Powered by Deep Web Technologies
Note: This page contains sample records for the topic "dp road tract" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Environmental assessment for the transfer of the DP Road tract to the County of Los Alamos. Final document  

SciTech Connect

The purpose of an Environmental Assessment (EA) is to provide the DOE with sufficient evidence and analysis to determine whether to prepare an Environmental Impact Statement (EIS) or a Finding of No Significant Impact (FONSI). Additional considerations (such as costs, timing, or non-environmental legal issues) that influence DOE decisions are not analyzed in this EA. As part of its initiative to fulfill its responsibilities to provide support for the County of Los Alamos (the County), in northern New Mexico, the US Department of Energy (DOE) proposes to transfer ownership of the undeveloped, so called, DP Road property to the County. Transfer of this tract would permanently reduce the size of Los Alamos National Laboratory (LANL) by approximately 0.1%. Approximately 12 hectares (28 acres) would be changed from an undeveloped to a developed status. This would result in an equivalent loss of wildlife habitat. A hypothetical accident was analyzed that evaluated potential radiological dose to the public at the DP Road tract from LANL operations. The dose to the hypothetical worker population of 450 new employees could result in an increase of approximately three latent cancer fatalities in the population. The DOE finds that there would be no significant impact from proceeding with the transfer of the 28-acre tract for development and use as a business park or for light industrial purposes.




Biological assessment for the transfer of the DP land tract  

SciTech Connect

The Department of Energy (DOE) is proposing to transfer to the County of Los Alamos up to 10-ha (25-ac) of federal land located in Technical Area-21 to be developed for commercial uses. Previous studies for the proposed land transfer area indicate that potential habitat for four threatened, endangered, and sensitive species occurs in or adjacent to the proposed land transfer area. These include the northern goshawk (federal species of concern), Mexican spotted owl (federal threatened), the spotted bat (federal species of concern, state threatened), die peregrine falcon (federal endangered, state endangered), and the. In order to determine the possible influences of the land transfer on these organisms, information from species-specific surveys was collected. These surveys were used to confirm the presence of these species or to infer their absence in or near the project area. It was concluded that none of die above mentioned species occur in the project area. Stretches of the stream channel within Los Alamos Canyon have been identified as palustrine and riverine, temporarily flooded wetlands. The proposed land transfer should not affect these wetlands.

Keller, D.C.



DP CleanTech Company Limited | Open Energy Information  

Open Energy Info (EERE)

DP CleanTech Company Limited Jump to: navigation, search Name: DP CleanTech Company Limited Place: Chaoyang District, Beijing Municipality, China Sector: Biomass Product:...


Effects of Dilute Acid Pretreatment on Cellulose DP and the Relationship Between DP Reduction and Cellulose Digestibility  

SciTech Connect

The degree of polymerization(DP) of cellulose is considered to be one of the most important properties affecting the enzymatic hydrolysis of cellulose. Various pure cellulosic and biomass materials have been used in a study of the effect of dilute acid treatment on cellulose DP. A substantial reduction in DP was found for all pure cellulosic materials studied even at conditions that would be considered relatively mild for pretreatment. The effect of dilute acid pretreatment on cellulose DP in biomass samples was also investigated. Corn stover pretreated with dilute acid under the most optimal conditions contained cellulose with a DPw in the range of 1600{approx}3500, which is much higher than the level-off DP(DPw 150{approx}300) obtained with pure celluloses. The effect of DP reduction on the saccharification of celluloses was also studied. From this study it does not appear that cellulose DP is a main factor affecting cellulose saccharification.

Wang, W.; Chen, X.; Tucker, M.; Himmel, M. E.; Johnson, D. K.



WINDERMERE RD WesternRoadWesternRoad  

E-Print Network (OSTI)

WINDERMERE RD N 2 210 Kilometres 186 189 194 WesternRoadWesternRoad Oxford Street Oxford Street 2 2 Street (9 kms) · Turn left (west) onto Oxford Street and follow to Wharncliffe Road (4 kms) · Turn right (north) onto Wharncliffe Road and follow to the fifth set of traffic lights · Turn left (west

Sinnamon, Gordon J.


DOE-DP-STD-3016-99 | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

DP-STD-3016-99 DP-STD-3016-99 DOE-DP-STD-3016-99 February 26, 1999 DOE-DP-STD-3016-99: Limited Standard; Hazard Analysis Reports for Nuclear Explosive Operations Replaced by DOE-NA-3016-2006 This technical standard applies to the conduct of hazard analyses and preparation of hazard analysis reports (HARs) for nuclear explosive operations (NEOs) conducted by the Department of Energy (DOE). This standard addresses operation-specific HARs and their interface with facility safety basis documents (Safety Analysis Reports [SARs] or other DOE-approved safety basis documents). DOE-DP-STD-3016-99, Limited Standard; Hazard Analysis Reports for Nuclear Explosive Operations More Documents & Publications Technical Standards, DOE Orders and Applicable CFRs/DEAR Crosswalk - February 2, 2002


Book Review: Hegel's Absolute: An Introduction to Reading the Phenomenology of Spirit Verene, D.P. State University of New York Press, Albany, 2007  

E-Print Network (OSTI)

Book Reviews 63 Hegel's Absolute: An Introduction to Reading the Phenomenology of Spirit Verene, D.P. State University of New York Press, Albany, 2007 Review by Fabio Escobar Castelli, Erie Community College Donald Phillip Verene's latest work... on Hegel is a precise and brief contribution to the "Introduction to Hegel" scholarship. As an exercise in brevity, its summation of the Phenomenology is a laud able triumph. As a skeletal presentation of the Notion on its road of despair, however...

Castelli, Fabio Escobar


Berkeley Lab UNIX-based Distributed Printing (DP)  

NLE Websites -- All DOE Office Websites (Extended Search)

Berkeley Lab UNIX-based Distributed Printing (DP) Berkeley Lab UNIX-based Distributed Printing (DP) LBNL Computing Services supports a variety of printers located throughout the Laboratory through its UNIX-based Distributed Printing System. Make sure to read the UNIX distributed printing overview. See Novell printing for information on Novell-based printing here. Berkeley Lab UNIX-based Distributed Printing (DP) Information Overview Print commands Print charges Printer lists (by division, etc.) Add a new DP printer name paper sizes (a4, etc.) Fixes for common problems Deleting print jobs on Solaris Printer-specific information Groff (GNU ditroff) on Sun & SGI System Admin Information CUPS printing information CUPS FAQ LINUX test suite of files; etc. Setting default printer using lpoptions Test suite of print files


DP awards showcase KCP collaboration | National Nuclear Security  

National Nuclear Security Administration (NNSA)

DP awards showcase KCP collaboration | National Nuclear Security DP awards showcase KCP collaboration | National Nuclear Security Administration Our Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy Emergency Response Recapitalizing Our Infrastructure Continuing Management Reform Countering Nuclear Terrorism About Us Our Programs Our History Who We Are Our Leadership Our Locations Budget Our Operations Media Room Congressional Testimony Fact Sheets Newsletters Press Releases Speeches Events Social Media Video Gallery Photo Gallery NNSA Archive Federal Employment Apply for Our Jobs Our Jobs Working at NNSA Blog Home > NNSA Blog > DP awards showcase KCP collaboration DP awards showcase KCP collaboration Posted By Office of Public Affairs More than 100 individuals from several Kansas City Plant teams received


DOE-DP-STD-3016-99 | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

1999 DOE-DP-STD-3016-99: Limited Standard; Hazard Analysis Reports for Nuclear Explosive Operations Replaced by DOE-NA-3016-2006 This technical standard applies to the conduct of...


Cefas contract report DP321 Wave Glider trial, final report;  

E-Print Network (OSTI)

with various instruments, solar panels and battery packs, and a sub-sea sled providing steering and propulsionCefas contract report DP321 Wave Glider trial, final report; September 2013 Authors: Tom Hull, Dave


East Avenue Truck Inspection Patterson Pass Road Vasco Road  

NLE Websites -- All DOE Office Websites (Extended Search)

Vasco Road Thunderbird Lane Greenville Road Greenville Road Directions to the SandiaCA - Visitor Badge Office Interstate 580 - OaklandSan Francisco, Traveling Eastbound * Exit...


Separable Optical Potentials for (d,p) Reactions  

E-Print Network (OSTI)

An important ingredient for applications of nuclear physics to e.g. astrophysics or nuclear energy are the cross sections for reactions of neutrons with rare isotopes. Since direct measurements are often not possible, indirect methods like (d,p) reactions must be used instead. Those (d,p) reactions may be viewed as effective three-body reactions and described with Faddeev techniques. An additional challenge posed by (d,p) reactions involving heavier nuclei is the treatment of the Coulomb force. To avoid numerical complications in dealing with the screening of the Coulomb force, recently a new approach using the Coulomb distorted basis in momentum space was suggested. In order to implement this suggestion, one needs not only to derive a separable representation of neutron- and proton-nucleus optical potentials, but also compute the Coulomb distorted form factors in this basis.

Ch. Elster; L. Hlophe; V. Eremenko; F. M. Nunes; G. Arbanas; J. E. Escher; I. J. Thompson



Separable Optical Potentials for (d,p) Reactions  

E-Print Network (OSTI)

An important ingredient for applications of nuclear physics to e.g. astrophysics or nuclear energy are the cross sections for reactions of neutrons with rare isotopes. Since direct measurements are often not possible, indirect methods like (d,p) reactions must be used instead. Those (d,p) reactions may be viewed as effective three-body reactions and described with Faddeev techniques. An additional challenge posed by (d,p) reactions involving heavier nuclei is the treatment of the Coulomb force. To avoid numerical complications in dealing with the screening of the Coulomb force, recently a new approach using the Coulomb distorted basis in momentum space was suggested. In order to implement this suggestion, one needs not only to derive a separable representation of neutron- and proton-nucleus optical potentials, but also compute the Coulomb distorted form factors in this basis.

Elster, Ch; Eremenko, V; Nunes, F M; Arbanas, G; Escher, J E; Thompson, I J



Forest Roads (Minnesota)  

Energy.gov (U.S. Department of Energy (DOE))

Proposed forest roads must be approved and designated by the Commissioner of the Department of Natural Resources.


Scott Stadium Stadium Road  

E-Print Network (OSTI)

Scott Stadium Stadium Road Residence Hereford College Alderman Road Residence Area Aquatic Increase Service to the Corner I0 750 1,500375 Feet Coordinate System: NAD 1983 StatePlane Virginia South 2: 36.7667 Latitude Of Origin: 36.3333 Units: Foot US #12;Scott Stadium Stadium Road Residence

Acton, Scott


Road Accidents and Research  

Science Journals Connector (OSTI)

... of speed); later still to lack of care in all road users without exception (pedestrians, cyclists and drivers), that is, the whole community. Before blaming the 'human ... to probe into such other accident causes as the varying number of traffic units including pedestrians brought on to the roads by more hours of sunshine. Two drought years increased ...




Hazards of the Road  

Science Journals Connector (OSTI)

... judges), the meeting considered its subject, under four main headings: the driver, the pedestrian, the vehicle and the road. No doubt remained at the conclusion that the fitness ... 1949 (when the Road Research Laboratory first prepared comprehensive records) and 1961, casualties to pedestrians have been increasing as traffic increased but not in direct proportion. On the other ...




Visibility and Road Accidents  

Science Journals Connector (OSTI)

... road accidents from a very unusual point of view. These writers investigated the beliefs of pedestrians regarding their own visibility, to see how far these beliefs compared with their actual ... drive.


Note: This page contains sample records for the topic "dp road tract" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Rapid road repair vehicle  

DOE Patents (OSTI)

Disclosed is a rapid road repair vehicle capable of moving over a surface to be repaired at near normal posted traffic speeds to scan for and find at the high rate of speed, imperfections in the pavement surface, prepare the surface imperfection for repair by air pressure and vacuum cleaning, applying a correct amount of the correct patching material to effect the repair, smooth the resulting repaired surface, and catalog the location and quality of the repairs for maintenance records of the road surface. The rapid road repair vehicle can repair surface imperfections at lower cost, improved quality, at a higher rate of speed than was not heretofor possible, with significantly reduced exposure to safety and health hazards associated with this kind of road repair activities in the past. 2 figs.

Mara, L.M.



Rapid road repair vehicle  

DOE Patents (OSTI)

Disclosed is a rapid road repair vehicle capable of moving over a surface to be repaired at near normal posted traffic speeds to scan for and find an the high rate of speed, imperfections in the pavement surface, prepare the surface imperfection for repair by air pressure and vacuum cleaning, applying a correct amount of the correct patching material to effect the repair, smooth the resulting repaired surface, and catalog the location and quality of the repairs for maintenance records of the road surface. The rapid road repair vehicle can repair surface imperfections at lower cost, improved quality, at a higher rate of speed than was was heretofor possible, with significantly reduced exposure to safety and health hazards associated with this kind of road repair activities in the past.

Mara, Leo M. (Livermore, CA)



The Road to 2010  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Road to 2010 Road to 2010 Addressing the nuclear question in the twenty first century July 2009 The Road to 2010 Addressing the nuclear question in the twenty first century Presented to Parliament by the Prime Minister, by Command of Her Majesty July 2009 Cm 7675 £14.35 Photograph on page 16 by EDF; © EDF Photograph on page 20 by BNFL; © BNFL, image from www.IAEA.org Photograph on page 26 by British Army; © Crown copyright/MoD, image from www.photos.mod.uk Photograph on page 34 by CTBTO; © CTBTO Preparatory Commission, image from www.CTBTO.org Photograph on pages 42 and 45 by Dean Calma; © Dean Calma, image from www.IAEA.org © Crown Copyright 2009 The text in this document (excluding the Royal Arms and other departmental or agency logos) may be reproduced free of


Rapid road repair vehicle  

DOE Patents (OSTI)

Disclosed are improvments to a rapid road repair vehicle comprising an improved cleaning device arrangement, two dispensing arrays for filling defects more rapidly and efficiently, an array of pre-heaters to heat the road way surface in order to help the repair material better bond to the repaired surface, a means for detecting, measuring, and computing the number, location and volume of each of the detected surface imperfection, and a computer means schema for controlling the operation of the plurality of vehicle subsystems. The improved vehicle is, therefore, better able to perform its intended function of filling surface imperfections while moving over those surfaces at near normal traffic speeds.

Mara, Leo M. (Livermore, CA)



Performance Measurement in the Road Sector: A Cross-Country Review of  

Open Energy Info (EERE)

Performance Measurement in the Road Sector: A Cross-Country Review of Performance Measurement in the Road Sector: A Cross-Country Review of Experience Jump to: navigation, search Tool Summary LAUNCH TOOL Name: Performance Measurement in the Road Sector: A Cross-Country Review of Experience Agency/Company /Organization: ITF Complexity/Ease of Use: Not Available Website: www.internationaltransportforum.org/jtrc/DiscussionPapers/DP201210.pdf Related Tools Handbook for Handling, Storing, and Dispensing E85 London Congestion Pricing: Implications for Other Cities Bike-Sharing:History, Impacts, Models of Provision, and Future ... further results Find Another Tool FIND TRANSPORTATION TOOLS This report focuses on reviewing performance requirements and indicators established by developed countries worldwide. Additionally, the concept of


Research and Road Traffic  

Science Journals Connector (OSTI)

... been advocated for Great Britain within my knowledge, deserve other than the fervent opposition of pedestrians as well as motorists. They can do nothing for safety?they do not discover ... relate the number of road fatalities in a place to the amount of traffic flow (pedestrian and other) there. It would establish at an early moment the machinery for measuring ...




Tweets on the road  

E-Print Network (OSTI)

The pervasiveness of mobile devices, which is increasing daily, is generating a vast amount of geo-located data allowing us to gain further insights into human behaviors. In particular, this new technology enables users to communicate through mobile social media applications, such as Twitter, anytime and anywhere. Thus, geo-located tweets offer the possibility to carry out in-depth studies on human mobility. In this paper, we study the use of Twitter in transportation by identifying tweets posted from roads and rails in Europe between September 2012 and November 2013. We compute the percentage of highway and railway segments covered by tweets in 39 countries. The coverages are very different from country to country and their variability can be partially explained by differences in Twitter penetration rates. Still, some of these differences might be related to cultural factors regarding mobility habits and interacting socially online. Analyzing particular road sectors, our results show a positive correlation b...

Lenormand, Maxime; Colet, Pere; Ramasco, Jos J



Time domain simulation of a one line failure for a DP-assisted mooring system  

Science Journals Connector (OSTI)

This paper focuses on the research of a semi-submersible platform equipped with a DP-assisted mooring system. ... assisted mooring system and the model of the platform motion, a time domain simulation program is ...

Jianxun Zhu; Liping Sun; Shengnan Liu



NNSA DP does it again! Collects boxes and boxes of toys | National Nuclear  

National Nuclear Security Administration (NNSA)

DP does it again! Collects boxes and boxes of toys | National Nuclear DP does it again! Collects boxes and boxes of toys | National Nuclear Security Administration Our Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy Emergency Response Recapitalizing Our Infrastructure Continuing Management Reform Countering Nuclear Terrorism About Us Our Programs Our History Who We Are Our Leadership Our Locations Budget Our Operations Media Room Congressional Testimony Fact Sheets Newsletters Press Releases Speeches Events Social Media Video Gallery Photo Gallery NNSA Archive Federal Employment Apply for Our Jobs Our Jobs Working at NNSA Blog Home > NNSA Blog > NNSA DP does it again! Collects boxes ... NNSA DP does it again! Collects boxes and boxes of toys Posted By Office of Public Affairs NNSA Defense Programs today presented hundreds of toys to the U.S. Marine


Size-Resolved Particle Number and Volume Emission Factors for On-Road  

NLE Websites -- All DOE Office Websites (Extended Search)

Size-Resolved Particle Number and Volume Emission Factors for On-Road Size-Resolved Particle Number and Volume Emission Factors for On-Road Gasoline and Diesel Motor Vehicles Title Size-Resolved Particle Number and Volume Emission Factors for On-Road Gasoline and Diesel Motor Vehicles Publication Type Journal Article Year of Publication 2009 Authors Ban-Weiss, George, Melissa M. Lunden, Thomas W. Kirchstetter, and Robert A. Harley Journal Journal of Aerosol Science Keywords emission, motor vehicle, particle number, size distribution, tunnel Abstract Average particle number concentrations and size distributions from ~61 000 light-duty (LD) vehicles and ~2500 medium-duty (MD) and heavy-duty (HD) trucks were measured during the summer of 2006 in a San Francisco Bay area traffic tunnel. One of the traffic bores contained only LD vehicles, and the other contained mixed traffic, allowing pollutants to be apportioned between LD vehicles and diesel trucks. Particle number emission factors (particle diameter Dp > 3 nm) were found to be (3.9 ± 1.4) x 1014 and (3.3 ± 1.3) x 1015 # kg-1 fuel burned for LD vehicles and diesel trucks, respectively. Size distribution measurements showed that diesel trucks emitted at least an order of magnitude more particles for all measured sizes (10 < Dp < 290 nm) per unit mass of fuel burned. The relative importance of LD vehicles as a source of particles increased as Dp decreased. Comparing the results from this study to previous measurements at the same site showed that particle number emission factors have decreased for both LD vehicles and diesel trucks since 1997. Integrating size distributions with a volume weighting


ADEC II Universal SCR Retrofit System for On-road and Off-road...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

ADEC II Universal SCR Retrofit System for On-road and Off-road Diesel Engines ADEC II Universal SCR Retrofit System for On-road and Off-road Diesel Engines Presentation given at...


Sally Johnson 123 Bakers Road  

E-Print Network (OSTI)

Sally Johnson 123 Bakers Road Nashville, TN 37212 203-333-4444 Sally.johnson@vanderbilt.edu Leslie. Sincerely, (signature) Sally Johnson #12;

Bordenstein, Seth


Sundial Substation Site Baxter Road Substation Site Casey Road  

NLE Websites -- All DOE Office Websites (Extended Search)

Sundial Substation Site Baxter Road Substation Site Casey Road Substation Site Monahan Creek Substation Site YALE DAM MERWIN DAM S i l v e r L a k e Lake Merwin Y a l e L a k e V a...



E-Print Network (OSTI)

depend non-linearly on numerous parameters, like materials used, vehicle and road usage, environmental conditions (e.g., temperature) and many others. Due to their many economic and ecological implications in the same test conditions. On the road circuit, Passenger Car (PC) and Heavy Goods Vehicle (HGV) equipped

Paris-Sud XI, Université de


Diesel Engines for Road Transport  

Science Journals Connector (OSTI)

... A REMARKABLE revolution is taking place in the type of engine used in large motor vehicles, and by some it is thought that for road ... motor vehicles, and by some it is thought that for road transport the highspeed oil engine is destined to supersede the long-favoured petrol ...



Categorical Exclusion for Access Road  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Access Road Access Road Improvements along the Pinnacle Peak- Prescott 230-kV Transmission Line between Structures 16813 and 170/1 Yavapai County. Arizona * RECORD OF CATEGORICAL EXCLUSION DETERMINATION A. Proposed Action: Western proposes to improve access roads along a portion of the Pinnacle Peak to Prescott 230-kV Transmission Line (Structures 168/3 and 170/1). which are currently impassable. to maintain worker safety and the reliability of the bulk electric system. Western plans to blade and grade the existing access road where it enters and leaves three washes so that Western's maintenance vehicles can drive across the washes. We will remove dirt from the road prism by starting at wash edges and pulling dirt up slope in order to create ramps with grades suitable for our equipment.


The Australasian College of Road Safety Road Safety 2020: Smart Solutions, Sustainability, Vision, Conference Proceedings, 5-6 November 2009  

E-Print Network (OSTI)

The Australasian College of Road Safety Road Safety 2020: Smart Solutions, Sustainability, Vision Solutions, Sustainability, Vision The Australasian College of Road Safety Conference, Perth, Western Australia : Australia (2009)" #12;The Australasian College of Road Safety Road Safety 2020: Smart Solutions

Paris-Sud XI, Université de


VNG's Hampton Roads Pipeline Crossing  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

VNG's Hampton Roads Pipeline Crossing VNG's Hampton Roads Pipeline Crossing FUPWG Conference Fall 2008 Williamsburg, Virginia Connection to DTI at Quantico Columbia Limitations South Hampton Roads served by a single pipeline Southside dependent on back up systems LNG Propane/air Two supply sources to VNG What if we connected pipelines? It would take Two Water Crossings Two Compressor Stations Construction in densely populated cities It could Deliver over 200,000 Dth of incremental supply Serve VNG, Columbia and Dominion customers ...we would get... Hampton Roads Crossing - HRX Hampton / Newport News Craney Island Norfolk 21 miles of 24" pipe 7 miles in Hampton/Newport News 4 miles in Norfolk 10 miles of water and island crossing 4 mile harbor crossing 4.5 miles on Craney



E-Print Network (OSTI)



Tunnels for roads and motorways  

Science Journals Connector (OSTI)

...compromise. Such a solution also offers no protection to pedestrians and tunnel service personnel; this is a consideration...unit length of the tunnel but also its extent from portal to portal. Whereas motorways and trunk roads usually tolerate...

Alan Marshall Muir Wood

Note: This page contains sample records for the topic "dp road tract" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.



E-Print Network (OSTI)

AveUniversity Ave University Ave South Ave 80 Ave 82 Ave Braithwaite Park North Saskatchewan River Mc Ave Edinboro Road Saskatchewan Drive Saskatchewan Drive Saskatchewan Drive 88 Corbett Field West

MacMillan, Andrew


Project EARTH-11-DP1: Exploring early solar system processes using Cr isotopes  

E-Print Network (OSTI)

Project EARTH-11-DP1: Exploring early solar system processes using Cr isotopes Supervisors: Dr D Porcelli & Dr K Amor Various isotope methods have been recently developed to explore the conditions in the early solar system and the processes that have led to the formation of the terrestrial planets. Stable

Henderson, Gideon


ADEC II Universal SCR Retrofit System for On-road and Off-road...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

ADEC II Universal SCR Retrofit System for On-road and Off-road Diesel Engines Richard Carlson Extengine Transport Systems, LLC Fullerton, California 2006 DEER Conference Poster...


Mn/DOT County Road Safety Plans  

E-Print Network (OSTI)

Roads Program !! Minnesota Central Safety Funds !! Foster safety culture among county stakeholders 41 Mn/DOT County Road Safety Plans CTS Annual Research Conference April 27 & 28, 2010 Howard Preston & Objectives !! Project Overview !! Schedule, Participating Counties, Approach !! Safety Emphasis Areas

Minnesota, University of


Rosetta on the Road: an outreach project  

E-Print Network (OSTI)

on the Road · Uses the groundbreaking ESA Rosetta mission ­ comet rendezvous and landing ­ as a basis


Sally Johnson 123 Bakers Road  

E-Print Network (OSTI)

Sally Johnson 123 Bakers Road Nashville, TN 37212 Sally.Johnson@vanderbilt.edu May 2, 2011 Leslie qualifications, you may reach me at (615) 555-5555 or Sally.johnson@vanderbilt.edu at your earliest convenience) Sally Johnson Enclosure Address blocks are used when the document is printed or attached to an email

Bordenstein, Seth


Mined Land Reclamation on DOE's Uranium Lease Tracts, Southwestern...  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

Mined Land Reclamation on DOE's Uranium Lease Tracts, Southwestern Colorado Mined Land Reclamation on DOE's Uranium Lease Tracts, Southwestern Colorado Mined Land Reclamation on...


Tanzania Roads Evaluation - Baseline | Data.gov  

NLE Websites -- All DOE Office Websites (Extended Search)

Tanzania Roads Evaluation - Baseline Tanzania Roads Evaluation - Baseline Agriculture Community Menu DATA APPS EVENTS DEVELOPER STATISTICS COLLABORATE ABOUT Agriculture You are here Data.gov » Communities » Agriculture » Data Tanzania Roads Evaluation - Baseline Dataset Summary Description Baseline survey for impact evaluation of MCC's roads improvement investments in Tanzania. The evaluation will examine the project's household- and community-level effects on local standards of living along the roads. For the evaluation of major roads on the mainland, Economic Development Initiatives conducted a survey of 3,000 households in 200 communities in 2009. For the Pemba rural roads evaluation, Economic Development Initiatives conducted a survey on 570 households in the treatment group and 630 households in the comparison group.


