamos, NM 87545 Fax: (505) 665-8357 Company Name (as registered with Tax Authority) NOTE: If registered with the State

  18. Submitting Organization Sandia National Laboratories

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Todd Bauer Sandia National Laboratories. P.O. Box 5800, MS 1077 Albuquerque, NM 87185-1077 USA Phone:: (505)-845-0086 Fax:: (505) 844-7833 Contact Person Glenn D. Kubiak, Director, Biological and Materials Sciences Center Sandia National Laboratories PO Box 969 Mail Stop 9405 Livermore, CA 94551-0969, USA Phone:: 925-294-3375 Fax:: 925-294-3403 Joint Entry: Front Edge Technology, Inc. 13455 Brooks Drive Baldwin Park, CA 91706 Submitter Simon Nieh Front Edge

  19. Contact Information | The Ames Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Contact Information If you have any questions concerning the Materials Preparation Center (MPC) services or capabilities, do not hesitate to contact us. Please also visit our Terms & Conditions page. Submit your request online and it will be routed to the appropriate channel. In all cases, the fax number is (515)-294-8727. Larry Jones Matthew F. Besser Director, MPC 121 Metals Development Building Ames Laboratory Ames, IA 50011-3020 Phone: 515-294-5236 Fax: 515-294-8727 E-mail:

  20. State and Local Solution Center Contacts | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    You are here Home » State and Local Solution Center Contacts State and Local Solution Center Contacts Please contact us by email or via postal delivery at: U.S. Department of Energy Energy Efficiency and Renewable Energy 1000 Independence Ave, SW, Mail Stop EE-2K U.S. Department of Energy Washington, DC 20585

  1. Operating Plan 573.1-2

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    OPERATING PLAN 573.1-2 Title: U.S. POSTAL MAIL, SHIPPING AND RECEIVING SECURITY Owner: Cindy Mullens, ESS&H Division, Office of Institutional Operations Approving Official: Thomas Wilson, Jr., Director, Office of Institutional Operations {signature} /s/ Thomas Wilson, Jr. Approval Date: 9/20/12 Last Reviewed Date: 9/20/12 Cancellation: None TABLE OF CONTENTS 1. PURPOSE

  2. C_Program FilesRightFaxRFaxGateINA001e2443-0f95-4c73-9ac5-402896144284.TIF

    Energy Savers [EERE]

  3. C_Program FilesRightFaxRFaxGateINA23326efa-6848-4e70-881e-87e980cbdc1a.TIF

    Energy Savers [EERE]

  4. C_Program FilesRightFaxRFaxGateINAa402975d-cd59-4ccc-928d-ecde174f0e37.TIF

    Energy Savers [EERE]

  5. Thomas Moore | Center for Bio-Inspired Solar Fuel Production

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Principal Investigators Postdoctoral Fellows Center researchers Graduate Students Undergraduate Students All Bisfuel Center Personnel Ana Moore Anne Jones Devens Gust Don Seo Giovanna Ghirlanda Hao Yan James Allen Kevin Redding Petra Fromme Thomas Moore Yan Liu Thomas Moore Principal Investigator Subtask 1 Leader Phone: 480-965-3308 Fax: 480-965-2747 E-mail: Regents' Professor Thomas Moore contributes to the EFRC as Subtask 1 Leader and the member of the EFRC Executive Committee.

  6. Tina Butler

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Butler Tina Butler Tina-Butler.jpg Tina L. P. Butler Computational Systems Group Phone: (510) 495-2379 Fax: (510) 486-4316 1 Cyclotron Road Mail Stop 943-256 Berkeley, CA 94720 Biographical Sketch Tina Butler is responsible for evaluating and recommending the direction and implementation of technology at NERSC, as well as performing ongoing system administration and support for the center's systems. Over the last 20 years, she held a variety of systems and applications

  7. Volker Urban | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Volker Urban Volker Urban Volker Urban Principal Investigator E-mail: Phone: 865-576-7221 Fax: 865-574-6080 Website: Oak Ridge National Lab Website Principal Investigator and Themes 1 & 2 Member Dr. Urban conducts Small Angle Neutron Scattering (SANS) studies for the characterization or macromolecular assemblies. Research and Development Staff, Center for Structural Molecular Biology, Chemical Sciences Division 3/23/11:: Neutron analysis yields insight into bacteria for

  8. Meeting Summary for Diagnostic and Performance Feedback for Residential Space Conditioning System Equipment Expert Meeting

    Energy Savers [EERE]

    Final Report on the Expert Meeting for DIAGNOSTIC AND PERFORMANCE FEEDBACK FOR RESIDENTIAL SPACE CONDITIONING SYSTEM EQUIPMENT Building Science Corporation Industry Team 15 July 2010 Work Performed Under Funding Opportunity Number: DE-FC26-08NT00601 Submitted By: Building Science Corporation 30 Forest Street Somerville, MA 02143 Principal Investigators: Joseph W. Lstiburek, Ph.D., P.Eng. ASHRAE Fellow Betsy Pettit, FAIA Phone Number: 978-589-5100 Fax Number: 978-589-5103 E-Mail:

  9. Microsoft Word - 2016 NEJC Letterhead[1].docx

    Energy Savers [EERE]

    Guidelines for Submission of Poster Abstracts for the 2016 National Environmental Justice Conference & Training Program and the Ninth Annual National Conference on Health Disparities March 9-12, 2016 Poster Abstract Submission Deadline All poster abstracts MUST be submitted through the abstract submission website by September 30, 2015 (11:59 PM Pacific Standard Time). The abstract submission website is located at: ***Abstracts sent by mail, FAX, or via


    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    CERTIFIED REALTY SPECIALIST Biographical Data Name Organization Office Address Telephone Number Fax Number e-mail address Certification Current Certification Level Date Certified Expiration Date Courses Taken For Certification: Course Provider Date Completed Federal Real Property Leasing Federal Real Property Lease Law Techniques of Negotiation of Federal Property Leases Cost and Price Analysis of Lease Proposals Lease Administration Real Estate Management and Disposal Real Estate Acquisition

  11. Vehicle Technologies Office: Organization and Contacts | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Organization and Contacts Vehicle Technologies Office: Organization and Contacts Vehicle Technologies Office: Organization and Contacts General Information Vehicle Technologies Office Telephone: (202) 586-8055 Fax: (202) 586-7409 Mailing Address: EE-3V Room 5G-030 1000 Independence Ave, SW Washington, DC 20585 Program Contacts Acting Director Christy Cooper Operations Supervisor Christy Cooper Analysis Jacob Ward

  12. Janos Kirz

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Janos Kirz Print Scientific Advisor, Advanced Light Source, Ernest Orlando Lawrence Berkeley National Laboratory and Distinguished Professor Emeritus at Stony Brook University. Advanced Light Source Lawrence Berkeley National Laboratory 1 Cyclotron Road, MS 15R0317 Berkeley, CA 94720 USA Tel. (510) 486-5423 Fax (510) 486-4960 Email: This e-mail address is being protected from spambots. You need JavaScript enabled to view it Dr. Janos Kirz was born in Budapest, Hungary. He came to the University

  13. Harry Frank | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Harry Frank Harry Frank Harry Frank Harry Frank Research Affiliate E-mail: Phone: 860.486.2844 Fax: 860.486.6558 Website: University of Connecticut Research Affiliate Dr. Frank's research focus is on carotenoids, a class of biological pigments. This research includes the roles carotenoids play in photosynthesis and how carotenoids carry out those roles. He employs various techniques, including X-ray and electron diffraction, nuclear magnetic resonance (NMR), absorption and

  14. Southwestern Power Administration

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Privacy Notice For statistical purposes only, Southwestern collects the following data: IP addresses of users who visit our Web site Dates of average Web site activity Most viewed web pages on Southwestern's site We use these statistics only for improvement purposes for Southwestern's Web site, not to identify any individual users. We do NOT enable "cookies" on Southwestern's website. Personal information submitted by a user via phone, fax, or e-mail is not distributed to any parties

  15. STEM Education Program Inventory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Issue for STEM Education Program Inventory Title of Program* Requestor Contact Information First Name* Last Name* Phone Number* E-mail* Fax Number Institution Name Program Description* Issue Information Leading Organization* Location of Program / Event Program Address Program Website To select multiple options, press CTRL and click. Type of Program (if Other, enter information in the box to the right.)* Workforce Development Student Programs Public Engagement in Life Long Learning

  16. Microsoft Word - Frontiers_DUAN_12_R.docx

    Office of Scientific and Technical Information (OSTI)

    Ab initio Thermodynamic Approach to Identify Mixed Solid Sorbents for CO2 Capture Technology Yuhua Duan* National Energy Technology Laboratory, United States Department of Energy, Pittsburgh, Pennsylvania 15236, USA Correspondence: Dr. Yuhua Duan, National Energy Technology Laboratory, United States Department of Energy, 626 Cochrans Mill Road, Pittsburgh, PA 15236, USA Tel. 412-386-5771, Fax 412-386-5990. E-mail: Keywords: CO2 capture, mixed solid sorbent, ab initio

  17. Thomas Moore | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Thomas Moore Thomas Moore Thomas Moore Thomas Moore Scientific Advisory Committee Chair E-mail: Phone: 480.965.3308 Fax: 480.965.2747 Website: Arizona State University Chair - Scientific Advisory Committee Dr. Moore's research interests are the design and assembly of bio-designed constructs for solar energy conversion, catalysis and signal transduction. His work includes the incorporation of artificial antennas and reaction centers into model biological membranes to make solar

  18. Alvin A. Taylor Director Robert D. Perry

    Energy Savers [EERE]

    Alvin A. Taylor Director Robert D. Perry Director, Office of Environmental Programs South Carolina Department of Natural Resources 1000 Assembly Street Suite 336 PO Box 167 Columbia, SC 29202 803.734.4199 Office 803.734.9809 Fax September 27, 2013 Julie A. Smith Office of Electricity Delivery and Energy Reliability Mail Code: OE-20 U.S. Department of Energy 1000 Independence Avenue SW. Washington, DC 20585 REF: Request for Information (RFI) Improving Performance of Federal

  19. LANSCE | Users | LUG | LUG EC

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Registration Full Name: First: Middle: Last: Country of Birth: U.S. Citizen? Yes No: (LANL foreign nationals may register at anytime.) Citizenship: E-Mail: Phone: (include area code) FAX: Name of Institution Address: Address 2 (optional): City: State Country: Zipcode: Please choose the workshop topics you are interested in: Workshop Topics.pdf New Directions in Local Structure Research Neutron Radiography Capability Nuclear Sciences Material Dynamics Will you be giving an invited presentation?

  20. Devens Gust | Center for Bio-Inspired Solar Fuel Production

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Principal Investigators Postdoctoral Fellows Center researchers Graduate Students Undergraduate Students All Bisfuel Center Personnel Ana Moore Anne Jones Devens Gust Don Seo Giovanna Ghirlanda Hao Yan James Allen Kevin Redding Petra Fromme Thomas Moore Yan Liu Devens Gust Director of the Center Principal Investigator Phone: 480-965-4547 Fax: 480-965-5927 E-mail: Regents' Professor Devens Gust contributes to the EFRC in the areas of management and research. In management, Dr. Gust

  1. Director's Office

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Director's Office Print Roger Falcone Director, Advanced Light Source, Ernest Orlando Lawrence Berkeley National Laboratory and Professor of Physics, University of California, Berkeley. Roger Falcone Web page at the University of California, Berkeley Advanced Light Source Lawrence Berkeley National Laboratory 1 Cyclotron Road, MS 80R0114 Berkeley, CA 94720 USA Tel. (510) 486-6692 Fax (510) 486-4960 Email: This e-mail address is being protected from spambots. You need JavaScript enabled to view

  2. Director's Office

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Director's Office Print Roger Falcone Director, Advanced Light Source, Ernest Orlando Lawrence Berkeley National Laboratory and Professor of Physics, University of California, Berkeley. Roger Falcone Web page at the University of California, Berkeley Advanced Light Source Lawrence Berkeley National Laboratory 1 Cyclotron Road, MS 80R0114 Berkeley, CA 94720 USA Tel. (510) 486-6692 Fax (510) 486-4960 Email: This e-mail address is being protected from spambots. You need JavaScript enabled to view

  3. Elizabeth Bautista

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Elizabeth Bautista Elizabeth Bautista ejb-headshot.jpg Elizabeth J. Bautista Group Lead Operations Technology Group Phone: (510) 486-7454 Fax: (510) 486-4316 1 Cyclotron Road Mail Stop 943R0256 Berkeley, CA 94720 Biographical Sketch Elizabeth Bautista is Group Lead for the Operations Technology Group, the team that ensures the accessibility, reliability, security and connectivity of NERSC and ESnet (ESnet by providing a central location for problem

  4. Microsoft Word - S06970_2010PC

    Office of Legacy Management (LM)

    and Monitoring Report for Corrective Action Unit 417: Central Nevada Test Area Surface, Hot Creek Valley, Nevada October 2010 Approved for public release; further dissemination unlimited LMS/CNT/S06970 Available for sale to the public from: U.S. Department of Commerce National Technical Information Service 5301 Shawnee Road Alexandria, VA 22312 Telephone: 800.553.6847 Fax: 703.605.6900 E-mail: Online Ordering: Available electronically

  5. Microsoft Word - S07053_PCMP

    Office of Legacy Management (LM)

    Monitoring and Inspection Plan for Amchitka Island Mud Pit Release Sites, Well Abandonment, and Infantry Road Repair Amchitka, Alaska March 2011 Approved for public release; further dissemination unlimited LMS/AMC/S07053 Available for sale to the public from: U.S. Department of Commerce National Technical Information Service 5301 Shawnee Road Alexandria, VA 22312 Telephone: 800.553.6847 Fax: 703.605.6900 E-mail: Online Ordering:

  6. Ryszard Jankowiak | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Ryszard Jankowiak Ryszard Jankowiak Ryszard Jankowiak Ryszard Jankowiak Research Affiliate E-mail: Phone: 785.532.6785 Fax: 785.532.6666 Website: Kansas State University Research Affiliate Dr. Jankowiak's photosynthesis research centers on photosynthetic reaction centers and photosynthetic antenna pigment complexes in green plants, green algae, and photosynthetic bacteria. Techniques employed include solid-state low temperature (laser-based) spectroscopies. His long-term goal is

  7. Notices

    Energy Savers [EERE]

    8852 Federal Register / Vol. 81, No. 63 / Friday, April 1, 2016 / Notices and Media Programs Division, Office of Compliance, Mail Code 2227A, Environmental Protection Agency, 1200 Pennsylvania Ave. NW., Washington, DC 20460; telephone number: (202) 564-2970; fax number: (202) 564-0050; email address: SUPPLEMENTARY INFORMATION: Supporting documents which explain in detail the information that the EPA will be collecting are available in the public docket for this ICR. The


    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    STRUCTURED OPTIMIZATION FOR PARAMETER SELECTION OF FREQUENCY-WATT GRID SUPPORT FUNCTIONS FOR WIDE-AREA DAMPING Jason Neely, Jay Johnson , Raymond Byrne, Ryan T. Elliott Sandia National Laboratories P.O. Box 5800 MS1033, Albuquerque, NM, USA 87185 Phone 1-505-845-7677, Fax 1-505-284-6078 E-mail: Keywords: distributed energy resources, advanced grid functions, wide-area damp- ing, inter-area oscillations, energy storage applications ABSTRACT Deployment of distributed renewable

  9. Tapashree Roy | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Tapashree Roy Postdoctoral Appointee (Supervisor, Daniel Lopez) Present research focusses on designing re-configurable nano-photonic devices for high impact applications in science and techonologies. Other interested areas of research include metamaterials, plasmonics, super-resolution microscopy, physics and engineering of super-oscillations and nano-fabrication. Telephone 630.252.4515 Fax 630.252.5739 E-mail CV/Resume PDF icon Tapashree_Roy.pdf

  10. Greg Butler

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Greg Butler Greg Butler Greg-Butler_2.jpg Gregory (Greg) F. Butler Storage Systems Group National Energy Research Scientific Computing Center Phone: (510) 486-8691 Fax: (510) 486-4316 Lawrence Berkeley National Laboratory 1 Cyclotron Road Mail Stop 943-256 Berkeley, CA 94720 US Biographical Sketch Greg Butler has over 35 years experience in the computing field, with over 25 years experience in high performance scientific computing at DOE, DOD, and US EPA installations. His

  11. SUSANA MARTINEZ Governor JOHN A SANCHEZ Lieutenant Governor

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    February 26, 2016 State of New Mexico ENVIRONMENT DEPARTMENT Harold Runnels Building 1190 Saint Francis Drive, PO Box 5469 Santa Fe, NM 87502-5469 Telephone (505) 827-2855 Fax (505) 827-2836 www CERTIFIED MAIL - RETURN RECEIPT REQUESTED RYAN FLYNN Cabinet Secretary BUTCHTONGATE Deputy Secretary Todd A. Shrader, Manager Carlsbad Field Office Department of Energy Philip J. Breidenbach, Project Manager Nuclear Waste Partnership, LLC P. 0. Box 2078 P. 0. Box 3090 Carlsbad, New Mexico

  12. SUSANA MARTINEZ Governor JOHN A. SANCHEZ Lieutenant Governor

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    , 2013 NEW MEXICO ENVIRONMENT DEPARTMENT Office of the Secretary Harold Runnels Building 1190 Saint Francis Drive (87505) PO Box 5469, Santa Fe, NM 87502-5469 Phone (505) 827-2990 Fax (505) 827-1628 CERTIFIED MAIL - RETURN RECEIPT REQUESTED RYAN FLYNN Cabinet Secretary - Designate BUTCH TONGATE Deputy Secretary Jose R. Franco, Manager Carlsbad Field Office Department of Energy M. Farok Sharif, Project Manager Nuclear Waste Partnership LLC P. O. Box 2078 P. O. Box 3090

  13. Microsoft Word - Scott-CV2013Sept.docx

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    November 2013 David E. Scott Savannah River Ecology Laboratory, P.O. Drawer E, Aiken, S.C. 29802 Phone: 803-725-5747 E-mail: Fax: 803-725-3309 Education: 1979-1983 MS (Environmental Sciences) University of Virginia, Charlottesville, Virginia. 1973-1977 BS (Biology), Phi Beta Kappa, Magna cum laude Wofford College, Spartanburg, South Carolina. Employment: * 1984-present Research assistant in the herpetology program at SREL. Research responsibilities include the design and

  14. Microsoft Word - foi 2009-0042 REQUEST.docx

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    20090513112125 Name: Richard I Smith Organization: Hanford Advisory Board Address: Country: United States Phone Number: Fax Number: NA E-mail: Reasonably Describe Records Description: RPP-21852 Hanford Shipping Facility Feasibility Study Optional Information Describe Yourself: An individual seeking information for personal use and not for commercial use. Cost Information: I request a waiver or reduction of fees. Waiver Request: The subject of the request: Whether the subject of the requested

  15. Request a Quote | The Ames Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Request a Quote Please read our Terms & Conditions before submitting. Title * - Select - Dr Mr Mrs Ms First Name * Last Name * Company/Organization Name * City State Zip Code Country * E-mail Address * Telephone Number * Fax Number To better assist you in fulfilling your material requests please include the flowing details in your request: (1) Mass or quantity required. (2) Composition and basis (i.e. is the request in weight% or atomic%). (3) Any geometrical specifications, or form, such as

  16. 1

    Office of Legacy Management (LM)

    Natural Gas, Produced Water, and Hydrologic Sampling and Analysis Results for 2014 December 2014 Approved for public release; further dissemination unlimited LMS/GSB/S12349 Available for sale to the public from: U.S. Department of Commerce National Technical Information Service 5301 Shawnee Road Alexandria, VA 22312 Telephone: 800.553.6847 Fax: 703.605.6900 E-mail: Online Ordering: Available electronically at

  17. 1

    Office of Legacy Management (LM)

    Monitoring Report Project Shoal Area Subsurface Corrective Action Unit 447 February 2014 Approved for public release; further dissemination unlimited LMS/SHL/S11217 Available for sale to the public from: U.S. Department of Commerce National Technical Information Service 5301 Shawnee Road Alexandria, VA 22312 Telephone: 800.553.6847 Fax: 703.605.6900 E-mail: Online Ordering: Available electronically at