EPA-600/4-82-061 DOE/DP/00539-046  

Office of Legacy Management (LM)

EPA-600/4-82-061 EPA-600/4-82-061 DOE/DP/00539-046 August 1982 OFFSITE ENVIRONMENTAL MONITORING REPORT R a d i a t i o n m o n i t o r i n g around U n i t e d States n u c l e a r t e s t areas, c a l e n d a r y e a r 1981 compiled by S. C. Black, R. F. Grossman, A . A . Mullen, G. D. P o t t e r and D. D. Smith Envi ronmental M o n i t o r i n g Systems Laboratory Las Vegas, Nevada 89114 and J. L. Hopper Reynolds E l e c t r i c a l & Engineering Company, Inc. Las Vegas, Nevada 89102 prepared f o r t h e 1J.S. Department o f Energy under Mernorandum o f Understanding Number DE-AI08-76DP00539 ENVIRONMENTAL MONITORING SYSTEMS LABORATORY OFFICE OF RESEARCH AND DEVELOPMENT U.S..ENVIRONMENTAL PROTECTION AGENCY LAS VEGAS, NEVADA 89114 DISCLAIMER T h i s r e p o r t has been reviewed i n accordance w i t h t h e U.S. Environmental P r o t e c t i o n Agency ' s peer and admi n


Fused-filament 3D printing (3DP) for fabrication of tablets  

Science Journals Connector (OSTI)

Abstract The use of fused-filament 3D printing (FF 3DP) to fabricate individual tablets is demonstrated. The technology permits the manufacture of tablets containing drug doses tailored to individual patients, or to fabrication of tablets with specific drug-release profiles. Commercially produced polyvinyl alcohol (PVA) filament was loaded with a model drug (fluorescein) by swelling of the polymer in ethanolic drug solution. A final drug-loading of 0.29% w/w was achieved. Tablets of PVA/fluorescein (10mm diameter) were printed using a 3D printer. It was found that changing the degree of infill percentage in the printer software varied the weight and volume of the printed tablets. The tablets were mechanically strong and no significant thermal degradation of the active occurred during printing. Dissolution tests were conducted in modified Hanks buffer. The results showed release profiles were dependent on the infill percentage used to print the tablet. The study indicates that FF 3DP has the potential to offer a new solution for fabricating personalized-dose medicines or unit dosage forms with controlled-release profiles. In addition, the low cost of FDM printers means the paradigm of extemporaneous or point-of-use manufacture of personalized-dose tablets is both feasible and attainable.

Alvaro Goyanes; Asma B.M. Buanz; Abdul W. Basit; Simon Gaisford



targetDP: an Abstraction of Lattice Based Parallelism with Portable Performance  

E-Print Network (OSTI)

To achieve high performance on modern computers, it is vital to map algorithmic parallelism to that inherent in the hardware. From an application developer's perspective, it is also important that code can be maintained in a portable manner across a range of hardware. Here we present targetDP (target Data Parallel), a lightweight programming layer that allows the abstraction of data parallelism for applications that employ structured grids. A single source code may be used to target both thread level parallelism (TLP) and instruction level parallelism (ILP) on either SIMD multi-core CPUs or GPU-accelerated platforms. targetDP is implemented via standard C preprocessor macros and library functions, can be added to existing applications incrementally, and can be combined with higher-level paradigms such as MPI. We present CPU and GPU performance results for a benchmark taken from the lattice Boltzmann application that motivated this work. These demonstrate not only performance portability, but also the optimisation resulting from the intelligent exposure of ILP.

Alan Gray; Kevin Stratford



Global Roads Global Roads Open Access Data Set, Version 1 (gROADSv1): South America  

E-Print Network (OSTI)

0 1,000 Km Global Roads Global Roads Open Access Data Set, Version 1 (gROADSv1): South America South America Lambert Conformal Conic Projection Data source: Center for International Earth Science

Columbia University


ROAD-MAN-LANDSCAPE -IN THEORY ASB155 Road-man-landscape -in theory  

E-Print Network (OSTI)

and environmental requirements. Innehåll: Course content: New roads in the landscape. Conversion concepts in traffic planning, road construction, landscape architecture, urban architecture, planning for masters (graduate) students of engineering, architecture and landscape architecture, and future planners


ROAD-MAN-LANDSCAPE -DESIGNPROJECT ASB150 Road-man-landscape -designproject  

E-Print Network (OSTI)

, landscape and environmental requirements. Innehåll: Course content: New roads in the landscape. Conversion concepts in traffic planning, road construction, landscape architecture, urban architecture, planning (graduate) students of engineering, architecture and landscape architecture, and future planners


Road and Trail Inventory Goal: map all of the legal and illegal existing roads and  

E-Print Network (OSTI)

, Car, 2WD, 4WD, ORV Trail marking None, Good, Fair, Poor Paved public road Forest road/trail Trail Other (power line) A trail in REALLY poor condition! #12;3/2/2011 3 Road and Trail Point Data Collected Water Hole Trail Sign/Kiosk Trail Structure Trail Damage Trail Stream Crossing ROW Crossing Stone Wall

Schweik, Charles M.


Review of Sandia National Laboratories - Albuquerque New Mexico DOE/DP Critical Skills Development Progrmas FY04.  

SciTech Connect

Sandia National Laboratories has developed a portfolio of programs to address the critical skills needs of the DP labs, as identified by the 1999 Chiles Commission Report. The goals are to attract and retain the best and the brightest students and transition them into Sandia - and DP Complex - employees. The US Department of Energy/Defense Programs University Partnerships funded ten laboratory critical skills development programs in FY04. This report provides a qualitative and quantitative evaluation of these programs and their status. 3

Gorman, Anna K; Wilson, Dominique; CLARK, KATHERINE



Impact of tool wear on joint strength in friction stir spot welding of DP 980 steel  

SciTech Connect

Friction stir spot welding has been shown to be a viable method of joining ultra high strength steel (UHSS), both in terms of joint strength and process cycle time. However, the cost of tooling must be reasonable in order for this method to be adopted as an industrial process. Recently a new tool alloy has been developed, using a blend of PCBN and tungsten rhenium (W-Re) in order to improve the toughness of the tool. Wear testing results are presented for two of these alloys: one with a composition of 60% PCBN and 40% W-Re, and one with 70% PCBN and 30% W-Re. The sheet material used for all wear testing was 1.4 mm DP 980. Lap shear testing was used to show the relationship between tool wear and joint strength. The Q70 tool provided the best combination of wear resistance and joint strength.

Miles, Michael; Ridges, Chris; Hovanski, Yuri; Peterson, Jeremy; Santella, M. L.; Steel, Russel



Shaftesbury Road Site The Edinburgh Building  

E-Print Network (OSTI)

.cambridge.org/bookshop By car Visitor parking is available on the Shaftesbury Road site. If visiting the pitt Building-storey car parks identified by a on the map. Alternatively, use the park & Ride facilities identified by a P take a local bus or a taxi (phone panther Taxis on 01223 715715) to the Shaftesbury Road site, or you

Mackenzie, Kirill



E-Print Network (OSTI)

ENERGY STRATEGY: THE ROAD NOT TAKEN? By Amory B. Lovins Two road5 diverged in a wood, and I-- I are America's formal or de facto energy policies leading us? Where might we choose to go instead? How can we concepts in energy strategy by outlining and contrasting two en- ergy paths tbat the United States might

Kammen, Daniel M.


Safety Considerations When Driving on Rural Roads  

E-Print Network (OSTI)

procedures to follow. Characteristics of rural or forest roads Extra caution is required when driving-moving vehicles, animals, debris) · Unusually steep hills or sharp curves Since help may often be difficult.Agricultural or prescribed forest burning may produce smoke on roads. Hazard: Approaching vehicles, livestock or wild animals

Vivoni, Enrique R.

Note: This page contains sample records for the topic "dp road tract" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Electricity for road transport, flexible power systems and wind...  

Open Energy Info (EERE)

Electricity for road transport, flexible power systems and wind power (Smart Grid Project) Jump to: navigation, search Project Name Electricity for road transport, flexible power...


DOE Uranium Leasing Program - Lease Tract Metrics  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Uranium Leasing Program -- Lease Tract Metrics Uranium Leasing Program -- Lease Tract Metrics Lease Tract Lessee Lease Date Bid (%) Reclamation Bond a Total Acres Acres Excluded b Comment C-JD-5 Gold Eagle Mining, Inc. 04/30/08 12.00 37,000 150.71 C-JD-5A Golden Eagle Uranium, LLC 06/27/08 20.10 5,000 24.54 C-JD-6 Cotter Corporation 04/30/08 14.20 19,000 530.08 C-JD-7 c Cotter Corporation 04/30/08 27.30 1,206,000 493.01 C-JD-8 Cotter Corporation 04/30/08 36.20 4,000 954.62 C-JD-8A No bids received - remains inactive N/A N/A N/A 77.91 C-JD-9 Cotter Corporation 04/30/08 24.30 72,000 1,036.50 C-SR-10 Golden Eagle Uranium, LLC 06/27/08 13.10 5,000 637.64 C-SR-11 Cotter Corporation 04/30/08 11.67 43,000 1,303.22 200.25 Summit Canyon area excluded from lease tract C-SR-11A Golden Eagle Uranium, LLC 06/27/08 14.30 5,000 1,296.81 C-SR-12 Colorado Plateau Partners 06/27/08


Murdock Road Knoxville.TN  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

702 702 Murdock Road Knoxville.TN 37932 Tel: (609) 921-1456 Fax: (609) 92 1-8703 AA\W.nell-one.com March 25,2009 Office of the Assistant General Counsel for Technology Transfer and Intellectual Property U.S. Department of Energy 1000 Independence Avenue, SW Washington, DC 20585 Attn: Technology Transfer Questions Subject: Questions Concerning Technology Transfer Practices at DOE Laboratories (Federal RegisterNol. 73, No. 229/ November 26,2008 /Notices) Dear Mr. Gottlieb, Thank you for the opportunity to respond to the questions published in the Federal Register. As Chief Executive Officer of Nell One Therapeutics, a spin-out company which is in the process of licensing technology from Oak Ridge National Laboratory (ORNL), I found the questions to be highly relevant to our experiences. While many great technologies and capabilities reside in the National Laboratories


Real-Time Gridless 800G Super-channel Transport Field Trial over 410km Using Coherent DP-16 QAM  

Science Journals Connector (OSTI)

We report the first successful trial of real-time gridless 800G super-channel over a 410km DCM-less, EDFA-only fibre link using production grade DP - 16QAM, demonstrating 4.76b/s/Hz...

Zhou, Yu Rong; Smith, Kevin; Payne, Roger; Lord, Andrew; Whalley, Glenn; Bennett, Tex; Maniloff, Eric; Alexander, Savchenko; Boymel, David


DP97, a DEAD box DNA/RNA helicase, is a target gene-selective co-regulator of the constitutive androstane receptor  

SciTech Connect

Highlights: Black-Right-Pointing-Pointer DP97 interacts with nuclear receptor CAR. Black-Right-Pointing-Pointer DP97 enhances CAR-mediated transcriptional activation. Black-Right-Pointing-Pointer DP97 synergistically enhances transactivity of CAR by the co-expression of SRC-1 or PGC1{alpha}. Black-Right-Pointing-Pointer DP97 is a gene-selective co-activator for hCAR. -- Abstract: The constitutive androstane receptor (CAR) plays a key role in the expression of xenobiotic/steroid and drug metabolizing enzymes and their transporters. In this study, we demonstrated that DP97, a member of the DEAD box DNA/RNA helicase protein family, is a novel CAR-interacting protein. Using HepG2 cells expressing human CAR in the presence of tetracycline, we showed that knockdown of DP97 with small interfering RNAs suppressed tetracycline-inducible mRNA expression of CYP2B6 and UGT1A1 but not CYP3A4. Thus, DP97 was found to be a gene (or promoter)-selective co-activator for hCAR. DP97-mediated CAR transactivation was synergistically enhanced by the co-expression of SRC-1 or PGC1{alpha}, therefore it might act as mediator between hCAR and appropriate co-activators.

Kanno, Yuichiro, E-mail: ykanno@phar.toho-u.ac.jp [Faculty of Pharmaceutical Sciences, Toho University, Chiba (Japan)] [Faculty of Pharmaceutical Sciences, Toho University, Chiba (Japan); Serikawa, Takafumi; Inajima, Jun; Inouye, Yoshio [Faculty of Pharmaceutical Sciences, Toho University, Chiba (Japan)] [Faculty of Pharmaceutical Sciences, Toho University, Chiba (Japan)



Forest Road Building Regulations | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

You are here You are here Home » Forest Road Building Regulations Forest Road Building Regulations < Back Eligibility Utility Commercial Agricultural Investor-Owned Utility State/Provincial Govt Industrial Construction Municipal/Public Utility Local Government Residential Installer/Contractor Rural Electric Cooperative Schools Retail Supplier Institutional Fuel Distributor Nonprofit Transportation Savings Category Alternative Fuel Vehicles Hydrogen & Fuel Cells Buying & Making Electricity Water Home Weatherization Solar Wind Program Info Start Date 09/2010 State Wisconsin Program Type Environmental Regulations The Wisconsin Department of Natural Resources has regulations for building a forest road, if development requires one. Regulations include zoning ordinances and permits for stream crossing, grading, stormwater, and


A quadratic algorithm for road coloring  

E-Print Network (OSTI)

The road coloring theorem states that every aperiodic directed graph with constant out-degree has a synchronized coloring. This theorem had been conjectured during many years as the road coloring problem before being settled by A. Trahtman. Trahtman's proof leads to an algorithm that finds a synchronized labeling with a cubic worst-case time complexity. We show a variant of his construction with a worst-case complexity which is quadratic in time and linear in space. We also extend the road coloring theorem to the periodic case.

Bal, Marie-Pierre



On-road remote sensing of vehicle emissions in  

E-Print Network (OSTI)

On-road remote sensing of vehicle emissions in the Auckland Region August 2003 Technical 1877353000 www.arc.govt.nz #12;TP 198 On-Road Remote Sensing of Vehicle Emissions in the Auckland Region #12;Page i TP 198 On-Road Remote Sensing of Vehicle Emissions in the Auckland Region On-road remote sensing

Denver, University of


The Political Economy of Private Roads David Levinson  

E-Print Network (OSTI)

to the generating plants in the electricity sector. What are not private, of course, are the roads them- selves4 The Political Economy of Private Roads David Levinson CosaNostra Pizza #3569 is on Vista Road in road privatization and alternative financing, not just by science fiction writ- ers, anarchists

Levinson, David M.


Rattlesnake Road Wind Farm | Open Energy Information  

Open Energy Info (EERE)

Rattlesnake Road Wind Farm Rattlesnake Road Wind Farm Jump to: navigation, search Name Rattlesnake Road Wind Farm Facility Rattlesnake Road Sector Wind energy Facility Type Commercial Scale Wind Facility Status In Service Owner Horizon Developer Horizon Energy Purchaser Constellation Energy/PG&E Location Gilliam County west of Arlington OR Coordinates 45.700461°, -120.280581° Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"ROADMAP","zoom":14,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"350px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":45.700461,"lon":-120.280581,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}


Hampton Roads Demonstration Project | Open Energy Information  

Open Energy Info (EERE)

Roads Demonstration Project Roads Demonstration Project Jump to: navigation, search Name Hampton Roads Demonstration Project Facility Hampton Roads Demonstration Project Sector Wind energy Facility Type Offshore Wind Facility Status Proposed Developer Virginia State Government Location Chesapeake Bay VA Coordinates 36.965°, -76.289° Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"ROADMAP","zoom":14,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"350px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":36.965,"lon":-76.289,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}


Understanding Road Usage Patterns in Urban Areas  

E-Print Network (OSTI)

In this paper, we combine the most complete record of daily mobility, based on large-scale mobile phone data, with detailed Geographic Information System (GIS) data, uncovering previously hidden patterns in urban road ...

Wang, Pu


HCEI Road Map: 2011 Edition (Brochure)  

Office of Energy Efficiency and Renewable Energy (EERE)

This road map outlines the 2011 key goals and strategies of the Hawaii Clean Energy Initiative, was founded based on a Memorandum of Understanding between the State of Hawaii and the U.S. Department of Energy in 2008.


Space-like Dp branes: accelerating cosmologies versus conformally de Sitter space-time  

E-Print Network (OSTI)

We consider the space-like D$p$ brane solutions of type II string theories having isometries ISO$(p+1)$ $\\times$ SO$(8-p,1)$. These are asymptotically flat solutions or in other words, the metrics become flat at the time scale $\\tau \\gg \\tau_0$. On the other hand, when $\\tau \\sim \\tau_0$, we get $(p+1)+1$ dimensional flat FLRWmetrics upon compactification on a $(8-p)$ dimensional hyperbolic space with time dependent radii. We show that the resultant $(p+1)+1$ dimensional metrics describe transient accelerating cosmologies for all $p$ from 1 to 6, i.e., from $(2+1)$ to $(7+1)$ space-time dimensions. We show how the acceleration changes with the interplay of the various parameters characterizing the solutions in $(3+1)$ dimensions. Finally, for $\\tau \\ll \\tau_0$, after compactification on $(8-p)$ dimensional hyperbolic space, the resultant metrics are shown to take the form of $(p+1)+1$ dimensional de Sitter spaces upto a conformal transformation. Cosmologies here are decelerating, but, only in a particular conformal frame we get eternal acceleration.

Kuntal Nayek; Shibaji Roy



Joint strength in high speed friction stir spot welded DP 980 steel  

SciTech Connect

High speed friction stir spot welding was applied to 1.2 mm thick DP 980 steel sheets under different welding conditions, using PCBN tools. The range of vertical feed rates used during welding was 2.5 mm 102 mm per minute, while the range of spindle speeds was 2500 6000 rpm. Extended testing was carried out for five different sets of welding conditions, until tool failure. These welding conditions resulted in vertical welding loads of 3.6 8.2 kN and lap shear tension failure loads of 8.9 11.1 kN. PCBN tools were shown, in the best case, to provide lap shear tension fracture loads at or above 9 kN for 900 spot welds, after which tool failure caused a rapid drop in joint strength. Joint strength was shown to be strongly correlated to bond area, which was measured from weld cross sections. Failure modes of the tested joints were a function of bond area and softening that occurred in the heat-affected zone.

Saunders, Nathan; Miles, Michael; Hartman, Trent; Hovanski, Yuri; Hong, Sung Tae; Steel, Russell



Wear testing of friction stir spot welding tools for joining of DP 980 Steel  

SciTech Connect

Friction stir spot welding has been shown to be a viable method of joining ultra high strength steel (UHSS), both in terms of joint strength and process cycle time. However, the cost of tooling must be reasonable in order for this method to be adopted as an industrial process. Several tooling materials have been evaluated in prior studies, including silicon nitride and polycrystalline cubic boron nitride (PCBN). Recently a new tool alloy has been developed, where a blend of PCBN and tungsten rhenium (W-Re) was used in order to improve the toughness of the tool. Wear testing results are presented for two of these alloys: one with a composition of 60% PCBN and 40% W-Re (designated as Q60), and one with 70% PCBN and 30% W-Re (designated at Q70). The sheet material used for all wear testing was DP 980. Tool profiles were measured periodically during the testing process in order to show the progression of wear as a function of the number of spots produced. Lap shear testing was done each time a tool profile was taken in order to show the relationship between tool wear and joint strength. For the welding parameters chosen for this study the Q70 tool provided the best combination of wear resistance and joint strength.

Ridges, Chris; Miles, Michael; Hovanski, Yuri; Peterson, Jeremy; Steel, Russell



IRF-World Road Statistics | Open Energy Information  

Open Energy Info (EERE)

IRF-World Road Statistics IRF-World Road Statistics Jump to: navigation, search Tool Summary LAUNCH TOOL Name: IRF-World Road Statistics Agency/Company /Organization: International Road Statistics Focus Area: Transportation, Economic Development Resource Type: Dataset Website: www.irfnet.org/statistics.php Cost: Paid IRF-World Road Statistics Screenshot References: IRF-World Road Statistics[1] "IRF World Road Statistics (WRS) compiles the most up-to-date official international road, traffic and transport data. The publication further provides a selection of the latest Sustainable Development Indicators and other data of key relevance, not only to industry and business but also to leading international organisations and financial institutions." References ↑ "IRF-World Road Statistics"


1.4Tb Real-Time Alien Superchannel Transport Demonstration over 410km Installed Fiber Link Using Software Reconfigurable DP-16QAM/QPSK  

Science Journals Connector (OSTI)

We successfully demonstrated, for the first time, 1.4Tb/s real-time Alien Superchannel over a 410km EDFA-only field fiber link using software reconfigurable DP-16QAM/QPSK production...

Zhou, Yu Rong; Smith, Kevin; Payne, Roger; Lord, Andrew; Raddatz, Lutz; Bertolini, Marco; Van De Velde, Tony; Colombo, Claudio; Korkmaz, Eyup; Fontana, Michele; Evans, Steve


End of the road for Roadrunner  

NLE Websites -- All DOE Office Websites (Extended Search)

End of the road for Roadrunner End of the road for Roadrunner End of the road for Roadrunner Roadrunner, the first supercomputer to break the once-elusive petaflop barrier-one million billion calculations per second-will be decommissioned on Sunday, March 31. March 29, 2013 Roadrunner, the first supercomputer to break the once-elusive petaflop barrier-one million billion calculations per second-will be decommissioned on Sunday, March 31. Roadrunner will be decommissioned on March 31. Contact Kevin Roark Communications Office (505) 665-9202 Email Roadrunner got everyone thinking in new ways about how to build and use a supercomputer. Once the World's Fastest Supercomputer; Central to the Success of Stockpile Stewardship LOS ALAMOS, N. M., March 29, 2013-Roadrunner, the first supercomputer to


HCEI Road Map: 2011 Edition (Brochure)  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Road Map Road Map 2011 Edition 2 www.hawaiicleanenergyinitiative.org The Hawaii Clean Energy Initiative (HCEI) was founded based on a Memorandum of Understanding (MOU) between the State of Hawaii and the U.S. Department of Energy on Jan. 28, 2008. Upon inception, the State and the Department worked to form a series of working groups incorporating a variety of stakeholders throughout the state, including local government, not-for-profit organizations, private sector companies, trade associations, Department of Defense representatives (including PACOM) and academic organizations, among others. These working groups form

Note: This page contains sample records for the topic "dp road tract" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


HCEI Road Map: 2011 Edition (Brochure)  

NLE Websites -- All DOE Office Websites (Extended Search)

HCEI Road Map HCEI Road Map 2011 Edition 2 www.hawaiicleanenergyinitiative.org The Hawaii Clean Energy Initiative (HCEI) was founded based on a Memorandum of Understanding (MOU) between the State of Hawaii and the U.S. Department of Energy on Jan. 28, 2008. Upon inception, the State and the Department worked to form a series of working groups incorporating a variety of stakeholders throughout the state, including local government, not-for-profit organizations, private sector companies, trade associations, Department of Defense representatives (including PACOM) and academic organizations, among others. These working groups form


Alternative Fuels Data Center: Electric Vehicle (EV) Road User Assessment  

Alternative Fuels and Advanced Vehicles Data Center (EERE)

Road User Assessment System Pilot to someone by E-mail Road User Assessment System Pilot to someone by E-mail Share Alternative Fuels Data Center: Electric Vehicle (EV) Road User Assessment System Pilot on Facebook Tweet about Alternative Fuels Data Center: Electric Vehicle (EV) Road User Assessment System Pilot on Twitter Bookmark Alternative Fuels Data Center: Electric Vehicle (EV) Road User Assessment System Pilot on Google Bookmark Alternative Fuels Data Center: Electric Vehicle (EV) Road User Assessment System Pilot on Delicious Rank Alternative Fuels Data Center: Electric Vehicle (EV) Road User Assessment System Pilot on Digg Find More places to share Alternative Fuels Data Center: Electric Vehicle (EV) Road User Assessment System Pilot on AddThis.com... More in this section... Federal State Advanced Search


Road to Fuel Savings: GM Technology Ramps Up Engine Efficiency...  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

Road to Fuel Savings: GM Technology Ramps Up Engine Efficiency Road to Fuel Savings: GM Technology Ramps Up Engine Efficiency August 14, 2014 - 11:25am Addthis Pictured here is an...


Cellulosic Biofuels and the Road to Energy Security  

Science Journals Connector (OSTI)

Cellulosic Biofuels and the Road to Energy Security ... And we badly need some operating commercial scale cellulosic biofuel plants. ...

Bruce E. Dale



"MBUF Demo" "Mn Road Fee Test"  

E-Print Network (OSTI)

(40 mpg) Electric Vehicle (non-gas powered) State Tax * Federal Tax ** State Tax * Federal Tax"MBUF Demo" "Mn Road Fee Test" "IntelliDrive Connected Vehicles for Safety, Mobility and User Fee Overview Six Months In-Vehicle Data Collection Participant Recruited Equipment Deployed First Odometer

Minnesota, University of


Keep your eyes on the road  

Science Journals Connector (OSTI)

... cruising the strip in your custom convertible. You turn your head to admire an attractive pedestrian. So far, so cool - but what?s stopping you steering off the road ... your neck. OK, fine - but what happens when you spot that head-turning pedestrian? The clue comes from experiments with simulators. These are rather like video games, ...

Henry Gee



Charing Cross Hospital Fulham Palace Road  

E-Print Network (OSTI)

Charing Cross Hospital Fulham Palace Road Fulham Cemetery Fulham High Street Putney Church Fulham Broadway West Brompton Empress State Building Chelsea and Westminster Hospital Victoria Coach Station Hall for London Aquarium and London Eye Roehampton Earl Spencer Roehampton Queen Mary's Hospital Barnes


WP1 Climate services for road  

E-Print Network (OSTI)

and assessment of existing climate change projections regarding TEN-T needs A2: Development of a common methodology for the production of regional climate projections to provide consistent input data for risk by road authorities related to climate data compared to the RIMAROCC project: especially how

Haak, Hein


On the road to sustainable development  

Science Journals Connector (OSTI)

This paper discusses two of the several models developed by the author over the past few years that attempt to portray an understanding of sustainable development. The first, an overview model, depicts a current understanding of SD. The second, a process model, positions role of education on the road to SD. Both models recognise the verity of interdisciplinary approach to and resolution environmental issues.

M.B. Neace




E-Print Network (OSTI)

ATP AND DNA AS MICROBIAL PARAMETERS IN THE ALIMENTARY TRACT J. WOLSTRUP K. JENSEN A. JUST I. The aim of the present work was to investi- gate the use of ATP and DNA as parameters for microbial activity and biomass in the ali- mentary tract of cows and pigs. ATP was selected because of the promising

Paris-Sud XI, Université de


Recent progress in road and lane detection: a survey  

Science Journals Connector (OSTI)

The problem of road or lane perception is a crucial enabler for advanced driver assistance systems. As such, it has been an active field of research for the past two decades with considerable progress made in the past few years. The problem was confronted ... Keywords: Advanced driver assistance systems, Lane detection, Road detection, Road segmentation

Aharon Bar Hillel, Ronen Lerner, Dan Levi, Guy Raz



Dielectron production in pp and dp collisions at 1.25 GeV/u with HADES  

E-Print Network (OSTI)

Inclusive production of e+e--pairs in pp and dp collisions at a kinetic beam energy of 1.25 GeV/u has been studied with the HADES spectrometer. In the latter case, the main goal was to obtain data on pair emission in quasi-free np collisions. To select this particular reaction channel the HADES experimental setup was extended with a Forward Wall hodoscope, which allowed to register spectator protons. Here, the measured invariant mass distributions demonstrate a strong enhancement of the pair yield for M > 140 MeV/c2 in comparison to pp data.

K. Lapidus; for the HADES Collaboration



Dielectron production in pp and dp collisions at 1.25 GeV/u with HADES  

E-Print Network (OSTI)

Inclusive production of e+e--pairs in pp and dp collisions at a kinetic beam energy of 1.25 GeV/u has been studied with the HADES spectrometer. In the latter case, the main goal was to obtain data on pair emission in quasi-free np collisions. To select this particular reaction channel the HADES experimental setup was extended with a Forward Wall hodoscope, which allowed to register spectator protons. Here, the measured invariant mass distributions demonstrate a strong enhancement of the pair yield for M > 140 MeV/c2 in comparison to pp data.

Lapidus, K



Despite increasing transportation related activities on rangelands globally, few tools exist for assessing and monitoring impacts of roads, road  

E-Print Network (OSTI)

and management but located far from roads and trails. No modification (careful of buried pipelines). See belowPenetrometer3 Qualitative assessment designed to capture how road is altering landscape hydrology where transect crosses road for later splitting of points on and off travel way. Gap intercept2 Collect


United States Environmental Monitoring EPA-600/4-81-047 Environmental Protection Systems Laboratory DOE/DP/00539-043  

Office of Legacy Management (LM)

EPA-600/4-81-047 EPA-600/4-81-047 Environmental Protection Systems Laboratory DOE/DP/00539-043 Agency P.O. Box 15027 June 1981 Las Vegas NV 891 14 Research and Development Offsite Environmental Monitoring Report Radiation Monitoring Around United States Nuclear Test Areas, Calendar Year 1980 prepared for the Nevada Operations Office U.S. Department of Energy This page intentionally left blank EPA-60014-81-047 DOE/DP/00539-043 June 1981 OFFSITE ENVIRONMENTAL MONITORING REPORT Radiation moni t o r i ng around U n i t e d States nuclear t e s t areas, calendar y e a r 1980 D. D. Smith, R. F. Grossman, W. D. Corkern, D. J. Thorn6 and R. G. Patzer Envi ronmental Moni t o r i ng Systems Laboratory Las Vegas, Nevada 89114 and J. L. Hopper Reynol ds E l e c t r i c a l & Engineering Company, Inc.


Timber Road II | Open Energy Information  

Open Energy Info (EERE)

II II Jump to: navigation, search Name Timber Road II Facility Timber Road II Sector Wind energy Facility Type Commercial Scale Wind Facility Status In Service Owner Horizon Wind Energy Developer Horizon Wind Energy Energy Purchaser American Electric Power Location Near Payne OH Coordinates 41.023524°, -84.717185° Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"ROADMAP","zoom":14,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"350px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":41.023524,"lon":-84.717185,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}


EPA Energy Strategy For The Road Ahead  

NLE Websites -- All DOE Office Websites (Extended Search)

Strategy Strategy for the Road Ahead Scenario Thinking for Business Executives and Corporate Boards 2007 GBN Global Business Network * Energy Strategy for the Road Ahead Printed on 100% recycled paper Copyright 2007 Global Business Network, a member of the Monitor Group. The U.S. Environmental Protection Agency (U.S. EPA) and its ENERGY STAR ® Program supported this effort. We encourage readers to use and share the content of this report, with the understanding that it is the intellectual property of Global Business Network and U.S. EPA ENERGY STAR ® , and that full attribution is required. 101 Market Street, Suite 1000 * San Francisco, CA 94105 * Telephone: (415) 932-5400 * Fax: (415) 932-5401


Early Cook County Roads -- Part Two  

NLE Websites -- All DOE Office Websites (Extended Search)

Two Two Nature Bulletin No. 739 January 18, 1964 Forest Preserve District of Cook County Seymour Simon, President Roberts Mann, Conservation Editor EARLY COOK COUNTY ROADS -- PART TWO -- THE PLANK ROAD ERA For ten years after Chicago, with a population of 4,170, was chartered as a city in 1837, its commerce and growth were crippled by wretched transportation to and from the hinterlands. During many periods of each year it was surrounded and isolated by mud. To be sure, there were dirt thoroughfares in all directions, graded and drained as best they could in those days, but not surfaced. No one who has never experienced it can appreciate how gooey and gluey a black prairie soil can be when wet. A wagon's wheels often become solid cylinders of mud as wide as a bass drum.


Respiratory tract infections in the military environment  

Science Journals Connector (OSTI)

Abstract Military personnel fighting in contemporary battlefields as well as those participating in combat training are at risk of contracting respiratory infections. Epidemiological studies have demonstrated that soldiers deployed to the harsh environment have higher rates of newly reported respiratory symptoms than non-deployers. Acute respiratory diseases are the principle reason for outpatient treatment and hospitalization among military personnel, with an incidence exceeding that of the adult civilian population by up to three-fold. Adenoviruses, influenza A and B viruses, Streptococcus pneumoniae, Streptococcus pyogenes, coronaviruses and rhinoviruses have been identified as the main causes of acute respiratory infections among the military population. Although infective pathogens have been extensively studied, a significant proportion of illnesses (over 40%) have been due to unknown causative agents. Other health hazards, which can lead to respiratory illnesses among troops, are extreme air temperatures, desert dust, emissions from burn pits, industrial pollutants, and airborne contaminants originating from degraded soil. Limited diagnostic capabilities, especially inside the area of operations, make it difficult to accurately estimate the exact number of respiratory diseases in the military environment. The aim of the study was to discuss the occurrence of respiratory tract infections in army personnel, existing risk factors and preventive measures.

Krzysztof Korzeniewski; Aneta Nitsch-Osuch; Monika Konior; Anna Lass



DOE - Office of Legacy Management -- LASL Tract OO - NM 06  

Office of Legacy Management (LM)

Tract OO - NM 06 Tract OO - NM 06 FUSRAP Considered Sites Site: LASL TRACT OO (NM.06 ) Eliminated from consideration under FUSRAP - Site was released by the AEC for sale and unrestricted use in 1976 Designated Name: Not Designated Alternate Name: None Location: Los Alamos , New Mexico NM.06-1 Evaluation Year: 1987 NM.06-1 Site Operations: Site consists of an area of 3.85 acres on the Los Alamos Scientific Laboratory compound. This tract of land was a location for a fire alarm equipment building and part of power plant and several warehouses. NM.06-2 Site Disposition: Eliminated - Radiological survey report declares the area to be free of residual radioactive contamination from site operations NM.06-1 Radioactive Materials Handled: No Primary Radioactive Materials Handled: None

Note: This page contains sample records for the topic "dp road tract" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


United States Environmental Monitoring EPAJ60014-901016 Environmental Protection Systems Laboratory DOE/DP/00539-062  

Office of Legacy Management (LM)

EPAJ60014-901016 EPAJ60014-901016 Environmental Protection Systems Laboratory DOE/DP/00539-062 Agency P.O. Box 93478 May 1990 Las Vegas NV 891 93-3478 Research and Development - Offsite Environmental lcrgw Monitoring Report Radiation Monitoring d ,& Around United States Nuclear Test Areas Calendar Year 1989 This page intentionally left blank EPN60014-90/016 DOEIDP100539-062 May 1990 Offsite Environmental Monitoring Report Radiation Monitoring Around United States Nuclear Test Areas, Calendar Year 1989 contributors: C. F. Costa, N. R. Sunderland, S. C. Black, M. W. Chilton, B. B. Dicey, W. G. Phillips, C. A. Fontana, R. W. Holloway, C. K. Liu, A. A. Mullen, V. E. Niemann, C. J. Rizzardi, D. D. Smith, D. J. Thome, E. A. Thompson, and Nuclear Radiation Assessment Division


d/p and t/p ratios in nucleon-nucleus and heavy ion reactions: Can entropy be determined?  

Science Journals Connector (OSTI)

The relative yields of high energy deuterons and tritons as compared to protons have been measured in p+Kr, 16O+Kr and 20Ne+Ar reactions with a continuously varying beam energy up to 500A (400A)?MeV. Statistical (expanding) evaporation models are not able to reproduce these d/p or t/p ratios, which for high particle energy (>30?MeV) increase smoothly with beam energy. Models that contain nucleon-nucleon scattering, like cascade or nuclear molecular dynamics models, can only reproduce the ratios if a final-state interaction is introduced via the coalescence prescription. The coalescence radius that best fit the data is rather constant over wide beam energy intervals. Entropy can, however, not be directly determined from these ratios.

A. Fokin et al. ((CHIC Collaboration))



Ed Westcotts photography goes on the road  

NLE Websites -- All DOE Office Websites (Extended Search)

the Manhattan Project by famed local photographer Ed Westcott, is going on the road. The Oak Ridge Secret City Photographic History Exhibit consists of selected images from many...


Montana - Access Road Easement Policy | Open Energy Information  

Open Energy Info (EERE)

General: Montana - Access Road Easement Policy Author Montana Department of Transportation Published Montana Department of Transportation, 2006 DOI Not Provided Check for...


Road Blocks Yield Key Information about a Catalyst | The Ames...  

NLE Websites -- All DOE Office Websites (Extended Search)

Road Blocks Yield Key Information about a Catalyst Researchers systematically blocked key chemical reaction pathways to get unambiguous information about how carbon-nitrogen bonds...


Early Cook County Roads -- Part One  

NLE Websites -- All DOE Office Websites (Extended Search)

One One Nature Bulletin No. 738 January 11, 1964 Forest Preserve District of Cook County Seymour Simon, President Roberts Mann, Conservation Editor EARLY COOK COUNTY ROADS -- PARK ONE When Chicago was incorporated as a village in 1833 it was only a squalid hamlet of about 350 inhabitants and appeared to be so poorly situated that it was hopeless -- "crude cabins and flimsy shacks in a chaos of mud, rubbish and confusion. " Only a few feet above the level of Lake Michigan, the place was almost entirely surrounded by swamps and miles and miles of prairies that became nearly impassable after spring thaws and during periods of heavy rainfall. There were only two important routes that afforded access at all times. One was the Green Bay Trail, ancestor of North Clark St. in Chicago, Ridge Ave. in Evanston, and Green Bay Road north of that. The other, traveled by the soldiers coming from Detroit to build Fort Dearborn in 1803, used the Great Sauk Trail to La Porte, Indiana, then a trail northwesterly to what is now Michigan City, and the firm sands of the lake beach the rest of the way.


13th Annual Transportation Engineering and Road Research Alliance (TERRA)  

E-Print Network (OSTI)

13th Annual Sponsor: Transportation Engineering and Road Research Alliance (TERRA) Cosponsors: Minnesota Department of Transportation (Mn/DOT) Minnesota Local Technical Assistance Program (LTAP Association State Aid for Local Transportation, Mn/DOT Minnesota Local Road Research Board (LRRB) Pavement

Minnesota, University of


Active traffic management on road networks: a macroscopic approach  

Science Journals Connector (OSTI)

...Active traffic management on road networks: a macroscopic approach Alex A. Kurzhanskiy...and Computer Sciences, University...Active traffic management (ATM) is the...by National Science Foundation Award...Active traffic management on road networks: a macroscopic approach. | Active traffic...



Lane departure detection for improved road geometry estimation  

E-Print Network (OSTI)

vehicles is mea- sured using a vision system and a radar, whereas the shape of the road is measured using1 Lane departure detection for improved road geometry estimation Thomas B. Sch¨on Andreas Eidehall Fredrik Gustafsson Division of Automatic Control Vehicle Dynamics and Active Safety Link¨oping University

Schön, Thomas


Astronomical Data Processing in EXTASCID 5200 N Lake Road  

E-Print Network (OSTI)

Astronomical Data Processing in EXTASCID Yu Cheng UC Merced 5200 N Lake Road Merced, CA 95343 ycheng4@ucmerced.edu Florin Rusu UC Merced 5200 N Lake Road Merced, CA 95343 frusu@ucmerced.edu ABSTRACT processing systems are designed for a single data model and handle complex processing at the application

Rusu, Florin



Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Hygiene Substation Access Road Repairs Hygiene Substation Access Road Repairs A. Brief Description of Proposal: Western Area Power Administration proposes to repair the access road/driveway into the Hygiene Substation. There is a low spot in the middle of the driveway that impedes maneuvering oflarge maintenance equipment in and out of the yard. Western plans to fill the low spot with road base and crumbled concrete fill. The Hygiene Substation is located in Boulder County, approximately 2 miles northwest of Longmont, CO (T3N, R69W, Sec 18). All proposed construction will occur within the existing, disturbed substation access road/driveway. B. Number and Title of tile Categorical Exclusion Being Applied: (See text in 10 CFR 1021, Subpart D.) BI.3 Routine maintenance activities and custodial services for buildings, structures,


Climate policies for road transport revisited (I): Evaluation of the  

Open Energy Info (EERE)

Climate policies for road transport revisited (I): Evaluation of the Climate policies for road transport revisited (I): Evaluation of the current framework Jump to: navigation, search Tool Summary LAUNCH TOOL Name: Climate policies for road transport revisited (I): Evaluation of the current framework Agency/Company /Organization: Elsevier Complexity/Ease of Use: Not Available Website: www.pik-potsdam.de/members/edenh/publications-1/CPFRTRI.pdf Related Tools Alternative Fuels and Advanced Vehicles Data Center - Codes and Standards Resources Reducing Congestion through Smart Parking Management Performance Measurement in the Road Sector: A Cross-Country Review of Experience ... further results Find Another Tool FIND TRANSPORTATION TOOLS This paper evaluates the effectiveness and efficiency of current climate policies for road transport that (1) target fuel producers and/or car


Carbon Capture and Storage Road Map | Open Energy Information  

Open Energy Info (EERE)

and Storage Road Map and Storage Road Map Jump to: navigation, search Name Carbon Capture and Storage Road Map Agency/Company /Organization Asian Development Bank Sector Energy Focus Area Renewable Energy, Economic Development, Greenhouse Gas, Industry Topics Adaptation, Implementation, Low emission development planning, -LEDS Website http://www.adb.org/news/adb-he Country China Eastern Asia References ADB Helps People's Republic of China Plan Carbon Capture and Storage Road Map[1] Program Overview "The Asian Development Bank (ADB) is assisting the People's Republic of China (PRC) in the development of a road map for carbon capture and storage (CCS) to help achieve the country's carbon dioxide (CO2) emissions reduction goals. ADB will assist the PRC in developing a detailed plan for a staged


DOE Issues Environmental Assessment on Road Project for Public Review  

NLE Websites -- All DOE Office Websites (Extended Search)

Brad Bugger (208) 526-0833 DOE Issues Environmental Assessment on Road Project for Public Review Brad Bugger (208) 526-0833 DOE Issues Environmental Assessment on Road Project for Public Review The U.S. Department of Energy has issued for public review and comment a draft environmental assessment of the potential environmental impacts of building an internal road to safely ship radioactive material within the Idaho National Laboratory. DOE�s preferred alternative under the environmental assessment is to develop a new, internal road that would connect the Idaho Nuclear Technology and Engineering Center with the Materials and Fuels Complex, a distance of about 20 miles. It would allow the INL to safely ship nuclear materials from the Idaho Nuclear Technology and Engineering Center and the Materials and Fuels Complex without having to utilize public roads, like Highway 20, which adds additional cost and security considerations to each shipment.


E-Print Network 3.0 - access roads rehabilitation Sample Search...  

NLE Websites -- All DOE Office Websites (Extended Search)

Station - Flagstaff Lab Collection: Environmental Sciences and Ecology 15 University of Kings Edwards Summary: . Bournbrook Road The road will be closed to vehicular traffic...


Cleaning Up Non-Road Diesel Vehicles: A Public Health Imperative...  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

Non-Road Diesel Vehicles: A Public Health Imperative Cleaning Up Non-Road Diesel Vehicles: A Public Health Imperative 2002 DEER Conference Presentation: Union of Concerned...


E-Print Network 3.0 - automatic road extraction Sample Search...  

NLE Websites -- All DOE Office Websites (Extended Search)

with no tuning, as well as extracting the road midline using residual... and watershed image processing techniques to extract a road network in the vicinity of the vehicle,...


The Private Provision of Frontier Infrastructure: Toll Roads in California, 1850-1902  

E-Print Network (OSTI)

and Gold Run (1867), Weaverville and Minersville (1863), andwho controlled the Weaverville & Shasta Wagon Road and thea large interest in the Weaverville & Minersville Toll Road.

Klein, Daniel B.; Yin, Chi



Notices Bldg., 901 Pilottown Road, Lewes, DE  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

4 Federal Register 4 Federal Register / Vol. 77, No. 249 / Friday, December 28, 2012 / Notices Bldg., 901 Pilottown Road, Lewes, DE 19958. January 17, 2013: 7-9 p.m.; Ocean County Administration Building, 101 Hooper Avenue, Public Hearing Room #119, Toms River, NJ 08754. Special Accommodations The hearings are physically accessible to people with disabilities. Requests for sign language interpretation or other auxiliary aids should be directed to M. Jan Saunders at the Mid-Atlantic Council Office, (302) 526-5251, at least 5 days prior to the hearing date. Dated: December 21, 2012. Tracey L. Thompson, Acting Deputy Director, Office of Sustainable Fisheries, National Marine Fisheries Service. [FR Doc. 2012-31148 Filed 12-27-12; 8:45 am] BILLING CODE 3510-22-P COMMODITY FUTURES TRADING


Savannah River Site 1991 Road Erosion Inventory.  

SciTech Connect

Final Report. USDA Forest Service, Savannah River, Aiken, SC. 28 pp. Abstract - This paper explains the rationale and results of a 1991 road erosion inventory conducted by members of the USDA Forest Service Savannah River (FS-SR) and USDA Natural Resources Conservation Service (NRCS). The inventory provided information for the Department of Energy - Savannah River (DOE-SR) to justify the need for developing an erosion and sediment control program with appropriate funding, personnel, and equipment. Federally managed since the early 1950s, the SRS is located on 198,344 acres (80,301 hectares) in the South Carolina counties of Aiken, Barnwell, and Allendale. Located along the eastern border of the Savannah River, the SRS is located within the Upper and Lower Coastal Plains of South Carolina.

Jones, Cliff.


Note: This page contains sample records for the topic "dp road tract" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Automatic high-fidelity 3D road network modeling based on 2D GIS data  

Science Journals Connector (OSTI)

Abstract Many computer applications such as racing games and driving simulations demand high-fidelity 3D road network models. However, few methods exist for the automatic generation of 3D realistic road networks, especially for those in the real world. On the other hand, vast 2D road network data in various geographical information systems (GIS) have been collected in the past and are used by a wide range of applications. A method that can automatically produce 3D high-fidelity road network models from 2D real road GIS data will significantly reduce both the labor and time cost, and greatly benefit applications involving road networks. Based on a set of carefully selected civil engineering rules for road design, this paper proposes a novel approach that transforms existing road GIS data that contain only 2D road centerline information into high-fidelity 3D road network models. The proposed method consists of several major components, including road GIS data preprocessing, 3D centerline modeling, and 3D geometric modeling. With this approach, basic road elements such as road segments, road intersections and traffic interchanges are generated automatically to compose sophisticated road networks in a seamless manner. Results show that this approach provides a rapid and efficient 3D road modeling method for applications that have stringent requirements on high-fidelity road models.

Jie Wang; Gary Lawson; Yuzhong Shen



Estimation of vocal?tract area function from lip impulse response based on lossy vocal?tract digital filter model  

Science Journals Connector (OSTI)

A method for estimating vocal?tract area function from lip impulse response based on lossy vocal?tract digital filter model is provided. Previous methods of lip impulse response [M. M. Sondhi and J. R. Resnick 73 9851002 (1983)] determines the area function from impulse response measured at lips by using the incident signal excited outside the oral cavity. This method is sensitive to the noise of measured impulse response. An alternative method [M. Honda and T. Mochida Proc. 1st ETRW?SPM 167170 (1996)] is advantageous for accurate estimation under noisy acoustic condition based on the vocal?tract digital filter model that optimizes the M sections of areas by using the impulse response longer than M samples. In this method however the vocal?tract model is based on the transmission line that treats the effect of loss in simplified form. The new method proposed in this study applies a mixture model of the lossless distributed circuit and the lumped circuit accounting for effects such as viscous loss heat conduction loss and loss due to wall vibration. The results on acoustic measurements have shown that the new method has better performance over the old method using optimization scheme based on simplified transmission line model. [Work supported by CREST JST.



M.-T. DO, P. MARSAC, Y. DELANNE Prediction of Tire/Wet Road Friction from  

E-Print Network (OSTI)

M.-T. DO, P. MARSAC, Y. DELANNE 1 Prediction of Tire/Wet Road Friction from Road Surface, validation of a contact model for the prediction of low-speed friction from road surface microtexture the friction ­ speed curve from road- and tire measurable parameters. The model development is briefly

Paris-Sud XI, Université de


Dillard Road Solar Power Facility | Open Energy Information  

Open Energy Info (EERE)

Dillard Road Solar Power Facility Dillard Road Solar Power Facility Jump to: navigation, search Name Dillard Road Solar Power Facility Facility Dillard Road Solar Power Facility Sector Solar Facility Type Photovoltaics Facility Status In Service Developer Recurrent Energy Energy Purchaser Sacramento Municipal Utility District Location Elk Grove, California Coordinates 38.465275°, -121.17847° Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"ROADMAP","zoom":14,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"350px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":38.465275,"lon":-121.17847,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}


End of the road for Roadrunner | National Nuclear Security Administration  

NLE Websites -- All DOE Office Websites (Extended Search)

End of the road for Roadrunner | National Nuclear Security Administration End of the road for Roadrunner | National Nuclear Security Administration Our Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy Emergency Response Recapitalizing Our Infrastructure Continuing Management Reform Countering Nuclear Terrorism About Us Our Programs Our History Who We Are Our Leadership Our Locations Budget Our Operations Media Room Congressional Testimony Fact Sheets Newsletters Press Releases Speeches Events Social Media Video Gallery Photo Gallery NNSA Archive Federal Employment Apply for Our Jobs Our Jobs Working at NNSA Blog Home > NNSA Blog > End of the road for Roadrunner End of the road for Roadrunner Posted By Office of Public Affairs This weekend, Roadrunner, the World's Fastest Supercomputer from 2008, will be switched off but not be forgotten.


Microsoft Word - CX-Ross-Lexington_access_road_WEB.doc  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Darin Bowman Darin Bowman Project Manager - TELF-TPP-3 Proposed Action: Access road repair including reconstructing, grading, and shaping of roads, placing and compacting of rock surfacing, installation of gates, installation and maintenance of erosion control and water drainage features, and restoration of disturbed areas. Budget Information: Work Order # 00259661 PP&A Project No.: 1738 Categorical Exclusion Applied (from Subpart D, 10 C.F.R. Part 1021): B1.3 Routine maintenance activities...for...rights-of-way, infrastructures (e.g.. roads)...routine maintenance activities, corrective...are required to maintain and preserve infrastructures...in a condition suitable for the facility to be used for its designated purpose. Location: The project area is a Bonneville Power Administration (BPA) access road located on


One Woman's Road to Recovery | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

One Woman's Road to Recovery One Woman's Road to Recovery One Woman's Road to Recovery October 19, 2010 - 6:04pm Addthis One Woman's Road to Recovery Jo Napolitano Media Specialist, Argonne National Laboratory Editor's Note: Cross-posted from Argonne National Lab's Portraits of ARRA. Rebecca Bivens, who worked for a major oil company for seven years before she was laid off in January 2008, was elated to land a job that summer at one of the world's largest equipment manufacturers. That is, until the company laid off her entire division the night before Christmas Eve. "No one saw it coming," said Bivens, who spent years working in safety and procurement. "Just the month before, they said we were doing great. After losing two jobs in a year, it was pretty depressing. It was scary."


End of the road for Roadrunner | National Nuclear Security Administration  

National Nuclear Security Administration (NNSA)

End of the road for Roadrunner | National Nuclear Security Administration End of the road for Roadrunner | National Nuclear Security Administration Our Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy Emergency Response Recapitalizing Our Infrastructure Continuing Management Reform Countering Nuclear Terrorism About Us Our Programs Our History Who We Are Our Leadership Our Locations Budget Our Operations Media Room Congressional Testimony Fact Sheets Newsletters Press Releases Speeches Events Social Media Video Gallery Photo Gallery NNSA Archive Federal Employment Apply for Our Jobs Our Jobs Working at NNSA Blog Home > NNSA Blog > End of the road for Roadrunner End of the road for Roadrunner Posted By Office of Public Affairs This weekend, Roadrunner, the World's Fastest Supercomputer from 2008, will be switched off but not be forgotten.


Distributing Urea for the On-Road Vehicle Market | Department...  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

21st Century Truck Programs. 2006deerjackson.pdf More Documents & Publications Nonroad SCR-Urea Study Ensuring the Availability and Reliability of Urea Dosing For On-Road and...


The Road to a Sustainable Energy Future | Princeton Plasma Physics...  

NLE Websites -- All DOE Office Websites (Extended Search)

31, 2015, 9:30am to 11:00am Science On Saturday MBG Auditorium The Road to a Sustainable Energy Future Professor Emily Carter, Department of Engineering; Director of the Andlinger...


Predicting and Utilizing the Vehicle's Past and Futuer Road Grade  

Energy.gov (U.S. Department of Energy (DOE))

Predicted road grade may be used to estimate the power required to propel the vehicle through the upcoming terrain so that the engine controller can deliver the necessary power.


Comparison of On-Road Portable and Bench Emission Measurements  

Energy.gov (U.S. Department of Energy (DOE))

Chassis dynamometer testing using a conventional emissions bench and on-road testing with a portable emissions system were performed to compare exhaust emissions from selected vehicles by both techniques.


An Integrated Measurement to Road Vibration Simulation System  

E-Print Network (OSTI)

An Integrated Measurement to Road Vibration Simulation System Charles Birdsong, Ph.D. Dactron Inc for vibrations measured on a Jeep, compensated, and replicated on an electrodynamic shaker. Introduction. Simulation of measured vibrations requires data acquisition, data compensation, and reproduction

Birdsong, Charles


Sheila I. Smith 117 Phillips Road (518) 301-5158  

E-Print Network (OSTI)

Sheila I. Smith 117 Phillips Road (518) 301-5158 Valley Falls, NY, 12185 ssmith4@albany.edu DOB: 12 for Excellence in Nanotechnology (4-year) ­ Spring 2010 Publications Rajan Kumar, Sheila Smith, James Mc

Daly, Samantha


Linear Road : benchmarking stream-based data management systems  

E-Print Network (OSTI)

This thesis describes the design, implementation, and execution of the Linear Road benchmark for stream-based data management systems. The motivation for benchmarking and the selection of the benchmark application are ...

Tibbetts, Richard S. (Richard Singleton), 1979-



Marsh Road Power Plant Biomass Facility | Open Energy Information  

Open Energy Info (EERE)

Marsh Road Power Plant Biomass Facility Marsh Road Power Plant Biomass Facility Jump to: navigation, search Name Marsh Road Power Plant Biomass Facility Facility Marsh Road Power Plant Sector Biomass Facility Type Landfill Gas Location San Mateo County, California Coordinates 37.4337342°, -122.4014193° Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"ROADMAP","zoom":14,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"350px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":37.4337342,"lon":-122.4014193,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}


One Woman's Road to Recovery | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

One Woman's Road to Recovery One Woman's Road to Recovery One Woman's Road to Recovery October 19, 2010 - 6:04pm Addthis One Woman's Road to Recovery Jo Napolitano Media Specialist, Argonne National Laboratory Editor's Note: Cross-posted from Argonne National Lab's Portraits of ARRA. Rebecca Bivens, who worked for a major oil company for seven years before she was laid off in January 2008, was elated to land a job that summer at one of the world's largest equipment manufacturers. That is, until the company laid off her entire division the night before Christmas Eve. "No one saw it coming," said Bivens, who spent years working in safety and procurement. "Just the month before, they said we were doing great. After losing two jobs in a year, it was pretty depressing. It was scary."