  18. 2014 Well Completion Report for Corrective Action Unit 447 Project Shoal Area Churchill County, Nevada

    Office of Legacy Management (LM)

    Well Completion Report for Corrective Action Unit 447 Project Shoal Area Churchill County, Nevada November 2015 Approved for public release; further dissemination unlimited LMS/SHL/S12297 Available for sale to the public from: U.S. Department of Commerce National Technical Information Service 5301 Shawnee Road Alexandria, VA 22312 Telephone: 800.553.6847 Fax: 703.605.6900 E-mail: Online Ordering: Available electronically at

  19. 2015 Groundwater Monitoring Report Project Shoal Area Subsurface Corrective Action Unit 447

    Office of Legacy Management (LM)

    Groundwater Monitoring Report Project Shoal Area: Subsurface Corrective Action Unit 447 April 2016 Approved for public release; further dissemination unlimited LMS/SHL/S13448 Available for sale to the public from: U.S. Department of Commerce National Technical Information Service 5301 Shawnee Road Alexandria, VA 22312 Telephone: 800.553.6847 Fax: 703.605.6900 E-mail: Online Ordering: Available electronically at

  20. Field-Based Site Characterization Technologies Short Course Presented by the U.S. Environmental Protection Agency's Technology Innovation Office

    Office of Environmental Management (EM)

    Ferrin Moore Title: Senior Aviation Policy Officer Organization: Office of Aviation Management/MA-30 Address: Headquarters, United States Department of Energy 1000 Independence Avenue S.W. Washington, D.C. 20585 E-mail Address: Phone Number: Office: (202) 586-6171, Mobile: Fax Number: (202) 586-6008 Biographical Summary: Ferrin Moore is a highly experience aviation manager and leader with 30 years of aviation experience in the private and government sector. Prior to


    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    ROBERT ALAN KENNAMER The University of Georgia Office Phone: (803) 725-0387 Savannah River Ecology Laboratory FAX: (803) 725-3309 P.O. Drawer E, Aiken, SC 29802 E-mail: Interests Avian Ecology, Population Ecology, Human-Wildlife Conflicts, Global Climate Change Biological Effects, Environmental Contaminants and Risk Assessment Experience Research Professional I, University of Georgia's Savannah River Ecology Lab - 2005- Activities at the Savannah River Ecology Lab include:

  2. Ralu Divan | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Ralu Divan Chemist Ph.D., University of Bucharest, Romania Research interests are in the lithographic properties and chemistry of materials, characterizing interfacial and compatibility properties of materials used in MEMS and NEMS, nanogels, and metal nanoparticles synthesis. News Traveling Electrons in Loosely Bound Layers Telephone 630.252.0146 Fax 630.252.5739 E-mail CV/Resume PDF icon Dr Divan 2014

  3. Request Number:

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    3023307 Name: Madeleine Brown Organization: nJa Address: --- -------- -------- -- Country: Phone Number: United States Fax Number: n/a E-mail: --- -------- --------_._------ --- Reasonably Describe Records Description: Please send me a copy of the emails and records relating to the decision to allow the underage son of Bill Gates to tour Hanford in June 2010. Please also send the emails and records that justify the Department of Energy to prevent other minors from visiting B Reactor. Optional

  4. Request Number:

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    1074438 Name: Gayle Cooper Organization: nla Address: _ Country: United States Phone Number: Fax Number: nla E-mail: . ~===--------- Reasonably Describe Records Description: Information pertaining to the Department of Energy's cost estimate for reinstating pension benefit service years to the Enterprise Company (ENCO) employees who are active plan participants in the Hanford Site Pension Plan. This cost estimate was an outcome of the DOE's Worker Town Hall Meetings held on September 17-18, 2009.

  5. Michael Sternberg | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Michael Sternberg Senior Scientific Associate Ph.D., University of Paderborn, Germany Research focus is in the integration of various modeling programs, to enable researchers to combine the strengths of each approach to allow solving more complex problems Responsibility for the high-performance computing systems at the center Telephone 630.252.4631 Fax 630.252.4646 E-mail CV/Resume PDF icon sternberg

  6. Janos Kirz

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Janos Kirz Print Scientific Advisor, Advanced Light Source, Ernest Orlando Lawrence Berkeley National Laboratory and Distinguished Professor Emeritus at Stony Brook University. Advanced Light Source Lawrence Berkeley National Laboratory 1 Cyclotron Road, MS 15R0317 Berkeley, CA 94720 USA Tel. (510) 486-5423 Fax (510) 486-4960 Email: This e-mail address is being protected from spambots. You need JavaScript enabled to view it Dr. Janos Kirz was born in Budapest, Hungary. He came to the University

  7. Jeff Broughton

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Jeff Broughton Jeff Broughton Portrait Jeff Broughton Deputy for Operations and Systems Department Head Phone: (510) 486-5972 Fax: (510) 486-4316 1 Cyclotron Road Mail Stop 943-256 Berkeley, CA 94720 US Biographical Sketch Jeff Broughton is the NERSC Deputy for Operations and Systems Department Head, and has responsibility for acquiring, installing and operating all computational, networking and storage equipment for NERSC and the Joint Genome Institute. Current projects

  8. Jerilyn Timlin | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Jerilyn Timlin Jerilyn Timlin Jerilyn Timlin Jerilyn Timlin Principal Investigator E-mail: Phone: 505.844.7932 Fax: 505.284.3775 Principal Investigator and Themes 1 & 2 Member Dr. Timlin visualizes the photosystem components in natural and biohybrid antenna systems using hyperspectral confocal fluorescence microscopy and multivariate curve resolution analysis. Principal Member of the Technical Staff, Bioenergy and Defense Technologies Department Bio 10/02/11:: Young

  9. Katie Antypas

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Katie Antypas Katie Antypas setheight-Antypas.jpg Katie Antypas Scientific Computing and Data Services Department Head Phone: (510) 486-5575 Fax: (510) 486-4316 1 Cyclotron Road Mail Stop 943R0256 Berkeley, CA 94720 US Biographical Sketch As the department head of Scientific Computing and Data Services at the National Energy Research Scientific Computing (NERSC) Center, Katie has oversight of the Data Science Engagement, Data and Analytics Services, Storage Systems, and

  10. Annette Greiner

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Annette Greiner Annette Greiner Annette-Greiner-2 Annette M. Greiner Web Application Developer Data & Analytics Services Phone: (510) 495-2935 Fax: (510) 486-4316 Web: 1 Cyclotron Road Mail Stop 943-256 Berkeley, CA 94720 Biographical Sketch Annette Greiner is a user interface designer and web developer with particular interest in interaction design and visualization. She earned a Master's in Information Management and Systems from UC Berkeley's

  11. *Permanent Resident Alien: Yes No

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    First Name: *Middle: *Last: *Gender (circle one): Male Female Is Visitor currently in the US? Yes No *Permanent Resident Alien: Yes No *Country of Citizenship: *Date of Birth (mm/dd/yyyy): *Country of Birth: *City of Birth: Affiliation or Company Info: *Institution or Company Name: Phone Number: Street (1): Fax Number: Street (2): E-mail Address: City: State: Zip Code: *Country of Employer: *Title or Position and Duties: First Name: Middle: Last: First Name: Middle: Last: First Name: Middle:

  12. Director's Office

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Director's Office Director's Office Print Roger Falcone Director, Advanced Light Source, Ernest Orlando Lawrence Berkeley National Laboratory and Professor of Physics, University of California, Berkeley. Roger Falcone Web page at the University of California, Berkeley Advanced Light Source Lawrence Berkeley National Laboratory 1 Cyclotron Road, MS 80R0114 Berkeley, CA 94720 USA Tel. (510) 486-6692 Fax (510) 486-4960 Email: This e-mail address is being protected from spambots. You need JavaScript

  13. Microsoft Word - FOI 2010-00205 REQUEST.docx

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Administration: Electronic FOIA Request Detail Thank you for your Freedom of Information Act Information Request. Within the next four weeks we will notify you of either how long the search will take to complete or the availability of the information you requested. Name: Brian D. Zeringer Organization: Lane Powell PC Address: 1420 Fifth Avenue, Suite 4100 Seattle, WA 98101 Country: United States Phone Number: 206-223-7073 Fax Number: 206-223-7107 E-mail: Reasonably

  14. Microsoft Word - FOI 2010-0047.REQUEST.docx

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    20090930114348 Name: Steven Burnum Organization: DOE-RL Address: 825 Jadwin Ave/MS A3-04 Richland, WA 99352 Country: United States Phone Number: 509.376.8409 Fax Number: n/a E-mail: Reasonably Describe Records Description: Requesting all information regarding RL's implementation of the new STRIPES system, including training to staff and related organization assignments and individucal position assignments. Optional Information Describe Yourself: An individual seeking

  15. Microsoft Word - Incoming FOI from Grando dated July 23 2015.pdf

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Request Detail Page 1 of 2 Freedom Of Information Act Electronic FOIA Request Detail Request Number: 20150723101304808 Name: Carl Grando Organization: Mr. Address: Country: United States Phone Number: Fax Number: n/a E-mail: Reasonably Describe Records: Description: A copy of the original Award #DE-FG06-94RL12917, to TRIDEC and the modifications to date excluding mod #39 which I already have a copy of. Optional Information: Describe Yourself: An individual seeking information for personal use

  16. Stefan Vajda | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Stefan Vajda Chemist Ph.D., Charles University, Prague Research interest is in the area of physical and chemical properties of size-selected clusters and materials assembled of clusters Adjunct professor, Yale University News Copper clusters capture and convert carbon dioxide to make fuel Telephone 630.252.8123 Fax 630.252.4954 E-mail CV/Resume PDF icon Vajda, Stefan - Bio - 2-9-16

  17. Stephen Gray | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Stephen Gray Group Leader, Theory & Modeling Ph.D., University of California-Berkeley Research activities include the theory and modeling of dynamical processes in nanosystems with particular emphasis on modeling light interactions with metallic nanostructures via rigorous electrodynamics simulations and the quantum dynamics of molecular systems within nanoscale environments. News Shape-shifting nanorods release heat differently Telephone 630.252.3594 Fax 630.252.4646 E-mail

  18. Microsoft Word - S05827_WCR_Final.doc

    Office of Legacy Management (LM)

    Well Completion Report for Corrective Action Unit 443 Central Nevada Test Area Nye County, Nevada December 2009 Approved for public release; further dissemination unlimited LMS/CNT/S05827 Available for sale to the public from: U.S. Department of Commerce National Technical Information Service 5301 Shawnee Road Alexandria, VA 22312 Telephone: 800.553.6847 Fax: 703.605.6900 E-mail: Online Ordering: Available electronically at

  19. Microsoft Word - S07896_GW_MR

    Office of Legacy Management (LM)

    11 Groundwater Monitoring Report, Central Nevada Test Area, Subsurface Corrective Action Unit 443 April 2012 Approved for public release; further dissemination unlimited LMS/CNT/S07896 Available for sale to the public from: U.S. Department of Commerce National Technical Information Service 5301 Shawnee Road Alexandria, VA 22312 Telephone: 800.553.6847 Fax: 703.605.6900 E-mail: Online Ordering: Available electronically at

  20. Microsoft Word - S10873_WCR.docx

    Office of Legacy Management (LM)

    3 Well Completion Report for Corrective Action Unit 443 Central Nevada Test Area Nye County, Nevada June 2014 Approved for public release; further dissemination unlimited LMS/CNT/S10873 Available for sale to the public from: U.S. Department of Commerce National Technical Information Service 5301 Shawnee Road Alexandria, VA 22312 Telephone: 800.553.6847 Fax: 703.605.6900 E-mail: Online Ordering: Available electronically at

  1. ForA Request Detail Page

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    ForA Request Detail Page 1 of2 Freedom Of Information Act Electronic FOIA Request Detail Request Number: Name: Organization: Address: Country: Phone Number: Fax Number: E-mail: 20121203070924543 Karen Troutman Dewey Publications Inc. 1840 Wilson Blvd. Suite 203 Arlington, VA 22201 United States 703-524-1355 703-524-1463 Reasonably Describe Records: Description: Pursuant to the Freedom of Information Act, you are requested to provide the name and email address

  2. Valentina Kutepova | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Valentina Kutepova Cleanroom Manager Ph.D., Moscow Tech University, Russia 30 years experience in research and professional engineering development in the field of advanced technologies for thin-film growth and microelectronic devices fabrication and characterization. Numerous innovations in both materials and devices development, and utilization of research results. Telephone 630.252.4290 Fax 630.252.5739 E-mail CV/Resume PDF icon kutepova.pdf

  3. Scott Campbell

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Operations Technology Storage Systems User Engagement Application Performance NESAP Postdocs Org Chart NERSC History NERSC Stakeholders Usage and User Demographics Careers Visitor Info Web Policies Home » About » Staff » Networking & Security » Scott Campbell Scott Campbell scampbell.jpg Scott Campbell Security Team Networking, Servers and Security Group Phone: (510) 486-6986 Fax: (510) 486-4316 1 Cyclotron Road Mail Stop 943R0256 Berkeley, CA 94720 US Biographical

  4. Staff Directory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Staff Directory Principal Investigator hubert-125 Hubert Ley, TRACC Director Phone: 630-252-8224; Fax: 630-252-5394; E-mail: This email address is being protected from spambots. You need JavaScript enabled to view it. Ph.D. and Masters, Nuclear Engineering, Rheinisch-Westfaelische Technische Hochschule, Aachen, Germany More than 20 years' experience in simulation, modeling, high-performance computing, and visualization Served on Argonne's International Nuclear Safety team, participating in

  5. Tatas Brotosudarmo | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Tatas Brotosudarmo Tatas Brotosudarmo Tatas Brotosudarmo Tatas Brotosudarmo Research Affiliate E-mail: Phone: 62-341-550 171 Fax: 62-341-550 175 Website: Ma Chung University Research Affiliate Dr. Brotosudarmo's research focuses on understanding the basic principle of natural light harvesting antenna complexes in solar energy collection and energy funneling. In 2010, Dr. Brotosudarmo worked on PARC projects as a postdoctoral associate in the Cogdell lab before

  6. Christine Kirmaier | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Christine Kirmaier Christine Kirmaier Christine Kirmaier Christine Kirmaier Principal Investigator E-mail: Phone: 314.935.6480 Fax: 314.935.4481 Website: Washington University in St. Louis Principal Investigator and Theme 3 Member Dr. Kirmaier's research specialties include electron transfer and energy transfer properties of porphyrin arrays with applications in molecular photonics; optical spectroscopy; primary photochemical processes of photosynthesis; solar energy and

  7. Christopher Daley

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Christopher Daley Christopher Daley ChrisDaleyPic2014 Christopher Steven Daley HPC Performance Engineer Advanced Technology Group Phone: +1 510 486 4504 Fax: +1 510 486 4316 National Energy Research Scientific Computing Center 1 Cyclotron Rd Mail Stop 59R4010A (office 59-3072B) Berkeley, California 94720 US Biographical Sketch Chris Daley is a member of the Advanced Technology Group (ATG). Before joining ATG, Chris was a Scientific Programmer at the Flash Center for Computational

  8. David Bocian | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    David Bocian David Bocian David Bocian David Bocian Principal Investigator E-mail: Phone: 951.827.3660 Fax: 951.827.4713 Office: Chemical Sciences 1 230 Website: University of California, Riverside Theme 3 Member Dr. Bocian conducts vibrational, electron paramagnetic resonance, electrochemical, and computational studies on tetrapyrrolic cofactors, synthetic light-harvesting assemblies, and natural photosynthetic antennas. Distinguished Professor of Chemistry and Vice Provost

  9. SWEAChapter1

    National Nuclear Security Administration (NNSA)

    COVER SHEET RESPONSIBLE AGENCY: National Nuclear Security Administration (NNSA) TITLE: Final Site-Wide Environmental Assessment (SWEA) for Sandia National Laboratories/California (DOE/EA-1422) CONTACT: For further information concerning the Draft Site-Wide Environmental Assessment (SWEA), contact: Susan Lacy, NEPA Document Manager NNSA, Sandia Site Office P.O. Box 5400, Albuquerque, NM 87185 Telephone: 1-505-845-5542, Fax: 505-845-4710 For further information by way of electronic mail, contact:

  10. FY2002 SSRLUO Executive Committee

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    SSRL USERS' ORGANIZATION 2002 EXECUTIVE COMMITTEE ENVIRONMENTAL/GEOSCIENCES Satish Myneni Princeton University Geoscience 151 Guyot Hall Princeton, NJ 08544 Phone: 609-258-5848 E-mail: Nicholas Pingitore University of Texas at El Paso Environmental & Geosciences El Paso, TX 79968-0555 Phone: 915-747-5754 Fax: 915-747-5073 E-mail: MACROMOLECULAR CRYSTALLOGRAPHY Paul Foster(ex-officio) UCSF/Exelixis Biophysics Box 0448 San Francisco, CA 94143 Phone:

  11. Womens.PDF

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Concerns Related to Radiation Exposure of the Female Nuclear Medicine Patient Michael G. Stabin Radiation Internal Dose Information Center Oak Ridge Institute for Science and Education P.O. Box 117, Oak Ridge, TN 37831-0117, USA Send all correspondence to the attention of: Michael G. Stabin, Ph.D., CHP same address as above, or, for express mail: Oak Ridge Institute for Science and Education 230 Warehouse Road, Building 1916-T2 Oak Ridge, TN 37830, USA Phone 423-576-3449 Fax 423-576-8673 E-mail

  12. Contact Us | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Contact Us Contact Us For information about the Office of Congressional & Intergovernmental Affairs at the Department of Energy; for assistance in locating information on the web site: By Mail: U.S. Department of Energy 1000 Independence Ave., SW Washington, DC 20585 By Phone: 1-202-586-5450 1-800-dial-DOE (1-800-342-5363) By Fax: 202-586-4891 By E-mail: You can send an email to the Webmaster at For Hearing and/or Speech Impaired: Telephone Communication Public

  13. Valley Forge Corporate Center

    Energy Savers [EERE]

    55 Jefferson Ave. Valley Forge Corporate Center Norristown, PA 19403-2497 Pauline Foley Assistant General Counsel 610.666.8248 | Fax - 610.666.8211 October 30, 2013 Via Electronic Mail: Julie A. Smith Office of Electricity Delivery and Energy Reliability Mail Code: OE-20 U.S. Department of Energy 1000 Independence Avenue, SW Washington, D.C. 20585 Re: Department of Energy - Improving Performance of Federal Permitting and

  14. Fermilab Cultural Events in Chicago's Far West Side

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    General Information Fermilab Arts & Lecture Series Kirk Road & Pine Street, P.O. Box 500, MS 111, Batavia, IL 60510 - 0500 Phone: Voice - 630.840.ARTS(2787), Fax - 630.840.5501 E-Mail: Tickets are sold on a first-come, first-served basis. Tickets may be charged on MasterCard, Visa, or Discover or paid for by check. Mail Order. Send a check (payable to Fermilab) or charge authorization with a self-addressed, stamped envelope to Fermilab Arts Series, P.O. Box 500, MS111,

  15. Vehicle Technologies Office Fall 2015 Quarterly Analysis Review |

    Office of Environmental Management (EM)

    55 Jefferson Ave. Valley Forge Corporate Center Norristown, PA 19403-2497 Pauline Foley Assistant General Counsel 610.666.8248 | Fax - 610.666.8211 October 30, 2013 Via Electronic Mail: Julie A. Smith Office of Electricity Delivery and Energy Reliability Mail Code: OE-20 U.S. Department of Energy 1000 Independence Avenue, SW Washington, D.C. 20585 Re: Department of Energy - Improving Performance of Federal Permitting and

  16. NMMSS News nov 2012.cdr

    National Nuclear Security Administration (NNSA)

    SAMS 8 Crosswalk to SAMS D-2/D-3 Updates Training Courses NMMSS Germantown Operations NMMSS Team Members NMMSS Due Dates 2012 NMMSS Calendar NMMSS Mailing Addresses SAMS 8, the most current version is available upon request. If you would like a copy of this software please request by E-Mail (, FAX (301-903-1998) or phone Greg Perry at (301-903-3656). Please provide the name and address of the person it is to be sent to as well as the RIS ID. November 2012 NMMSS 2012 Meeting

  17. S A N D I A N A T I O N A L L A B O R A T O R I E S * R

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    S A N D I A N A T I O N A L L A B O R A T O R I E S * R & D 1 0 0 2 0 1 1 Submitting Organization Organization Name: Sandia National Laboratories Contact Name of individual submitting this entry: Roy H. Olsson III Address: PO Box 5800 MS1069 City/State: Albuquerque, NM Zip/Postal Code: 87185-1069 Country: USA Phone: (505) 284-6375 Fax: (505) 844-2081 Email: Web URL: Product Information Microresonator Filters and Frequency References Figure 1. Left: At bottom

  18. Atcitty_Ultra-HighSIC_RD100v8.2.indd

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    R & D 1 0 0 * 2 0 1 1 * E N T R Y S U B M I S S I O N 1. DEVELOPER INFORMATION A. Primary submitting organization GeneSiC Semiconductor Inc. Contact Name: Dr. Ranbir Singh Address: 43670 Trade Center Place, Suite 155 City/State: Dulles, VA Zip/Postal Code: 20166 Country: USA Phone: 703-996-8200 x105 Fax: 703-373-6918 Email: Web URL: B. Joint submitters Sandia National Laboratories Describe role of joint submitter in development of technology:

  19. Subscribe Today to E-mail Alerts from GTO

    Broader source: [DOE]

    Sign up today to get the most up-to-date information on Geothermal Technologies Office (GTO)-sponsored webinars and funding announcements as they become available—delivered right to your inbox for free.