Liver and biliary tract cancer among chemical workers  

SciTech Connect

A recent cohort mortality study of male, hourly wage employees of a large Michigan chemical production and research facility had found a greater than expected number of deaths coded to liver and biliary tract cancer. In response, an additional investigation was then undertaken of the 44 liver and biliary tract cancer deaths observed between 1940 and 1982. A random sample (N = 1,888) of subjects was selected from the total cohort (N = 21,437) to serve as referents. Company work history records were used to classify cases and referents by work area assignment and potential for exposure to 11 selected chemical agents which have been shown to produce cancer of the liver or biliary passages in experimental animals. Statistically significant associations in both positive and negative directions were found for several work areas within the facility. A suggestive association was found for vinyl chloride monomer, based on five cases with presumed exposure.

Bond, G.G.; McLaren, E.A.; Sabel, F.L.; Bodner, K.M.; Lipps, T.E.; Cook, R.R. (Dow Chemical Company, Midland, MI (USA))



INFOGRAPHIC: The Road to Fuel Efficiency | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

The Road to Fuel Efficiency The Road to Fuel Efficiency INFOGRAPHIC: The Road to Fuel Efficiency November 27, 2012 - 11:01am Addthis This infographic takes a look at fuel economy standards and how recent improvements in these standards will benefit consumers and the U.S. economy. | Infographic by Sarah Gerrity. This infographic takes a look at fuel economy standards and how recent improvements in these standards will benefit consumers and the U.S. economy. | Infographic by Sarah Gerrity. Sarah Gerrity Sarah Gerrity Multimedia Editor, Office of Public Affairs The Obama Administration's new national fuel economy standards for passenger vehicles will improve vehicle efficiency and save Americans money at the pump, all while reducing our dependence on foreign oil and growing


Microsoft Word - CX-Boyer-Tillamook_access_road_WEB.doc  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

James Semrau Project Manager - TELF-TPP-3 David Forward TELF-TPP-3 Proposed Action: Boyer-Tillamook No. 1 transmission line access road maintenance including grading and rocking of road surfaces and installation of water bars and cross drain culverts Budget Information: Work Order #00253279 PP&A Project No.: PP&A 1533 Categorical Exclusion Applied (from Subpart D, 10 C.F.R. Part 1021): B1.3 Routine maintenance activities...for...rights-of-way...(e.g. roads)...required to maintain and preserve...infrastructures in a condition suitable for a facility to be used for its designated purpose. Location: Tillamook and Yamhill counties, Oregon. Proposed by: Bonneville Power Administration (BPA) Description of the Proposed Action:

Note: This page contains sample records for the topic "dp road tract" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Electricity for road transport, flexible power systems and wind power  

Open Energy Info (EERE)

road transport, flexible power systems and wind power road transport, flexible power systems and wind power (Smart Grid Project) Jump to: navigation, search Project Name Electricity for road transport, flexible power systems and wind power Country Denmark Coordinates 56.26392°, 9.501785° Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"ROADMAP","zoom":14,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"350px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":56.26392,"lon":9.501785,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}


On the Road with ARPA-E | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

On the Road with ARPA-E On the Road with ARPA-E On the Road with ARPA-E September 23, 2010 - 12:29pm Addthis ARPA-E Director Dr. Arun Majumdar and MSU Project Lead Dr. Norbert Mueller test the wave disk engine. ARPA-E Director Dr. Arun Majumdar and MSU Project Lead Dr. Norbert Mueller test the wave disk engine. Dr. Arun Majumdar Dr. Arun Majumdar Former Director, Advanced Research Projects Agency - Energy Auto enthusiasts should be forewarned that this post may make you jealous. I say that because earlier this month I traveled to Michigan to visit two projects ARPA-E is currently funding - one at Michigan State University (MSU), the second at General Motors (GM), and got an up close look at several innovative transportation-related energy advancements. While at MSU, I had the op portunity to tour the facility where the wave


Microsoft Word - FINAL Contact Record 2012-01 Roads Maintenance  

Office of Legacy Management (LM)

RFLMA Contact Record 2012-01 page 1 of 6 RFLMA Contact Record 2012-01 page 1 of 6 ROCKY FLATS SITE REGULATORY CONTACT RECORD Purpose: Soil Disturbance Review Plan-Roads maintenance, including grading the road to the former A-3 Pond to convert the road to two-track vehicle use. Contact Record Approval Date: May 31, 2012 Site Contact(s)/Affiliation(s): Scott Surovchak, U.S. Department of Energy (DOE); Gwen Hooton, DOE; Rick DiSalvo, S.M. Stoller Corporation (Stoller); Kurt Franzen, Stoller; Linda Kaiser, Stoller Regulatory Contact(s)/Affiliation(s): Carl Spreng, Colorado Department of Public Health and Environment (CDPHE); Vera Moritz, U.S. Environmental Protection Agency (EPA) Date of Consultation Meeting: May 24, 2012 Consultation Meeting Participants: Carl Spreng, CDPHE; Scott Surovchak, DOE;


Microsoft Word - CX-Ostrander-Troutdale-access_road_WEB.doc  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

July 30, 2010 REPLY TO ATTN OF: KEP-4 SUBJECT: Environmental Clearance Memorandum Rick Ross Project Manager - TELF-TPP-3 Proposed Action: Ostrander-Troutdale No. 1 transmission line access road maintenance including grading and rocking of road surfaces and installation of water bars and cross drain culverts Budget Information: Work Order #: Unavailable PP&A Project No.: PP&A #1740 Categorical Exclusion Applied (from Subpart D, 10 C.F.R. Part 1021): B1.3 Routine maintenance activities for rights-of-way, infrastructures (e.g. roads) routine maintenance activities corrective are required to maintain and preserve infrastructures in a condition suitable for the facility to be used for its designed purpose. Location: The proposed project is located within the Bonneville Power Administration (BPA)


Bruceville Road Solar Power Facility | Open Energy Information  

Open Energy Info (EERE)

Bruceville Road Solar Power Facility Bruceville Road Solar Power Facility Jump to: navigation, search Name Bruceville Road Solar Power Facility Facility Bruceville Solar Power Facility Sector Solar Facility Type Photovoltaics Facility Status In Service Developer Recurrent Energy Energy Purchaser Sacramento Municipal Utility District Location Elk Grove, California Coordinates 38.347479°, -121.412498° Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"ROADMAP","zoom":14,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"350px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":38.347479,"lon":-121.412498,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}


EIS-0293: Transfer of Land Tracts Located at Los Alamos National  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

EIS-0293: Transfer of Land Tracts Located at Los Alamos National EIS-0293: Transfer of Land Tracts Located at Los Alamos National Laboratory, New Mexico EIS-0293: Transfer of Land Tracts Located at Los Alamos National Laboratory, New Mexico Summary This EIS evaluates the potential environmental impacts of a NNSA/DOE proposal for the conveyance of certain additional tracts of land administered by the DOE and located at Los Alamos National Laboratory, Los Alamos, and Santa Fe Counties, NM. Public Comment Opportunities No public comment opportunities available at this time. Documents Available for Download January 23, 2012 EIS-0293: Amended Record of Decision Transfer of Land Tracts Located at Los Alamos National Laboratory, NM August 17, 2005 EIS-0293: Amended Record of Decision Conveyance and Transfer of Certain Land Tracts Administered by the


Medical Progress: How Contagious Are Common Respiratory Tract Infections?  

Science Journals Connector (OSTI)

...the 20th century. In general, the potential for an outbreak is modified by the general health and the level of specific immunity of the population at risk., Among South African miners in 1910 to 1912, the attack rate exceeded 1 percent per month, as it did in some military training camps during the... The answer to this frequently asked question is addressed in this review article, which focuses on common respiratory tract infections that are spread from person to person. The author concentrates on community-based contagion rather than nosocomial infections or agents that have received recent attention principally because of their actual or potential role in biologic terrorism.

Musher D.M.



Search for protons from the H2(d,p)3H reaction in an electrolytic cell with Pd-Pt electrodes  

Science Journals Connector (OSTI)

The production of protons from the H2(d,p)3H reaction was investigated using an electrolytic cell and a proportional counter. The cathode, consisting of a 30.5-mg/cm2-thick Pd foil, separated the gas in the counter from the electrolyte (0.1M LiOD in D2O). The efficiency for proton detection was 28%. The electrolytic cell was operated with current densities up to 650 mA/cm2. Several runs with the current switched on and off and with different Pd foils have been performed with the longest run lasting more than 10 days. No difference in the count rate was observed when the electrolytic cell was on or off. From the high-energy part of the particle spectrum we obtain an upper limit for the proton production from the fusion reaction H2(d,p)3H of 410-23 fusion/(dd pair/sec).

K. E. Rehm; W. Kutschera; G. J. Perlow



Solution structure of a fragment of the dimerization domain of DP-1 determined by 1H-nuclear magnetic resonance and distance geometry  

Science Journals Connector (OSTI)

The structure of a synthesized peptide with the sequence of NHILPNESAYDQKNIRRRVYDALNVLMAMNIISK that corresponds to residues 151184 of transcription factor DP-1 (Girling et al., Nature 362 (1993) 8387) was determined by 1H-nuclear magnetic resonance in water and 40% d3-trifluoroethanol/water, respectively. Nuclear Overhauser effect cross peaks, ?H chemical shifts and J-coupling constants of ?HNH show that the peptide consists a helix from Ser-8 to Ser-33 in solution. Fifty structures were constructed with 288 upper distance limits and 21 angle constraints by DIANA (Guntert et al., J. Mol. Biol. 217 (1991) 517530). Although the N-terminal of the peptide exhibits a random conformation, the 20 best structures show a root mean square deviation of 0.890.36 for backbone atoms and 1.800.34 for heavy atoms from residue Ser-8 to Ser-33. This result supports the proposal that DP-1 and E2F-1 may dimerize with a coiled-coil type interaction.

Shouhong Guang; Jihui Wu; Tianning Yu; Youlin Xia; Yunyu Shi



Market and Community in Antebellum America: The Plank Roads of New York  

E-Print Network (OSTI)

University 57.The map of Oneida County is part of the largeTERVILLE Plank Roads of Oneida County, NewYork, 1845-1860PLANK ROADS OF ONEIDA COUNTY, NEW YORK, 1845-1860 NO. I0 ii

Majewski, John; Baer, Christopher; Klein, Daniel B.



The walled city : Beijing hybrid development plan in the 2nd ring road  

E-Print Network (OSTI)

The circular ring roads are one of the key elements that define the spatial organization of Beijing today. However, as the city continues to expand, the ring roads located in the inner city, combined with the gridded ...

Liang, Shaoyi



E-Print Network 3.0 - air pollution ii--road Sample Search Results  

NLE Websites -- All DOE Office Websites (Extended Search)

ii--road Search Powered by Explorit Topic List Advanced Search Sample search results for: air pollution ii--road Page: << < 1 2 3 4 5 > >> 1 Air Pollution Physics and Chemistry EAS...


Floodplain and Wetlands Assessment for Construction of a Second Full Service Access Road over Lena Gulch  

Office of Energy Efficiency and Renewable Energy (EERE)

Floodplain and Wetlands Assessment for Construction of a Second Full Service Access Road over Lena Gulch from South Golden Road to the National Renewable Energy Laboratorys South Table Mountain Complex, Golden, Colorado.


Kursplan fr lsret 2001/2002 ROAD-MAN-LANDSCAPE -DESIGNPROJECT ASB150  

E-Print Network (OSTI)

, landscape and environmental requirements. Innehåll: Course content: New roads in the landscape. Conversion concepts in traffic planning, road construction, landscape architecture, urban architecture, planning (graduate) students of engineering, architecture and landscape architecture, and future planners


Gobble Up Fuel Savings on Your Next Road Trip with My Trip Calculator...  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

Gobble Up Fuel Savings on Your Next Road Trip with My Trip Calculator Gobble Up Fuel Savings on Your Next Road Trip with My Trip Calculator November 19, 2012 - 9:51am Addthis Save...


E-Print Network 3.0 - ascending tract neurons Sample Search Results  

NLE Websites -- All DOE Office Websites (Extended Search)

1987 Summary: or with transmitted white light. The ganglionic tracts and the fluorescent processes of the stained neuron were drawn... to the ventral and dorsal...


E-Print Network 3.0 - association fiber tracts Sample Search...  

NLE Websites -- All DOE Office Websites (Extended Search)

; Computer Technologies and Information Sciences 2 Shape Modeling and Clustering of White Matter Fiber Tracts Using Fourier Descriptors Summary: Shape Modeling and Clustering...


E-Print Network 3.0 - atrazine-induced reproductive tract Sample...  

NLE Websites -- All DOE Office Websites (Extended Search)

secreted by the male that seal the female reproductive tract Present in insects, snakes, and rats 10 Source: Blouin-Demers, Gabriel - Department of Biology, University of...


120 Check www.uaf.edu/schedule/ for changes to classes, regulations and fees. Area code is 907. FarmersLoopRoad  

E-Print Network (OSTI)

. TROTH YEDDHA' PARK FarmersLoopRoad West Valley Plaza 4001 Geist Road, Suite 6 - Advancement Services

Wagner, Diane


HCEI Road Map and Introduction and Overview 2011  

Office of Energy Efficiency and Renewable Energy (EERE)

This road map is a summary of the 2011 key goals and strategies of the Hawaii Clean Energy Initiative, which was founded based on a Memorandum of Understanding between the State of Hawaii and the U.S. Department of Energy in 2008.

Note: This page contains sample records for the topic "dp road tract" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


An Investigation of Optimal Vehicle Maneuvers for Different Road Conditions  

E-Print Network (OSTI)

vehicle maneuvers in time-critical situations have emerged as powerful tools during the past years. EvenAn Investigation of Optimal Vehicle Maneuvers for Different Road Conditions Bj¨orn Olofsson Lund, Sweden, firstname.lastname@control.lth.se. Department of Electrical Engineering, Link



E-Print Network (OSTI)

STAY TO THE RIGHT ON UNION STREET Roosevelt Road NORTH HalstedStreet UnionAvenue Rochford Street Maxwell Street I-94DanRyanExpressway MXPS Maxwell Street Parking Structure X Stukel Towers (student onto W. Roosevelt Rd. Turn left at the first light onto S. Union Ave. From the North I-90 E

Illinois at Chicago, University of


Road Grade Estimation for Look-ahead Vehicle Control  

E-Print Network (OSTI)

to help meet the instantaneous power demand while keeping fuel consumption and environmental impact as low conserve fuel without increasing trip time. The preview road grade information can also be uti- lized when power comsumption scheduling over time can improve total energy efficiency, as explored in Pettersson

Johansson, Karl Henrik


Story Road Landfill Solar Site Evaluation: San Jose  

Energy.gov (U.S. Department of Energy (DOE))

This report describes the findings of a solar site evaluation conducted at the Story Road Landfill (Site) in the City of San Jose, California (City). This evaluation was conducted as part of a larger study to assess solar potential at multiple public facilities within the City.


The long and winding road of state building  

E-Print Network (OSTI)

Chapter 15 The long and winding road of state building Sagar Raj Sharma1 1. Context Post and services, including security. In this book, we have attempted to view state-building as essentially with various such aspects of state-building in today's post-conflict Nepal. The first two chapters have dealt

Richner, Heinz


On-Road Vehicle Detection Using Optical Sensors: A Review  

E-Print Network (OSTI)

1 On-Road Vehicle Detection Using Optical Sensors: A Review Zehang Sun1 , George Bebis2 and Ronald are expected to add up to 1%-3% of the world's gross domestic product [1]. With the aim of reducing injury

Bebis, George


Road traffic noise mapping in Guangzhou using GIS and GPS  

Science Journals Connector (OSTI)

Abstract The primary objective of this study is to develop day and night road traffic noise maps for Guangzhou using Geographical Information Systems (GIS) and Global Positioning Systems (GPS). First, as speed-density relation is used to estimate the traffic volume from GPS data collected from floating cars. Meanwhile, the attributes of the roads and buildings are automatically exported from GIS. Second, a single vehicle noise emission model is combined with a noise propagation model to formulate a regional traffic noise calculation model that accounts for the traffic noise attenuation in an urban area. The algorithm is optimized by intelligently dividing the computational grids, filtering the traffic noise sources automatically and performing a quick index of the estimation objects. Finally, the day and night road traffic noise levels in Guangzhou are estimated to create two traffic noise maps. The accuracy of the developed algorithm is validated by conducting a traffic noise monitoring experiment in several districts of Guangzhou with different road types. The results show that the average error between the estimated and measured values is below 2.0dB.

Ming Cai; Jingfang Zou; Jiemin Xie; Xialin Ma



Office of the General Counsel 777 Glades Road  

E-Print Network (OSTI)

Office of the General Counsel 777 Glades Road Boca Raton, FL 33431 tel: 561.297.3007 / fax: 561) communications intended to protect student, campus, or public safety. The Florida law is commonly interpreted be disclosed? Answer: In general, information derived from a student's education records may be disclosed only

Fernandez, Eduardo


FOR341 Timber Harvesting and Forest Roads Spring 2009  

E-Print Network (OSTI)

Text: Water Quality BMPs (Best Management Practices) for Montana Forests Other readings as assigned management. Best management practices as they apply to forest operations in Montana and the western US, cost effectiveness, and environmental performance of forest road systems. · Upper Division Writing

Vonessen, Nikolaus


On-Road Remote Sensing of Automobile Emissions in the Denver Area: Year 6,  

E-Print Network (OSTI)

On-Road Remote Sensing of Automobile Emissions in the Denver Area: Year 6, January 2007 Gary A 80208 June 2007 #12;On-Road Remote Sensing of Automobile Emissions in the Denver Area: Year 6 1-Road Remote Sensing of Automobile Emissions in the Denver Area: Year 6 2 INTRODUCTION Many cities

Denver, University of


On-Road Remote Sensing of Automobile Emissions in the Phoenix Area: Year 2  

E-Print Network (OSTI)

On-Road Remote Sensing of Automobile Emissions in the Phoenix Area: Year 2 Sajal S. Pokharel, Gary Alpharetta, Georgia 30022 Contract No. E-23-4 #12;On-Road Remote Sensing of Automobile Emissions when the measurements were binned by model year. #12;On-Road Remote Sensing of Automobile Emissions

Denver, University of


On-Road Remote Sensing of Automobile Emissions in the Phoenix Area: Year 5,  

E-Print Network (OSTI)

On-Road Remote Sensing of Automobile Emissions in the Phoenix Area: Year 5, November 2004 Gary A, Suite 140 Alpharetta, Georgia 30022 Contract No. E-23-9 #12;On-Road Remote Sensing of Automobile campaigns.14 #12;On-Road Remote Sensing of Automobile Emissions in the Phoenix Area: Year 5 2 INTRODUCTION

Denver, University of


On-Road Remote Sensing of Automobile Emissions in the Phoenix Area: Year 3  

E-Print Network (OSTI)

On-Road Remote Sensing of Automobile Emissions in the Phoenix Area: Year 3 Sajal S. Pokharel, Gary Alpharetta, Georgia 30022 Contract No. E-23-4 #12;On-Road Remote Sensing of Automobile Emissions a slight negative dependence on #12;On-Road Remote Sensing of Automobile Emissions in the Phoenix Area

Denver, University of


On-Road Remote Sensing of Automobile Emissions in the Denver Area: Year 5,  

E-Print Network (OSTI)

On-Road Remote Sensing of Automobile Emissions in the Denver Area: Year 5, January 2005 Gary A, Suite 140 Alpharetta, Georgia 30022 Contract No. E-23-9 #12;On-Road Remote Sensing of Automobile campaigns.13 #12;On-Road Remote Sensing of Automobile Emissions in the Denver Area: Year 5 2 INTRODUCTION

Denver, University of


On-Road Remote Sensing of Automobile Emissions in the LaBrea Area: Year 2  

E-Print Network (OSTI)

On-Road Remote Sensing of Automobile Emissions in the LaBrea Area: Year 2 Mitchell J. Williams 140 Alpharetta, Georgia 30022 Contract No. E-23-4 #12;On-Road Remote Sensing of Automobile Emissions compared to the standard error of the mean measurements. #12;On-Road Remote Sensing of Automobile Emissions

Denver, University of


Pollutant Emissions from Biodiesels in Diesel Engine Tests and On-road Tests  

E-Print Network (OSTI)

-road biodiesel truck tests and data analysis were developed. Both road condition and engine performance affected the formation of emissions. Vehicle specific power (VSP) was calculated to present real power required in on-road tests. Tests data of highways showed...

Zhong, Yue



An overview of recycling in road infrastructure in France from the OFRIR Jullien Agnsa  

E-Print Network (OSTI)

in road framework in France since 1980, considering both environmental, geotechnical road building (Ministry of Transport and Construction/Scientifical office and Road direction), by MEDD/DPPR (Ministry of environment and sustainable development/ Pollution and risk direction), by ADEME (Energy and Environment

Boyer, Edmond


Going-to-the-Sun Road, Glacier National Park, MT, USA  

E-Print Network (OSTI)

Going-to-the-Sun Road, Glacier National Park, MT, USA Avalanche Path Atlas Erich H. Peitzsch Daniel..................................................................................................................................... 2 Overview of Red Rock Group avalanche paths, Going-to-the-Sun Road, Glacier National Park, MT................................................................................................................................................... 3 Overview of Lower GTSR group avalanche paths, Going-to-the-Sun Road, Glacier National Park, MT


Quantitative analysis along the pyramidal tract by length-normalized parameterization based on diffusion tensor tractography  

E-Print Network (OSTI)

on diffusion tensor tractography: Application to patients with relapsing neuromyelitis optica Fuchun Lin,a,1 the pyramidal tract (PYT) of relapsing neuromyelitis optica (RNMO) patients without visible brain lesions-normalized parameterization; Diffusion indices; Pyramidal tract; Relapsing neuromyelitis optica Introduction Diffusion tensor



Quantitative MRI and DTI of human white matter tracts: Myelin density and diffusivity Robert Dougherty1  

E-Print Network (OSTI)

-myelinated white matter tracts: left SLF,occipital-callosal, frontal-callosal and optic radiation, left ILF captures the callosal tracts, but not SLF, ILF, or OR. 4° 10° 20° 30° Measure 4 SPGRs with variable flip

Dougherty, Bob

Note: This page contains sample records for the topic "dp road tract" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Search for solar axion emission from {sup 7}Li and D(p, ?){sup 3}He nuclear decays with the CAST ?-ray calorimeter  

SciTech Connect

We present the results of a search for a high-energy axion emission signal from {sup 7}Li (0.478 MeV) and D(p, ?){sup 3}He (5.5 MeV) nuclear transitions using a low-background ?-ray calorimeter during Phase I of the CAST experiment. These so-called ''hadronic axions'' could provide a solution to the long-standing strong-CP problem and can be emitted from the solar core from nuclear M1 transitions. This is the first such search for high-energy pseudoscalar bosons with couplings to nucleons conducted using a helioscope approach. No excess signal above background was found.

Andriamonje, S.; Aune, S.; Dafni, T.; Ferrer-Ribas, E. [DAPNIA, Centre d'tudes Nuclaires de Saclay, Gif-sur-Yvette (France); Autiero, D.; Barth, K.; Davenport, M.; Lella, L. Di [European Organization for Nuclear Research (CERN),CH-1211 Genve 23 (Switzerland); Belov, A. [Institute for Nuclear Research, Russian Academy of Sciences, Moscow (Russian Federation); Beltrn, B.; Carmona, J.M.; Cebrin, S. [Instituto de Fsica Nuclear y Altas Energas, Universidad de Zaragoza, Zaragoza (Spain); Bruninger, H.; Englhauser, J.; Friedrich, P. [Max-Planck-Institut fr extraterrestrische Physik, Giessenbachstrasse, 85748 Garching (Germany); Collar, J.I. [Enrico Fermi Institute and KICP, University of Chicago, Chicago, IL (United States); Eleftheriadis, C. [Aristotle University of Thessaloniki, Thessaloniki (Greece); Fanourakis, G. [National Center for Scientific Research ''Demokritos'', Athens (Greece); Fischer, H.; Franz, J., E-mail: David.Miller@slac.stanford.edu [Albert-Ludwigs-Universitt Freiburg, Freiburg (Germany); Collaboration: CAST collaboration; and others



Patterns of radiotherapy practice for biliary tract cancer in Japan: results of the Japanese radiation oncology study group (JROSG) survey  

Science Journals Connector (OSTI)

The patterns of radiotherapy (RT) practice for biliary tract cancer (BTC) in Japan are not clearly established.

Fumiaki Isohashi; Kazuhiko Ogawa; Hirobumi Oikawa; Hiroshi Onishi



Godfrey Road, Florida: Energy Resources | Open Energy Information  

Open Energy Info (EERE)

Godfrey Road, Florida: Energy Resources Godfrey Road, Florida: Energy Resources Jump to: navigation, search Equivalent URI DBpedia Coordinates 26.293686°, -80.223003° Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"ROADMAP","zoom":14,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"350px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":26.293686,"lon":-80.223003,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}


U.S. Virgin Islands Energy Road Map: Analysis  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Energy Energy Road Map: Analysis Eric Lantz, Dan Olis, and Adam Warren Technical Report NREL/TP-7A20-52360 September 2011 NREL is a national laboratory of the U.S. Department of Energy, Office of Energy Efficiency & Renewable Energy, operated by the Alliance for Sustainable Energy, LLC. National Renewable Energy Laboratory 1617 Cole Boulevard Golden, Colorado 80401 303-275-3000 * www.nrel.gov Contract No. DE-AC36-08GO28308 U.S. Virgin Islands Energy Road Map: Analysis Eric Lantz, Dan Olis, and Adam Warren Prepared under Task No. IDVI.0020 Technical Report NREL/TP-7A20-52360 September 2011 NOTICE This report was prepared as an account of work sponsored by an agency of the United States government.


Alaskan Ice Road Water Supplies Augmented by Snow Barriers  

NLE Websites -- All DOE Office Websites (Extended Search)

6, 2013 6, 2013 Alaskan Ice Road Water Supplies Augmented by Snow Barriers Washington, D.C. - In a project supported and managed by the Office of Fossil Energy's National Energy Technology Laboratory (NETL), researchers at the University of Alaska Fairbanks have demonstrated that the use of artificial barriers-snow fences-can significantly increase the amount of fresh water supplies in Arctic lakes at a fraction of the cost of bringing in water from nearby lakes. The results promise to enhance environmentally sound development of Alaska's natural resources, lowering the costs of building ice roads used for exploring for oil and natural gas in Alaska. They could also be used to help augment fresh water supplies at remote villages. Researcher Joel Bailey measures the density of the snow in this snow pit to determine the amount of snow in the drift and the water equivalent of the snow drift.