  20. Customer Feedback during Development of 1998 MECS: Mail/Electronic...

    U.S. Energy Information Administration (EIA) Indexed Site

    and its composition (by fuel type) in China; - commercial and industrial energy management market data, specifically in software market; - energy consumption in health,...

  1. Data-Driven Mailing Helps Heat Up Untapped Seattle Market

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ... you're probably reaching folks who aren't strong prospects for energy efficiency upgrades. ... Whether it's the age of the home, heating source, or age of the families living there, use ...

  2. Fermilab | Press Room | Subscribe to Press Release mailing list

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Sheets and Brochures Fermilab Today symmetry Photo and Video Archive Resources for ... Employees Researchers, Postdocs and Graduate Students Job Seekers Neighbors...

  3. Mailing Addresses and Information Numbers for Operations, Field...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    of Energy National Nuclear Security Administration ... Rocky Mountain Oilfield Testing Center 907 N. Poplar, ... Contractors News & Blog Data Phonebook Web Policies History

  4. Report Period: EIA ID NUMBER: Appendix A: Mailing Address: Appendix...

    U.S. Energy Information Administration (EIA) Indexed Site

    This report is mandatory under the Federal Energy Administration Act of 1974 (Public Law 93-275). Failure to comply may result in criminal fines, civil penalties and other ...

  5. Mailing Addresses for National Laboratories and Technology Centers...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ... Livermore, CA 94551-0969 925-294-3000 U.S. Department of Energy Savannah River Ecology Laboratory Building 737-A, Drawer E Aiken, SC 29802 803-725-2472 U.S. Department of Energy ...

  6. Minutes from the March 17, 2010 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Printing Agenda Items... Upcoming Congressional Joint Committee on Printing Commercial ... Woodruff also said Headquarters is planning visits to other sites this fiscal year. ...

  7. Video Tutorial for Submitting a 2014 ERCAP Request available

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Video Library The Office of Civil Rights maintains a video library for training and educational needs. The videos are available for use by employees of the NNSA, Site Offices, and Office of Secure Transportation. If you would like to view a video(s), please submit your request via e-mail to (G) EEO Special Emphasis Programs or by telephone at 505-845-5517. Requested video(s) will be sent via postal mail return receipt upon request. Videos are available for loan up to two weeks and should be

  8. Weatherization and Intergovernmental Program Contacts | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy You are here Home » About the Office » Weatherization and Intergovernmental Program Contacts Weatherization and Intergovernmental Program Contacts For information about how the Weatherization and Intergovernmental Programs Office is organized, see the organization chart. You can contact the office by email or via postal delivery at: U.S. Department of Energy Energy Efficiency and Renewable Energy 1000 Independence Ave, SW, Mail Stop EE-2K U.S. Department of Energy Washington, DC

  9. U.S. Postal Service BlueEarth Program - Personal Electronics...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Cleaning Out? Don't Forget to Recycle How Will You Encourage Your Coworkers to Save Energy this Earth Day? Thanks for the New Printer, Santa Now What Do I Do with the Old One?

  10. Golden Field Office Contacts | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Golden Field Office » Golden Field Office Contacts Golden Field Office Contacts On this page you will find address and contact information for the Golden Field Office. Mailing Address U.S. Department of Energy Golden Field Office 15013 Denver West Parkway Golden, Colorado 80401 Main Number: 720-356-1800 Main Fax: 720-356-1750 Media Inquiries For media inquiries, please email the EERE communications team at Golden Field Office Key Contacts Deputy Assistant Secretary For

  11. Neutron and Nuclear Science To/MS: Distribution From/MS: Stephen Wender/H855

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    memorandum Neutron and Nuclear Science To/MS: Distribution From/MS: Stephen Wender/H855 Phone/Fax: 7-1344/5-3705 E-mail: Symbol: LANSCE-NS-14-02 Date: February 4, 2014 Subject: AUTHORIZATIONS AND ASSIGNMENTS I. LANSCE-NS Additional Duty Assignments ALARA Coordinator Ron Nelson Crane Coordinator Gregg Chaparro Facility Coordinator Steve Wender Electrical Safety Officer William Waganaar ES&H Officer Steve Wender Forklift Coordinator Tim Medina Lockout/Tagout Coordinator Ron

  12. Tina Declerck

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Declerck Tina Declerck Tina-DeClerk.jpg Tina M. Declerck Computational Systems Group Phone: (510) 486-7662 Fax: (510) 486-4316 1 Cyclotron Road Mail Stop 943-256 Berkeley, CA 94720 Biographical Sketch Tina Declerck recently returned to the NERSC's Computational Systems Group after working there from 1997 through 2001. In her previous tenure at NERSC she managed the PDSF and Cray J90 SV1 clusters. During her hiatus, she worked at Sistina Software, the company that developed the

  13. Triangle Universities Nuclear Laboratory : 2011

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Main Office June Tirpak, Grants and Contracts Administrator Room 414, TUNL Phone : (919) 660 - 2600 Fax : (919) 660 - 2634 Email : Courier Deliveries Duke University 116 Science Drive TUNL Building, Room 414 Durham, NC 27708 USA Post Office Mail Duke University Physics Department/TUNL P. O. Box 90308 Durham, NC 27708-0308 USA HIGS/New Visitor Matthew Paul, Staff Assistant Room 125, DFELL Phone : (919) 660 - 2681 Email : Director's Office Calvin

  14. WIPP News Release Archives Index

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    WIPP News Release Archives 2006 News Releases 2005 News Releases 2004 News Releases 2003 News Releases 2002 News Releases 2001 News Releases 2000 News Releases 1999 News Releases 1998 News Releases 1997 News Releases 1996 News Releases 1995 News Releases Back to 2007 News Releases If you have any questions regarding the above, contact: Dennis Hurtt, Team Leader Office of Public Affairs DOE, Carlsbad Field Office P.O. Box 3090 Carlsbad, NM 88221-3090 Phone: 505/234-7327 Fax: 505/234-7025 E-mail:

  15. Jakub Pšenčík | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Jakub Pšenčík Jakub Pšenčík Jakub Pšenčík Jakub Pšenčík E-mail: Phone: +420.221.911.627 Fax: +420.221.911.249 Research Affiliate Dr. Pšenčík's research interests include excitation energy transfer and electron transport in the primary events of photosynthesis; function and properties of chlorophylls and carotenoids; structure and function of photosynthetic complexes; and self-assembling pigment aggregates and biomimetic light havesting. Department of

  16. Health Education Specialist/Project Manager Oak Ridge Institute for Science and Education

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    inFormation about the CHRIS faith-based approach to addressing minority health disparities in your community, please contact: rose marie Womble, mSSW Health Education Specialist/Project Manager Oak Ridge Institute for Science and Education P.O. Box 117, MS-37 Oak Ridge, TN 37831-0117 E-mail: Telephone: 865.576.6256 Fax: 865.241.3851 "The beauty of the CHRIS program is that it's tailored to provide information that addresses a wide array of health issues within a

  17. Help Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Los Alamos National Laboratory Advanced Simulation and Computing Menu Events Partnerships Help Center Events Partnerships Help Center Videos Advanced Simulation and Computing Program » Help Center Computing Help Center Help hotlines, hours of operation, training, technical assistance, general information Los Alamos National Laboratory Hours: Monday through Friday, 8:00 a.m. - noon, 1:00-5:00 p.m. Mountain time Telephone: (505) 665-4444 option 3 Fax: (505) 665-6333 E-mail: 24


    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    » ; * * " \ ) I O O l i n O A O U 3 N 3 9 6 6 L I M d v This publication and other Energy Information Administration (EIA) publications may be purchased from the Superintendent of Documents, U.S. Government Printing Office. Telephone orders may be directed to: Superintendent of Documents U.S. Government Printing Office Main Order Desk (202)512-1800 FAX: (202) 512-2250 8 a.m. to 4:30 p.m., eastern time, M-F All mail orders should be directed to: U.S. Government Printing Office P.O. Box

  19. Image

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    MA RTINEZ Governor JOHN A. SANCHEZ Lieutenant Governor NEW MEXICO ENVIRONMENT DEPARTMENT Hazardous Waste Bureau 2905 Rodeo Park Drive East, Building 1 Santa Fe, New Mexico 87505-6303 Phone (505) 476-6000 Fax (505) 476-6030 www.llmellv.Sfale.IlIll.1I s CERTIFIED MAIL - RETURN REC EIPT REQUESTED DAVE MARTIN Secretary BUTCH TONOATE Deputy Secretary May 30, 2012 RECEIVED JUN 1 lOll General M QU. anager's '1tce Jose R. Franco, Manager Carlsbad Field Office Department of Energy P.O. Box 3090 Carl

  20. Image

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    JOH N A. SANCHEZ Lieutenant Governor NEW MEXICO ENVIRONMENT DEPARTMENT Hazardous Waste Bureau 2905 Rodeo Park Drive East, Building 1 Santa Fe, New Mexico 87505*6303 Phone (505) 476*6000 Fax (505) 476*6030 WWW. lUneIl CERTIFI ED MAIL* RETURN RECEIPT R EQUESTED August 24, 20 12 Jose R. Franco, M anager Carl sbad Field Office Departmen t of Energy P.O. Box 3090 Carl sbad, New M ex ico 8822 1 *3090 M. Farok Sharif Washington TRU Solutions LLC P.O. Box 2078 Carlsbad, New Mexico 88221

  1. Image

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    MARTINI:'!, Governor JOHN A SANCHI":Z Lieutenant Governor NEW MEXICO ENVIRONMENT DEPARTMENT Hazardous Waste Bureau 2905 Rodeo Park Drive East, Building 1 Santa Fe, New Mexico 87505-6303 Phone (505) 476-6000 Fax (505) 476-6030 CERTIFIED MAIL - RETURN RECEIPT REQUESTED October 13,2013 Jose R. Franco, Manager Carlsbad Field Office Department of Energy P.O. Box 3090 Carlsbad, New Mexico 88221-3090 M. Farok Sharif, Project Manager Nuclear Waste Partnership LLC P.O. Box 2078

  2. Image

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    SliSANA MARTINEZ Governol' JOHN A. SANCHEZ Lieutenant Governor September 28, 2012 Jose Franco, Manager Carlsbad Field Office Department of Energy P.O. Box 3090 NEW MEXICO ENVIRONMENT DEPARTMENT Resource Protection Division Harold Runnels Building 1190 Saint Francis Drive (87505) P.O. Box 5469, Santa Fe, NM 87502-5469 Phone (505) 827-0419 Fax (505) 827-0310 W\V~V. nnl~X~Y".B!il t C .1}111.1I.::>. CERTIFIED MAIL - RETURN RECEIPT REQUESTED M. Farok Sharif Washington TRU Solutions LLC P.O.

  3. Image

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    MA!n!NEZ Governor JOHN A, SANCHEZ Lieutenant Governor July 29, 2013 Jose Franco, Manager Carlsbad Field Office Department of Energy P.O. Box 3090 NEW MEXICO ENVIRONMENT DEPARTMENT Hazardous Waste Bureau 2905 Rodeo Park Drive East, Building 1 Santa Fe, New Mexico 87505*6303 Phone (505) 476*6000 Fax (505) 476*6030 CERTIFIED MAIL' RETURN RECEIPT REQUESTED M. Farok Sharif, Project Manager Nuclear Waste Partnership LLC P.O. Box 2078 Carlsbad, New Mexico 88221*5608 Carlsbad, New

  4. Image

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Nov, 1. 2011 1: 08PM SUSANA MARTINEZ Go\'crnor lOI'IN A. SANCHEZ Lieutenanl Go\'crnor November 2,201 I NEW MEXICO ENVIRONMENT DEPARTMENT Hazardous Waste Bureau 2905 Rodeo Pal'k DI'ive East, Building 1 Santn Fe, New Mexico 81505-6303 Phone (505) 476*6000 Fax (50S) 476.6030 IVI VIP, "n um l'.,f (flfC.1I m .1IS CERTIFIED MAIL - RETURN RECEIPT REQUESTED Fru:ok Sharif No , 0170 p , 112 DAVE MARTIN SecrelOry BUTCH TONGAn: AC lillg Deputy Sccremry General M 0'" anager', /lIce Edward


    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Lieutenan t Governor NEW MEXICO ENVIRONMENT DEPARTMENT Harold l~unn e l s Buildi ng 11 90 St. francis Drive P.O. Box 5469, Santa Fe, NM 87502-5469 Phone (505) 827-29 18 Fax (505) 82 7-2965 RYAN FL YNN Secretary 13UTCI I TONGATE Deputy Secretary CERTIFIED MAIL- RETU RN RECEIPT REQUESTED July 29, 20 I 4 Jose Franco, Manager U.S. Department of Energy P.O. Box 3090 Carlsbad, NM 88221 RE: Discharge Permit Renewal, DP-831, Waste Isolation Pilot Plant (WlPP) Dear Mr. Franco: The

  6. SciEdbrochure_outsidePRINT

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    NATIONAL ACCELERATOR FACILITY Thomas Je erson National Accelerator Facility (Je erson Lab) is managed by Je erson Science Associates, LLC for the U.S. Department of Energy's O ce of Science WANT TO KNOW MORE? Contact Information: Thomas Je erson National Accelerator Facility O ce of Science Education 628 Hofstadter Road, Suite 6 Newport News, VA 23606 phone: (757) 269-7567 fax: (757) 269-5065 e-mail: ABOUT JEFFERSON LAB Je erson Lab is a U.S. Department of Energy nuclear physics

  7. The Fate of Trees: How Climate Change May Alter Forests Worldwide

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    site. We will let you know what is new through this newsletter. As you will find in this issue, briefs of various alternative fuels information are provided by category. We will also begin an addi- tional service, the AFDC Express. The Express will provide impor- tant information on late-breaking issues via e-mail and fax. If you would like to receive these, you should ensure that the Center has your correct information. For those of you who have finished this editorial of sorts, fear not, it is

  8. PII: S0304-8853(99)00407-2

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Tel.: #001-408-927-2461; fax: #001-408-927-2100. E-mail address: (J. Sto K hr) Journal of Magnetism and Magnetic Materials 200 (1999) 470}497 Exploring the microscopic origin of magnetic anisotropies with X-ray magnetic circular dichroism (XMCD) spectroscopy J. Sto K hr* IBM Research Division, Almaden Research Center, 650 Harry Road, San Jose, CA 95120-6099, USA Received 11 February 1999; received in revised form 13 April 1999 Abstract Symmetry breaking and bonding at


    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    PROJECT MANAGEMENT PLAN Energy and Water in the Western and Texas Interconnects October 15, 2010 WORK PERFORMED UNDER AGREEMENT RC-BM-2010 SUBMITTED BY Sandia National Laboratories PO Box 5800; MS1377 Albuquerque, New Mexico 87185-1377 PRINCIPAL INVESTIGATOR Vincent Tidwell Phone: (505)844-6025 Fax: (505)844-8558 E-mail: SUBMITTED TO U.S. Department of Energy National Energy Technology Laboratory Ray Lopez Raymond.Lopez@NETL.DOE.GOV Sandia National Laboratories is a

  10. dynamic-origin-destination-matrix

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Dynamic Origin-Destination Matrix Estimation in TRANSIMS Using Direction-Guided Parallel Heuristic Search Algorithms Adel W. Sadek, Ph.D. Associate Professor University at Buffalo, The State University of New York 233 Ketter Hall Buffalo, NY 14260 Phone: (716) 645-4367 FAX: (716) 645-3733 E-mail: This email address is being protected from spambots. You need JavaScript enabled to view it. List of Authors ================ Adel W. Sadek, Ph.D. Shan Huang Liya Guo University at Buffalo, The State

  11. FOIA Request - February 2008

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Morris. Alexander From: Sent: To: Subject: Friday, February 01, 2008 11 :50 AM FOIA-Central DOE Headquarters FOIA Request Name:lf~te Win~/senior Writer and Investigative Reporter Organization: Cybercast News Service Address: 325 S. Patrick Street Alexandria, VA 22314 Tel: 703-302-8352 E-Mail: Phone: 7033028352 FAX: Email: Record Description: RE: Freedom of Information Act Request Dear Sir or Madam I am a senior writer and

  12. FOIA Request - May 2008

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Kate S. Keane PIICINB: (202) 434*1641 EMAIL: April 28, 2008 VIA U.S. MAIL Kevin Hagerty Director, FOINP A Division, ME-73 Department of Energy 1000 Independence Ave., SW Washington, DC 20585 Re: Freedom of Information Act Request Dear Mr. Hagerty: perki~ Coie 607 Fourteenth Street N.W. Washington, D.C. 20005-2003 PHONE: 202.628.6600 FAX: 202.4341690 I am writing to request records, regardless of format, medium, or physical characteristics, and

  13. 3610 N. 44th Street, Suite 250, Phoenix, AZ 85018 ● Phone 602-808-2004 ●

    Energy Savers [EERE]

    10 N. 44th Street, Suite 250, Phoenix, AZ 85018 ● Phone 602-808-2004 ● Fax 602-808-2099 ● October 17, 2013 Transmitted via electronic mail to and Subject: SunZia Southwest Transmission Project comments on Department of Energy's August 29, 2013 Federal Register Notice regarding Improving Performance of Federal Permitting and Review of Infrastructure Projects. The following comments are provided to the Department of


    Energy Savers [EERE]

    URANIUM PRODUCERS OF AMERICA 141 EAST PALACE AVENUE, POST OFFICE Box 669, SANTA FE, NEW MEXICO 87504-0669 TELEPHONE(505) 982-4611; FAX (505) 988-2987; WWW.URANJUMPRODUCERSAMERJCA.COM David Henderson U.S. Department of Energy Office of Nuclear Energy Mail Stop NE-52 19901 Germantown Rd. Germantown, MD 20874-1290 April 6, 2015 Re: UP A Response to DOE Notice of Issues for Public Comment on "Excess Uranium Management: Effects of DOE Transfers of Excess Uranium on Domestic Uranium Mining,

  15. DOE - NNSA/NFO -- FOIA Request

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Request NNSA/NFO Language Options U.S. DOE/NNSA - Nevada Field Office FOIA Requests FOIA requests to the U.S. Department of Energy, National Nuclear Security Administration Service Center may be submitted in writing, by fax, or e-mail. You may contact the U.S. Department of Energy, National Nuclear Security Administration Nevada Field Office at the following address: Ms. Carolyn A. Becknell Freedom of Information Act Office NNSA Service Center Office of Public Affairs P.O. Box 5400 Albuquerque,

  16. Dewey Holten | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Dewey Holten Dewey Holten Dewey Holten Associate Director/Theme 3 Leader/Principal Investigator E-mail: Phone: 314.935.6502 Fax: 314.935.4481 Office: Louderman 336 PARC Associate Director, Theme 3 Leader, Themes 2 & 3 Member Dr. Holten uses static and time-resolved optical spectroscopy to study energy transfer rates and mechanisms in synthetic, biohybrid and native light-harvesting architectures. Professor, Department of Chemistry Bio 11/29/11:: Making a light-harvesting

  17. Don Seo | Center for Bio-Inspired Solar Fuel Production

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Ana Moore Anne Jones Devens Gust Don Seo Giovanna Ghirlanda Hao Yan James Allen Kevin Redding Petra Fromme Thomas Moore Yan Liu Don Seo Principal Investigator Subtask 5 Leader Phone: 480-727-7789 Fax: 480-965-2747 E-mail: Professor Don Seo contributes to the EFRC management as a Member of the Executive Committee and a leader of Subtask 5 (Functional nanostructured transparent electrode materials). His research in the Center is focused on two areas: (1) synthetic development of

  18. E

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    6 Marianne B. Hill Sandia National Laboratories P.O. Box 5800, MS-0141 Albuquerque, NM 87185-0141 Phone: (505) 844-9444 Fax: (505) 844-3551 E-mail: Sandia National Laboratories is a multi-program laboratory managed and operated by Sandia Corporation, a wholly owned subsidiary of Lockheed Martin Corporation, for the U.S. Department of Energy's National Nuclear Security Administration under contract DE-AC04-94AL85000. SAND No. SAND2015-10285O Marianne Hill is Acting Vice

  19. E

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    SAND No. 2015-5788 O Jill M. Hruby Sandia National Laboratories P.O. Box 5800, MS-0101 Albuquerque, NM 87185-0101 Phone: (505) 284-2000 Fax: (505) 844-1120 E-mail: Jill Hruby is the director of Sandia National Laboratories and president of Sandia Corporation, a wholly owned subsidiary of Lockheed Martin Corporation, which operates Sandia for the U.S. Department of Energy's National Nuclear Security Administration (NNSA). Sandia has principal sites in Albuquerque, New Mexico,

  20. E

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    December 2015 Leonard M. Napolitano, Jr. Ph.D Sandia National Laboratories P.O. Box 5800, MS-0531 Albuquerque, NM 87185-0531 Phone: (505) 844-3218 Fax: (505) 845-7578 E-mail: Sandia National Laboratories is a multi-program laboratory managed and operated by Sandia Corporation, a wholly owned subsidiary of Lockheed Martin Corporation, for the U.S. Department of Energy's National Nuclear Security Administration under contract DE-AC04-94AL85000. SAND2015-10911 O Dr. Leonard M.

  1. E

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    April 2015 Sandia National Laboratories is a multi-program laboratory managed and operated by Sandia Corporation, a wholly owned subsidiary of Lockheed Martin Corporation, for the U.S. Department of Energy's National Nuclear Security Administration under contract DE-AC04-94AL85000. SAND2015-2452 O Dr. James S. Peery Sandia National Laboratories P.O. Box 5800, MS-1231 Albuquerque, NM 87185-1231 Phone: (505) 845-9490 Fax: (505) 844-6610 E-mail: B I O G R A P H Y Dr. James S.

  2. E

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    January 2016 Jennifer Plummer Sandia National Laboratories P.O. Box 5800, MS-0112 Albuquerque, NM 87185-0112 Phone: (505) 844-9336 Fax: (505) 844-6339 E-mail: Sandia National Laboratories is a multi-program laboratory managed and operated by Sandia Corporation, a wholly owned subsidiary of Lockheed Martin Corporation, for the U.S. Department of Energy's National Nuclear Security Administration under contract DE-AC04-94AL85000. SAND No. 2015-10912 O Jennifer Plummer is Acting

  3. E

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    SAND2015-0118O January 2015 Dr. Gary A. Sanders Sandia National Laboratories P.O. Box 5800, MS-0141 Albuquerque, NM 87185-0141 Phone: (505) 844-6675 Fax: (505) 844-2716 E-mail: Dr. Gary A. Sanders is Vice President of Weapons Engineering and Product Realization and the Chief Engineer for Nuclear Weapons at Sandia National Laboratories, a U.S. Department of Energy (DOE) multi-program engineering and science laboratory located in Albuquerque, New Mexico. He is the executive

  4. E

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    SAND No. SAND2014-16361O August 2014 Michael (Mike) Hazen Sandia National Laboratories P.O. Box 5800, MS-0143 Albuquerque, NM 87185-0143 Phone: (505) 284-3191 Fax: (505) 284-1790 E-mail: Michael Hazen is Vice President of the Infrastructure Operations Division and serves as Chief Security Officer at Sandia National Laboratories (Sandia), a subsidiary of Lockheed Martin Corporation. In September 2007 he assumed his current position with line responsibilities which include

  5. E

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    October 2014 Sandia National Laboratories is a multi-program laboratory managed and operated by Sandia Corporation, a wholly owned subsidiary of Lockheed Martin Corporation, for the U.S. Department of Energy's National Nuclear Security Administration under contract DE-AC04-94AL85000. SAND No. 2014-19755 O Robert W. Leland Sandia National Laboratories P.O. Box 5800, MS-0351 Albuquerque, NM 87185-0351 Phone: (505) 845-8439 Fax: (505) 844-4394 E-mail: B I O G R A P H Y Robert W.

  6. E

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Kimberly (Kim) C. Sawyer Sandia National Laboratories P.O. Box 5800, MS-0109 Albuquerque, NM 87185-0109 Phone: (505) 844-8358 Fax: (505) 844-9611 E-mail: January 2016 Sandia National Laboratories is a multi-program laboratory managed and operated by Sandia Corporation, a wholly owned subsidiary of Lockheed Martin Corporation, for the U.S. Department of Energy's National Nuclear Security Administration under contract DE-AC04-94AL85000. SAND No. 2015-10435O B I O G R A P H Y

  7. E

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    SAND2015-2127 O Dr. Marianne C. Walck Sandia National Laboratories 7011 East Avenue Livermore, CA 94550 Phone: (925) 294-2049 Fax: (925) 294-1516 E-mail: B I O G R A P H Y Dr. Marianne C. Walck California Laboratory & Energy and Climate Sandia National Laboratories Dr. Marianne C. Walck is vice president of Sandia's California laboratory and serves as lead for the Laboratories' Energy and Climate business unit. The California laboratory's principal programs include nuclear

  8. 1998 Annual Facility Representative Workshop Attendees

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    998 Annual Facility Representative Workshop Attendees Last Name First Office Location Phone Fax E-Mail Alvord Bob OAK LLNL (925) 422-0830 (925) 422-0832 Barnes John SR SRTC (803) 208-2628 (803) 208-1123 Bell Fred AL LAAO (505) 665-4856 (505) 665-9230 Bell Bill AL LAAO (505) 665-6324 (505) 665-9230 Bennett Rick RF DOE (303) 966-8155 (303) 966-7447 Biro Brian RL LABS (509) 376-7660 (509) 376-9837

  9. Microsoft Word - S05725_SAP

    Office of Legacy Management (LM)

    Sampling Plan for the Amchitka, Alaska, Site 2011 Sampling Event March 2011 Approved for public release; further dissemination unlimited LMS/AMC/S05725 Available for sale to the public from: U.S. Department of Commerce National Technical Information Service 5301 Shawnee Road Alexandria, VA 22312 Telephone: 800.553.6847 Fax: 703.605.6900 E-mail: Online Ordering: Available electronically at Available for a


    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    MEXICO ENVIRONMENT DEPARTMENT Hazardous Waste Burealt SUSANA MARTINEZ Governor 2905 Rodeo Park Drive East, Building 1 Santa Fe, New Mexico 87505*6303 Phone (50S) 476-6000 Fax (50S) 476-6030 www.lfmenv.stale.nm.IU RYAN FLYNN Cabinet Secretary Designate JOHN A, SANCHr - :Z Lieutenant Governor CERTIFIED MAIL - RETURN RECEIPT REQUESTED SeplelIlber 20, 201 3 Jose Franco, Manager Carlsbad Field Office Department of Energy P.O. Box 3090 Carlsbad, New Mexico 88221-3090 M. Farok Sharif, Project Manager

  11. How Do You Report A Concern? | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    How Do You Report A Concern? DOE/NNSA Federal, contractor and subcontractor employees may report their concerns to the Employee Concerns Program by: Completing the reporting form Faxing your concern to:(505) 845-4020 Mailing your concern to: DOE/NNSA/SC ECP P. O. Box 5400 Albuquerque, NM 87185-5400 Visit your local ECP Office. Sending email to: Calling the ECP 24-Hour Hotline to report your concerns at:1-800-688-5713 Or to make an appointment to meet with someone face to face at

  12. SUSANA MTINEZ Goveror JOH A. SANCHZ Lieutenant Goveror

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    MTINEZ Goveror JOH A. SANCHZ Lieutenant Goveror Februay 6, 2012 NEW MEXICO E�ONMENTDEPARTMENT Hazardous Waste Bureau 2905 Rodeo Park Drive East, Building 1 Santa Fe, New Mexico 87505-6303 Phone (505) 476-6000 Fax (505) 476-60lO y= CERTIFIED MAIL J RTUR RECEIPT REQUESTED M. Faok Sharif DAVE MTIN Secreta BUTCH TONGATE Deputy Secretar Edward Ziemiaski, Acting Maager Carlsbad Field Ofce Depament of Energy Washington TRU Solutions LLC P. O. Box 2078 P. O. Box 3090 Carlsbad,

  13. SUSANA MARTINEZ Governor JOHN A SANCHEZ Lieutenant Governor

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    . Hazardous Waste Bureau 2905 Rodeo Park Drive East, Building 1 Santa Fe, New Mexico 87505-6303 Phone (505) 476-6000 Fax (505) 476-6030 CERTIFIED MAIL - RETURN RECEIPT REQUESTED December 17, 2012 DAVEMARTlN Secretary BUTCH TONGATE Deputy Secretary JAMES H. DAVIS, Ph.D. Division Director Jose R. Franco, Manager Carlsbad Field Office Department of Energy M. Farok Sharif, General Manager Nuclear Waste Partnership LLC P. O. Box 2078 P. O. Box 3090 Carlsbad, New Mexico

  14. SUSANA MARTINEZ Governor JOHN A SANCHEZ Lieutenant Governor

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    28, 2011 NEW MEXICO ENVIRONMENT DEPARTMENT Water and Waste Management Division Harold Runnels Building 1190 St. Francis Drive, Santa Fe, NM 87505 Phone (505) 827-1758 Fax (505) 827-2836 CERTIFIED MAIL - RETURN RECEIPT REQUESTED Edward Ziemianski, Acting Manager Carlsbad Field Office M. Farok Sharif Washington TRU Solutions LLC P.O. Box 2078 Department of Energy P.O. Box 3090 Carlsbad, New Mexico 88221-5608 Carlsbad, New Mexico 88221-3090 RE: NOTICE OF EXTENSION FOR CLASS 2

  15. SUSANA MARTINEZ Governor JOHN A SANCHEZ Lieutenant Governor

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    3, 2015 State of New Mexico ENVIRONMENT DEPARTMENT Harold Runnels Building 1190 Saint Francis Drive, PO Box 5469 Santa Fe, NM 87502-5469 Telephone (505) 827-2855 Fax (505) 827-2836 CERTIFIED MAIL - RETURN RECEIPT REQUESTED RYAN FLYNN Cabinet Secretary BUTCH TONGATE Deputy Secretary Todd A. Shrader, Manager Carlsbad Field Office Department of Energy Philip J. Breidenbach, Project Manager Nuclear Waste Partnership, LLC P. 0. Box 2078 P. 0. Box 3090 Carlsbad, New Mexico 88221-2078

  16. SUSANA MARTINEZ Governor JOHN A SANCHEZ Lieutenant Governor

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    21, 2014 NEW MEXICO ENVIRONMENT DEPARTMENT Hazardous Waste Bureau 2905 Rodeo Park Drive East, Building 1 Santa Fe, New Mexico 87505-6303 Phone (505) 476-6000 Fax (505) 476-6030 CERTIFIED MAIL -RETURN RECEIPT REQUESTED RYAN FLYNN Cabinet Secretary BUTCHTONGATE Deputy Secretary TOM BLAINE, P.E. Director Jose Franco, Manager Carlsbad Field Office Department of Energy P.O. Box 3090 Robert L. McQuinn, Project Manager Nuclear Waste Partnership LLC P.O. Box 2078 Carlsbad, New

  17. SUSANA MARTINEZ Governor JOHN A SANCHEZ Lieutenant Governor

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    August 5, 2014 Jose Franco, Manager Carlsbad Field Office Department of Energy P.O. Box 3090 State of New Mexico ENVIRONMENT DEPARTMENT Harold Runnels Building 1190 Saint Francis Drive, PO Box 5469 Santa Fe, NM 87502-5469 Telephone (505) 827-2855 Fax (505) 827-2836 CERTIFIED MAIL- RETURN RECEIPT REQUESTED Robert L. McQuinn, Project Manager Nuclear Waste Partnership, LLC P.O. Box 2078 Carlsbad, New Mexico 88221-2078 Carlsbad, New Mexico 88221-3090 RE: WIPP NITRATE SALT

  18. SUSANA MARTINEZ Governor JOHN A SANCHEZ Lieutenant Governor

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    September 24, 2014 Jose Franco, Manager Carlsbad Field Office Department of Energy P.O. Box 3090 State of New Mexico ENVIRONMENT DEPARTMENT Harold Runnels Building 1190 Saint Francis Drive, PO Box 5469 Santa Fe, NM 87502-5469 Telephone (505) 827-2855 Fax (505) 827-2836 CERTIFIED MAIL - RETURN RECEIPT REQUESTED Robert L. McQuinn, Project Manager Nuclear Waste Partnership, LLC P.O. Box 2078 Carlsbad, New Mexico 88221-2078 Carlsbad, New Mexico 88221-3090 RE: DRAFT UNDERGROUND

  19. SUSANA MARTINEZ Governor JOHN A SANCHEZ Lieutenant Governor

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    30, 2015 Jose R. Franco, Manager Carlsbad Field Office Department of Energy P.O. Box 3090 State of New Mexico ENVIRONMENT DEPARTMENT Harold Runnels Building 1190 Saint Francis Drive, PO Box 5469 Santa Fe, New Mexico 87502-5469 Telephone (505) 827-2855 Fax (505) 827-2836 CERTIFIED MAIL- RETURN RECEIPT REQUESTED Robert L. McQuinn, Project Manager Nuclear Waste Partnership LLC P.O. Box 2078 Carlsbad, New Mexico 88221-2078 Carlsbad, New Mexico 88221-3090 RYAN FLYNN Cabinet

  20. SUSANA MARTINEZ Governor JOHN A SANCHEZ Lieutenant Governor

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    July 15, 2015 NEW MEXICO ENVIRONMENT DEPARTMENT 2905 Rodeo Park Drive East, Building 1 Santa Fe, New Mexico 87505-6303 Phone (505) 476-6000 Fax (505) 476-6030 CERTIFIED MAIL - RETURN RECEIPT REQUESTED RYAN FLYNN Cabinet Secretary BUTCH TONGA TE Deputy Secretary Dana C. Bryson, Acting Manager Carlsbad Field Office Department of Energy Philip J. Breidenbach, Project Manager Nuclear Waste Partnership, LLC P .0. Box 2078 P.O. Box 3090 Carlsbad,NewMexico 88221-2078 Carlsbad, New Mexico

  1. SUSANA MARTINEZ Governor JOHN A. SANCHEZ Lieutenant Governor

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    MARTINEZ Governor JOHN A. SANCHEZ Lieutenant Governor NEW MEXICO ENVIRONMENT DEPARTMENT Hazardous Waste Bureau 2905 Rodeo Park Drive East, Building 1 Santa Fe, New Mexico 87505*6303 Phone (505) 476-6000 Fax (505) 476-6030 CERTIFIED MAIL - RETURN RECEIPT REQUESTED* September 23,2013 Jose R. Franco, Manager M. Farok Sharif, Project Manager Carlsbad Field Office Nuclear Waste Partnership LLC Department of Energy P. O. Box 2078 P. O. Box 3090 Carlsbad, New Mexico 88221-5608

  2. SUSANA MARTINEZ Governor JOHN A. SANCHEZ Lieutenant Governor

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    30, 2014 NEW MEXICO ENVIRONMENT DEPARTMENT 2905 Rodeo Park Drive East, Building 1 Santa Fe, New Mexico 87505-6303 Phone (505) 476-6000 Fax (505) 476-6030 CERTIFIED MAIL- RETURN RECEIPT REQUESTED RYAN FLYNN Cabinet Secretary BUTCH TONGATE Deputy Secretary TOM BLAIN E, P.E. Director Environmental Health Division Jose R. Franco, Manager Carlsbad Field Office Department of Energy Robert L. McQuinn, Project Manager Nuclear Waste Partnership LLC P. 0. Box 2078 P. 0. Box 3090

  3. SUSANA MARTINEZ Governor JOHN A. SANCHEZ Lieutenant Governor

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    27, 2016 NEW MEXICO ENVIRONMENT DEPARTMENT 2905 Rodeo Park Drive East, Building 1 Santa Fe, New Mexico 87505-6303 Phone (505) 476-6000 Fax (505) 476-6030 www .env CERTIFIED MAIL - RETURN RECEIPT REQUESTED RYAN FLYNN Cabinet Secretary BUTCHTONGATE Deputy Secretary Todd A. Shrader, Manager Carlsbad Field Office Department of Energy P.O. Box 3090 Philip J. Breidenbach, Project Manager Nuclear Waste Partnership LLC P.O. Box 2078 Carlsbad, New Mexico 88221-2078 Carlsbad, New Mexico 88221-3090

  4. SUSANA MARTINEZ Governor JOHN A. SANCHEZ Lieutenant Governor

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    3, 2011 NEW MEXICO ENVIRONMENT DEPARTMENT Hazardous Waste Bureau 2905 Rodeo Park Drive East, Building 1 Santa Fe, New Mexico 87505-6303 Phone (505) 476-6000 Fax (505) 476-6030 CERTIFIED MAIL - RETURN RECEIPT REQUESTED Edward Ziemianski, Acting Manager Carlsbad Field Office Farok Sharif Washington TRU Solutions LLC P.O. Box 2078 Department of Energy P.O. Box 3090 Carlsbad, New Mexico 88221-5608 Carlsbad, New Mexico 88221-3090 RE: WIPP llAzARDouS WASTE FACILITY PERMIT REVISED

  5. SUSANA MARTINEZ Governor JOHN A. SANCHEZ Lieutenant Governor

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    1 NEW MEXICO ENVIRONMENT DEPARTMENT Hazardous Waste Bureau 2905 Rodeo Park Drive East, Building 1 Santa Fe, New Mexico 87505-6303 Phone (505) 476-6000 Fax (505) 476-6030 CERTIFIED MAIL - RETURN RECEIPT REQUESTED Edward Ziemianski, Acting Manager Carlsbad Field Office Farok Sharif Washington TRU Solutions LLC P.O. Box 2078 Department of Energy P.O. Box 3090 Carlsbad, New Mexico 88221-5608 Carlsbad, New Mexico 88221-3090 DAVE MARTIN Secretary RAJ SOLOMON, P.E. Deputy

  6. SUSANA MARTINEZ Governor JOHN A. SANCHEZ Lieutenant Governor

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    27,2012 Jose Franco, Manager Carlsbad Field Office Department of Energy P.O. Box 3090 NEW MEXICO ENVIRONMENT DEPARTMENT Resource Protection Division Harold Runnels Building 1190 Saint Francis Drive (87505) P.O. Box 5469, Santa Fe, NM 87502-5469 Phone (505) 827-0419 Fax (505) 827-0310 \ CERTIFIED MAIL - RETURl'll RECEIPT REQUESTED Farok Sharif, Project Manager Nuclear Waste Partnership LLC P.O. Box 2078 Carlsbad, New Mexico 88221-5608 Carlsbad, New Mexico 88221-3090 RE:

  7. SUSANA MARTINEZ Governor JOHN A. SANCHEZ Lieutenant Governor

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    8, 2016 State of New Mexico ENnRONMENTDEPARTMENT Harold Runnels Building 1190 Saint Francis Drive, PO Box 5469 Santa Fe, NM 87502-5469 Telephone (505) 827-2855 Fax (505) 827-2836 CERTIFIED MAIL- RETURN RECEIPT REQUESTED RYAN FLYNN Cabinet Secretary BUTCH TONGATE Deputy Secretary Todd A. Shrader, Manager Carlsbad Field Office Department of Energy Philip J. Breidenbach, Project Manager Nuclear Waste Partnership, LLC P. 0 . Box 2078 P. 0 . Box 3090 Carlsbad. New Mexico 88221-2078