Using Daylight to Light the Access Zone of Road Tunnels  

NLE Websites -- All DOE Office Websites (Extended Search)

Using Daylight to Light the Access Zone of Road Tunnels Using Daylight to Light the Access Zone of Road Tunnels Speaker(s): Eliyahu Ne'eman Date: March 4, 2003 - 12:00pm Location: Bldg. 90 Lighting guides for roadway tunnels specify relatively high luminances for the "access zone" into the tunnel. They are needed to allow the eyes of the driver sufficient time to adapt during the short period of the transition from the outdoor natural daylight levels to the fairly low luminances along the main length of the tunnel. Usually, the necessary high luminances are provided by rows of costly luminaries which consume a lot of electricity during peak use periods and need a good deal of maintenance. To save some electric power, controls are used to dim the lighting on cloudy hours. Daylight has been used for the access zone in several tunnels around the


Airport Road, Wyoming: Energy Resources | Open Energy Information  

Open Energy Info (EERE)

Road, Wyoming: Energy Resources Road, Wyoming: Energy Resources Jump to: navigation, search Equivalent URI DBpedia Coordinates 43.9932901°, -107.9492606° Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"ROADMAP","zoom":14,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"350px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":43.9932901,"lon":-107.9492606,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}


West Valley Demonstration Project 10282 Rock Springs Road  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

West Valley Demonstration Project West Valley Demonstration Project 10282 Rock Springs Road West Valley, NY 141 71 -9799 Mr. Daniel W. Coyne President & General Manager CH2M HILL B&W West Valley, LLC West Valley Demonstration Project 10282 Rock Springs Road West Valley, NY 141 71 -9799 ATTENTION: J. D. Rendall, Regulatory Strategy, AC-EA SUBJECT: Environmental Checklist WVDP-20 12-0 1, " WVDP Reservoir Interconnecting Canal Maintenance Activities" REFERENCE: Letter WD:2012:0409 (357953), D. W. Coyne to R. W. Reffner, "CONTRACT NO. DE-EM000 1529, Section 5-3, Item 105, NEPA Documentation (Transmittal of Environmental Checklist WVDP-20 12-0 1, WVDP Reservoir Interconnecting Canal Maintenance Activities), Revision 1 ," dated July 24, 20 12 Dear Mr. Coyne:


Indicators of longitudinal unevenness of roads in the USA  

Science Journals Connector (OSTI)

About 25,800 longitudinal profiles of in-service roads in the USA (Long-Term Pavement Performance (LTPP) Program) were evaluated to obtain indicators of the longitudinal unevenness (roughness) of the road surface defined by standards ISO 8608 : 1995 and EN 13036-5 : 2006. Besides the commonly used International Roughness Index (IRI), also parameters of the Power Spectral Density (PSD) were evaluated taking into account not only the whole interval of effectively acting wavelengths, but also its two and three partial sub-bands. Differences between left and right tracks and between Asphalt Concrete (AC) and Portland Cement Concrete (CC) wearing courses were considered. For all the mentioned indicators (21), their Probability Density Functions (PDF) and numerical statistics were estimated.

Oldrich Kropac; Peter Mucka



Moose Wilson Road, Wyoming: Energy Resources | Open Energy Information  

Open Energy Info (EERE)

Road, Wyoming: Energy Resources Road, Wyoming: Energy Resources Jump to: navigation, search Equivalent URI DBpedia Coordinates 43.5252053°, -110.844655° Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"ROADMAP","zoom":14,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"350px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":43.5252053,"lon":-110.844655,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}


Science Education on the Road: 2013 Princeton University Community and  

NLE Websites -- All DOE Office Websites (Extended Search)

Science Education on the Road: 2013 Princeton University Community and Science Education on the Road: 2013 Princeton University Community and Staff Day October 12, 2013 Gallery: It was a beautiful autumn day in Princeton, NJ. As tailgaters got ready for the football game (Princeton vs. Lafayette) in Lot 21, others took the short walk into Jadwin Gym to take part in the University's Annual Community & Staff Day. PPPL was represented by the Science Education Department and in usual Science Ed. fashion, we did not disappoint! The table was busy all day with kids and adults equally fascinated by what they learned... Plasma! From the hair-raising Van de Graaff generator to the innovative Plasma Speaker to the surprising vacuum pump marshmallow experiment, folks were wowed by what they saw. Spreading the word about Plasma while having a great time, check!


Trends in On-Road Vehicle Emissions of Ammonia  

NLE Websites -- All DOE Office Websites (Extended Search)

Trends in On-Road Vehicle Emissions of Ammonia Trends in On-Road Vehicle Emissions of Ammonia Title Trends in On-Road Vehicle Emissions of Ammonia Publication Type Journal Article Year of Publication 2008 Authors Kean, Andrew J., David Littlejohn, George Ban-Weiss, Robert A. Harley, Thomas W. Kirchstetter, and Melissa M. Lunden Journal Atmospheric Environment Abstract Motor vehicle emissions of ammonia have been measured at a California highway tunnel in the San Francisco Bay area. Between 1999 and 2006, light-duty vehicle ammonia emissions decreased by 38 ± 6%, from 640 ± 40 to 400 ± 20 mg kg-1. High time resolution measurements of ammonia made in summer 2001 at the same location indicate a minimum in ammonia emissions correlated with slower-speed driving conditions. Variations in ammonia emission rates track changes in carbon monoxide more closely than changes in nitrogen oxides, especially during later evening hours when traffic speeds are highest. Analysis of remote sensing data of Burgard et al. (Environ Sci. Technol. 2006, 40, 7018-7022) indicates relationships between ammonia and vehicle model year, nitrogen oxides, and carbon monoxide. Ammonia emission rates from diesel trucks were difficult to measure in the tunnel setting due to the large contribution to ammonia concentrations in a mixed-traffic bore that were assigned to light-duty vehicle emissions. Nevertheless, it is clear that heavy-duty diesel trucks are a minor source of ammonia emissions compared to light-duty gasoline vehicles.


Cultural Resource Investigations for a Multipurpose Haul Road on the Idaho National Laboratory  

SciTech Connect

The U. S. Department of Energy, Idaho Operations Office is considering options for construction of a multipurpose haul road to transport materials and wastes between the Materials and Fuels Complex (MFC) and other Idaho National Laboratory (INL) Site facilities. The proposed road will be closed to the public and designed for limited year-round use. Two primary options are under consideration: a new route south of the existing T-25 power line road and an upgrade to road T-24. In the Spring of 2010, archaeological field surveys and initial coordination and field reconnaissance with representatives from the Shoshone-Bannock Tribes were completed to identify any resources that may be adversely affected by the proposed road construction and to develop recommendations to protect any listed or eligible for listing on the National Register of Historic Places. The investigations showed that 24 archaeological resources and one historic marker are located in the area of potential effects for road construction and operation south of the T-25 powerline road and 27archaeological resources are located in the area of potential effects for road construction and operation along road T-24. Generalized tribal concerns regarding protection of natural resources were also documented in both road corridors. This report outlines recommendations for additional investigations and protective measures that can be implemented to minimize adverse impacts to the identified resources.

Brenda R. Pace; Cameron Brizzee; Hollie Gilbert; Clayton Marler; Julie Braun Williams



Dosimetry of internal exposure of respiratory tract to incorporated plutonium  

Science Journals Connector (OSTI)

ICRP Publication 66 that had adopted a new approach to estimate dose to lungs and an extrathoracic region based on a revised human respiratory tract model was considered by the authors to address some aspects related to application of ICRP 66 in radiation safety practices. Comparison of committed equivalent doses received to the lungs following acute inhalation of plutonium-239 aerosols with different solubility and particle size calculated as per previous ICRP 30 approach (averaging of energy imparted by radiation to the organ over the mass of the organ) and new ICRP 66 concept (detriment-weighted dose resulting from irradiation of specific cells at risk in the lung) showed that these dose estimates are disparate. At the same time, ICRP 66 approach, being more biologically reasonable, still requires additional studies to validate risk apportionment among tissues in the lungs. Because ICRP 66 for the first time introduced a method to calculate internal radiation dose to the extrathoracic region, equivalent dose to this region following acute inhalation of different plutonium-239 aerosols was assessed in comparison with equivalent dose to the lungs. The relative contribution of the extrathoracic region to the effective dose turned out to be significant.

S.A. Romanov; Y.V. Zaytseva



EA-0904: Access Road from State Route 240 to the 200 West Area Hanford  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

4: Access Road from State Route 240 to the 200 West Area 4: Access Road from State Route 240 to the 200 West Area Hanford Site, Richland, Washington EA-0904: Access Road from State Route 240 to the 200 West Area Hanford Site, Richland, Washington SUMMARY This EA evaluates the environmental impacts of a proposal to construct an access road on the U.S. Department of Energy's Hanford Site in Richland, Washington, from State Route 240 to Beloit Avenue in the 200 West Area. PUBLIC COMMENT OPPORTUNITIES None available at this time. DOCUMENTS AVAILABLE FOR DOWNLOAD March 10, 1994 EA-0904: Finding of No Significant Impact Access Road from State Route 240 to the 200 West Area Hanford Site, Richland, Washington March 10, 1994 EA-0904: Final Environmental Assessment Access Road from State Route 240 to the 200 West Area Hanford Site,


Opportunities for the Use of Renewable Energy in Road Transport | Open  

Open Energy Info (EERE)

Opportunities for the Use of Renewable Energy in Road Transport Opportunities for the Use of Renewable Energy in Road Transport Jump to: navigation, search Tool Summary LAUNCH TOOL Name: Opportunities for the Use of Renewable Energy in Road Transport Agency/Company /Organization: Renewable Energy Technology Deployment Sector: Energy Focus Area: Renewable Energy, Transportation Topics: Implementation, Policies/deployment programs Resource Type: Publications, Guide/manual Website: www.iea-retd.org/files/RETRANS_PolicyMakersReport_final.pdf Opportunities for the Use of Renewable Energy in Road Transport Screenshot References: Opportunities for the Use of Renewable Energy in Road Transport[1] "This report discusses the current state of the art of the use of options for using renewable energies in road transport, and explores possible



Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

FINDING OF NO SIGNIFICANT IMPACT FOR THE MULTIPURPOSE HAUL ROAD FINDING OF NO SIGNIFICANT IMPACT FOR THE MULTIPURPOSE HAUL ROAD WITHIN THE IDAHO NATIONAL LABORATORY SITE (EM-FMDP-I0-068) Agency: U. S. Department of Energy (DOE) Action: Finding of No Significant Impact (FONSI) Summary: The DOE prepared a Draft Environmental Assessment (EA) for the proposed "Environmental Assessment for the Multipurpose Haul Road Within the Idaho National Laboratory Site" (DOE/EA-I772). The proposed action consists of constructing a road for limited year-round use with the ability for trucks traveling in opposite directions to pass. The analysis of the proposed road evaluates clearing and grading a base, installing necessary culverts and drainage, and placing and compacting gravel for the roadway. The haul road would be used to:


Vehicle Technologies Office: Fact #502: January 21, 2008 Off-Road Diesel  

NLE Websites -- All DOE Office Websites (Extended Search)

2: January 21, 2: January 21, 2008 Off-Road Diesel Equipment Facing Tougher Emissions Regulation to someone by E-mail Share Vehicle Technologies Office: Fact #502: January 21, 2008 Off-Road Diesel Equipment Facing Tougher Emissions Regulation on Facebook Tweet about Vehicle Technologies Office: Fact #502: January 21, 2008 Off-Road Diesel Equipment Facing Tougher Emissions Regulation on Twitter Bookmark Vehicle Technologies Office: Fact #502: January 21, 2008 Off-Road Diesel Equipment Facing Tougher Emissions Regulation on Google Bookmark Vehicle Technologies Office: Fact #502: January 21, 2008 Off-Road Diesel Equipment Facing Tougher Emissions Regulation on Delicious Rank Vehicle Technologies Office: Fact #502: January 21, 2008 Off-Road Diesel Equipment Facing Tougher Emissions Regulation on Digg


Prevalence of urinary tract infections and associated factors among pregnant workers in the electronics industry  

Science Journals Connector (OSTI)

Pregnancy is a risk factor for urinary tract infection (UTI), and it has been shown that frequent urine voiding was a protecting factor against UTI for nonpregnant female cleanroom workers. We conducted a study t...

Shih-Bin Su; Jiang-Nan Wang; Chih-Wei Lu



Toward new tracts for America : the house and its serial deployment  

E-Print Network (OSTI)

This thesis is a proposition for suburban tract housing in the United States. A brief critical history of the production of suburban housing and some precedents for architecturally motivated responses to its shortcomings ...

Slate, Bjrn Robert


Note: This page contains sample records for the topic "dp road tract" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


E-Print Network 3.0 - ascending urinary tract Sample Search Results  

NLE Websites -- All DOE Office Websites (Extended Search)

(tract) infection C3: Pulmonary collapse C5: Vesicoure teral reflux C20: Urinary... : Cough C2: Asthma, unspecifie d C9: Urinary ... Source: Dy, Jennifer G. - Department of...


Application of SCR and PM-METALIT for Non-Road Applications: SCRi  

Energy.gov (U.S. Department of Energy (DOE))

Advantages of this new application of SCR and PM-METALIT for non-road applications include compact design, robustness, low backpressure, and cost


Technologies for a Sustainable Heavy-Duty On-Road Fleet  

Energy.gov (U.S. Department of Energy (DOE))

Only selected energy pathways for the heavy-duty on-road fleet are consistent with the joint objectives of reducing petroleum dependence and mitigating climate change


Microsoft Word - CX-Longview-Chehalis-etall-2013-AccessRoad_WEB...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Proposed Action: Access road maintenance on Bonneville Power Administration's (BPA) Longview-Chehalis No. 1 and No. 3, and Lexington-Longview No. 1 transmission line...


USVI Energy Road Map: Charting the Course to a Clean Energy Future...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Islands pilot project road map, including over-arching goals, organization, strategy, technology-specific goals and accomplishments, challenges, solutions, and upcoming...


Effects of Off-road Vehicles on Rodents in the Sonoran Desert.  

E-Print Network (OSTI)

??Human recreation on rangelands may negatively impact wildlife populations. Among those activities, off-road vehicle (ORV) recreation carries the potential for broad ecological consequences. A study (more)

Reid, John Simon



EA-1980: Spar Canyon-Round Valley Access Road System Improvements...  

Energy Savers (EERE)

proposed improvements to the access road system for its existing Spar Canyon-Round Valley Transmission Line located on BLM land in Custer County, Idaho. Additional information is...


Mead-Liberty 345-kV Transmission Line Access Road Maintenance...  

NLE Websites -- All DOE Office Websites (Extended Search)

2 Mead-Liberty 345-kV Transmission Line Access Road Maintenance and Localized Vegetation Management Maricopa County, Arizona Categorical Exclusion Continuation Sheet Project...


Widespread Distribution of Urinary Tract Infections Caused by a Multidrug-Resistant Escherichia coli Clonal Group  

Science Journals Connector (OSTI)

...Subjects of the University of California at Berkeley; informed consent was not obtained, because the study involved neither direct interviews nor chart reviews. The California cohort consisted of women with symptoms of urinary tract infection who were seen at a university health service and were consecutively... A previously unrecognized clone of E. coli appears to be involved in many of the community-acquired urinary tract infections in three locations in the United States.

Manges A.R.; Johnson J.R.; Foxman B.



Texture, composition, and diagenesis of the Burbank Sandstone, North Burbank field, Tract 97, Osage County, Oklahoma  

E-Print Network (OSTI)

TEXTURE, COMPOSITION, AND DIAGENESIS OF THE BURBANK SANDSTONE, NORTH BURBANK FIELD, TRACT 97, OSAGE COUNTY, OKLAHOMA A Thesis HALTER RAY HUFFORD Sumitted to the Graduate College of Texas A&M University in partial fulfillment of the requirement... for the degree of MASTER OF SCIENCE August 1983 Major Subject: Geology TEXTURE, COMPOSITION, AND DIAGENESIS OF THE BURBANK SANDSTONE, NORTH BURBANK FIELD, TRACT 97, OSAGE COUNTY, OKLAHOMA A Thesis by WALTER RAY HUFFORD Approved as the style and content...

Hufford, Walter Ray



Distribution of glycosaminoglycans in specific regions of the reproductive tract of mares  

E-Print Network (OSTI)

(Chair Committee) David W. Forrest (Member) Thomas H. Welsh, Jr (Member) Ro ert C. Bur rdt (Member Gerald R. Bratton (Head of Department) May 1990 ABSTRACT Distribution of Glycosaminoglycans in Specific Regions of the Reproductive Tract... of glycosaminoglycans in luminal fluids is affected by the oestrous cycle and location within the reproductive tract. All mares were considered to be reproduc- tively sound, based on physical examination (Greenhoff 5 Kenney, 1975), evaluation of endometrial biopsies...

Varner, Dickson Drew



Neurogenic period of ascending tract neurons in the upper lumbar spinal cord of the rat  

SciTech Connect

Although the neurogenic period for neurons in the lumbar spinal cord has been clearly established (Days 12 through 16 of gestation), it is not known when the neurogenesis of ascending tract neurons is completed within this period. The purpose of the present study was to determine the duration of the neurogenic period for projection neurons of the ascending tracts. To label neurons undergoing mitosis during this period, tritiated thymidine was administered to fetal rats on Embryonic (E) Days E13 through E16 of gestation. Ascending tract neurons of the lumbar cord were later (Postnatal Days 40-50) labeled in each animal with a retrograde tracer, Fluoro-Gold, applied at the site of a hemisection at spinal cord segment C3. Ascending tract neurons which were undergoing mitosis in the upper lumbar cord were double labeled, i.e., labeled with both tritiated thymidine and Fluoro-Gold. On Day E13, 89-92% of the ascending tract neurons were double labeled; on Day E14, 35-37%; and on Day E15, 1-4%. Results showed, then, that some ascending tract neurons were double labeled through Day E15 and were, therefore, proliferating in the final one-third of the neurogenic period. Ascending tract neurons proliferating on Day E15 were confined to laminae III, IV, V, and X and the nucleus dorsalis. Long tract neurons in the superficial dorsal horn (laminae I and II), on the other hand, were found to have completed neurogenesis on Day E14 of gestation. Results of the present study show that spinal neurogenesis of ascending projection neurons continues throughout most of the neurogenic period and does not completely follow the well-established ventral to dorsal gradient.

Nandi, K.N.; Beal, J.A.; Knight, D.S. (Louisiana State Univ. Medical Center, Shreveport (USA))



Archaeological investigations on the Buckboard Mesa Road Project  

SciTech Connect

In 1986, the Desert Research Institute (DRI) conducted an archaeological reconnaissance of a new alignment for the Buckboard Mesa Road on the Nevada Test Site for the Department of Energy (DOE). During this reconnaissance, several archaeological sites of National Register quality were discovered and recorded including a large quarry, site 26Ny4892, and a smaller lithic scatter, site 26Ny4894. Analysis of the debitage at 26Ny4892 indicates that this area was used primarily as a quarry for relatively small cobbles of obsidian found in the alluvium. Lithic reduction techniques used here are designed for efficiently reducing small pieces of toolstone and are oriented towards producing flake blanks from small cores and bifacially reducing exhausted cores. Projectile point cross references indicate that the area has seen at least casual use for about 10,000 years and more sustained use for the last 3,000 years. Initial obsidian hydration measurements indicate sustained use of the quarry for about the last 3,000 years although the loci of activities appear to change over time. Based on this study, the DRI recommends that quarrying activities in the area of 26Ny4892 are sufficiently sampled and that additional investigations into that aspect of prehistoric activity in the area are not necessary. This does not apply to other aspects of prehistoric use. DRI recommends that preconstruction surveys continue to identify nonquarrying, prehistoric utilization of the area. With the increased traffic on the Buckboard Mesa Road, there is a greater potential for vandalism to sites of National Register-quality located near the road. The DRI recommends that during the orientation briefing the workers at the Test Site be educated about the importance of cultural resources and the need for their protection. 202 refs., 41 figs., 52 tabs.

Amick, D.S.; Henton, G.H.; Pippin, L.C.



16 - Life cycle assessment (LCA) of road pavement materials  

Science Journals Connector (OSTI)

Abstract: At present the choice of materials and techniques in road construction is dictated by structural requirements and economic aspects. However, ecological factors have gained in importance due to environmental considerations in politics and society. To evaluate the environmental impact of motorways, a life cycle assessment (LCA) according to ISO 14040 was carried out for different pavement types. By investigating different case scenarios, the reduction potential of environmental impact was quantified. The biggest reduction in air pollution can be achieved by improving pavement properties (e.g., texture, stiffness and flatness) which would significantly reduce the fuel consumption of vehicles.

C. Thiel; T. Stengel; C. Gehlen



PABPN1 polyalanine tract deletion and long expansions modify its aggregation pattern and expression  

Science Journals Connector (OSTI)

Expansions of a (GCN)10/polyalanine tract in the Poly(A) Binding Protein Nuclear 1 (PABPN1) cause autosomal dominant oculopharyngeal muscular dystrophy (OPMD). In OPMD muscles, as in models, PABPN1 accumulates in intranuclear inclusions (INIs) whereas in other diseases caused by similar polyalanine expansions, the mutated proteins have been shown to abnormally accumulate in the cytoplasm. This study presents the impact on the subcellular localization of PABPN1 produced by large expansions or deletion of its polyalanine tract. Large tracts of more than 24 alanines result in the nuclear accumulation of PABPN1 in SFRS2-positive functional speckles and a significant decline in cell survival. These large expansions do not cause \\{INIs\\} formation nor do they lead to cytoplasmic accumulation. Deletion of the polyalanine tract induces the formation of aggregates that are located on either side and cross the nuclear membrane, highlighting the possible role of the N-terminal polyalanine tract in PABPN1 nucleo-cytoplasmic transport. We also show that even though five other proteins with polyalanine tracts tend to aggregate when over-expressed they do not co-aggregate with PABPN1 INIs. This study presents the first experimental evidence that there may be a relative loss of function in OPMD by decreasing the availability of PABPN1 through an INI-independent mechanism.

Arnaud F. Klein; Mitsuru Ebihara; Christine Alexander; Marie-Jose Dicaire; A. Marie-Jose Sasseville; Yves Langelier; Guy A. Rouleau; Bernard Brais



U.S. DOE Turbine Program Stakeholder Road Mapping Session  

NLE Websites -- All DOE Office Websites (Extended Search)

U.S. DOE Turbine Program Stakeholder Road Mapping Session U.S. DOE Turbine Program Stakeholder Road Mapping Session July 29-30, 2003 Table of Contents Disclaimer Papers and Presentations Disclaimer This report was prepared as an account of work sponsored by an agency of the United States Government. Neither the United States Government or any agency thereof, nor any of their employees, makes any warranty, express or implied, or assumes any legal liability or responsibility for the accuracy, completeness, or usefulness of any information, apparatus, product, or process disclosed, or represents that its use would not infringe privately owned rights. Reference herein to any specific commercial product, process, or service by trade name, trademark, manufacturer, or otherwise does not necessarily constitute or imply its endorsement, recommendation, or favoring by the United States Government or any agency thereof. The views and opinions of authors expressed herein do not necessarily state or reflect those of the United States Government or any agency thereof.


South Fence Road -- Phase 1 field operations summary  

SciTech Connect

The South Fence Road (SFR) project is part of the Sandia National Laboratories, New Mexico (SNL/NM) Site-Wide Hydrogeologic Characterization (SWHC) task. The SWHC task has as its objective the reduction of uncertainty about the rate and direction of groundwater flow in the SNL/NM/Kirtland Air Force Base (KAFB) area. The SFR project area is located along the southern boundary of SNL/KAFB. This project area was selected to provide site-specific information related to geology and groundwater hydrology within the Hubbell Spring/Tijeras/Sandia fault complex. Specific objectives included determining the depth to the Santa Fe Group/bedrock contact, the depth to the water table, and the hydrogeologic complexities related to faulting. This report is a basic data report from the first phase of field operations associated with the drilling, logging, completion, and development of South Fence Road Wells SFR-1D and SFR-1S, SFR-2, SFR-3D and SFR-3S, and SFR-4. These test/monitoring wells were installed as part of Sandia National Laboratories, New Mexico, Environmental Restoration Project.

McCord, J.P. [INTERA, Inc., Albuquerque, NM (United States); Neel, D. [GRAM, Inc., Albuquerque, NM (United States)



Radiological survey results at 4400 Piehl Road, Ottawa Lake, Michigan  

SciTech Connect

At the request of the US Department of Energy (DOE), a team from Oak Ridge National Laboratory conducted a radiological survey at 4400 Piehl Road in Ottawa Lake, Michigan. The survey was performed in September, 1992. The purpose of the survey was to determine if materials containing uranium from work performed under government contract at the former Baker Brothers facility in Toledo, Ohio had been transported off-site to this neighboring area. The radiological survey included surface gamma scans indoors and outdoors, alpha and beta scans inside the house and attached garage, beta-gamma scans of the hard surfaces outside, and the collection of soil, water, and dust samples for radionuclide analyses. Results of the survey demonstrated that the majority of the measurements on the property were within DOE guidelines. However, the presence of isolated spots of uranium contamination were found in two areas where materials were allegedly transported to the property from the former Baker Brothers site. Uranium uptake by persons on the property by ingestion is fairly unlikely, but inhalation is a possibility. Based on these findings, it is recommended that the residential property at 4400 Piehl Road in Ottawa Lake, Michigan be considered for inclusion under FUSRAP.

Foley, R.D.; Johnson, C.A.



Evaluation of mobile emissions contributions to Mexico City's emissions inventory using on-road and cross-road emission measurements and ambient data  

E-Print Network (OSTI)

Mobile emissions represent a significant fraction of the total anthropogenic emissions burden in the Mexico City Metropolitan Area (MCMA) and, therefore, it is crucial to use top-down techniques informed by on-road exhaust ...

Zavala-Perez, Miguel Angel


A Hybrid macro-micro pedestrians evacuation model to speed up simulation in road networks  

E-Print Network (OSTI)

A Hybrid macro-micro pedestrians evacuation model to speed up simulation in road networks NGUYEN efficient than the use of micro model alone. Keywords: Crowd movement, Hybrid modeling, road networks, multi simulation in a dynamic environments are either based on micro or macro models. These two types of models

Paris-Sud XI, Université de

Note: This page contains sample records for the topic "dp road tract" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.



E-Print Network (OSTI)

LASER SCANNING AND NOISE REDUCTION APPLIED TO 3D ROAD SURFACE ANALYSIS Thorsten Schulz and Hilmar, EAWAG Email: michele.steiner@eawag.ch Abstract: Terrestrial laser scanning was applied to acquire 3D the catchment area of a road with respect to a pilot plant. As laser scanning requires only a few minutes

Giger, Christine


Efficient algorithm for automatic road sign recognition and its hardware implementation  

Science Journals Connector (OSTI)

The automatic detection of road signs is an application that alerts the vehicle's driver of the presence of signals and invites him to react on time in the aim to avoid potential traffic accidents. This application can thus improve the road safety of ... Keywords: Classification, Detection, Hardware implementation, Recognition

Chokri Souani; Hassene Faiedh; Kamel Besbes



Comparison of Different Load Road Implementation Strategies on Fuel Economy of USPS Step Vans  

Energy.gov (U.S. Department of Energy (DOE))

An alternative form of measuring road loads, instead of using a chassis dynamometer and a method described in 40 CFR section 86.1229-85, was conducted on on-road coastdowns, and regression analysis was used to determine the characteristics of the two U.S. Postal Service step vans, one of which was a hybrid model


On-Road Remote Sensing of Automobile Emissions in the Phoenix Area: Year 4,  

E-Print Network (OSTI)

On-Road Remote Sensing of Automobile Emissions in the Phoenix Area: Year 4, November 2002 Gary A Sensing of Automobile Emissions in the Phoenix Area: Year 4 1 EXECUTIVE SUMMARY The University of Denver #12;On-Road Remote Sensing of Automobile Emissions in the Phoenix Area: Year 4 2 by 5 years

Denver, University of


Direct radiative effect of aerosols emitted by transport from road, shipping and  

E-Print Network (OSTI)

Direct radiative effect of aerosols emitted by transport from road, shipping and aviation 1234567.0 License. Atmospheric Chemistry and Physics Direct radiative effect of aerosols emitted by transport: from road, shipping and aviation Y. Balkanski1, G. Myhre2,3, M. Gauss2,*, G. R�adel4, E. J. Highwood4, and K

Wirosoetisno, Djoko


Marginal costs of freeway traffic congestion with on-road pollution exposure externality  

E-Print Network (OSTI)

Traffic congestion On-road In-vehicle Pollution exposure Vehicle emissions a b s t r a c t The health cost improvements. When considering distinct vehicle classes, inclusion of on-road exposure costs greatly increases heavy-duty vehicle marginal costs because of their higher emissions rates and greater roadway capacity

Bertini, Robert L.