  8. SUSANA MARTINEZ Governor JOHN A. SANCHEZ Lieutenant Governor

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    2, 2015 NEW MEXICO ENVIRONMENT DEPARTMENT 2905 Rodeo Park Drive East, Building 1 Santa Fe, New Mexico 87505-6303 Phone (505) 476-6000 Fax (505) 476-6030 CERTifiED MAIL - RETURN RECEIPT REQUESTED RYAN FLYNN Cabinet Secretary BUTCH TONGATE Deputy Secretary Dana C. Bryson, Acting Manager Carlsbad Field Office Department of Energy Philip J. Breidenbach, Project Manager Nuclear Waste Partnership LLC P. 0. Box 2078 P. 0. Box 3090 Carlsbad, New Mexico 88221-2078 Carlsbad, New Mexico

  9. SUSANA MARTINEZ Governor JOHN A. SANCHEZ Lieutenant Governor

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    9, 2014 State of New Mexico ENVIRONMENT DEPARTMENT Harold Runnels Building 1190 Saint Francis Drive, PO Box 5469 Santa Fe, NM 87502-5469 Telephone (505) 827-2855 Fax (505) 827-2836 CERTIFIED MAIL * RETURN RECEIPT REQUESTED RYAN FLYNN Cabinet Secretary BUTCH TONGATE Deputy Secretary Jose Franco, Manager Carlsbad Field Office Department of Energy P.O. Box 3090 Robert L. McQuinn, Project Manager Nuclear Waste Partnership, LLC P.O. Box 2078 Carlsbad, New Mexico 88221-2078

  10. SUSANA MARTINEZ Governor JOHN A. SANCHEZ Lieutenant Governor

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    5, 2011 NEW MEXICO ENVIRONMENT DEPARTMENT Hazardous Waste Bureau 2905 Rodeo Park Drive East, Building 1 Santa Fe, New Mexico 87505-6303 Phone (505) 476-6000 Fax (505) 476-6030 CERTIFIED MAIL - RETURN RECEIPT REQUESTED Edward Ziemianski, Acting Manager Carlsbad Field Office Farok Sharif Washington TRU Solutions LLC P.O. Box 2078 Department of Energy P.O. Box 3090 Carlsbad, New Mexico 88221-5608 Carlsbad, New Mexico 88221-3090 RE: NOTICE OF APPROVAL GROUNDWATER PERMIT

  11. SUSANA MARTINEZ Governor JOHN A. SANCHEZ Lieutenant Governor

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    29, 2014 Jose Franco, Manager Carlsbad Field Office Department of Energy P.O. Box 3090 State of New Mexico ENVIRONMENT DEPARTMENT Harold Runnels Building 1190 Saint Francis Drive, PO Box 5469 Santa Fe, NM 87502-5469 Telephone (505) 827-2855 Fax (505) 827-2836 www.nmenv .state.nm. us CERTIFIED MAIL- RETURN RECEIPT REQUESTED Robert L. McQuinn, Project Manager Nuclear Waste Partnership, LLC P.O. Box 2078 Carlsbad, New Mexico 88221-2078 Carlsbad, New Mexico 88221-3090 RE: AMENDMENT TO REPORTING

  12. SUSANA MARTINEZ Governor JOHN A. SANCHEZ Lieutenant Governor

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    August 7, 2014 Jose Franco, Manager Carlsbad Field Office Department of Energy P.O. Box 3090 NEW MEXICO ENVIRONMENT DEPARTMENT Office of the Secretary Harold Runnels Building 1190 Saint Francis Drive (87505) P.O. Box 5469, Santa Fe, NM 87502 Phone: (505) 827-2855 Fax: (505) 827-2836 CERTIFIED MAIL- RETURN RECEIPT REQUESTED Robert L. McQuinn, Project Manager Nuclear Waste Partnership, LLC P.O. Box 2078 Carlsbad, New Mexico 88221-2078 Carlsbad, New Mexico 88221-3090 RE: WIPP

  13. SUSANA MARTINEZ Governor JOHN A. SANCHEZ Lieutenant Governor

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    October 7, 2014 Jose Franco, Manager Carlsbad Field Office Department of Energy P.O. Box 3090 State of New Mexico ENVIRONMENT DEPARTMENT Harold Runnels Building 1190 Saint Francis Drive, PO Box 5469 Santa Fe, NM 87502-5469 Telephone (505) 827-2855 Fax (505) 827-2836 CERTIFIED MAIL- RETURN RECEIPT REQUESTED Robert L. McQuinn, Project Manager Nuclear Waste Partnership, LLC P.O. Box 2078 Carlsbad, New Mexico 88221-2078 Carlsbad, New Mexico 88221-3090 RE: MODIFICATION TO MAY

  14. SUSANA MARTINEZ Governor JOHN A. SANCHEZ Lieutenant Governor

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    22, 2016 State of New Mexico ENVIRONMENT DEPARTMENT Harold Runnels Building 1190 Saint Francis Drive, PO Box 5469 Santa Fe, NM 87502-5469 Telephone (505) 827-2855 Fax (505) 827-2836 www CERTIFIED MAIL - RETURN RECEIPT REQUESTED RYAN FLYNN Cabinet Secretary BUTCH TONGATE Deputy Secretary Todd A. Shrader, Manager Carlsbad Field Office Department of Energy Philip J. Breidenbach, Project Manager Nuclear Waste Partnership, LLC P. 0. Box 2078 P. 0. Box 3090 Carlsbad, New Mexico 88221-2078

  15. SUSANA MARTINEZ Governor JOHN A. SANCHEZ Lieutenant Governor

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    December 2, 2014 Jose Franco, Manager Carlsbad Field Office Department of Energy P.O. Box 3090 State of New Mexico ENVIRONMENT DEPARTMENT Harold Runnels Building 1190 Saint Francis Drive, PO Box 5469 Santa Fe, NM 87502-5469 Telephone (505) 827-2855 Fax (505) 827-2836 CERTIFIED MAIL *RETURN RECEIPT REQUESTED Robert L. McQuinn, Project Manager Nuclear Waste Partnership, LLC P.O. Box 2078 Carlsbad, New Mexico 88221-2078 Carlsbad, New Mexico 88221-3090 RE: UNDERGROUND DERIVED

  16. SUSANA MARTINEZ Governor JOHN A. SANCHEZ Lieutenant Governor

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    November 7, 2014 Jose Franco, Manager Carlsbad Field Office Department of Energy P.O. Box 3090 State of New Mexico ENVIRONMENT DEPARTMENT Harold Runnels Building 1190 Saint Francis Drive, PO Box 5469 Santa Fe, NM 87502-5469 Telephone (505) 827-2855 Fax (505) 827-2836 CERTIFIED MAIL - RETURN RECEIPT REQUESTED Robert L. McQuinn, Project Manager Nuclear Waste Partnership, LLC P.O. Box 2078 Carlsbad, New Mexico 88221-2078 Carlsbad, New Mexico 88221-3090 RYAN FLYNN Cabinet

  17. SUSANA MARTINEZ Governor JOHN A. SANCHEZ Lieutenant Governor

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    4 Jose Franco, Manager Carlsbad Field Office Department of Energy P.O. Box 3090 State of New Mexico ENVIRONMENT DEPARTMENT Harold Runnels Building 1190 Saint Francis Drive, PO Box 5469 Santa Fe, NM 87502-5469 Telephone (505) 827-2855 Fax (505) 827-2836 CERTIFIED MAIL - RETURN RECEIPT REQUESTED Robert L. McQuinn, Project Manager Nuclear Waste Partnership, LLC P.O. Box 2078 Carlsbad, New Mexico 88221-2078 Carlsbad, New Mexico 88221-3090 RYAN FLYNN Cabinet Secretary BUTCH

  18. SUSANA MARTINEZ Governor JOHN A. SANCHEZ Lieutenant Governor

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    September 10, 2014 Jose Franco, Manager Carlsbad Field Office Department of Energy P.O. Box 3090 State of New Mexico ENVIRONMENT DEPARTMENT Harold Runnels Building 1190 Saint Francis Drive, PO Box 5469 Santa Fe, NM 87502-5469 Telephone (505) 827-2855 Fax (505) 827-2836 CERTIFIED MAIL - RETURN RECEIPT REQUESTED Robert L. McQuinn, Project Manager Nuclear Waste Partnership, LLC P.O. Box 2078 Carlsbad, New Mexico 88221-2078 Carlsbad, New Mexico 88221-3090 RYAN FLYNN Cabinet

  19. SUSANA MARTINEZ Governor JOHN A. SANCHEZ Lieutenant Governor

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    , 2015 Jose Franco, Manager Carlsbad Field Office Department of Energy P.O. Box 3090 State of New Mexico ENVIRONMENT DEPARTMENT Harold Runnels Building 1190 Saint Francis Drive, PO Box 5469 Santa Fe, NM 87502-5469 Telephone (505) 827-2855 Fax (505) 827-2836 www CERTIFIED MAIL - RETURN RECEIPT REQUESTED Robert L. McQuinn, Project Manager Nuclear Waste Partnership, LLC P.O. Box 2078 Carlsbad, New Mexico 88221-2078 Carlsbad, New Mexico 88221-3090 RYAN FLYNN Cabinet Secretary

  20. SUSANA MARTINEZ Governor JOHN A. SANCHEZ Lieutenant Governor

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    18,2012 NEW MEXICO ENVIRONMENT DEPARTMENT Hazardous Waste Bureau 2905 Rodeo Park Drive East, Building 1 Santa Fe, New Mexico 87505-6303 Phone (505) 476~6000 Fax (505) 476~6030 CERTIFIED MAIL ~ RETURN RECEIPT REQUESTED Edward Ziemianski, Acting Manager Carlsbad Field Office M. Farok Sharif Washington TRU Solutions LLC P.O. Box 2078 Department of Energy P.O. Box 3090 Carlsbad, New Mexico 88221 ~5608 Carlsbad, New Mexico 88221 ~3090 RE: NOTICE OF COMPLETENESS DETERMINATION AND

  1. SUSANA MARTINEZ Governor JOHN A. SANCHEZ Lieutenant Governor

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    June 15,2011 NEW MEXICO ENVIRONMENT DEPARTMENT Hazardous Waste Bureau 2905 Rodeo Park Drive East, Building 1 Santa Fe, New Mexico 87505-6303 Phone (505) 476-6000 Fax (505) 476-6030 CERTIFIED MAIL - RETURN RECEIPT REQUESTED Edward Ziemianski, Acting Manager Carlsbad Field Office Farok Sharif Washington TRU Solutions LLC P.O. Box 2078 Department of Energy DAVE MARTIN Secretary RAJ SOLOMON, P.E. Deputy Secretary P.O. Box 3090 Carlsbad, New Mexico 88221-5608 Carlsbad, New

  2. SUSANA MARTINEZ Governor JOHN A.. SANCHEZ Lieutenant Governor

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    . SANCHEZ Lieutenant Governor NEW MEXICO ENVIRONMENT DEPARTMENT 2905 Rodeo Park Drive East, Building 1 Santa Fe, New Mexico 87505-6303 Phone (505) 476-6000 Fax (505) 476-6030 CERTIFIED MAIL - RE;;rURN RECEIPT REQUESTED March 4, 2015 Jose R. Franco, Manager Carlsbad Field Office Department of Energy P.O. Box 3090 Carlsbad, New Mexico 88221-3090 Robert L. McQuinn, Project Manager Nuclear Waste Partnership LLC P.O. Box 2078 Carlsbad, New Mexico 88221-2078 RE: CLASS 1

  3. SUSANA MARTINEZ Governor JOI-IN A_ SANC HEZ Lieutenant Governor

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    JOI-IN A_ SANC HEZ Lieutenant Governor NEW MEXICO ENVIRONMENT DEPARTMENT Hazardous Waste Bureau 2905 Rodeo Park Drive East, Building 1 Santa Fe, New Mexico 87505-6303 Phone (505) 476-6000 Fax (505) 476-6030 WWW.llmeIlV.slate.ltJlt.lIS CERTIFIED MAIL - RETURN RECEIPT REQ UESTED May 8, 20 12 Jose R_ Franco, Manager Carlsbad Field Office Department of Energy P.O. Box 3090 Carl sbad, New Mexico 88221-3090 M. Farok Sharif Washington TRU Solutions LLC P.O. Box 2078 Carlsbad, New Mexico 88221-5608 RE:

  4. SUSANA MARTINEZ Governor JOfiN A. SANCHEZ Lieutenant Governor

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    JOfiN A. SANCHEZ Lieutenant Governor May 20,2015 State of New Mexico ENVIRONMENT DEPARTMENT Harold Runnels Building I 190 Saint Francis Drive, PO Box 5469 Santa Fe, NM 87502-5469 Telephone (505) 827-2855 Fax (505) 827-2836 CERTIFIED MAIL- RETURN RECEIPT REQUESTED RYAN FLYNN Cabinet Secretary BUTCII TONGA TE Deputy Secretary Jose Franco, Manager Carlsbad Field Office Department of Energy P.O. Box 3090 Robert L. McQuinn, Project Manager Nuclear Waste Partnership, LLC P.O. Box

  5. SUSANA MARTfNEZ Governor JOHN A. SANCHEZ Lieutenant Governor

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    A. SANCHEZ Lieutenant Governor December 6, 2014 Jose Franco, Manager Carlsbad Field Office Department of Energy P.O. Box 3090 State of New Mexico ENVIRONMENT DEPARTMENT Harold Runnels Building 1190 Saint Francis Drive, PO Box 5469 Santa Fe, NM 87502-5469 Telephone (505) 827-2855 Fax (505) 827-2836 CERTIFIED MAIL- RETURN RECEIPT REQUESTED Robert L. McQuinn, Project Manager Nuclear Waste Partnership, LLC P.O. Box 2078 Carlsbad, New Mexico 88221-2078 Carlsbad, New Mexico

  6. SUSANA MARTiNEZ Governor JOHN A. SANCHEZ Lieutenant Governor

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    MARTiNEZ Governor JOHN A. SANCHEZ Lieutenant Governor November 9, 2011 NEW MEXICO ENVIRONMENT DEPARTMENT Hazardous Waste Bureau 2905 Rodeo Park Drive East, Building 1 Santa Fe, New Mexico 87505-6303 Phone (505) 476-6000 Fax (505) 476-6030 CERTIFIED MAIL - RETURN RECEIPT REQUESTED Farok Sharif DAVE MARTIN Secretary BUTCH TONGATE Deputy Secretary Edward Ziemianski, Acting Manager Carlsbad Field Office Department of Energy Washington TRU Solutions LLC P. O. Box 2078 P. O. Box

  7. Microsoft Word - foi 2009-0038.request.docx

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Eric Feist Organization: Veolia ES Technical Solutions Address: 21814 76th Ave S Kent, WA 98032 Country: United States Phone Number: 206-790-180 Fax Number: 425-272-0777 E-mail: Reasonably Describe Records Description: I would like to request the award, to include pricing,for RFP #181287 "Hazardous Waste Treatment" in support of the Hanford Project, Richland, WA. This award was made by CH2M Hill Plateau Remediation company under prime contract

  8. Microsoft Word - 40834R02.doc

    Office of Scientific and Technical Information (OSTI)

    Report Title: Flux Enhancement in Crossflow Membrane Filtration: Fouling and It's Minimization by Flow Reversal Report Type: ANNUAL Reporting Period Start Date: 09/01/2001 End Date: 08/31/2002 Principal Author(s): Shamsuddin Ilias Report Issue Date: March 14, 2002 DOE Award No.: DE-FG26-00NT40834 Name and Address of Submitting Organization: North Carolina A&T State University Department of Chemical Engineering Greensboro, NC 27411 E-mail: Tel: (336) 334-7564 Fax: (336)

  9. New Regenerative Cycle for Vapor Compression Refrigeration

    Office of Scientific and Technical Information (OSTI)

    SCIENTIFIC REPORT Title Page Project Title: New Regenerative Cycle for Vapor Compression Refrigeration DOE Award Number: DE-FG36-04GO14327 Document Title: Final Scientific Report Period Covered by Report: September 30, 2004 to September 30, 2005 Name and Address of Recipient Organization: Magnetic Development, Inc., 68 Winterhill Road, Madison, CT 06443, phone: 203-214-7247, fax: 203-421-7948, e-mail: Contact Information: Mark J. Bergander, Ph.D., P.E., Principal Investigator,

  10. FBP-ER-RIFS-BG-PLN-0036 Rev. 6 1 DOE/PPPO/03-0383&D4

    Energy Savers [EERE]

    BG-PLN-0036 Rev. 6 1 DOE/PPPO/03-0383&D4 Aerial photo of the Portsmouth Gaseous Diffusion Plant, showing the approximate 1,000-acre industrialized area within Perimeter Road PUBLIC COMMENT PERIOD NOVEMBER 12, 2014 TO JANUARY 10, 2015 HOW YOU CAN PARTICIPATE Read this Proposed Plan and review related documents in the Administrative Record. Comment on this Proposed Plan by mail, email, phone, or fax to: Ms. Kristi Wiehle Department of Energy P.O. Box 370 Piketon, Ohio 45661 Email:

  11. Federal Technical Capability Panel

    Energy Savers [EERE]

    Updated: April 2015 1 U. S. Department of Energy and National Nuclear Security Administration Federal Technical Capability Panel Organization Name Telephone Fax E-Mail FTCP CHAIR Chair (DOE/NTC) Karen L. Boardman (505) 845-6444 (505) 845-6079 FTCP Deputy Dave Chaney (505) 845-4300 (505) 845-4879 FTCP Technical Standards Mgr. Jeanette Yarrington (301) 903-7030 (301) 903-3445 FTCP Program Coordinator Jeannie Lozoya

  12. transims-studies-at-the-university

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Studies at the University at Buffalo, the State University of New York Adel W. Sadek, Ph.D. Associate Professor University at Buffalo, The State University of New York 233 Ketter Hall Buffalo, NY 14260 Phone: (716) 645-4367 FAX: (716) 645-3733 E-mail: This email address is being protected from spambots. You need JavaScript enabled to view it. List of Authors ================ Adel W. Sadek, Ph.D. Shan Huang Liya Guo Yan Yang Irene Casas, Ph.D. University at Buffalo, The State University of New

  13. A. Lawrence Bryan, Jr.

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    A. Lawrence (Larry) Bryan, Jr. Research Professional III Savannah River Ecology Laboratory P.O. Drawer E Aiken, SC 29802 803-725-2907 (Voice) -3309 (Fax) 803-646-3616 (cell) (e-mail) Education: B.S., Wildlife Biology/North Carolina State University. May, 1979 M.S., Wildlife Biology/Clemson University. December, 1981 Experience summary From 1984 through the present, I have been involved in research pertaining to the ecology, behavior and conservation of Wood Storks, including

  14. Rebecca Hartman-Baker

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Rebecca Hartman-Baker Rebecca Hartman-Baker head shot Rebecca J. Hartman-Baker Ph.D. Acting Group Leader Phone: (510) 486-4403 Fax: (510) 486-4316 User Engagement Group 1 Cyclotron Road Mail Stop 59R4010A Berkeley, CA 94720 US Biographical Sketch Rebecca Hartman-Baker is a computational scientist with expertise in the development of scalable parallel algorithms for the petascale and beyond. Her other research interests include inverse and ill-posed problems, numerical

  15. Rei Lee

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Rei Lee Rei Lee rlee.jpg Rei Chi Lee Storage Systems Group National Energy Research Scientific Computing Center Phone: (510) 495-2610 Fax: (510) 486-4316 Lawrence Berkeley National Laboratory 1 Cyclotron Road Mail Stop 943-256 Berkeley, CA 94720 US Conference Papers Zhengji Zhao, Mike Davis, Katie Antypas, Yushu Yao, Rei Lee and Tina Butler, "Shared Library Performance on Hopper", A paper presented in the Cray User Group meeting, Apri 29-May-3, 2012, Stuttgart, German.,

  16. Richard Gerber

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Gerber Richard Gerber GerberRichard Richard A. Gerber , Ph.D. Acting HPC Department Head, NERSC Senior Science Advisor Phone: (510) 486-6820 Fax: (510) 486-4316 1 Cyclotron Road Mail Stop 943R0256 Berkeley, CA 94720 US Biographical Sketch Richard Gerber is NERSC's Senior Science Advisor and Acting Department Head of the HPC Department. The User Services group is NERSC's point of contact with its community of 6,000 users and 700 projects conducting research in basic and applied

  17. Brent Draney

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Brent Draney Brent Draney bdraney.jpg Brent R. Draney Group Lead Networking, Servers and Security Group Phone: (510) 486-5791 Fax: (510) 486-4316 1 Cyclotron Road Mail Stop 943R0256 Berkeley, CA 94720 US Biographical Sketch Before joining NERSC, Brent analyzed census data as an information specialist in Berkeley Lab's Work Force Diversity Office. Before coming to the Lab, he worked as a statistician at the National Council on Crime and Delinquency. He has completed a B.S. at the

  18. Brian Friesen

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Brian Friesen Brian Friesen bfriesen Brian Friesen , Ph.D. Postdoctoral Fellow Phone: (510) 486-5654 Fax: (510) 486-6459 1 Cyclotron Road Mail Stop 59R4010A Berkeley, CA 94720 Biographical Sketch Brian received his Ph.D. in physics from the University of Oklahoma in 2015, supervised by Prof. Edward Baron. His research focused on astrophysics and cosmology, especially radiative transfer calculations in supernovae. At NERSC, he will be working with Ann Almgren and others in the

  19. Microsoft Word - S07531_PC_2010_032911

    Office of Legacy Management (LM)

    Calendar Year 2010 March 2011 Approved for public release; further dissemination unlimited LMS/SAL/S07531 Available for sale to the public from: U.S. Department of Commerce National Technical Information Service 5301 Shawnee Road Alexandria, VA 22312 Telephone: 800.553.6847 Fax: 703.605.6900 E-mail: Online Ordering: Available electronically at Available for a processing fee to U.S. Department of Energy and its

  20. Microsoft Word - S08711_2011AnnRpt

    Office of Legacy Management (LM)

    1 March 2012 Approved for public release; further dissemination unlimited LMS/SAL/S08711 Available for sale to the public from: U.S. Department of Commerce National Technical Information Service 5301 Shawnee Road Alexandria, VA 22312 Telephone: 800.553.6847 Fax: 703.605.6900 E-mail: Online Ordering: Available for a processing fee to U.S. Department of Energy and its contractors, in paper, from: U.S. Department of Energy Office of

  1. Microsoft Word - S09886_PC

    Office of Legacy Management (LM)

    Calendar Year 2012 March 2013 Approved for public release; further dissemination unlimited LMS/SAL/S09886 Available for sale to the public from: U.S. Department of Commerce National Technical Information Service 5301 Shawnee Road Alexandria, VA 22312 Telephone: 800.553.6847 Fax: 703.605.6900 E-mail: Online Ordering: Available electronically at Available for a processing fee to U.S. Department of Energy and its

  2. September 2004 Water Sampling

    Office of Legacy Management (LM)

    Water Sampling at the Salmon, Mississippi, Site March 2014 Approved for public release; further dissemination unlimited LMS/SAL/S00413 Available for sale to the public from: U.S. Department of Commerce National Technical Information Service 5301 Shawnee Road Alexandria, VA 22312 Telephone: 800.553.6847 Fax: 703.605.6900 E-mail: Online Ordering: Available electronically at Available for a processing fee to U.S.

  3. September 2004 Water Sampling

    Office of Legacy Management (LM)

    Salmon, Mississippi, Site June 2015 LMS/SAL/S01014 Available for sale to the public from: U.S. Department of Commerce National Technical Information Service 5301 Shawnee Road Alexandria, VA 22312 Telephone: 800.553.6847 Fax: 703.605.6900 E-mail: Online Ordering: Available electronically at Available for a processing fee to U.S. Department of Energy and its contractors, in paper, from: U.S. Department of

  4. documenttemplate

    Office of Legacy Management (LM)

    Sampling and Analysis Report Salmon, Mississippi, Site Calendar Year 2013 March 2014 Approved for public release; further dissemination unlimited LMS/SAL/S10376 Available for sale to the public from: U.S. Department of Commerce National Technical Information Service 5301 Shawnee Road Alexandria, VA 22312 Telephone: 800.553.6847 Fax: 703.605.6900 E-mail: Online Ordering: Available electronically at Available

  5. 1

    Office of Legacy Management (LM)

    3 December 2013 Approved for public release; further dissemination unlimited LMS/GSB/S10841 Available for sale to the public from: U.S. Department of Commerce National Technical Information Service 5301 Shawnee Road Alexandria, VA 22312 Telephone: 800.553.6847 Fax: 703.605.6900 E-mail: Online Ordering: Available electronically at Available for a processing fee to U.S. Department of Energy and its contractors,

  6. 1

    Office of Legacy Management (LM)

    Monitoring Report Project Shoal Area Subsurface Corrective Action Unit 447 March 2015 Approved for public release; further dissemination unlimited LMS/SHL/S12315 Available for sale to the public from: U.S. Department of Commerce National Technical Information Service 5301 Shawnee Road Alexandria, VA 22312 Telephone: 800.553.6847 Fax: 703.605.6900 E-mail: Online Ordering: Available electronically at Available

  7. 2015 Groundwater Monitoring and Inspection Report Gnome-Coach, New Mexico, Site

    Office of Legacy Management (LM)

    Groundwater Monitoring and Inspection Report Gnome-Coach, New Mexico, Site January 2016 Approved for public release; further dissemination unlimited LMS/GNO/S13360 Available for sale to the public from: U.S. Department of Commerce National Technical Information Service 5301 Shawnee Road Alexandria, VA 22312 Telephone: 800.553.6847 Fax: 703.605.6900 E-mail: Online Ordering: Available electronically at

  8. 2015 Long-Term Hydrologic Monitoring Program Sampling and Analysis Results at Rio Blanco, Colorado

    Office of Legacy Management (LM)

    at Rio Blanco, Colorado December 2015 Approved for public release; further dissemination unlimited LMS/RBL/S13678 Available for sale to the public from: U.S. Department of Commerce National Technical Information Service 5301 Shawnee Road Alexandria, VA 22312 Telephone: 800.553.6847 Fax: 703.605.6900 E-mail: Online Ordering: Available electronically at Available for a processing fee to U.S. Department of

  9. DOE-LM/XXXX-2007

    Office of Legacy Management (LM)

    Surface Corrective Action Unit 417 at the Central Nevada Test Area, Nevada, Site January 2015 Approved for public release; further dissemination unlimited LMS/CNT/S12300 Available for sale to the public from: U.S. Department of Commerce National Technical Information Service 5301 Shawnee Road Alexandria, VA 22312 Telephone: 800.553.6847 Fax: 703.605.6900 E-mail: Online Ordering: Available electronically at

  10. Isaac Ovadia

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Isaac Ovadia Isaac Ovadia Isaac-Ovadia.jpg Isaac Ovadia HPC Technician Operations Technology Group Phone: (510) 486-6821 Fax: (510) 486-4316 1 Cyclotron Road Mail Stop 943-256 Berkeley, CA 94720 Biographical Sketch Isaac Ovadia joined LBNL in 2007 to provide Computer Operations and Network support to NERSC and ESNET. Isaac has a BS degree in Informations Systems Management from the University of San Francisco. In addition, he has a certification in Unix Systems Administration and

  11. James Allen | Center for Bio-Inspired Solar Fuel Production

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Ana Moore Anne Jones Devens Gust Don Seo Giovanna Ghirlanda Hao Yan James Allen Kevin Redding Petra Fromme Thomas Moore Yan Liu James Allen Principal Investigator Subtask 2 Leader Phone: 480-965-8241 Fax: 480-965-2747 E-mail: Professor James Allen is a member of the Executive Committee and is the leader of Subtask 2 (Artificial water oxidation complex). His major management function as the subtask leader is the coordination of the activities of Subtask 2. This includes the

  12. James Botts

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    James Botts James Botts JamesBottsPic James Botts , Ph.D Phone: (510) 486-6149 Fax: (510) 486-4316 Computational Systems Group 1 Cyclotron Road Mail Stop 943-256 Berkeley, CA 94720 Biographical Sketch James Botts earned his Ph.D in High Energy Theory from Stony Brook University. He subsequently worked at the University of Washington, Illinois Institute of Technology and DESY-IfH Zeuthen and has published papers on perturbative QCD. He was maintainer of the source code used to

  13. Jason Lee

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Lee Jason Lee jason 1992 Jason R Lee Deputy of Networking and Security NERSC Phone: (510) 486-7342 Fax: (510) 486-4316 1 Cyclotron Road Mail Stop 943R0256 Berkeley, CA 94720 US Biographical Sketch Jason holds a MS in Computer Science from San Francisco State University. Jason is currently the Deputy of the Networking and Security Group, this involves handling the day-to-day operations and keeping the network flowing and security blocking. Jason has worked at Berkeley Lab since

  14. Jeff Porter

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Jeff Porter Jeff Porter R Jefferson Porter Jefferson (Jeff) R. Porter Ph.D. Data & Analytics Group National Energy Research Scientific Computing Center Phone: (510) 502-7231 Fax: (510) 486-4316 Lawrence Berkeley National Laboratory 1 Cyclotron Road Mail Stop 943-256 Berkeley, CA 94720 Biographical Sketch Jeff Porter is a member of the Data and Analytics Services team, supporting grid and distributed computing services at NERSC. Jeff earned his PhD in Nuclear Physics from UC

  15. Kevin Redding | Center for Bio-Inspired Solar Fuel Production

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Ana Moore Anne Jones Devens Gust Don Seo Giovanna Ghirlanda Hao Yan James Allen Kevin Redding Petra Fromme Thomas Moore Yan Liu Kevin Redding Associate Director of the Center Principal Investigator Phone: 480-965-0136 Fax: 480-965-2747 E-mail: Associate Professor Kevin Redding contributes to the EFRC in the area of management as an Associate Director of the Center. As a Principal Investigator of the Center he is primarily focussed on the area of EPR analysis of the

  16. The Express

    Alternative Fuels and Advanced Vehicles Data Center [Office of Energy Efficiency and Renewable Energy (EERE)]

    site. We will let you know what is new through this newsletter. As you will find in this issue, briefs of various alternative fuels information are provided by category. We will also begin an addi- tional service, the AFDC Express. The Express will provide impor- tant information on late-breaking issues via e-mail and fax. If you would like to receive these, you should ensure that the Center has your correct information. For those of you who have finished this editorial of sorts, fear not, it is

  17. Alex Ubungen

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Alex Ubungen Alex Ubungen Alex-Ubungen.jpg Alex B. Ubungen HPC Technician Operations Technology Group Phone: (510) 486-6821 Fax: (510) 486-4316 1 Cyclotron Road Mail Stop 943-256 Berkeley, CA 94720 Biographical Sketch Alex Ubungen came from Pacific Gas and Electric Company, where he worked for 16 years. He has ten years of experience in the mainframe environment, and over four years experience in imaging technology, as a technical specialist in a document management system. He

  18. Argonne Physics Division - ATLAS

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    REGISTRATION FORM Name: First Middle Last Organization: Department: Business Address: Street City State Zip Country Business Phone: Fax: E-mail: Citizenship: Additional information is needed for on-site access for non-US citizens who are not ATLAS Users. To download the form as a word document or pdf file, please go to the ATLAS user website ( Please return information to Barbara Weller by July 10, 2009. REGISTRATION Fees (If paying by check,

  19. BILL RICHARDSON Governor DIANE DENISH Lieutenant Governor

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    November 25,2009 David Moody, Manager Carlsbad Field Office Department of Energy P.O. Box 3090 NEW MEXICO ENVIRONMENT DEPARTMENT Hazardous Waste Bureau 2905 Rodeo Park Drive East, Building 1 Santa Fe, New Mexico 87505-6303 Phone (505) 476-6000 Fax (505) 476-6030 JIIJIIW.lll1leIlV.state.lll1l.lIS CERTIFIED MAIL - RETURN RECEIPT REQUESTED Farok Sharif, President Washington TRU Solutions LLC P.O. Box 2078 Carlsbad, New Mexico 88221-5608 Carlsbad, New Mexico 88221-3090 RON CURRY Secretary JON

  20. Yu Lok Lam

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Yu Lok Lam Yu Lok Lam ylam.jpg Yu Lok Lam Team Lead, CSE Operations Technology Group Phone: (510) 486-6821 Fax: (510) 486-4316 1 Cyclotron Road Mail Stop 943-256 Berkeley, CA 94720 Biographical Sketch Yu Lok Lam is the Team Lead and provides operations and network support to NERSC and ESnet control room staff. He earned a B.S. degree in Computer Information Systems at San Francisco State University and an M.S. degree in Information Technology from Golden Gate University. Last

  1. Contacts | Jefferson Lab

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Contacts Mailing Address Jefferson Lab 12000 Jefferson Avenue, Suite 15 Newport News, VA 23606 fax (757) 269-7398 Public Affairs Manager John Warren 757-269-7689 Public Affairs Specialist Debbie Magaldi (757) 269-5102 Government Relations Specialist Deborah Dowd (757) 269-7180 Public Affairs Associate Michael Robbins (757) 269-7617 Science Writer Kandice Carter (757) 269-7263 Assembling a Cryomodule Jefferson Lab

  2. Microsoft Word - 2009_NESHAP_06152010.docx

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Available electronically at Available for a processing fee to the U.S. Department of Energy and its contractors, in paper, from: U.S. Department of Energy Office of Scientific and Technical Information P.O. Box 62 Oak Ridge, TN 37831-0062 Telephone: 865-576-8401 Fax: 865-576-5728 E-mail: National Emission Standards for Hazardous Air Pollutants - Radionuclide Emissions Calendar Year 2009 June 2010 Work Performed Under Contract No.

  3. Microsoft Word - Dispute Resolution Agreement August 2009.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    BILL RICHARDSON Governor DIANE DENISH Lieutenant Governor NEW MEXICO ENVIRONMENT DEPARTMENT Hazardous Waste Bureau 2905 Rodeo Park Drive East, Building 1 Santa Fe, New Mexico 87505-6303 Phone (505) 476-6000 Fax (505) 476-6030 RON CURRY Secretary JON GOLDSTEIN Deputy Secretary CERTIFIED MAIL - RETURN RECEIPT REQUESTED August 4, 2009 David Moody, Manager Farok Sharif, President Carlsbad Field Office Washington TRU Solutions LLC Department of Energy P.O. Box 2078 P.O. Box 3090

  4. Microsoft Word - Final Determ Cl-2 04-2011 _signed_.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Water and Waste Management Division Harold Runnels Building 1190 St. Francis Drive, Santa Fe, NM 87505 Phone (505) 827-1758 Fax (505) 827-2836  DAVE MARTIN Secretary RAJ SOLOMON, P.E. Deputy Secretary CERTIFIED MAIL - RETURN RECEIPT REQUESTED April 15, 2011 Edward Ziemianski, Acting Manager Farok Sharif Carlsbad Field Office Washington TRU Solutions LLC Department of Energy P.O. Box 2078 P.O. Box 3090 Carlsbad, New Mexico 88221-5608 Carlsbad, New Mexico 88221-3090 RE:

  5. Microsoft Word - Inspection of TRUPACT-III Changes.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Hazardous Waste Bureau 2905 Rodeo Park Drive East, Building 1 Santa Fe, New Mexico 87505-6303 Phone (505) 476-6000 Fax (505) 476-6030  DAVE MARTIN Secretary RAJ SOLOMON, P.E. Deputy Secretary CERTIFIED MAIL - RETURN RECEIPT REQUESTED January 21, 2011 Edward Ziemianski, Acting Manager Farok Sharif, President Carlsbad Field Office Washington TRU Solutions LLC Department of Energy P.O. Box 2078 P.O. Box 3100 Carlsbad, New Mexico 88221-5608 Carlsbad, New Mexico 88221-3100

  6. SlISANA MARTINEZ Governor JOHN A. SANCHEZ Lieutenant Governor

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    SlISANA MARTINEZ Governor JOHN A. SANCHEZ Lieutenant Governor March 13, 2013 Jose Franco, Manager Carlsbad Field Office Department of Energy P.O. Box 3090 NEW MEXICO ENVIRONMENT DEPARTMENT Resource Protection Division Harold Runnels Building 1190 Saint Francis Drive (87505) P.O. Box 5469, Santa Fe, NM 87502-5469 Phone (505) 827-0419 Fax (505) 827-0310 CERTIFIED MAIL - RETURN RECEIPT REQUESTED M. Farok Sharif, Project Manager Nuclear Waste Partnership LLC P.O. Box 2078

  7. Slide 1

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    The U.S. Department of Energy wants to keep you informed on the continued progress with the TC&WM EIS. As the Public Involvement and agency coordination work evolves, it is important to inform you about opportunities to get information on the TC&WM EIS. Mary Beth Burandt, Document Manager U.S. Department of Energy, Office of River Protection P.O. Box 450, Mail Stop H6-60 Richland, WA 99352 TC& Fax: 509-376-7701 - Phone: 888-829-6347 To view related documents on the EIS

  8. Local Hotels | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Local Hotels Argonne Guest House Argonne National Laboratory 9700 South Cass Avenue, Building 460 Argonne, IL 60439 Reservations: 800/632-8990 or 630/739-6000 Fax: 630/739-1000 E-mail: Online reservations Additional Hotels AmeriSuites Burr Ridge 15 W. 90 N. Frontage Road Burr Ridge, IL 60521 Reservations: 630/323-7530 La Quinta 225 W. South Frontage Road Bolingbrook, IL 60440 Reservations: 630/226-0000 La Quinta 855 79th Street Willowbrook, IL 60527 Reservations:

  9. LMS/CNT/S05935

    Office of Legacy Management (LM)

    Monitoring Report Central Nevada Test Area Subsurface Corrective Action Unit 443 May 2014 Approved for public release; further dissemination unlimited LMS/CNT/S11448 Available for sale to the public from: U.S. Department of Commerce National Technical Information Service 5301 Shawnee Road Alexandria, VA 22312 Telephone: 800.553.6847 Fax: 703.605.6900 E-mail: Online Ordering: Available electronically at

  10. Microsoft Word - S05767_PostClosureInspRpt.doc

    Office of Legacy Management (LM)

    Surface, Hot Creek Valley, Nevada October 2009 Approved for public release; further dissemination is unlimited LMS/CNT/S05767 Available for sale to the public from: U.S. Department of Commerce National Technical Information Service 5301 Shawnee Road Alexandria, VA 22312 Telephone: 800.553.6847 Fax: 703.605.6900 E-mail: Online Ordering: Available electronically at Available for a processing fee to U.S.