An improved approach for robust road marking detection and tracking applied to multi-lane estimation.  

E-Print Network (OSTI)

provided a great number of devices on many types of automatic vehicle guidance and security systems detection system. This application is usually based on road marking detection algorithms. [3]. This systemAn improved approach for robust road marking detection and tracking applied to multi

Paris-Sud XI, Université de


Seymour Marine Discovery Center at Long Marine Lab 100 Shaffer Road * Santa Cruz, CA 95060  

E-Print Network (OSTI)

Seymour Marine Discovery Center at Long Marine Lab 100 Shaffer Road * Santa Cruz, CA 95060 (831) 459-3800 2014 Endowment Challenge to benefit Seymour Marine Discovery Center SANTA CRUZ, CA Discovery Center at Long Marine Lab 100 Shaffer Road * Santa Cruz, CA 95060 (831) 459-3800 Open

California at Santa Cruz, University of


Plug-in Hybrid Electric Vehicle On-Road Emissions Characterization and Demonstration Study  

E-Print Network (OSTI)

On-road emissions and operating data were collected from a plug-in hybrid electric vehicle (PHEV) over the course of 6months spanning August 2007 through January 2008 providing the first comprehensive on-road evaluation of the PHEV drivetrain...

Hohl, Carrie



Dynamic Friction Models for Longitudinal Road/Tire Interaction: Experimental Results  

E-Print Network (OSTI)

Dynamic Friction Models for Longitudinal Road/Tire Interaction: Experimental Results C. Canudas dynamic friction force model for the longitudinal road/tire interaction for wheeled ground vehicles is val- idated via experiments with an actual passenger vehicle. Contrary to common static friction/slip maps

Tsiotras, Panagiotis


Dynamic Friction Models for Longitudinal Road/Tire Interaction: Theoretical Advances  

E-Print Network (OSTI)

Dynamic Friction Models for Longitudinal Road/Tire Interaction: Theoretical Advances C. Canudas we derive a new dynamic friction force model for the longitudinal road/tire interaction for wheeled-point friction problems, called the LuGre model [1]. By assuming a con- tact patch between the tire

Tsiotras, Panagiotis


Conceptual design report, TWRS Privatization Phase I, site development and roads, subproject W-505  

SciTech Connect

This document includes Conceptual Design Report (CDR) for the site development, construction of new roads and improvements at existing road intersections, habitat mitigation, roadway lighting, and construction power needed for the construction of two Private Contractor (PC) Facilities. Approximately 50 hectare (124 acres) land parcel, east of the Grout Facility, is planned for the PC facilities.

Singh, G.



An Approach to Produce a GIS Database for Road Surface Monitoring  

Science Journals Connector (OSTI)

Abstract Road Surface Monitoring (RSM) is the process of detecting the distress on paved or unpaved road surfaces. The primary aim of this process is to detect any distress (such as road surface cracks) at early stages in order to apply maintenance on time. Early detection of road cracks can assist maintenance before the repair costs becomes too high. Local authorities should have an effective and easy to use monitoring process in place across the road network to meet their obligations. The process of adding geographical identification metadata to the photos is called Geo-tagging. The proposed method in this work entails capturing GPS information when the photo is taken for the road surface distress, then attaching the photo to a map. The location disclosure in the act of geo-tagging of a photo provides qualities to the digital map. In that respect, a specific richness of the GIS dataset arises when they disclose the road surface distress photos. This paper proposes a system for establishing a GIS database consisting of geo-tagged photos for local authorities to automate the process of recording and reporting road surface distresses. This system is easy to use, cost-effective, deployable, and can be used effectively by local authorities.

Karwan Ghazi Fendi; Sarhat Mustafa Adam; Nick Kokkas; Martin Smith



The role of hydrogen in powering road transport Alison Pridmore and Abigail Bristow  

E-Print Network (OSTI)

3.1 Greenhouse Gas Emissions From Hydrogen Powered Fuel Cell Vehicles ...9 3.2 Greenhouse GasThe role of hydrogen in powering road transport Alison Pridmore and Abigail Bristow April 2002 Tyndall Centre for Climate Change Research Working Paper 19 #12;The Role of Hydrogen in Powering Road

Watson, Andrew


Vision-based Navigation for Mobile Robots on Ill-structured Roads  

E-Print Network (OSTI)

I INTRODUCTION : : : : : : : : : : : : : : : : : : : : : : : : : : 1 II RELATED WORK : : : : : : : : : : : : : : : : : : : : : : : : : : 5 III VISION-BASED MOTION PLANNING FOR AN AUTONOMOUS MOTORCYCLE ON ILL-STRUCTURED ROADS : : : : : : : : : 8 A.... : : : : : : : : : : : : : : 34 xi LIST OF FIGURES FIGURE Page 1 (a) Autonomous motorcycle and (b) unstructured road in desert. : : : : : 9 2 Camera configuration on the motorcycle. : : : : : : : : : : : : : : : : : 14 3 An example of the collision-free directions...

Lee, Hyun Nam



Effects of Intermediate Ethanol Blends on Legacy Vehicles and Small Non-Road Engines, Report 1 ? Updated Feb 2009  

Energy.gov (U.S. Department of Energy (DOE))

Effects of Intermediate Ethanol Blends on Legacy Vehicles and Small Non-Road Effects of Intermediate Ethanol Blends on Legacy Vehicles and Small Non-Road Engines, Report 1 ? Updated Feb 2009


Toolkit for Public-Private Partnerships in Roads and Highways | Open Energy  

Open Energy Info (EERE)

form form View source History View New Pages Recent Changes All Special Pages Semantic Search/Querying Get Involved Help Apps Datasets Community Login | Sign Up Search Page Edit with form History Facebook icon Twitter icon » Toolkit for Public-Private Partnerships in Roads and Highways Jump to: navigation, search Tool Summary Name: Toolkit for Public-Private Partnerships in Roads and Highways Agency/Company /Organization: World Bank Sector: Energy Focus Area: Transportation Resource Type: Guide/manual User Interface: Website Website: www.ppiaf.org/ppiaf/sites/ppiaf.org/files/documents/toolkits/highwayst Cost: Free Toolkit for Public-Private Partnerships in Roads and Highways Screenshot References: Toolkit for Public-Private Partnerships in Roads and Highways[1] "The Toolkit for Public-Private Partnership in Roads and Highways is to


USVI Energy Road Map: Charting the Course to a Clean Energy Future  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

USVI Energy Road Map: Charting the Course to a Clean Energy Future USVI Energy Road Map: Charting the Course to a Clean Energy Future (Brochure), EDIN (Energy Development in Island Nations), U.S. Virgin Islands USVI Energy Road Map: Charting the Course to a Clean Energy Future (Brochure), EDIN (Energy Development in Island Nations), U.S. Virgin Islands This brochure provides an overview of the integrated clean energy deployment process and progress of the Energy Development in Island Nations U.S. Virgin Islands pilot project road map, including over-arching goals, organization, strategy, technology-specific goals and accomplishments, challenges, solutions, and upcoming milestones. edinusvi_roadmap.pdf More Documents & Publications U.S. Virgin Islands Energy Road Map: Analysis Integrating Renewable Energy into the Transmission and Distribution System



NLE Websites -- All DOE Office Websites (Extended Search)

DEPARTMENT OF ENERGY FINDING OF NO SIGNIFICANT IMPACT FOR THE MULTIPURPOSE HAUL ROAD WITHIN THE IDAHO NATIONAL LABORATORY SITE (EM-FMDP-I0-068) Agency: U. S. Department of Energy (DOE) Action: Finding of No Significant Impact (FONSI) Summary: The DOE prepared a Draft Environmental Assessment (EA) for the proposed "Environmental Assessment for the Multipurpose Haul Road Within the Idaho National Laboratory Site" (DOE/EA-I772). The proposed action consists of constructing a road for limited year-round use with the ability for trucks traveling in opposite directions to pass. The analysis of the proposed road evaluates clearing and grading a base, installing necessary culverts and drainage, and placing and compacting gravel for the roadway. The haul road would be used to:


USVI Energy Road Map: Charting the Course to a Clean Energy Future  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

USVI Energy Road Map: Charting the Course to a Clean Energy Future USVI Energy Road Map: Charting the Course to a Clean Energy Future (Brochure), EDIN (Energy Development in Island Nations), U.S. Virgin Islands USVI Energy Road Map: Charting the Course to a Clean Energy Future (Brochure), EDIN (Energy Development in Island Nations), U.S. Virgin Islands This brochure provides an overview of the integrated clean energy deployment process and progress of the Energy Development in Island Nations U.S. Virgin Islands pilot project road map, including over-arching goals, organization, strategy, technology-specific goals and accomplishments, challenges, solutions, and upcoming milestones. edinusvi_roadmap.pdf More Documents & Publications U.S. Virgin Islands Energy Road Map: Analysis Integrating Renewable Energy into the Transmission and Distribution System

Note: This page contains sample records for the topic "dp road tract" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Properties of random component of longitudinal road profile influenced by local obstacles  

Science Journals Connector (OSTI)

This paper describes the statistical properties of the pure random component of longitudinal road profile. The individual obstacles were removed from the road profile by median filtering approach. A total of 25,830 test sections records from the long-term pavement performance (LTPP) programme were analysed. The differences between asphalt concrete (AC) and cement concrete (CC) wearing courses were outlined. The comparison was shown on statistics (mean, median, standard deviation values) and probability density functions (PDFs) of contemporary used road indices (international roughness index (IRI), road elevation variance, power spectrum density (PSD) parameters in one-, two- and three-wavelength bands, etc.). The simulation study revealed the marked influence of obstacles on the road indices. The spectral properties of the pure random part were quantified.

Peter Mucka; Oldrich Kropac



Estimating Potential Carbon Sequestration in Conservation Reserve Program (Crp) Tracts in the Central High Plains of the United States.  

E-Print Network (OSTI)

??The main goal of this research is to examine long term trends in carbon sequestration in Conservation Reserve Program (CRP) tracts in the Central High (more)

Dung, Elisha Jasper



Harmonization of Road Signs for Electric Vehicle Charging Stations  

Alternative Fuels and Advanced Vehicles Data Center (EERE)

Avenue Louise 200 Box 113 1050 Brussels Belgium 1 Avenue Louise 200 Box 113 1050 Brussels Belgium 1 32.2.647.3218 Mobile 32.473.284.603 jseisler@cleanfuelsconsulting.org www.cleanfuelsconsulting.org Harmonization of Road Signs for Electric Vehicle Charging Stations Prepared for: Argonne National Laboratory and the U.S. Department of Energy November 2012 Avenue Louise 200 Box 113 1050 Brussels Belgium 2 32.2.647.3218 Mobile 32.473.284.603 jseisler@cleanfuelsconsulting.org www.cleanfuelsconsulting.org This page is intentionally blank. Avenue Louise 200 Box 113 1050 Brussels Belgium 3 32.2.647.3218 Mobile 32.473.284.603 jseisler@cleanfuelsconsulting.org www.cleanfuelsconsulting.org TABLE OF CONTENTS ACKNOWLEDGMENTS ............................................................................................................. 5


Meeting Location: Las Vegas, NV- DOE Office at Lossee Road  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

11 11 th EM QUALITY ASSURANCE CORPORATE BOARD MEETING Meeting Location: Las Vegas, NV- DOE Office at Lossee Road With Limited Conference Call Capabilities Room: 6404 Agenda for May 1, 2012 1:00-1:15 pm Agenda, Introductions, Status of Action Items from Last Board Meeting Bob Murray (EM-43) 1:15-1:35 pm Discussion and Summary of the Site ISM/QA Declarations Steven Ross (EM-43) 1:35-2:05 pm Status of Phase II Follow-up Reviews for Field Offices including Use and Status of the Standard Review Plan Bob Toro (EM-43) 2:05-2:35 pm Overview of EM QA Program (as provided to DNFSB) Matthew Moury (EM-40) Bob Murray (EM-43) 2:35-3:05 pm (BOARD VOTE)


HCEI Road Map and Introduction and Overview 2011  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Edition Edition Introduction & Overview HCEI Road Map 12% 10% 8% 6% 4% 2% 0% 1997 1998 1999 2000 2001 2002 2003 2004 2005 2006 2007 2008 *Estimated HAWAII ENERGY COSTS BY PERCENT GDP 80% 70% 60% 50% 40% 30% 20% 10% Hawaii Alaska Florida Lousiana Kentucky Montana Source: FIA 906 January - June 2010 PETROLEUM DEPENDENCE FOR ELECTRICITY TOP SIX STATES 0% Hawaii is the most petroleum-dependent state in the U.S. As a result, we have America's highest energy prices. Energy costs are 10% of our gross State product. Roughly 96% of the $4 billion we spend on petroleum not only leaves the State, but goes to countries in Asia and Africa. Hawaii's economic vitality is reduced by approximately $2.75 for every dollar that leaves our islands. This is a result of a multiplier effect that impacts


On the road performance simulation of hydrogen and hybrid cars  

Science Journals Connector (OSTI)

An assessment is made of on-the-road performance, for a pure hydrogen fuel cell car, a pure battery operated car, and a hydrogen fuel cell-battery hybrid car. The tool used for this study is the modular software-package ADVISOR [Markel T, et al. ADVISOR. J Power Sources 2002; 110:25566], which is well tested and offers a range of simple, parametrized sub-models or more detailed physical models for the fuel cell stack, the batteries, the electric motor, the exhaust control, the transmission and entire power train including controls and control strategies. The basis configurations of the cars modelled is characterized by high energy efficiency, before adding a fuel cell and electric motor also of high conversion efficiencies. Preceding the presentation of results, the best way to characterize energy efficiency is discussed.

Bent Srensen



BLM issues final EIS for Tract C-a offsite lease  

SciTech Connect

In October, 1986, the US Bureau of Land Management, White River Resource Area, issued the Final Environmental Impact Statement concerning Rio Blanco Oil Shale Company's request to lease an offtract site for disposal of overburden and spent shale from Tract C-a. A major issue which pitted Rio Blanco Oil Shale Company against many other members of the oil shale community was the covering up of oil shale resources on 84 Mesa. The oil shale resource under 84 Mesa may contain as much oil in place as Tract C-a itself. Some of the significant points concerning this issue are discussed. A summary of environmental consequences is given. 5 figures.

Not Available



Congestion control of heavy vehicles using electronic road pricing: the Singapore experience  

Science Journals Connector (OSTI)

Intelligent transportation systems based on electronic road pricing are shown to be an effective way to moderate congestion levels caused by heavy vehicles on Singapore roads. The system is the first of its kind in the world, and the technology permits structuring of pricing regimes based on time of day, point of entry into the road network and class of vehicle. This study suggests that in the general congestion equation, the role played by heavy vehicles is rather significant, and ought to be given greater weight than has previously been recognised.

W.H.L. Tan; R. Subramaniam



WORM: A new open road line source model for low wind speed conditions  

Science Journals Connector (OSTI)

Emission from road traffic constitutes one of the most important sources of air pollution in urban areas. This paper describes a newly developed air pollution dispersion model for open roads and highways called WORM (Weak Wind Open Road Model), and give some results using this model at Nordbysletta, Norway, in the period 1 January 200215 April 2002. Generally, a good correspondence was found between observed and model-predicted concentrations of nitrogen oxides (NOx), even in periods with low wind speed and (strongly) stable atmospheric conditions.

S.E. Walker



Structural damage to the corticospinal tract correlates with bilateral sensorimotor cortex reorganization in stroke patients  

E-Print Network (OSTI)

reorganization in stroke patients Judith D. Schaechter, Katherine L. Perdue, and Ruopeng Wang MGH 2007 Available online 16 October 2007 Damage to the corticospinal tract (CST) in stroke patients has of structural damage to the CST and functional reorganization in stroke patients. The purpose of the current

Schaechter, Judith D.



E-Print Network (OSTI)

CHANGES IN THE ORTHODROMIC AND ANTI- DROMIC RESPONSE OF OPTIC TRACT DURING THE EYE MOVEMENTS photocoagulation of the optic disc or enuclea- tion of the eyes, these geniculate slow waves persist unmodified the time course of wave disappearance correlates precisely with the time course of optic nerve degeneration

Bizzi, Emilio


Occurrence of mycoplasmas in urinary tracts of patients with acute pyelonephritis.  

Science Journals Connector (OSTI)

...Sex Urethra Bladder Upper urinary tract tients M. hom- U. urea- M. hom- U. urea- M. hom- U. urea- inis lyticum inis lyticum inis Iyticum Group I (acute pyelonephri- 13 M 3 7 0 4 0 0 tis) 67 F 14a 29<' 11b 15b 7c 5c Group II (noninfectious...

A C Thomsen



Where the Rubber Meets the Road -- the Alternative Fuel Station Locator |  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Where the Rubber Meets the Road -- the Alternative Fuel Station Where the Rubber Meets the Road -- the Alternative Fuel Station Locator Where the Rubber Meets the Road -- the Alternative Fuel Station Locator August 10, 2010 - 2:32pm Addthis Dennis A. Smith Director, National Clean Cities Last week, this blog highlighted the highly efficient vehicles competing for the Automotive X Prize. The innovative designs on display in that competition may very well reflect the future of the auto industry, but there are many alternative vehicles already on the road, actively doing their part to cut emissions and improve efficiency. By decreasing the amount of petroleum we use for transportation and running our vehicles on alternative fuels, we can improve our country's social, economic, and environmental sustainability. However, those of us that drive


DOE Statement on UK Government's "Road to 2010" Report on Nuclear Security  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Statement on UK Government's "Road to 2010" Report on Nuclear Statement on UK Government's "Road to 2010" Report on Nuclear Security DOE Statement on UK Government's "Road to 2010" Report on Nuclear Security July 17, 2009 - 12:00am Addthis WASHINGTON, DC - Thomas P. D'Agostino, the Department of Energy's Under Secretary for Nuclear Security and Administrator of the National Nuclear Security Administration, today applauded the British government's new report on advancing the global nuclear security agenda. Issued yesterday, "The Road to 2010 - Addressing the Nuclear Question in the Twenty First Century" outlines a strategy for addressing the threat posed by the proliferation of nuclear weapons ahead of the 2010 Nuclear Non-Proliferation Treaty (NPT) Review Conference. Among other steps, it includes the creation of a UK Center for Nuclear



Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

7 7 SITEWIDE CATEGORICAL EXCLUSION FOR MINOR ROAD AND UTILITY ALTERATIONS, PACIFIC NORTHWEST NATIONAL LABORATORY SITE, RICHLAND, WASHINGTON Proposed Action: The U.S. Department of Energy (DOE) Pacific Northwest Site Office (PNSO) proposes to conduct minor alteration, repair, ~lacement, or relocation of roads, pathways, and utilities such as water, sewer, electriCIty, natura1g8S, and communications lines. Location of Action: The proposed action would largely occur on the Pacific Northwest National Laboratory (PNNL) Site, within or near existing road and utility easements. Tie-ins to nearby offsite road and utility distribution points are occasionally necessary and are included in the scope of this categorical exclusion (CX). Description 01 tbe Proposed Action:


Climate Rapid Overview and Decision Support (C-ROADS) Simulator | Open  

Open Energy Info (EERE)

Climate Rapid Overview and Decision Support (C-ROADS) Simulator Climate Rapid Overview and Decision Support (C-ROADS) Simulator Jump to: navigation, search LEDSGP green logo.png FIND MORE DIA TOOLS This tool is part of the Development Impacts Assessment (DIA) Toolkit from the LEDS Global Partnership. Tool Summary LAUNCH TOOL Name: Climate Rapid Overview and Decision Support (C-ROADS) Simulator Agency/Company /Organization: Ventana Systems Inc., Massachusetts Institute of Technology, Sustainability Institute Partner: United States Department of Energy Sector: Climate, Energy Topics: Co-benefits assessment, - Macroeconomic, Pathways analysis Resource Type: Software/modeling tools User Interface: Desktop Application, Spreadsheet Complexity/Ease of Use: Moderate Website: climateinteractive.org/simulations/C-ROADS Cost: Free


Fuel Used for Off-Road Recreation: A Reassessment of the Fuel Use Model  

NLE Websites -- All DOE Office Websites (Extended Search)

Used for Off-Road Recreation: Used for Off-Road Recreation: A Reassessment of the Fuel Use Model Stacy C. Davis Lorena F. Truett Patricia S. Hu ORNL/TM-1999/100 Fuel Used for Off-Road Recreation: A Reassessment of the Fuel Use Model Stacy C. Davis Lorena F. Truett Patricia S. Hu July 1999 Prepared for the Office of Highway Information Management Federal Highway Administration U.S. Department of Transportation Washington, DC 20590 Prepared by the Statistics and Data Analysis Program Center for Transportation Analysis Oak Ridge National Laboratory Oak Ridge, TN 37831-6073 managed by Lockheed Martin Energy Research Corporation for the U.S. Department of Energy under Contract No. DE-AC05-96OR22464 Fuel Used for Off-Road Recreation: A Reassessment of the Fuel Use Model - iii - TABLE OF CONTENTS LIST OF ACRONYMS AND ABBREVIATIONS


Integration and road tests of a self-sensing CNT concrete pavement system for traffic detection  

Science Journals Connector (OSTI)

In this paper, a self-sensing carbon nanotube (CNT) concrete pavement system for traffic detection is proposed and tested in a roadway. Pre-cast and cast-in-place self-sensing CNT concrete sensors were simultaneously integrated into a controlled pavement test section at the Minnesota Road Research Facility (MnROAD), USA. Road tests of the system were conducted by using an MnROAD five-axle semi-trailer tractor truck and a van, respectively, both in the winter and summer. Test results show that the proposed self-sensing pavement system can accurately detect the passing of different vehicles under different vehicular speeds and test environments. These findings indicate that the developed self-sensing CNT concrete pavement system can achieve real-time vehicle flow detection with a high detection rate and a low false-alarm rate.

Baoguo Han; Kun Zhang; Tom Burnham; Eil Kwon; Xun Yu



Factors influencing the road mortality of snakes on the Upper Snake River Plain, Idaho  

E-Print Network (OSTI)

from the Area of Concern (AOC) roads data maintained athttp://giscenter.isu.edu). The AOC refers to land areas thatin the field. I used the AOC vegetation coverage assembled

Jochimsen, Denim M.



Balancing people, place and the automobile : recommendations for the redesign of Belmont's Trapelo Road  

E-Print Network (OSTI)

This thesis presents a case study of the planning process for the redesign of Trapelo Road in Belmont, Massachusetts, a Boston suburb. The case is an on-going planning controversy that deals with a number of key issues ...

Carry, William J


Note: This page contains sample records for the topic "dp road tract" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


On-Road Remote Sensing of Automobile Emissions in the Los Angeles Area  

E-Print Network (OSTI)

On-Road Remote Sensing of Automobile Emissions in the Los Angeles Area: Year 1 Gary A. Bishop.1 According to Heywood2 , carbon monoxide emissions from automobiles are at a maximum when the air

Denver, University of


On-Road Remote Sensing of Automobile Emissions in the Denver Area: Year 1  

E-Print Network (OSTI)

On-Road Remote Sensing of Automobile Emissions in the Denver Area: Year 1 Peter J. Popp, Sajal S to Heywood,2 carbon monoxide emissions from automobiles are at a maximum when the air/fuel ratio is rich

Denver, University of


On-Road Remote Sensing of Automobile Emissions in the Chicago Area: Year 2  

E-Print Network (OSTI)

On-Road Remote Sensing of Automobile Emissions in the Chicago Area: Year 2 Peter J. Popp, Gary A from automobiles are at a maximum when the air/fuel ratio is rich of stoichiometric, and are caused

Denver, University of


On-Road Remote Sensing of Automobile Emissions in the Phoenix Area: Year 1  

E-Print Network (OSTI)

On-Road Remote Sensing of Automobile Emissions in the Phoenix Area: Year 1 Gary A. Bishop, Sajal S to the national emission inventory.1 According to Heywood2 , carbon monoxide emissions from automobiles

Denver, University of


On-Road Remote Sensing of Automobile Emissions in the Chicago Area: Year 1  

E-Print Network (OSTI)

On-Road Remote Sensing of Automobile Emissions in the Chicago Area: Year 1 Peter J. Popp, Gary A.1 Carbon monoxide emissions from automobiles are at a maximum when the air/fuel ratio is rich

Denver, University of


454 Sequencing: The road to the Future ( 7th Annual SFAF Meeting, 2012)  

ScienceCinema (OSTI)

Jim Knight on "454 Sequencing: The Road to the Future" at the 2012 Sequencing, Finishing, Analysis in the Future Meeting held June 5-7, 2012 in Santa Fe, New Mexico.

Knight, James R [Roche



Responding to Relative Decline: The Plank Road Boom of Antebellum New York  

E-Print Network (OSTI)

lists for ten roads in Oneida county with their occupationalWelocated the names of Oneida county subscrib- ers on anthat 3, The map of Oneida county is in the map collection

Majewski, John; Baer, Christopher; Klein, Daniel B.



Multi-criteria analysis : an alternative approach for the evaluation of road pricing strategies  

E-Print Network (OSTI)

Interest in road pricing among political leaders, transportation analysts, academics, and government agencies has increased in recent years. There are myriad reasons for this newfound consideration, but the deployment of ...

Ensor, Jeffrey D. (Jeffrey Douglas)



Science on Saturday: January 31, 2015- The Road to a Sustainable...  

NLE Websites -- All DOE Office Websites (Extended Search)

31, 2015 - 09:30 to 11:00 Science on Saturday: January 31, 2015- The Road to a Sustainable Energy Future Speaker: Professor Emily Carter, Department of Engineering; Director of the...


On-Road Particle Matter Emissions from a MY 2010 Compliant HD...  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

Particle Matter Emissions from a MY 2010 Compliant HD Diesel Vehicle Driving Across the U.S. On-Road Particle Matter Emissions from a MY 2010 Compliant HD Diesel Vehicle Driving...


Analysis Reveals Impact of Road Grade on Vehicle Energy Use (Fact Sheet)  

SciTech Connect

Findings of study indicate that, on average, road grade could be responsible for 1%-3% of fuel use in light-duty automobiles, with many individual trips impacted by as much as 40%.