  11. Microsoft Word - S05869_2009SampleResultsRpt.doc

    Office of Legacy Management (LM)

    Hydrologic and Natural Gas Sampling and Analysis Results for 2009 November 2009 Approved for public release; further dissemination unlimited LMS/GSB/S05869 Available for sale to the public from: U.S. Department of Commerce National Technical Information Service 5301 Shawnee Road Alexandria, VA 22312 Telephone: 800.553.6847 Fax: 703.605.6900 E-mail: Online Ordering: Available electronically at Available for a

  12. Microsoft Word - S05935_GW.doc

    Office of Legacy Management (LM)

    Groundwater Monitoring Report Central Nevada Test Area, Corrective Action Unit 443 September 2010 Approved for public release; further dissemination unlimited LMS/CNT/S05935 Available for sale to the public from: U.S. Department of Commerce National Technical Information Service 5301 Shawnee Road Alexandria, VA 22312 Telephone: 800.553.6847 Fax: 703.605.6900 E-mail: Online Ordering: Available electronically at

  13. Microsoft Word - S07076_Results

    Office of Legacy Management (LM)

    Hydrologic and Natural Gas Sampling and Analysis Results for 2010 December 2010 Approved for public release; further dissemination unlimited LMS/GSB/S07076 Available for sale to the public from: U.S. Department of Commerce National Technical Information Service 5301 Shawnee Road Alexandria, VA 22312 Telephone: 800.553.6847 Fax: 703.605.6900 E-mail: Online Ordering: Available electronically at Available for a

  14. Microsoft Word - S07114_MonRpt

    Office of Legacy Management (LM)

    Monitoring and Inspection Report Gnome-Coach Site, New Mexico February 2011 Approved for public release; further dissemination unlimited LMS/GNO/S07114 Available for sale to the public from: U.S. Department of Commerce National Technical Information Service 5301 Shawnee Road Alexandria, VA 22312 Telephone: 800.553.6847 Fax: 703.605.6900 E-mail: Online Ordering: Available electronically at Available for a

  15. Microsoft Word - S07116_MR

    Office of Legacy Management (LM)

    Central Nevada Test Area, Corrective Action Unit 443 February 2011 Approved for public release; further dissemination unlimited LMS/CNT/S07116 Available for sale to the public from: U.S. Department of Commerce National Technical Information Service 5301 Shawnee Road Alexandria, VA 22312 Telephone: 800.553.6847 Fax: 703.605.6900 E-mail: Online Ordering: Available electronically at Available for a processing fee

  16. Microsoft Word - S07305_FMP

    Office of Legacy Management (LM)

    Fluid Management Plan Subsurface Corrective Action Unit 447 Shoal, Nevada, Site September 2011 Approved for public release; further dissemination unlimited LMS/SHL/S07305 Available for sale to the public from: U.S. Department of Commerce National Technical Information Service 5301 Shawnee Road Alexandria, VA 22312 Telephone: 800.553.6847 Fax: 703.605.6900 E-mail: Online Ordering: Available electronically at

  17. Microsoft Word - S09337_MonRpt

    Office of Legacy Management (LM)

    Monitoring and Inspection Report Gnome-Coach, New Mexico, Site March 2013 Approved for public release; further dissemination unlimited LMS/GNO/S09337 Available for sale to the public from: U.S. Department of Commerce National Technical Information Service 5301 Shawnee Road Alexandria, VA 22312 Telephone: 800.553.6847 Fax: 703.605.6900 E-mail: Online Ordering: Available electronically at Available for a

  18. Microsoft Word - S09647_GW_MR.doc

    Office of Legacy Management (LM)

    Monitoring Report Central Nevada Test Area, Subsurface Corrective Action Unit 443 April 2013 Approved for public release; further dissemination unlimited LMS/CNT/S09647 Available for sale to the public from: U.S. Department of Commerce National Technical Information Service 5301 Shawnee Road Alexandria, VA 22312 Telephone: 800.553.6847 Fax: 703.605.6900 E-mail: Online Ordering: Available electronically at

  19. September 2004 Water Sampling

    Office of Legacy Management (LM)

    Central Nevada Test Area March 2014 Approved for public release; further dissemination unlimited LMS/CNT/S01113 Available for sale to the public from: U.S. Department of Commerce National Technical Information Service 5301 Shawnee Road Alexandria, VA 22312 Telephone: 800.553.6847 Fax: 703.605.6900 E-mail: Online Ordering: Available electronically at Available for a processing fee to U.S. Department of Energy

  20. September 2004 Water Sampling

    Office of Legacy Management (LM)

    4 Groundwater Sampling at the Central Nevada Test Area February 2015 LMS/CNT/S01214 Available for sale to the public from: U.S. Department of Commerce National Technical Information Service 5301 Shawnee Road Alexandria, VA 22312 Telephone: 800.553.6847 Fax: 703.605.6900 E-mail: Online Ordering: Available electronically at Available for a processing fee to U.S. Department of Energy and its contractors, in

  1. September 2004 Water Sampling

    Office of Legacy Management (LM)

    Groundwater, Surface Water, Produced Water, and Natural Gas Sampling at the Gasbuggy, New Mexico, Site October 2014 LMS/GSB/S00614 Available for sale to the public from: U.S. Department of Commerce National Technical Information Service 5301 Shawnee Road Alexandria, VA 22312 Telephone: 800.553.6847 Fax: 703.605.6900 E-mail: Online Ordering: Available electronically at Available for a processing fee to U.S.

  2. September 2004 Water Sampling

    Office of Legacy Management (LM)

    Rio Blanco, Colorado, Site February 2014 LMS/RBL/S00509 Available for sale to the public from: U.S. Department of Commerce National Technical Information Service 5301 Shawnee Road Alexandria, VA 22312 Telephone: 800.553.6847 Fax: 703.605.6900 E-mail: Online Ordering: Available electronically at Available for a processing fee to U.S. Department of Energy and its contractors, in paper, from: U.S. Department of

  3. September 2004 Water Sampling

    Office of Legacy Management (LM)

    Rio Blanco, Colorado Site October 2013 LMS/RBL/S00513 Available for sale to the public from: U.S. Department of Commerce National Technical Information Service 5301 Shawnee Road Alexandria, VA 22312 Telephone: 800.553.6847 Fax: 703.605.6900 E-mail: Online Ordering: Available electronically at Available for a processing fee to U.S. Department of Energy and its contractors, in paper, from: U.S. Department of

  4. September 2004 Water Sampling

    Office of Legacy Management (LM)

    and Surface Water Sampling at the Rio Blanco, Colorado, Site October 2014 LMS/RBL/S00514 Available for sale to the public from: U.S. Department of Commerce National Technical Information Service 5301 Shawnee Road Alexandria, VA 22312 Telephone: 800.553.6847 Fax: 703.605.6900 E-mail: Online Ordering: Available electronically at Available for a processing fee to U.S. Department of Energy and its contractors, in

  5. September 2004 Water Sampling

    Office of Legacy Management (LM)

    and Surface Water Sampling at the Rio Blanco, Colorado, Site October 2015 LMS/RBL/S00515 Available for sale to the public from: U.S. Department of Commerce National Technical Information Service 5301 Shawnee Road Alexandria, VA 22312 Telephone: 800.553.6847 Fax: 703.605.6900 E-mail: Online Ordering: Available electronically at Available for a processing fee to U.S. Department of Energy and its contractors, in

  6. September 2004 Water Sampling

    Office of Legacy Management (LM)

    5 Produced Water Sampling at the Rulison, Colorado, Site May 2015 LMS/RUL/S00115 Available for sale to the public from: U.S. Department of Commerce National Technical Information Service 5301 Shawnee Road Alexandria, VA 22312 Telephone: 800.553.6847 Fax: 703.605.6900 E-mail: Online Ordering: Available electronically at Available for a processing fee to U.S. Department of Energy and its contractors, in paper,

  7. September 2004 Water Sampling

    Office of Legacy Management (LM)

    Rulison, Colorado, Site February 2014 LMS/RUL/S00509 Available for sale to the public from: U.S. Department of Commerce National Technical Information Service 5301 Shawnee Road Alexandria, VA 22312 Telephone: 800.553.6847 Fax: 703.605.6900 E-mail: Online Ordering: Available electronically at Available for a processing fee to U.S. Department of Energy and its contractors, in paper, from: U.S. Department of

  8. September 2004 Water Sampling

    Office of Legacy Management (LM)

    Rulison, Colorado, Site October 2013 LMS/RUL/S00513 Available for sale to the public from: U.S. Department of Commerce National Technical Information Service 5301 Shawnee Road Alexandria, VA 22312 Telephone: 800.553.6847 Fax: 703.605.6900 E-mail: Online Ordering: Available electronically at Available for a processing fee to U.S. Department of Energy and its contractors, in paper, from: U.S. Department of

  9. September 2004 Water Sampling

    Office of Legacy Management (LM)

    5 Groundwater and Surface Water Sampling at the Rulison, Colorado, Site October 2015 LMS/RUL/S00515 Available for sale to the public from: U.S. Department of Commerce National Technical Information Service 5301 Shawnee Road Alexandria, VA 22312 Telephone: 800.553.6847 Fax: 703.605.6900 E-mail: Online Ordering: Available electronically at Available for a processing fee to U.S. Department of Energy and its

  10. September 2004 Water Sampling

    Office of Legacy Management (LM)

    Natural Gas and Produced Water Sampling at the Rulison, Colorado, Site November 2014 LMS/RUL/S00714 Available for sale to the public from: U.S. Department of Commerce National Technical Information Service 5301 Shawnee Road Alexandria, VA 22312 Telephone: 800.553.6847 Fax: 703.605.6900 E-mail: Online Ordering: Available electronically at Available for a processing fee to U.S. Department of Energy and its

  11. September 2004 Water Sampling

    Office of Legacy Management (LM)

    Produced Water Sampling at the Rulison, Colorado, Site January 2016 LMS/RUL/S00915 Available for sale to the public from: U.S. Department of Commerce National Technical Information Service 5301 Shawnee Road Alexandria, VA 22312 Telephone: 800.553.6847 Fax: 703.605.6900 E-mail: Online Ordering: Available electronically at Available for a processing fee to U.S. Department of Energy and its contractors, in

  12. September 2004 Water Sampling

    Office of Legacy Management (LM)

    Project Shoal, Nevada, Site December 2013 LMS/SHL/S00513 Available for sale to the public from: U.S. Department of Commerce National Technical Information Service 5301 Shawnee Road Alexandria, VA 22312 Telephone: 800.553.6847 Fax: 703.605.6900 E-mail: Online Ordering: Available electronically at Available for a processing fee to U.S. Department of Energy and its contractors, in paper, from: U.S. Department of

  13. September 2004 Water Sampling

    Office of Legacy Management (LM)

    Shoal, Nevada, Site July 2014 LMS/SHL/S00514 Available for sale to the public from: U.S. Department of Commerce National Technical Information Service 5301 Shawnee Road Alexandria, VA 22312 Telephone: 800.553.6847 Fax: 703.605.6900 E-mail: Online Ordering: Available electronically at Available for a processing fee to U.S. Department of Energy and its contractors, in paper, from: U.S. Department of Energy


    Gasoline and Diesel Fuel Update (EIA)

    61- NOIJLVaiSINIWaV NOIlVlAldOdNI AOU3N3 Z661 This publication and other Energy Information Administration (EIA) publications may be purchased from the Superintendent of Documents, U.S. Government Printing Office. AH telephone orders should be directed to: U.S. Government Printing Office McPherson Square Bookstore 1510 H Street, N.W. Washington, DC 20005 (202)653-2050 FAX (202)376-5055 9 a.m. to 5 p.m., eastern time, M-F All mail orders should be directed to: Superintendent of Documents U.S.

  15. M

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    M od e - F ilt e r e d F ibe r A m p l if ie r  2007 R&D 100 Award Entry Form M od e - F ilt e r e d F ibe r A m p l if ie r  Submitting Organization Dahv A.V. Kliner Sandia National Laboratories P.O. Box 969, Mail Stop 9056 Livermore, CA 94551, USA 925-294-2821 (phone) 925-294-2595 (fax) AFFIRMATION: I affirm that all information submitted as a part of, or supplemental to, this entry is a fair and accurate represen- tation of this product.

  16. About EIA - Organization - U.S. Energy Information Administration (EIA)

    Gasoline and Diesel Fuel Update (EIA)

    Howard K. Gruenspecht, Acting Administrator and Deputy Administrator Howard K. Gruenspecht Print friendly PDF Deputy Administrator E-mail: Phone: (202) 586-6351 Fax: (202) 586-0329 Room: 2H-027 Address: U.S. Energy Information Administration 1000 Independence Avenue, S.W. Washington, DC 20585 Duties Howard Gruenspecht was named Deputy Administrator of the U.S. Energy Information Administration (EIA) in March 2003. As the second-in-command at EIA and the agency's top

  17. About EIA - Organization - U.S. Energy Information Administration (EIA)

    Gasoline and Diesel Fuel Update (EIA)

    John Conti, Director of the Office of Integrated Analysis and Forecasting John ContiPrint-friendly PDF Assistant Administrator for Energy Analysis E-mail: Phone: (202) 586-2222 Fax: (202) 586-3045 Room: 2H-073 Address: U.S. Energy Information Administration 1000 Independence Avenue, S.W. Washington, DC 20585 Duties John Conti is the Assistant Administrator for Energy Analysis and analyzes energy supply, demand, and prices including the impact of financial markets on energy

  18. About EIA - Organization - U.S. Energy Information Administration (EIA)

    Gasoline and Diesel Fuel Update (EIA)

    Harvey, Director of the Office of Oil and Gas Stephen Harvey Print-friendly PDF Assistant Administrator for Energy Statistics E-mail: Phone: (202) 586-6012 Fax: (202) 586-9739 Room: 2G-020 Address: U.S. Energy Information Administration 1000 Independence Avenue, S.W. Washington, DC 20585 Duties Stephen Harvey is the Assistant Administrator (AA) for Energy Statistics and is responsible for a wide range of survey, statistical methods, and integration activities related to:

  19. Getting Energized!

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    GETTING ENERGIZED! Teacher's Activity Guide for Elementary Grades 3-6 National Renewable Energy Laboratory Education Programs 1617 Cole Blvd. Golden CO 80401-3393 Tel: (303) 275-3044 Fax: (303) 275-3076 E-mail: URL: ACKNOWLEDGMENTS The Education Programs Office at NREL would like to thank the following individuals for their commitment and hard work in the testing and revising of this activity kit. The expertise of these educators was

  20. GoodwinNUG2013.pptx

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Golden Field Office » Golden Field Office Contacts Golden Field Office Contacts On this page you will find address and contact information for the Golden Field Office. Mailing Address U.S. Department of Energy Golden Field Office 15013 Denver West Parkway Golden, Colorado 80401 Main Number: 720-356-1800 Main Fax: 720-356-1750 Media Inquiries For media inquiries, please email the EERE communications team at Golden Field Office Key Contacts Deputy Assistant Secretary For

  1. Governor JOH

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    lI Si\N" MARTINEZ. Governor JOH r-I A. SANCHEZ. Lieutenant Governor November 1,2012 Jose Franco, Manager Carlsbad Field Office Department of Energy P.O. Box 3090 NEW MEXICO ENVIRONMENT DEPARTMENT Harold Runnels BI,ilding 11 90 Saint Francis Drive (87505) P.O. Box 5469, Santa Fe. NM 87502-5469 Phone (505) 827-0419 Fax (505) 827-03 10 www.nmenv.sto!e.!lIn.lIs CERTIFIED MAIl. - RETURN RECEIPT REQUESTED Farok Sharif, Project Manager Nuclear Waste Partnership LLC P.O. Box 2078 Carlsbad, New

  2. documenttemplate

    Office of Legacy Management (LM)

    Closure Report Central Nevada Test Area Subsurface Corrective Action Unit 443 January 2016 Approved for public release; further dissemination unlimited LMS/CNT/S12760 Available for sale to the public from: U.S. Department of Commerce National Technical Information Service 5301 Shawnee Road Alexandria, VA 22312 Telephone: 800.553.6847 Fax: 703.605.6900 E-mail: Online Ordering: Available electronically at

  3. About INCITE | U.S. DOE Office of Science (SC)

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    About EIA Senior Executive Biographies Adam Sieminski, Administrator Adam Sieminski Print friendly PDF Administrator E-mail: Phone: (202) 586-4361 Fax: (202) 586-0329 Room: 2H-027 Address: U.S. Energy Information Administration 1000 Independence Avenue, S.W. Washington, DC 20585 Biography Adam Sieminski was sworn in on June 4, 2012, as the eighth administrator of the U.S. Energy Information Administration (EIA). From March 2012 to May 2012, while awaiting confirmation as

  4. Scott Burrow

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Scott Burrow Scott Burrow staffportrait Scott Burrow Phone: (510) 486-4313 Fax: (510) 486-4316 Computational Systems Group 1 Cyclotron Road Mail Stop 943-256 Berkeley, CA 94720 Scott Burrow is a system administrator in the Computational Systems Group. Scott is currently the system lead for Carver's testbed and a backup for Carver. Prior to that Scott worked in commercial and high performance computing. Scott served as an IBM consultant on-site for NASA Ames from 2007-2009 and at

  5. Shane Canon

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Shane Canon Shane Canon Shane-Cannon.jpg Shane Richard Canon Project Engineer Data & Analytics Services Group Phone: (510) 486-7024 Fax: (510) 486-4316 1 Cyclotron Road Mail Stop 943-256 Berkeley, CA 94720 US Biographical Sketch Shane Canon joined NERSC in 2000 to serve as a system administrator for the PDSF cluster. While working with PDSF he gained experience in cluster administration, batch systems, parallel file systems and the Linux kernel. In 2005, Shane left LBNL to

  6. Clayton Bagwell

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Clayton Bagwell Clayton Bagwell Clayton-Bagwell.jpg Clayton L. Bagwell Jr. Account & Allocation Support, NIM Development Team Member Phone: (510) 495-2264 Fax: (510) 486-4316 1 Cyclotron Road Mail Stop 943-256 Berkeley, CA 94720 US Biographical Sketch Clayton Bagwell provides Account & Allocation Support and is a primary member of the NIM (NERSC Information Management) system development team. He has a B.S. degree in Information Systems Management from the University of

  7. Clear Sky Detection Paper for Solar Energy

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    J. Reno and C. W. Hansen, "Identification of Periods of Clear Sky Irradiance in Time Series of GHI Measurements," Renewable Energy, 2016. Preprint. DOI: 10.1016/j.renene.2015.12.031 1 Identification of Periods of Clear Sky Irradiance in Time Series of GHI Measurements Matthew J. Reno * and Clifford W. Hansen Sandia National Laboratories, P.O. Box 5800, Albuquerque, NM 87185-1033, USA *Corresponding author. E-mail address: TEL.: +1 505 844 3087; Fax: +1 505 844 7231

  8. Craig Lant

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Craig Lant Craig Lant Craig-Lant.jpg Craig Lant Security Analyst Networking, Servers and Security Group Phone: (510) 423-3373 Fax: (510) 486-4316 1 Cyclotron Road Mail Stop 943R0256 Berkeley, CA 94720 US Biographical Sketch Craig has more than 10 years of experience in a variety of computer security positions, with four years at Berkeley Lab and six years with UC Berkeley. His expertise includes firewalls, network intrusion detection systems, detecting compromised systems, and

  9. DOE - NNSA/NFO -- Contact Us Information

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Contact Information NNSA/NFO Language Options U.S. DOE/NNSA - Nevada Field Office Nevada Field Office Contact Information Street Address: 232 Energy Way North Las Vegas, NV 89030 Mailing Address: U.S. Department of Energy National Nuclear Security Administration Nevada Field Office P.O. Box 98518 Las Vegas, NV 89193-8518 Phone: 702-295-3521 Fax: 702-295-0154 Email: You may also contact us through the Feedback Form Our policy is to reply to inquiries within 48 hours

  10. Microsoft Word - Contact List Template 11-5-14- ali notes.doc

    National Nuclear Security Administration (NNSA)

    Operations E-Mail: Unclassified Fax: 301-903-1998 NMMSS Points-of-Contact for Assistance Name Topic Phone Email Address Karen Antizzo IAEA Reporting General Data Submission Custom Report Requests (301) 903-0872 John Ballard DOE/NNSA Reconciliation Training (301) 903-0092 Elaine Beacom International Reporting (Import/Export) (301) 903-1328 Carl Berger Special Requests and

  11. CMRR SEIS commments Tuesday Final

    National Nuclear Security Administration (NNSA)

    1 W. Cordova, #808, Santa Fe, NM 87505 * Phone and fax: 505.989.7342 * * 1 November 16, 2010 Mr. John Tegtmeier CMRR-NF SEIS Document Manager Los Alamos Site Office 3747 West Jemez Road TA-3 Building 1410 Los Alamos, New Mexico, 87544 By e-mail to Nuclear Watch New Mexico (NWNM) respectfully submits these comments on the needed scope of the Supplemental Environmental Impact Statement for the Nuclear

  12. Environmental Protection Division (ENV)

    National Nuclear Security Administration (NNSA)

    e~Alamos NATIONAL LABORATORY - - l :il . l! IIJ - - Environmental Protection Division (ENV) Environmental Stewardship (ENV-ES) P.O. Box 1663, Mail Stop J978 Los Alamos, New Mexico 87545 (505) 665-8855/FAX: (505) 667-0731 Mr. George Rael Assistant Manager for Enviromnental Operations National Nuclear Security Administration Los Alamos Site Office, MS A316 Date : October 28, 2010 Refer To: ENV-ES: 10-211 SUBJECT: 2008 SITE-WIDE ENVIRONMENTAL IMP ACT STATEMENT MITIGATION ACTION PLAN ANNUAL REPORT