Not Available



An analysis of the current investment trend in the U.S. toll road sector  

E-Print Network (OSTI)

In recent years, long term concessions through public-private partnerships (PPP's) in the US toll road sector have emerged and are expected to become a phenomenon in the near future. Up until now, only two large scale ...

Zhang, Xin, S.M. Massachusetts Institute of Technology



RCRA Facility Investigation/Remedial Investigation Report for the Grace Road Site (631-22G)  

SciTech Connect

This report summarizes the activities and documents the results of a Resource Conservation and Recovery Act Facility Investigation/Remedial Investigation conducted at Grace Road Site on the Savannah River Site near Aiken, South Carolina.

Palmer, E.



Finding Multiple Lanes in Urban Road Networks with Vision and Lidar  

E-Print Network (OSTI)

This paper describes a system for detecting and estimating the properties of multiple travel lanes in an urban road network from calibrated video imagery and laser range data acquired by a moving vehicle. The system operates ...

Huang, Albert S.


Microsoft Word - CX-CentraliaAreaAccessRoadsFY13_WEB.doc  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Darin Bowman Project Manager TELF-TPP-3 Proposed Action: Access Road maintenance on the Chehalis-Centralia No. 1, Chehalis-Covington No. 1, Paul-Allston No. 2, and Paul-Napavine...


Microsoft Word - CX-Ross-Lexington_access_road_addition_WEB.doc  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

KEPR-4 KEPR-4 SUBJECT: Environmental Clearance Memorandum Dawneen Dostert Project Manager - TERR-LMT Proposed Action: New access road construction to include clearing, grading, and shaping of roads, placing and compacting of rock surfacing, installation of gates, installation and maintenance of erosion control and water drainage features, and restoration of disturbed areas Budget Information: Work Order # 00230995 PP&A Project No.: 1534 Categorical Exclusion Applied (from Subpart D, 10 C.F.R. Part 1021): B1.13 Construction/ acquisition/relocation of onsite pathways, short onsite access roads/railroads. Location: The project area is confined to the existing and proposed access roads around the right-of-way (ROW) corridor of Bonneville Power Administration's (BPA) Ross-Lexington


U.S. Virgin Islands Energy Road Map: Analysis | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Virgin Islands Energy Road Map: Analysis Virgin Islands Energy Road Map: Analysis U.S. Virgin Islands Energy Road Map: Analysis This report lays out the strategy envisioned by the stakeholders in the U.S. Virgin Islands, U.S. Department of Energy, and U.S. Department of Interior to achieve the ambitious goal of achieving a 60% reduction in business-as-usual fossil fuel demand by 2025 (60x25) within the electricity sector. Instead, this work and supporting analysis provides a framework within which decisions can begin to be made, a concrete vision of what the future might hold, and a guide to determine what questions should follow. 52360.pdf More Documents & Publications USVI Energy Road Map: Charting the Course to a Clean Energy Future (Brochure), EDIN (Energy Development in Island Nations), U.S. Virgin


A quadratic algorithm for road coloring Marie-Pierre Beal and Dominique Perrin  

E-Print Network (OSTI)

A quadratic algorithm for road coloring Marie-Pierre B´eal and Dominique Perrin May 30, 2013, {beal,perrin}@univ-mlv.fr This work is supported by French National Agency (ANR) through "Programme d

Paris-Sud XI, Université de


Journal: Forest Ecology and Management1 Title Bridge Scour Physical Road and Stream Network Connectivity, Northeastern  

E-Print Network (OSTI)

­ Bridge Scour Physical Road and Stream Network Connectivity, Northeastern Puerto Rico Authors ­ Sherrill, K.R.1 , Pike, A.S.2 , Laituri, M.J.1* , Scatena, F.N.2 , Helmer, E.H.3 , and Blanco, J.F.4 1, CO 80523-1472, USA 21 22 23 24 25 26 27 Key Words ­ Bridge Scour, Physical Road and Stream Network


Road Map for Development of Crystal-Tolerant High Level Waste Glasses  

SciTech Connect

This road map guides the research and development for formulation and processing of crystal-tolerant glasses, identifying near- and long-term activities that need to be completed over the period from 2014 to 2019. The primary objective is to maximize waste loading for Hanford waste glasses without jeopardizing melter operation by crystal accumulation in the melter or melter discharge riser. The potential applicability to the Savannah River Site (SRS) Defense Waste Processing Facility (DWPF) is also addressed in this road map.

Matyas, Josef; Vienna, John D.; Peeler, David; Fox, Kevin; Herman, Connie; Kruger, Albert A.


Note: This page contains sample records for the topic "dp road tract" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Chaotic Vibration of a Quarter-Car Model Excited by the Road Surface Profile  

E-Print Network (OSTI)

The Melnikov criterion is used to examine a global homoclinic bifurcation and transition to chaos in the case of a quarter car model excited kinematically by the road surface profile. By analyzing the potential an analytic expression is found for the homoclinic orbit. By introducing an harmonic excitation term and damping as perturbations, the critical Melnikov amplitude of the road surface profile is found, above which the system can vibrate chaotically.

Grzegorz Litak; Marek Borowiec; Michael I. Friswell; Kazimierz Szabelski



Handbook of Emission Factors for Road Transport (HBEFA) | Open Energy  

Open Energy Info (EERE)

of Emission Factors for Road Transport (HBEFA) of Emission Factors for Road Transport (HBEFA) Jump to: navigation, search Tool Summary LAUNCH TOOL Name: Handbook of Emission Factors for Road Transport (HBEFA) Focus Area: Clean Transportation Topics: Policy, Deployment, & Program Impact Website: www.hbefa.net/e/index.html Equivalent URI: cleanenergysolutions.org/content/handbook-emission-factors-road-transp Language: "English,French,German" is not in the list of possible values (Abkhazian, Achinese, Acoli, Adangme, Adyghe; Adygei, Afar, Afrihili, Afrikaans, Afro-Asiatic languages, Ainu, Akan, Akkadian, Albanian, Aleut, Algonquian languages, Altaic languages, Amharic, Angika, Apache languages, Arabic, Aragonese, Arapaho, Arawak, Armenian, Aromanian; Arumanian; Macedo-Romanian, Artificial languages, Assamese, Asturian; Bable; Leonese; Asturleonese, Athapascan languages, Australian languages, Austronesian languages, Avaric, Avestan, Awadhi, Aymara, Azerbaijani, Balinese, Baltic languages, Baluchi, Bambara, Bamileke languages, Banda languages, Bantu (Other), Basa, Bashkir, Basque, Batak languages, Beja; Bedawiyet, Belarusian, Bemba, Bengali, Berber languages, Bhojpuri, Bihari languages, Bikol, Bini; Edo, Bislama, Blin; Bilin, Blissymbols; Blissymbolics; Bliss, Bosnian, Braj, Breton, Buginese, Bulgarian, Buriat, Burmese, Caddo, Catalan; Valencian, Caucasian languages, Cebuano, Celtic languages, Central American Indian languages, Central Khmer, Chagatai, Chamic languages, Chamorro, Chechen, Cherokee, Cheyenne, Chibcha, Chichewa; Chewa; Nyanja, Chinese, Chinook jargon, Chipewyan; Dene Suline, Choctaw, Chuukese, Chuvash, Classical Newari; Old Newari; Classical Nepal Bhasa, Classical Syriac, Coptic, Cornish, Corsican, Cree, Creek, Creoles and pidgins , Crimean Tatar; Crimean Turkish, Croatian, Cushitic languages, Czech, Dakota, Danish, Dargwa, Delaware, Dinka, Divehi; Dhivehi; Maldivian, Dogri, Dogrib, Dravidian languages, Duala, Dutch; Flemish, Dyula, Dzongkha, Eastern Frisian, Efik, Egyptian (Ancient), Ekajuk, Elamite, English, Erzya, Esperanto, Estonian, Ewe, Ewondo, Fang, Fanti, Faroese, Fijian, Filipino; Pilipino, Finnish, Finno-Ugrian languages, Fon, French, Friulian, Fulah, Ga, Gaelic; Scottish Gaelic, Galibi Carib, Galician, Ganda, Gayo, Gbaya, Geez, Georgian, German, Germanic languages, Gilbertese, Gondi, Gorontalo, Gothic, Grebo, Greek, Modern, Guarani, Gujarati, Gwich'in, Haida, Haitian; Haitian Creole, Hausa, Hawaiian, Hebrew, Herero, Hiligaynon, Himachali languages; Western Pahari languages, Hindi, Hiri Motu, Hittite, Hmong; Mong, Hungarian, Hupa, Iban, Icelandic, Ido, Igbo, Ijo languages, Iloko, Inari Sami, Indic languages, Indo-European languages, Indonesian, Ingush, Interlingue; Occidental, Inuktitut, Inupiaq, Iranian languages, Irish, Iroquoian languages, Italian, Japanese, Javanese, Judeo-Arabic, Judeo-Persian, Kabardian, Kabyle, Kachin; Jingpho, Kalaallisut; Greenlandic, Kalmyk; Oirat, Kamba, Kannada, Kanuri, Kara-Kalpak, Karachay-Balkar, Karelian, Karen languages, Kashmiri, Kashubian, Kawi, Kazakh, Khasi, Khoisan languages, Khotanese; Sakan, Kikuyu; Gikuyu, Kimbundu, Kinyarwanda, Kirghiz; Kyrgyz, Klingon; tlhIngan-Hol, Komi, Kongo, Konkani, Korean, Kosraean, Kpelle, Kru languages, Kuanyama; Kwanyama, Kumyk, Kurdish, Kurukh, Kutenai, Ladino, Lahnda, Lamba, Land Dayak languages, Lao, Latin, Latvian, Lezghian, Limburgan; Limburger; Limburgish, Lingala, Lithuanian, Lojban, Lower Sorbian, Lozi, Luba-Katanga, Luba-Lulua, Luiseno, Lule Sami, Lunda, Luo (Kenya and Tanzania), Lushai, Luxembourgish; Letzeburgesch, Macedonian, Madurese, Magahi, Maithili, Makasar, Malagasy, Malay, Malayalam, Maltese, Manchu, Mandar, Mandingo, Manipuri, Manobo languages, Manx, Maori, Mapudungun; Mapuche, Marathi, Mari, Marshallese, Marwari, Masai, Mayan languages, Mende, Mi'kmaq; Micmac, Minangkabau, Mirandese, Mohawk, Moksha, Mon-Khmer languages, Mongo, Mongolian, Mossi, Multiple languages, Munda languages, N'Ko, Nahuatl languages, Nauru, Navajo; Navaho, Ndebele, North; North Ndebele, Ndebele, South; South Ndebele, Ndonga, Neapolitan, Nepal Bhasa; Newari, Nepali, Nias, Niger-Kordofanian languages, Nilo-Saharan languages, Niuean, North American Indian languages, Northern Frisian, Northern Sami, Norwegian, Nubian languages, Nyamwezi, Nyankole, Nyoro, Nzima, Occitan (post 1500); Provençal, Ojibwa, Oriya, Oromo, Osage, Ossetian; Ossetic, Otomian languages, Pahlavi, Palauan, Pali, Pampanga; Kapampangan, Pangasinan, Panjabi; Punjabi, Papiamento, Papuan languages, Pedi; Sepedi; Northern Sotho, Persian, Philippine languages, Phoenician, Pohnpeian, Polish, Portuguese, Prakrit languages, Pushto; Pashto, Quechua, Rajasthani, Rapanui, Rarotongan; Cook Islands Maori, Romance languages, Romanian; Moldavian; Moldovan, Romansh, Romany, Rundi, Russian, Salishan languages, Samaritan Aramaic, Sami languages, Samoan, Sandawe, Sango, Sanskrit, Santali, Sardinian, Sasak, Scots, Selkup, Semitic languages, Serbian, Serer, Shan, Shona, Sichuan Yi; Nuosu, Sicilian, Sidamo, Sign Languages, Siksika, Sindhi, Sinhala; Sinhalese, Sino-Tibetan languages, Siouan languages, Skolt Sami, Slave (Athapascan), Slavic languages, Slovak, Slovenian, Sogdian, Somali, Songhai languages, Soninke, Sorbian languages, Sotho, Southern, South American Indian (Other), Southern Altai, Southern Sami, Spanish; Castilian, Sranan Tongo, Sukuma, Sumerian, Sundanese, Susu, Swahili, Swati, Swedish, Swiss German; Alemannic; Alsatian, Syriac, Tagalog, Tahitian, Tai languages, Tajik, Tamashek, Tamil, Tatar, Telugu, Tereno, Tetum, Thai, Tibetan, Tigre, Tigrinya, Timne, Tiv, Tlingit, Tok Pisin, Tokelau, Tonga (Nyasa), Tonga (Tonga Islands), Tsimshian, Tsonga, Tswana, Tumbuka, Tupi languages, Turkish, Turkmen, Tuvalu, Tuvinian, Twi, Udmurt, Ugaritic, Uighur; Uyghur, Ukrainian, Umbundu, Uncoded languages, Undetermined, Upper Sorbian, Urdu, Uzbek, Vai, Venda, Vietnamese, Volapük, Votic, Wakashan languages, Walamo, Walloon, Waray, Washo, Welsh, Western Frisian, Wolof, Xhosa, Yakut, Yao, Yapese, Yiddish, Yoruba, Yupik languages, Zande languages, Zapotec, Zaza; Dimili; Dimli; Kirdki; Kirmanjki; Zazaki, Zenaga, Zhuang; Chuang, Zulu, Zuni) for this property.


On-Road Use of Fischer-Tropsch Diesel Blends  

SciTech Connect

Alternative compression ignition engine fuels are of interest both to reduce emissions and to reduce U.S. petroleum fuel demand. A Malaysian Fischer-Tropsch gas-to-liquid fuel was compared with California No.2 diesel by characterizing emissions from over the road Class 8 tractors with Caterpillar 3176 engines, using a chassis dynamometer and full scale dilution tunnel. The 5-Mile route was employed as the test schedule, with a test weight of 42,000 lb. Levels of oxides of nitrogen (NO{sub x}) were reduced by an average of 12% and particulate matter (PM) by 25% for the Fischer-Tropsch fuel over the California diesel fuel. Another distillate fuel produced catalytically from Fischer-Tropsch products originally derived from natural gas by Mossgas was also compared with 49-state No.2 diesel by characterizing emissions from Detroit Diesel 6V-92 powered transit buses, three of them equipped with catalytic converters and rebuilt engines, and three without. The CBD cycle was employed as the test schedule, with a test weight of 33,050 lb. For those buses with catalytic converters and rebuilt engines, NO x was reduced by 8% and PM was reduced by 31% on average, while for those buses without, NO x was reduced by 5% and PM was reduced by 20% on average. It is concluded that advanced compression ignition fuels from non-petroleum sources can offer environmental advantages in typical line haul and city transit applications.

Nigel Clark; Mridul Gautam; Donald Lyons; Chris Atkinson; Wenwei Xie; Paul Norton; Keith Vertin; Stephen Goguen; James Eberhardt



Six?year study of IMSA road racing noise  

Science Journals Connector (OSTI)

The Del Mar Fairgrounds San Diego hosted the IMSA Grand Prix for 6 years from 19871993. The project provides a unique long?term study of professional road racing noise in a unique setting a narrow valley just east of the coastline and within an environmentally sensitive lagoon. Sponsors were required to perform community noise monitoring at selected locations in the adjacent hills and lagoon. Both human and bird responses were examined. The monitoring documented the hour by hour variations in the maximum and average noise levels at up to 12 separate locations. The results indicated the thresholds which would trigger community response the sensitivity of the response to diurnal and short?term wind shift the effect of the inversion layer the effects on bird patterns and the statistical distribution of vehicle noise levels for the IMSA class vehicle. Basic findings revealed community response was triggered when levels exceeded 70 dBA Lavg. Downwind levels tended to increase at 1 dBA/mph over 5 mph. When the track was within an inversion levels increased 10 dBA. The mean vehicle level at 15 m was 105 dBA with a 4?dBA standard deviation.

Gordon Bricken; Christopher Jean



Year/PAD District Alkylates Aromatics Road Oil  

U.S. Energy Information Administration (EIA) Indexed Site

Alkylates Alkylates Aromatics Road Oil and Lubricants Petroleum Coke (MMcfd) Hydrogen Sulfur (short tons/day) Production Capacity Asphalt Isomers Marketable Table 7. Operable Production Capacity of Petroleum Refineries, January 1, 1981 to January 1, 2013 (Thousand Barrels per Stream Day, Except Where Noted) a JAN 1, 1981 974 299 765 131 234 276 2,054 NA JAN 1, 1982 984 290 740 162 242 267 1,944 NA JAN 1, 1983 960 237 722 212 241 296 2,298 NA JAN 1, 1984 945 218 800 208 241 407 2,444 NA JAN 1, 1985 917 215 767 219 243 424 2,572 NA JAN 1, 1986 941 276 804 258 246 356 2,357 NA JAN 1, 1987 974 287 788 326 250 364 2,569 23,806 JAN 1, 1988 993 289 788 465 232 368 2,418 27,639 JAN 1, 1989 1,015 290 823 469 230 333 2,501 28,369 JAN 1, 1990 1,030 290 844 456 232 341 2,607 24,202


Vocal tract changes caused by phonation into a tube: A case study using computer tomography and finite-element modeling  

Science Journals Connector (OSTI)

Phonation into a glass tube is a voice training and therapy method that leads to beneficial effects in voice production. It has not been known however what changes occur in the vocal tract during and after the phonation into a tube. This pilot study examined the vocal tract shape in a female subject before during and after phonation into a tube using computer tomography(CT). Three-dimensional finite-elementmodels (FEMs) of the vocal tract were derived from the CTimages and used to study changes in vocal tract input impedance. When phonating on vowel [a:] the data showed tightened velopharyngeal closure and enlarged cross-sectional areas of the oropharyngeal and oral cavities during and after the tube-phonation. FEM calculations revealed an increased input inertance of the vocal tract and an increased acoustic energy radiated out of the vocal tract after the tube-phonation. The results indicate that the phonation into a tube causes changes in the vocal tract which remain also when the tube is removed. These effects may help improving voice production in patients and voice professionals.

Tom Vampola; Anne-Maria Laukkanen; Jaromr Hor?ek; Jan G. vec



Campus Construction Situation Report #18 August 8, 2012 High Rise Road Realignment --Note High Rise Road is not accessible (near RDH, Scott Hall, Holshouser  

E-Print Network (OSTI)

. PORTAL --Foundation work and steel construction continues. Residence Hall Phase X -- Structural walls by Monday, July 30. The road will remain open to pedestrian and bicycle traffic. Residence Hall Phase XI portions of parking lot #8. Site excavation in process . Note--parking is limited PORTAL --Site grading

Howitt, Ivan


Microsoft Word - CX-Chemawa-Salem1and2-AccessRoads-FY13_WEB.doc  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

September 27, 2013 REPLY TO ATTN OF: KEP-Alvey SUBJECT: Environmental Clearance Memorandum Steven Bailor Contractor - TELF-TPP-3 Proposed Action: Access road improvements on the...


Generating Pseudo-Random Permutations and Maximum Flow IBM Almaden Research Center, 650 Harry Road, San Jose, CA 95120 ,USA  

E-Print Network (OSTI)

of length r if there are i1 j1 r Center, 650 Harry Road, San Jose, CA 95120 ,USA and Sackler Faculty of Exact Sciences, Tel Aviv

Shamir, Ron


Assessing the Stone Martens Patch Occupancy in Fragmented landscapes and its Relation to Road-Killing Occurences  

E-Print Network (OSTI)

smaller and isolated habitat patches may become unoccupied,in average size of patches of remnant natural vegetation.according to habitat patch size and isolation, and road

Ascenso, Fernando; Grilo, Clara; Santos-Reis, Margarida



Differences in Brainstem Fiber Tract Response to Radiation: A Longitudinal Diffusion Tensor Imaging Study  

SciTech Connect

Purpose: To determine whether radiation-induced changes in white matter tracts are uniform across the brainstem. Methods and Materials: We analyzed serial diffusion tensor imaging data, acquired before radiation therapy and over 48 to 72 months of follow-up, from 42 pediatric patients (age 6-20 years) with medulloblastoma. FSL software (FMRIB, Oxford, UK) was used to calculate fractional anisotropy (FA) and axial, radial, and mean diffusivities. For a consistent identification of volumes of interest (VOIs), the parametric maps of each patient were transformed to a standard brain space (MNI152), on which we identified VOIs including corticospinal tract (CST), medial lemniscus (ML), transverse pontine fiber (TPF), and middle cerebellar peduncle (MCP) at the level of pons. Temporal changes of DTI parameters in VOIs were compared using a linear mixed effect model. Results: Radiation-induced white matter injury was marked by a decline in FA after treatment. The decline was often accompanied by decreased axial diffusivity, increased radial diffusivity, or both. This implied axonal damage and demyelination. We observed that the magnitude of the changes was not always uniform across substructures of the brainstem. Specifically, the changes in DTI parameters for TPF were more pronounced than in other regions (P<.001 for FA) despite similarities in the distribution of dose. We did not find a significant difference among CST, ML, and MCP in these patients (P>.093 for all parameters). Conclusions: Changes in the structural integrity of white matter tracts, assessed by DTI, were not uniform across the brainstem after radiation therapy. These results support a role for tract-based assessment in radiation treatment planning and determination of brainstem tolerance.

Uh, Jinsoo, E-mail: jinsoo.uh@stjude.org [Department of Radiological Sciences, St. Jude Children's Research Hospital, Memphis, Tennessee (United States)] [Department of Radiological Sciences, St. Jude Children's Research Hospital, Memphis, Tennessee (United States); Merchant, Thomas E. [Department of Radiological Sciences, St. Jude Children's Research Hospital, Memphis, Tennessee (United States)] [Department of Radiological Sciences, St. Jude Children's Research Hospital, Memphis, Tennessee (United States); Li, Yimei; Feng, Tianshu [Department of Biostatistics, St. Jude Children's Research Hospital, Memphis, Tennessee (United States)] [Department of Biostatistics, St. Jude Children's Research Hospital, Memphis, Tennessee (United States); Gajjar, Amar [Department of Oncology, St. Jude Children's Research Hospital, Memphis, Tennessee (United States)] [Department of Oncology, St. Jude Children's Research Hospital, Memphis, Tennessee (United States); Ogg, Robert J.; Hua, Chiaho [Department of Radiological Sciences, St. Jude Children's Research Hospital, Memphis, Tennessee (United States)] [Department of Radiological Sciences, St. Jude Children's Research Hospital, Memphis, Tennessee (United States)



Description of the reproductive tract and its uses in determining productivity in the Ringtail (Bassariscus astutus)  

E-Print Network (OSTI)

analysis in determining reproductive performance of black-tailed deer. J. Wildl. Manage. 21(1):62-65. Grinnell, J. , J. S. Dixon, and J. M. Lindsdale. 1937. Fur-bearing mammals of California, Vol. 1. U. of California Press, Berkeley. 375pp. Hall, E. R...DESCRIPTION OF THE REPRODUCTIVE TRACT AND ITS USES IN DETERMINING PRODUCTIVITY IN THE RINGTAIL (BASSARISCUS ASTUTUS) A Thesis by JONATHAN CHURCHILL SNYDER Submitted to the Graduate College of Texas A&M University in partial fulfillment...

Snyder, Jonathan Churchill



File:Guidelines-for-leasing-row-tracts.pdf | Open Energy Information  

Open Energy Info (EERE)

Guidelines-for-leasing-row-tracts.pdf Guidelines-for-leasing-row-tracts.pdf Jump to: navigation, search File File history File usage Metadata File:Guidelines-for-leasing-row-tracts.pdf Size of this preview: 463 × 599 pixels. Other resolution: 464 × 600 pixels. Go to page 1 2 Go! next page → next page → Full resolution ‎(1,275 × 1,650 pixels, file size: 23 KB, MIME type: application/pdf, 2 pages) File history Click on a date/time to view the file as it appeared at that time. Date/Time Thumbnail Dimensions User Comment current 15:06, 13 June 2013 Thumbnail for version as of 15:06, 13 June 2013 1,275 × 1,650, 2 pages (23 KB) Apalazzo (Talk | contribs) You cannot overwrite this file. Edit this file using an external application (See the setup instructions for more information) File usage There are no pages that link to this file.


Tract based spatial statistics in multiple system atrophy: A comparison between clinical subtypes  

Science Journals Connector (OSTI)

AbstractObjective Using a novel method of tract-based spatial statistics (TBSS), this study aimed to investigate micro-structural white matter similarities and differences between the two MSA variants. Methods Diffusion tensor image data were acquired from 10 MSA-P, 15 MSA-C patients and 15 controls. Using TBSS, we performed pairwise comparison by examining the fractional anisotropy (FA), mean diffusivity, axial diffusivity (AD) and radial diffusivity (RD) maps of the white matter tract. Clusters showing diffusivity abnormalities were used as region of interests for correlation analysis. Results Both in MSA-C and MSA-P, we detected significantly decreased FA values in bilateral corticospinal tract (CST) and right anterior thalamic radiation (ATR), increased RD values in bilateral CST, which correlated significantly with clinical severity. Direct comparison of two variants showed higher AD values of superior longitudinal fasciculus (SLF) in MSA-P than in MSA-C. Conclusions These findings indicate that patients with MSA-C and MSA-P share similar diffusivity abnormalities in the bilateral CST and right ATR. Higher AD values of SLF in MSA-P than in MSA-C might be a reason for faster functional deterioration in MSA-P than in MSA-C.

Li Ji; Donglin Zhu; Chaoyong Xiao; Jingping Shi



2005-2009 American Community Survey 5-Year Estimates Summary File Tracts  

NLE Websites -- All DOE Office Websites (Extended Search)

Estimates Summary File Tracts Estimates Summary File Tracts and Block Groups BusinessUSA Data/Tools Apps Challenges Let's Talk BusinessUSA You are here Data.gov » Communities » BusinessUSA » Data 2005-2009 American Community Survey 5-Year Estimates Summary File Tracts and Block Groups Dataset Summary Description A nationwide survey that collects information such as age, race, income, commute time to work, home value, veteran status, and other data. Data from the American Community Survey and the Puerto Rico Community Survey were collected during calendar years 2005- 2009. Data available at the block group level. Tags {ACS,demographic,population,age,sex,disability,education,employment,income,ancestry,language,poverty,race,ethnicity,"Hispanic or Latino origin",relationships,"veteran status",grandparents,"marital status",marriage,divorce,fertility,"school enrollment",housing,tenure,renters,owners,homeowner,"physical characteristics","financial characteristics","number of rooms",mortgage,"household size","family type",Economic,industry,"grandparents as caregivers","journey to work",occupation,"health insurance","food stamps",SNAP,"place of birth",social,veterans,citizenship,employment,disability}


ThePlant Journal (1992) 2(4),507-51 5 PEPC-mediatedcarbonfixation intransmitting tract cells  

E-Print Network (OSTI)

molecularweight compounds such as glucose and galactoseare present inthe matrix and are thought to supply energy Ultrastructure analysis of style tissue The tissue of the transmitting tract of many of the Sola

Sessa, Guido


CNG in OKC: Improving Efficiency at the Pump and on the Road | Department  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

CNG in OKC: Improving Efficiency at the Pump and on the Road CNG in OKC: Improving Efficiency at the Pump and on the Road CNG in OKC: Improving Efficiency at the Pump and on the Road March 8, 2012 - 4:02pm Addthis Andy Mitchell, Public Works Project Manager for the City of Oklahoma City, refills a vehicle at the new fast-fill CNG fueling station located at the city's main maintenance facility. | Courtesy of the City of Oklahoma City. Andy Mitchell, Public Works Project Manager for the City of Oklahoma City, refills a vehicle at the new fast-fill CNG fueling station located at the city's main maintenance facility. | Courtesy of the City of Oklahoma City. Jennifer Holman Project Officer, Golden Field Office What does this mean for me? Switching from gasoline and diesel fuels to compressed natural gas (CNG) can mean significantly lower amounts of carbon dioxide and air


Microsoft Word - CX-Cardwell-Cowlitz2011AccessRoad_WEB.doc  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

KEP-4 KEP-4 SUBJECT: Environmental Clearance Memorandum Rick Ross Project Manager - TELF-TPP-3 Proposed Action: Access road maintenance on or leading to the Cardwell-Cowlitz No.1, 115-kilovolt (kV) transmission line. Budget Information: Work Order #00281014 PP&A Project No.: 2020 Categorical Exclusion Applied (from Subpart D, 10 C.F.R. Part 1021): B1.3 Routine maintenance activities... for...rights-of-way, infrastructures (e.g.. roads)... routine maintenance activities, corrective...are required to maintain and preserve infrastructures...in a condition suitable for the facility to be used for its designated purpose. Location: The project area consists of Bonneville Power Administration (BPA) access roads located on or leading to the Cardwell-Cowlitz No. 1, 115-kV transmission line right-of-way.