  13. Microsoft PowerPoint - 7_MARY_MCCDONNELL_JOHN_BALLARD_Tips for REporting requirements_presentations_4-29-14.ppt [Compatibility

    National Nuclear Security Administration (NNSA)

    Tips for Successful Reporting to NMMSS by DOE Contractors and NRC Licensees John Ballard, DOE Reconciliation Mary McConnell, NRC Reconciliation LINK Technologies Outline  The NMMSS process  Best Practices  Tips for success  Resources  Facility Performance 2 NMMSS Flow of Data (Generic Depiction of Data Flow) 3 DOE/NRC Form 741 DOE/NRC Form 740M DOE Form DP-749 * Hardcopies by mail (U) * Faxes (U) * Email (U) * REM (U) * CREM (C) * SIPRNet (C) * SecureNet (C) Sites or Facilities

  14. BILL RICHARDSON Governor DIANE DENISH Lieutenant Governor NEW MEXICO

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    NEW MEXICO ENVIRONMENT DEPARTMENT Hazardous Waste Bureau 2905 Rodeo Park Drive East, Building 1 Santa Fe, New Mexico 87505-6303 Phone (50S) 476-6000 Fax (50S) 476-6030 CERTIFIED MAIL - RETURN RECEIPT REQUESTED July 7,2008 David Moody, Manager Carlsbad Field Office Department of Energy P.O. Box 3090 Carlsbad, New Mexico 88221-3090 Farok Sharif, President Washington TRU Solutions LLC P.O. Box 2078 Carlsbad, New Mexico 88221-5608 RE: JUNE 11, 2008 DISPUTE RESOLUTION - TERMS OF

  15. Tri-Party Agreement Agencies Annual Hanford Public Involvement Survey

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    7 Tri-Party Agreement Agencies Annual Hanford Public Involvement Survey 1. How do you usually receive information about Hanford topics? (Please select all that apply) Response Percent Response Count Advisory Board 23.7% 22 Citizens Group 32.3% 30 Ecology website 21.5% 20 website 33.3% 31 Hanford Listserv (email) 54.8% 51 Hanford Mailing (postal) 12.9% 12 Newspaper 48.4% 45 Radio 26.9% 25 Social Media (Facebook, Twitter, etc.) 26.9% 25 Television 17.2% 16 Work Announcements 11.8% 11 I

  16. Microsoft Word - userreportformat.docx

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Your Title in Bold 14 pt. Times New Roman lnclude author(s), affiliation, postal and e-mail addresses, and PRN here in 12 pt. Times New Roman. The contact person's name should be underlined. Body of report begins here. All writing should be on 8.5x 11 paper layout with 1" top and bottom margins, 1.25" right and left margins. Please single-space and use 12 pt. Times New Roman font throughout, double-spacing between paragraphs. Text should be in left alignment. If you have any

  17. Statement of Frank S. Swain, Chief Counsel for Advocacy, US Small Business Administration before the Subcommittee on Antitrust and Restraint of Trade, House Small Business Committee on utility competition with small businesses, May 22, 1984

    SciTech Connect (OSTI)

    Not Available


    Mr. Swain's statement and documentation present evidence that utilities have a competitive advantage over small businesses when they engage in unregulated activities because of cross subsidies and the effect on supplies and products that a large enterprise can have. The statement focuses on energy-related programs and the Commercial and Apartment Conservation Service (CACS) program with its mandated energy audits. Utility services that provide financing for conservation programs are less disruptive than those which provide supplies and installation. An appendix describing the electronic mail and postal service competition illustrates many of the principles involved.

  18. NOTICE TO SUPPLIERS Fraudulent Quote Requests/Purchase Order E-Mail Activity

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    * The email message may be poorly written, with misspellings and awkward sentence structure. * The sender's email address is not the same as CNS standard email address domain. The email address domain for Y-12:, for Pantex: Email from either site may also be in this form: * The message and purchase order requests shipment/delivery of products to non-CNS facilities. * The message will include an attachment that is designed to look like a purchase

  19. NOTICE TO SUPPLIERS Fraudulent Quote Requests/Purchase Order E-Mail Activity

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

     The email message may be poorly written, with misspellings and awkward sentence structure.  The senders email address is not the same as CNS standard email address domain. The email address domain for Y-12:, for Pantex:  The message and purchase order requests shipment/delivery of products to non-CNS facilities.  The message will include an attachment that is designed to look like a purchase order, and includes a logo or other graphic, and a signature


    Energy Savers [EERE]

    health program requirements related to laser and electron beam equipment at SLAC ... principles necessary for safe operation of laser systems and energetic beam equipment. ...

  1. E-Alerts: Environmental pollution and control (solid waste pollution and control). E-mail newsletter

    SciTech Connect (OSTI)


    The paper discusses pollution by solid wastes including garbage, scrap, junked automobiles, spoil, sludge, containers; Disposal methods such as composts or land application, injection wells, incineration, sanitary landfills; Mining wastes; Processing for separation and materials recovery; Solid waste utilization; Recycling; Biological and ecological effects; Superfund (Records of Decision, etc.); SITE technology; Laws, legislation, and regulations; Public administration; Economics; Land use. The discussion includes disposal of concentrated or pure liquids such as brines, oils, chemicals, and hazardous materials.

  2. Via E-Mail Michael Li Electricity Policy Specialist U.S. Department of Energy

    Energy Savers [EERE]

    Veterans Solving Energy Challenges Veterans Solving Energy Challenges August 6, 2014 - 10:31am Addthis Ronald J. (R.J.) McIntosh receives a Certificate of Special Congressional Recognition from Rep. Suzan DelBene of Washington. | Photo courtesy of Rep. Suzan DelBene’s office Ronald J. (R.J.) McIntosh receives a Certificate of Special Congressional Recognition from Rep. Suzan DelBene of Washington. | Photo courtesy of Rep. Suzan DelBene's office Six of the eight FEMP veteran internship

  3. E-Alerts: Combustion, engines, and propellants (reciprocation and rotating combustion engines). E-mail newsletter

    SciTech Connect (OSTI)


    Design, performance, and testing of reciprocating and rotating engines of various configurations for all types of propulsion. Includes internal and external combustion engines; engine exhaust systems; engine air systems components; engine structures; stirling and diesel engines.

  4. Site Office Contracting Officer E-mail address Ames Site Office...

    National Nuclear Security Administration (NNSA) Sandia Site Office Dave Ferguson Savannah River Site Office Carol Elliot Y-12 Site Office Jill ...

  5. C:MydocsMYDOCSHATTIERECS97recsForms97Mail.PDF

    Gasoline and Diesel Fuel Update (EIA)

    ... 06 Coal or Coke 07 Wood 08 Solar Collectors 21 Other Fuel (SPECIFY): ... How do you pay for your air-conditioning costs? 1 We pay directly to the gas or ...

  6. By E-Mail Daniel Cohen Assistant General Counsel for Legislation, Regulation, and Energy Efficiency

    Energy Savers [EERE]

    of Energy Buying a Car? Find Out What it Will REALLY Cost You Each Year Buying a Car? Find Out What it Will REALLY Cost You Each Year November 9, 2009 - 12:52pm Addthis Allison Casey Senior Communicator, NREL If you're in the market for a new car, you've probably been doing a lot of research. Talking to friends, reading reviews, scoping out other cars on the road, maybe even taking some test drives. You probably have a list of things you want in car, and you should consider all of these

  7. E-Alerts: Energy (engine studies (energy related)). E-mail newsletter

    SciTech Connect (OSTI)


    Operation and design of engines when related to energy conservation and energy use. Covers turbine, rotary, and reciprocating engines.

  8. Cyber in the Cloud -- Lessons Learned from INL's Cloud E-Mail Acquisition

    SciTech Connect (OSTI)

    Troy Hiltbrand; Daniel Jones


    As we look at the cyber security ecosystem, are we planning to fight the battle as we did yesterday, with firewalls and intrusion detection systems (IDS), or are we sensing a change in how security is evolving and planning accordingly? With the technology enablement and possible financial benefits of cloud computing, the traditional tools for establishing and maintaining our cyber security ecosystems are being dramatically altered.

  9. By E-Mail Daniel Cohen Assistant General Counsel for Legislation...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ... to incorporate by reference specific clauses from IEC Standard 62301, First Edition. 2 ... verification programs that utilize independent testing laboratories and are developed ...

  10. ORISE: Contact information for REAC/TS - phone numbers, e-mail

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Contact Us Radiation Emergency Assistance CenterTraining Site staff contact information Emergency Number 865.576.1005 (Ask for REACTS) Nicholas Dainiak, M.D., FACP Medical and...

  11. > FAQs for Survey Form EIA-888

    Gasoline and Diesel Fuel Update (EIA)

    Fax - fax price(s) to a secure, toll-free fax number, 1-877-359-6637 Telephone ... of the Federal Energy Administration Act of 1974 (FEAA) (Public Law 93-275), as amended. ...

  12. FAQs for Survey Form EIA-878

    Annual Energy Outlook [U.S. Energy Information Administration (EIA)]

    Fax - fax prices to a secure, toll-free fax number, 1-877-359-6637 Telephone ... of the Federal Energy Administration Act of 1974 (FEAA) (Public Law 93-275), as amended. ...

  13. Application for use of BPA Right-of-Way

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    ADDRESS: EMAIL ADDRESS: FAX NO: FAX NO: 7. LOCATION OF PROPERTY (Legal description of the property. This information is on your title, insurance policy, courthouse deed, or your...

  14. EIA-800

    U.S. Energy Information Administration (EIA) Indexed Site

    Email: Floor, Suite): Fax: (202) 586-1076 City: State: Zip: - Secure File Transfer: Electronic Transmission: City: State: Zip: - Contact Name: Phone No.: Ext: Fax No.: Questions? ...

  15. Summaries of FY 1995 engineering research

    SciTech Connect (OSTI)


    The individual engineering project summaries follow the program overview. The summaries are ordered alphabetically by name of institution and so the table of contents lists all the institutions at which projects were sponsored in fiscal year 1995. Each project entry begins with an institutional-departmental heading. The names of investigators are listed immediately below the title. The funding level for fiscal year 1995 appears to the right of title; it is followed by the budget activity number. These numbers categorize the projects for budgetary purposes and the categories are described in the budget number index. A separate index of Principal Investigators includes phone number, fax number and e-mail address, where available. The fiscal year in which either the project began or was renewed and the anticipated duration in years are indicated respectively by the first two and last digits of the sequence directly below the budget activity number. The summary description of the project completes the entry.

  16. Environmental Sciences Division: Summaries of research in FY 1996

    SciTech Connect (OSTI)


    This document describes the Fiscal Year 1996 activities and products of the Environmental Sciences Division, Office of Biological and Environmental Research, Office of Energy Research. The report is organized into four main sections. The introduction identifies the basic program structure, describes the programs of the Environmental Sciences Division, and provides the level of effort for each program area. The research areas and project descriptions section gives program contact information, and provides descriptions of individual research projects including: three-year funding history, research objective and approach used in each project, and results to date. Appendixes provide postal and e-mail addresses for principal investigators and define acronyms used in the text. The indexes provide indexes of principal investigators, research institutions, and keywords for easy reference. Research projects are related to climatic change and remedial action.

  17. Retrospective Analysis of Communication Events - Understanding the Dynamics of Collaborative Multi-Party Discourse

    SciTech Connect (OSTI)

    Cowell, Andrew J.; Haack, Jereme N.; McColgin, Dave W.


    This research is aimed at understanding the dynamics of collaborative multi-party discourse across multiple communication modalities. Before we can truly make sig-nificant strides in devising collaborative communication systems, there is a need to understand how typical users utilize com-putationally supported communications mechanisms such as email, instant mes-saging, video conferencing, chat rooms, etc., both singularly and in conjunction with traditional means of communication such as face-to-face meetings, telephone calls and postal mail. Attempting to un-derstand an individuals communications profile with access to only a single modal-ity is challenging at best and often futile. Here, we discuss the development of RACE Retrospective Analysis of Com-munications Events a test-bed prototype to investigate issues relating to multi-modal multi-party discourse.

  18. Beamline 12.3.1

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    view it Life Sciences Division, Berkeley Lab Phone: (510) 486-8179 Fax: (510) 486-5298 Jane Tanamachi Life Sciences Division, Berkeley Lab Phone: (510) 495-22404 Fax: (510)...


    National Nuclear Security Administration (NNSA)

    Services 702-295-6582 702-858-5587 (cell) 702-295-7699 (fax) From: Michael Skougard ... Services 702-295-6582 702-858-5587 (cell) 702-295-7699 (fax) From: Morris, Patrick ...


    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    t 092007 15:28 FAX 301 903 4656 CAPITAL REGION 0 j002 SDOE F 1325.8 (8-89) EFG (0790) ... 092007 15:29 FAX 301 903 4656 CAPITAL REGION 003 * Implemented a more robust ...

  1. Microsoft Word - 13-NEAC-Plant-Closures

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ... 263-1646 Fax: (608) 263-7451 www.engr.wisc.eduep Finding: There have been five ... 263-1646 Fax: (608) 263-7451 www.engr.wisc.eduep Recommendation: The NRT recommends ...

  2. eia-910.xls

    U.S. Energy Information Administration (EIA) Indexed Site

    Indicate unit of measure by placing an "X" in the appropriate box. Commercial Residential ... Address 1: Contact Name: Fax: (202) 586-1076 Ext: Fax No.: enter an "X...

  3. Victor Ramirez

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Victor Ramirez Title: Research Specialist 2 Office Tel. : (225) 578-9374 Fax: (225) 578-6954

  4. BPA-2012-00676-FOIA Request

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    *** FO1.A OFFICE TILTS DATE: DUE DATE: Name: Francisco Carvalho Organization: University Professor Address: Phone: FAX: Email: Description of...

  5. Metal-Air Electric Vehicle Battery: Sustainable, High-Energy Density, Low-Cost Electrochemical Energy Storage Metal-Air Ionic Liquid (MAIL) Batteries

    SciTech Connect (OSTI)


    Broad Funding Opportunity Announcement Project: ASU is developing a new class of metal-air batteries. Metal-air batteries are promising for future generations of EVs because they use oxygen from the air as one of the batterys main reactants, reducing the weight of the battery and freeing up more space to devote to energy storage than Li-Ion batteries. ASU technology uses Zinc as the active metal in the battery because it is more abundant and affordable than imported lithium. Metal-air batteries have long been considered impractical for EV applications because the water-based electrolytes inside would decompose the battery interior after just a few uses. Overcoming this traditional limitation, ASUs new battery system could be both cheaper and safer than todays Li-Ion batteries, store from 4-5 times more energy, and be recharged over 2,500 times.

  6. Search for: All records | SciTech Connect

    Office of Scientific and Technical Information (OSTI)

    Silverstein, Eva (1) Smith, Kendrick M., E-mail:, E-mail: ... Mirbabayi, Mehrdad ; Senatore, Leonardo ; Smith, Kendrick M., E-mail: ...

  7. Search for: All records | SciTech Connect

    Office of Scientific and Technical Information (OSTI)

    ... Enhancement in magnetic properties of magnesium substituted bismuth ferrite nanoparticles Xu, Jianlong ; Xie, Dan, E-mail:, E-mail: ...

  8. Industrial demand-side management programs: What`s happened, what works, what`s needed

    SciTech Connect (OSTI)

    Jordan, J.A.; Nadel, S.M.


    In order to analyze experience to date with industrial demand-side management (DSM), a survey of utilities was conducted and a database of industrial DSM programs was prepared. More than eighty utilities and third-party organizations were interviewed. Data were collected via phone, fax, and/or mail from the utilities and entered into a database. In order to limit the scope of this study, the database contains incentive-based, energy-saving programs and not load management or information-only programs (including technical assistance programs). Programs in the database were divided into four categories: two ``prescriptive rebate`` categories and two ``custom rebate`` categories. The database contains 31 incentive-based, energy-saving industrial DSM programs offered by 17 utilities. The appendix to this report summarizes the results approximately 60 industrial DSM programs. Most of the programs included in the appendix, but not in the database, are either C&I programs for which commercial and industrial data were not disaggregated or new industrial DSM programs for which data are not yet available.

  9. Hyekyung Kim | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Hyekyung Kim Hyekyung Kim Postdoctoral Appointee E-mail clarisse

  10. Osman Eryilmaz | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Osman Eryilmaz Principal Materials Scientist E-mail eryilmaz

  11. Balendra Sutharshan | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Balendra Sutharshan Chief Operations Officer - EGS E-mail bsutharshan

  12. Ryne T. Willig | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Ryne T. Willig Safety Associate - EGS E-mail rwillig

  13. Search for: All records | SciTech Connect

    Office of Scientific and Technical Information (OSTI), E-mail:, E-mail:, ..., E-mail:, E-mail:, ...

  14. Better Buildings Neighborhood Program

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ... * Contest held * Neighborhood meetings * Contest had participants * Social media * Direct mail * Social media applications * Direct mail resulted in applications * Telethon ...

  15. Desmond Toa | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Desmond Toa Desmond Toa Desmond Toa Graduate Student E-mail: Website: Princeton University

  16. Microsoft Word - Revision 2 06-16-2014.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    0 Nevada National Security Site Profile Sheet Nevada National Security Site Profile Sheet - Revision 2 - June 2014 A. Waste Generator or Classified Matter Originator Information 1. Company name: 2. Address: 3. Generator/Originator Facility: 4. Primary Technical Contact: Email: Phone: Fax: 5. DOE Point of Contact: Email: Phone: Fax: 6. Certification Official: Email: Phone: Fax: 7. Generator's EPA Identification Number (If profile involves hazardous waste): 8. If the waste or classified matter is

  17. Microsoft Word - frm-1901rev1.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Form FRM-1901 ASBESTIFORM SHIPMENT NOTIFICATION Fax to (702) 295-1153 02/14/08 Rev. 01 Page 1 of 1 The generator signed below shall submit this notification to NNSA/NSO at least seven days in advance of arrival of shipment of Asbestiform low-level waste to the Area 5 Radioactive Waste Management Site (RWMS). Generator: Generator Address: Generator Telephone Number: Fax Number: Transporter Name: Transporter Address: Transporter Telephone Number: Fax Number: Waste Stream Identification Number:

  18. Beyond telecommuting

    SciTech Connect (OSTI)

    Loken, S.C.; Niles, J.


    Although there has been considerable discussion about how telecommunications will affect the demand for transportation, most studies have focused on substituting telecommunications for transportation. For example, telephone and video conferencing can replace travel for meetings; electronic mail can replace postal service. More importantly, people can telecommute part-time or full- time using telecommunications instead of traveling to work. There are many other examples of reducing or eliminating travel by telecommunicating, but what may not be obvious is how telecommunications stimulates travel. As the volume of telecommunications traffic increases, travel has been stimulated in a number of important ways. Increased telecommunications has fostered economic growth that has, in turn, increased travel. With increased use of telecommunications, people move farther apart so economic and social trips become, on the average, longer. to ensure that society continues to benefit from this stimulation, the government will have to devote considerable attention to developing the telecommunications infrastructure and to supporting appropriate telecommunications policy. In particular, governments must learn to allocate resources and attention reasonably to ensure that systems support economic and social growth.

  19. Beyond telecommuting: A new paradigm for the effect of telecommunications on travel

    SciTech Connect (OSTI)

    Niles, J.S.


    Conventional wisdom about social and economic behavior holds that the use of telecommunications is a natural substitute for transportation. For example, telephone calls can replace travel to meetings, and facsimile or electronic-mail transmission of documents substitutes for courier or postal delivery. The moving of information can replace the moving of period and goods. Vehicle traffic on the national transportation infrastructure can be replaced by digital traffic on what is now called the National Information Infrastructure (NII). A leading example is telecommuting. This means using telecommunications to replace commuting between home and work. Telecommuting is an optional way of expanding employees` work locations in those circumstances where it yields both improved organizational performance and employee satisfication. Telecommuting accounts for 7.6 million U.S. workers as of early 1993, up 15% from the 6.6 million counted in 1992. The growth of telecommuting has been strong for the past five years. No one has identified any reasons to suggest that this growth will abate in the forseeable future.


    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Address: City: State: Zip Code: Phone: Fax: County: Federal Identification Number: Tax Status: Description of item or items to be purchased: (use an additional sheet if...