Why Did the LED Light Bulb Cross the Road? | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Why Did the LED Light Bulb Cross the Road? Why Did the LED Light Bulb Cross the Road? Why Did the LED Light Bulb Cross the Road? January 24, 2012 - 1:31pm Addthis Big Bill and Little Bill are here to talk with you about energy efficiency on behalf of Energy Impact Illinois. Roland Risser Roland Risser Program Director, Building Technologies Office How can I participate? You can view all of Big Bill and Little Bill's videos on the Energy Bill's YouTube channel. Everyone knows that laughter is good for you. Studies suggest it can buffer stress and increase your resistance to disease. Also, it just feels great to laugh. Advertisers have long used the allure of laughter to sell their products, and many Americans tune in to the Super Bowl just to chuckle at the funny commercials. However, when it comes to selling people on smart


STEM Women All-Stars Hit the Road | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

STEM Women All-Stars Hit the Road STEM Women All-Stars Hit the Road STEM Women All-Stars Hit the Road April 30, 2012 - 4:32pm Addthis Karina Edmonds, Technology Transfer Coordinator for the Department of Energy, meets with girls from the University of San Francisco Upward Bound Math and Science Program. (Photo courtesy of USF Upward Bound Math and Science Program) Karina Edmonds, Technology Transfer Coordinator for the Department of Energy, meets with girls from the University of San Francisco Upward Bound Math and Science Program. (Photo courtesy of USF Upward Bound Math and Science Program) Lauren Andersen Policy Advisor at White House Office of Science and Technology Policy What are the key facts? Watch the White House Girls in STEM video Read about the Energy Department's Women in STEM Tweet Up

Note: This page contains sample records for the topic "dp road tract" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Microsoft Word - CX-LowerGranite-HatwaiAccessRoadImprovementFY13_WEB.doc  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

9, 2012 9, 2012 REPLY TO ATTN OF: KEPR-Bell-1 SUBJECT: Environmental Clearance Memorandum Kristi Unholz Project Manager - TELF-TPP-3 Proposed Action: Improve the access road system in miles 4, 5, 16, 17, 18, and 30 of the Lower Granite-Hatwai transmission line PP&A Project No.: 2378 Categorical Exclusion Applied (from Subpart D, 10 C.F.R. Part 1021): B1.3 Routine Maintenance. B1.13 Pathways, short access roads, and rail lines Location: As identified in table below: Lower Granite-Hatwai Access Road Project Location Township Range Section County, State mile 4 to mile 5 13N 43E 2 Whitman, WA mile 16 12N 45E 8 mile 17 12N 45E 17 mile 18 12N 45E 20 mile 30 36N 5W 19, 30 Nez Perce, ID Proposed by: Bonneville Power Administration (BPA)


Argonne TTRDC - APRF - Research Activities - Through-the-Road Parallel PHEV  

NLE Websites -- All DOE Office Websites (Extended Search)

Through-the-Road (TTR) Parallel PHEV Through-the-Road (TTR) Parallel PHEV ttr on dyno Argonne engineers developed the TTR to be the Lab's own PHEV development platform. As the demand for affordable and efficient PHEVs grows, so does the need to develop cost-effective PHEV technologies and components that are optimized for efficiency and performance. Argonne researchers needed a test platform for evaluating PHEV components, so they created the Through-the-Road (TTR) parallel hybrid electric vehicle. Argonne engineers accomplished this by transforming a Saturn Vue into an in-house PHEV development platform. The TTR allows researchers to run performance tests on a wide variety of PHEV technologies. The TTR is used to test PHEV components and to develop test procedures for competitive evaluation of those technologies. The Argonne-developed control


Alaskan Ice Road Water Supplies Augmented by Snow Barriers | Department of  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Alaskan Ice Road Water Supplies Augmented by Snow Barriers Alaskan Ice Road Water Supplies Augmented by Snow Barriers Alaskan Ice Road Water Supplies Augmented by Snow Barriers March 6, 2013 - 10:55am Addthis Monitoring equipment and part of the snowfence peek out of the snow drift. Monitoring equipment and part of the snowfence peek out of the snow drift. The aerial view shows the experimental lake at Franklin Bluffs used for the snowfence experiment. The aerial view shows the experimental lake at Franklin Bluffs used for the snowfence experiment. Researcher Joel Bailey measures the density of the snow in this snow pit to determine the amount of snow in the drift and the water equivalent of the snow drift. Researcher Joel Bailey measures the density of the snow in this snow pit to determine the amount of snow in the drift and the water equivalent of the


Alaskan Ice Road Water Supplies Augmented by Snow Barriers | Department of  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Alaskan Ice Road Water Supplies Augmented by Snow Barriers Alaskan Ice Road Water Supplies Augmented by Snow Barriers Alaskan Ice Road Water Supplies Augmented by Snow Barriers March 6, 2013 - 10:55am Addthis Monitoring equipment and part of the snowfence peek out of the snow drift. Monitoring equipment and part of the snowfence peek out of the snow drift. The aerial view shows the experimental lake at Franklin Bluffs used for the snowfence experiment. The aerial view shows the experimental lake at Franklin Bluffs used for the snowfence experiment. Researcher Joel Bailey measures the density of the snow in this snow pit to determine the amount of snow in the drift and the water equivalent of the snow drift. Researcher Joel Bailey measures the density of the snow in this snow pit to determine the amount of snow in the drift and the water equivalent of the


STEM Women All-Stars Hit the Road | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

STEM Women All-Stars Hit the Road STEM Women All-Stars Hit the Road STEM Women All-Stars Hit the Road April 30, 2012 - 4:32pm Addthis Karina Edmonds, Technology Transfer Coordinator for the Department of Energy, meets with girls from the University of San Francisco Upward Bound Math and Science Program. (Photo courtesy of USF Upward Bound Math and Science Program) Karina Edmonds, Technology Transfer Coordinator for the Department of Energy, meets with girls from the University of San Francisco Upward Bound Math and Science Program. (Photo courtesy of USF Upward Bound Math and Science Program) Lauren Andersen Policy Advisor at White House Office of Science and Technology Policy What are the key facts? Watch the White House Girls in STEM video Read about the Energy Department's Women in STEM Tweet Up


Hit the Road, Jack! New Thermal Window Technology Lessens Menace of Jack  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Hit the Road, Jack! New Thermal Window Technology Lessens Menace of Hit the Road, Jack! New Thermal Window Technology Lessens Menace of Jack Frost Hit the Road, Jack! New Thermal Window Technology Lessens Menace of Jack Frost January 17, 2012 - 4:25pm Addthis The frost patterns on your window might be pretty, but they're not helping you save any energy. Energy efficient windows provide an effective barrier from inclement weather. | Photo courtesy of Callie Reed. The frost patterns on your window might be pretty, but they're not helping you save any energy. Energy efficient windows provide an effective barrier from inclement weather. | Photo courtesy of Callie Reed. Roland Risser Roland Risser Program Director, Building Technologies Office


Electromagnetic geophysics: Notes from the past and the road ahead | Open  

Open Energy Info (EERE)

Electromagnetic geophysics: Notes from the past and the road ahead Electromagnetic geophysics: Notes from the past and the road ahead Jump to: navigation, search OpenEI Reference LibraryAdd to library Journal Article: Electromagnetic geophysics: Notes from the past and the road ahead Abstract During the last century, electrical geophysics has been transformed from a simple resistivity method to a modern technology that uses complex data-acquisition systems and high-performance computers for enhanced data modeling and interpretation. Not only the methods and equipment have changed but also our ideas about the geoelectrical models used for interpretation have been modified tremendously. This paper describes the evolution of the conceptual and technical foundations of EM methods. Author Michael S. Zhdanov Published Journal


Why Did the LED Light Bulb Cross the Road? | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Why Did the LED Light Bulb Cross the Road? Why Did the LED Light Bulb Cross the Road? Why Did the LED Light Bulb Cross the Road? January 24, 2012 - 1:31pm Addthis Big Bill and Little Bill are here to talk with you about energy efficiency on behalf of Energy Impact Illinois. Roland Risser Roland Risser Program Director, Building Technologies Office How can I participate? You can view all of Big Bill and Little Bill's videos on the Energy Bill's YouTube channel. Everyone knows that laughter is good for you. Studies suggest it can buffer stress and increase your resistance to disease. Also, it just feels great to laugh. Advertisers have long used the allure of laughter to sell their products, and many Americans tune in to the Super Bowl just to chuckle at the funny commercials. However, when it comes to selling people on smart


You Can Still Save on the Road -- Even with No Cash for Clunkers |  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

You Can Still Save on the Road -- Even with No Cash for Clunkers You Can Still Save on the Road -- Even with No Cash for Clunkers You Can Still Save on the Road -- Even with No Cash for Clunkers August 26, 2009 - 1:16pm Addthis Eric Barendsen Energy Technology Program Specialist, Office of Energy Efficiency and Renewable Energy Just about everybody by now has heard of the Car Allowance Rebate System (CARS) Program, better known as "Cash for Clunkers," which had pumped $1.9 billion worth of incentives into the ailing car industry by last Thursday, according to the Department of Transportation. The red-hot program enticed about a half-a-million eligible buyers to trade in their late-model cars for new, more fuel-efficient vehicles by throwing in a cool $3,500 to $4,500 toward their purchase. Pretty sweet motivational tool if you ask me.


Microsoft Word - CX-GarrisonSubstationAccessRoadImprovementFY13_WEB.doc  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

8, 2013 8, 2013 REPLY TO ATTN OF: KEPR-Bell-1 SUBJECT: Environmental Clearance Memorandum Jonathan Malmberg Project Manager - TETQ-TPP-3 Proposed Action: Maintenance along sections of the access road leading to Bonneville Power Administration's (BPA) Garrison Substation PP&A Project No.: 2609 Categorical Exclusion Applied (from Subpart D, 10 C.F.R. Part 1021): B1.3 Routine Maintenance. B1.13 Pathways, short access roads, and rail lines. Location: As identified in table below: Township Range Section County 9N 11W 14, 13, 24 Powell 9N 10W 19, 30, 20 Powell Proposed by: BPA Description of the Proposed Action: BPA proposes repairing a corrugated metal pipe end; making minor asphalt repairs; and grading, shaping, compacting, and placing road aggregate on 20,005 linear feet


A Study on the acoustical properties of road surfaces of recycled CFB materials  

Science Journals Connector (OSTI)

Traffic noise and noise control are major concerns of transportation as noise and vibration will cause both psychological and physiological consequences. Great efforts have been made to use more sound absorbent road surfaces in order to reduce traffic noise. The raw materials under study are recycled byproducts from circulating fluidized bed boiler (CFB). The recycled CFB materials have been approved for use by the Environmental and Transportation Departments in various regions throughout the United States for road stabilization and base/surface installations. These (CFB) materials have shown good ecological civil and mechanical properties and are more environmentally friendly than asphalt and concrete. However the acoustical properties of the pavements are not known. Two types of measurements have been conducted. First the traffic noise was measured using the statistical pass-by method on various road surfaces and a comprehensive comparison was conducted. Second the sound absorption coefficients of the CFB materials were measured using impedance tubes.

Ha Ngo; Zhuang Li; Alan Davis



A congestion sensitive approach to modelling road networks for air quality management  

Science Journals Connector (OSTI)

This research establishes an approach to modelling a congested road network for air quality management, which enables the assessment of traffic management solutions that may create only subtle changes in the traffic flow regimes. Road network emissions have been calculated using standard factors taking into account details of vehicle fleet composition, average speeds and road type. Additionally, the use of microsimulation traffic modelling in conjunction with an instantaneous emissions model (IEM) has been adopted to allow comparison between methodologies and enable congestion sensitive analysis of the impact of air quality management measures on the network. Findings from microscale modelling have revealed that the use of an IEM to calculate emissions as an input for air quality dispersion modelling significantly improved the performance of the dispersion modelling when measured against monitored data. Moreover, this methodology has been successfully applied to assess the performance of a traffic scheme in Durham, UK.

James O'Brien; Anil Namdeo; Margaret Bell; Paul Goodman



Microsoft Word - CX-McNary-SantiamAccessRoad_WEB.doc  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

James Semrau Project Manager - TELF-TPP-3 Proposed Action: Access road maintenance along the McNary-Santiam 230-kV and Jones Canyon-Santiam 230-kV transmission line corridors. Budget Information: WO #00292092 PP&A Project No.: 2044 Categorical Exclusion Applied (from Subpart D, 10 C.F.R. Part 1021): B1.3 Routine maintenance activities... for...rights-of-way, infrastructures (e.g.. roads)... routine maintenance activities, corrective...are required to maintain and preserve infrastructures...in a condition suitable for the facility to be used for its designated purpose. Location: The project area consists of Bonneville Power Administration (BPA) access roads located on the McNary-Santiam (structure 123/1) & Jones Canyon-Santiam (structure 75/1)


LANL closes road, trails for safety reasons; flooding and erosion control  

NLE Websites -- All DOE Office Websites (Extended Search)

Road, trails closed for safety reasons Road, trails closed for safety reasons LANL closes road, trails for safety reasons; flooding and erosion control work under way Closure is in response to the increased fire risk and danger of flash flooding. July 8, 2011 Los Alamos National Laboratory sits on top of a once-remote mesa in northern New Mexico with the Jemez mountains as a backdrop to research and innovation covering multi-disciplines from bioscience, sustainable energy sources, to plasma physics and new materials. Los Alamos National Laboratory sits on top of a once-remote mesa in northern New Mexico with the Jemez mountains as a backdrop to research and innovation covering multi-disciplines from bioscience, sustainable energy sources, to plasma physics and new materials. Contact Fred deSousa


Model-Based Estimation of Off-Highway Road Geometry using Single-Axis LADAR and Inertial Sensing  

E-Print Network (OSTI)

Submitted, 2006 International Conference on Robotics and Automation Abstract-- This paper applies some for a variety of automotive applications in intelligent transporta- tion systems, because it enables prediction estimation schemes for road estimation to "off-highway" environments, where roads are typically not painted

Murray, Richard M.



E-Print Network (OSTI)

ON-ROAD MOTOR VEHICLE EMISSIONS FROM AROUND THE WORLD Donald H. Stedman and Gary A. Bishop@du.edu ABSTRACT In 1993, on-road emissions in Continental Europe showed a pronounced South/North declining gradient for CO, HC and NO fuel specific emissions (gm/kg). Emissions in Hamburg and Rotterdam were

Denver, University of


REFUEL: an EU road map for biofuels , E. Deurwaarder and S. Lensink, ECN policy Studies, the Netherlands  

E-Print Network (OSTI)

REFUEL: an EU road map for biofuels M. Londo1 , E. Deurwaarder and S. Lensink, ECN policy Studies), Poland K. Könighofer, Joanneum Research, Austria Abstract A successful mid-term development of biofuels calls for a robust road map. REFUEL assesses inter alia least-cost biofuel chain options, their benefits


Improvements in Terrain-Based Road Vehicle Localization By Initializing an Unscented Kalman Filter Using Particle Filters  

E-Print Network (OSTI)

the computational cost of the previous terrain- based localization algorithm. In order to localize a vehicle alongImprovements in Terrain-Based Road Vehicle Localization By Initializing an Unscented Kalman Filter of a road vehicle along a one-mile test track and 7 kilometer span of a highway using terrain

Brennan, Sean


University of Nevada, Reno Tree crown mortality associated with roads in the Lake Tahoe Basin: a remote  

E-Print Network (OSTI)

University of Nevada, Reno Tree crown mortality associated with roads in the Lake Tahoe Basin entitled Tree crown mortality associated with roads in the Lake Tahoe Basin: a remote sensing approach, Advisor Robert S. Nowak, Committee Member Wendy Calvin, Graduate School Representative Marsha H. Read, Ph

Weisberg, Peter J.


Microsoft Word - CX-Kalispell-KerrMile15-16AccessRoadImprovementFY12_WEB.doc  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

2 2 REPLY TO ATTN OF: KEPR-Bell-1 SUBJECT: Environmental Clearance Memorandum Joe Johnson Project Manager - TELF-TPP-3 Proposed Action: Access road improvement for the Kalispell-Kerr #1, 115-kilovolt (kV) transmission line PP&A Project No.: 2474 Categorical Exclusion Applied (from Subpart D, 10 C.F.R. Part 1021): B1.3 Routine Maintenance, B1.13 Pathways, short access roads, and rail lines Location: Township 26 North, Range 21 West, Section 13 and 24, Flathead County, MT. Proposed by: Bonneville Power Administration (BPA) Description of the Proposed Action: BPA proposes to perform access road maintenance on several segments of the access road for the Kalispell-Kerr #1, 115-kV transmission line. Work includes reconstruction and drainage enhancements on 5000 feet of road beginning at structure

Note: This page contains sample records for the topic "dp road tract" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Amargosa Farm Road Solar Energy Project Solar Power Plant | Open Energy  

Open Energy Info (EERE)

Amargosa Farm Road Solar Energy Project Solar Power Plant Amargosa Farm Road Solar Energy Project Solar Power Plant Jump to: navigation, search Name Amargosa Farm Road Solar Energy Project Solar Power Plant Facility Amargosa Farm Road Solar Energy Project Sector Solar Facility Type Concentrating Solar Power Developer Solar Millenium, LLC, MAN Ferrostaal Inc Location Nye County, Nevada Coordinates 38.5807111°, -116.0413889° Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"ROADMAP","zoom":14,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"350px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":38.5807111,"lon":-116.0413889,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}


The road to rack and ruin: selecting deleterious mitochondrial DNA variants  

Science Journals Connector (OSTI)

...Maintenance and evolution of mtDNA compiled and edited by Duur K. Aanen, Johannes N. Spelbrink and Madeleine Beekman The road to rack and ruin: selecting deleterious mitochondrial DNA variants Ian J. Holt 1 Dave Speijer 2 Thomas B. L. Kirkwood 3 e-mail...



Assessment of road pavement condition, based on the combined concept of chance, change and entropy  

Science Journals Connector (OSTI)

This paper presents a new methodology for the assessment of road pavement condition, based on three powerful concepts, aimed to accommodate the uncertainty caused by the complex interrelationships, material defects, structural deficiencies, human errors, ... Keywords: chance, change, dynamics, entropy, pavement condition, probability

Radu Andrei; Zeynep Durmusoglu; Vasile Boboc; Elena Pusl?u



CBER-DETR Nevada Coincident and Leading Employment Leading Index Hits Bump in the Road  

E-Print Network (OSTI)

the seasonally adjusted data reported by the Bureau of Labor Statistics. The Nevada Coincident Employment IndexCBER-DETR Nevada Coincident and Leading Employment Indexes1 Leading Index Hits Bump in the Road The Nevada Coincident Employment Index measures the ups and downs of the Nevada economy using an index

Ahmad, Sajjad


CBER-DETR Nevada Coincident and Leading Employment Bumps in the Road of Recovery  

E-Print Network (OSTI)

the seasonally adjusted data reported by the Bureau of Labor Statistics. The Nevada Coincident Employment IndexCBER-DETR Nevada Coincident and Leading Employment Indexes1 Bumps in the Road of Recovery The Nevada Coincident Employment Index measures the ups and downs of the Nevada economy using an index

Ahmad, Sajjad


CBER-DETR Nevada Coincident and Leading Employment Recovery Continues Down the Long Road Back  

E-Print Network (OSTI)

the seasonally adjusted data reported by the Bureau of Labor Statistics. The Nevada Coincident Employment IndexCBER-DETR Nevada Coincident and Leading Employment Indexes1 Recovery Continues Down the Long Road Back The Nevada Coincident Employment Index measures the ups and downs of the Nevada economy using

Ahmad, Sajjad


Off-Road Vehicle Impact on Sediment Displacement and Disruption at Assateague Island National Seashore, Maryland  

E-Print Network (OSTI)

The National Park Service (NPS) monitors off-road vehicle (ORV) use in National Seashores across the United States. The sediment disturbance that is caused by ORVs is believed to have a large impact on erosion (by wind or waves), which...

Labude, Brian



Vehicles as big data carriers: Road map space reduction and efficient data assignment  

E-Print Network (OSTI)

Vehicles as big data carriers: Road map space reduction and efficient data assignment Benjamin used mode of transport. We argue in favor of equipping standard electric vehicles with data storage´es Inria, U. de Lyon, INSA-Lyon CITI CNRS Abstract--We advocate the use of a data shuttle service model

Boyer, Edmond


Computing turn delay in city road network with GPS collected trajectories  

Science Journals Connector (OSTI)

In this paper, we aim to mine turn delay at different times and turn types in city road network based on personal GPS collected trajectories. We provide a method to effectively solve the problem for computing turn delay. By using this method, we can ... Keywords: community, data mining, gps trajectory, turn delay

Hengcai Zhang; Feng Lu; Liang Zhou; Yingying Duan



Why should you cycle? With more and more automobiles crowding the road  

E-Print Network (OSTI)

, front wheel, lights, air pump, etc. should be locked up with your bike if possible (a cable lock can of the information contained herein nor warrant the safety or fitness of any route, highway, road, street. For added safety, wear bright clothing with light-reflective strips. Hand siGnals:Usearmsignalstoindicat


Fact #625: May 31, 2010 Distribution of Trucks by On-Road Vehicle Weight  

Energy.gov (U.S. Department of Energy (DOE))

According to weigh-in-motion data collected by fifteen states, the majority of 5-axle tractor-trailers on the road weigh between 33,000 and 73,000 lbs.Eleven percent of the tractor-trailers had...


Simulating the effect of access road route slection on wind farm construction  

Science Journals Connector (OSTI)

Wind energy as a power source is attractive alternative to fossil fuels. Wind farms are typically constructed in undeveloped rural areas with challenging topography. The lack of a paved road network leading to the site and within the site itself pose ...

Khaled Nassar; Mohamed El Masry; Hesham Osman



Life Cycle Assessment Comparing the Use of Jatropha Biodiesel in the Indian Road and Rail Sectors  

SciTech Connect

This life cycle assessment of Jatropha biodiesel production and use evaluates the net greenhouse gas (GHG) emission (not considering land-use change), net energy value (NEV), and net petroleum consumption impacts of substituting Jatropha biodiesel for conventional petroleum diesel in India. Several blends of biodiesel with petroleum diesel are evaluated for the rail freight, rail passenger, road freight, and road-passenger transport sectors that currently rely heavily on petroleum diesel. For the base case, Jatropha cultivation, processing, and use conditions that were analyzed, the use of B20 results in a net reduction in GHG emissions and petroleum consumption of 14% and 17%, respectively, and a NEV increase of 58% compared with the use of 100% petroleum diesel. While the road-passenger transport sector provides the greatest sustainability benefits per 1000 gross tonne kilometers, the road freight sector eventually provides the greatest absolute benefits owing to substantially higher projected utilization by year 2020. Nevertheless, introduction of biodiesel to the rail sector might present the fewest logistic and capital expenditure challenges in the near term. Sensitivity analyses confirmed that the sustainability benefits are maintained under multiple plausible cultivation, processing, and distribution scenarios. However, the sustainability of any individual Jatropha plantation will depend on site-specific conditions.

Whitaker, M.; Heath, G.



Impact of relief accuracy on flood simulations and road network vulnerability analysis  

E-Print Network (OSTI)

1 Impact of relief accuracy on flood simulations and road network vulnerability analysis Jean). Numerical representation of relief (DTM) is a prime necessity in risk simulation, in particular in flood of the flood simulation. On that account, we consider ways to enrich the DTM by integrating relevant

Paris-Sud XI, Université de


Project Information Form Project Title Reduction of Lifecycle Green House Gas Emissions From Road  

E-Print Network (OSTI)

Project Information Form Project Title Reduction of Lifecycle Green House Gas Emissions From Road@ucdavis.edu Funding Source(s) and Amounts Provided (by each agency or organization) US DOT $30,000 Total Project Cost Brief Description of Research Project This white paper will summarize the state of knowledge and state

California at Davis, University of


Road Map for a Modular Magnetic Fusion Program Dale M. Meade  

E-Print Network (OSTI)

1 Road Map for a Modular Magnetic Fusion Program Dale M. Meade Princeton Plasma Physics Laboratory Princeton University During the past several decades magnetic fusion has made outstanding progress in understanding the science of fusion plasmas, the achievement of actual fusion plasmas and the development of key


Market-driven considerations affecting the prospects of alternative road fuels  

Science Journals Connector (OSTI)

...shows global history and the IEA's...road sector energy consumption...rising oil prices-that mean...of the USA's primary...command a price premium...to adopt energy-efficient...production in the USA, where there...dated oil price. Source...vehicle fleet history and (b...International Energy Agency...



Improving the Performance of On-Road Vehicle Detection by Combining Gabor and Wavelet  

E-Print Network (OSTI)

from gray-scale images. A first step of any vehicle detection system is hypothesizing the loca- tions1 Improving the Performance of On-Road Vehicle Detection by Combining Gabor and Wavelet Features to the problem of vehicle detection. These methods learn the characteristics of the vehicle class from a set

Bebis, George


Environmental assessment of a BOF steel slag used in road construction: The ECLAIR research program  

E-Print Network (OSTI)

1 Environmental assessment of a BOF steel slag used in road construction: The ECLAIR research and to the lack of environmental regulations. This study aimed at investigating the potential release and impact of pollutants, especially Cr and V that are present in rather high concentrations in slag, from a BOF slag used

Boyer, Edmond


EN-017 Silviculture March 2003 Tree Growth on Rehabilitated Forest Roads in  

E-Print Network (OSTI)

production on managed forest lands. Restoring soil conditions on roads that probably would not otherwise-effective meth- ods need to be established. In parts of interior British Columbia success- ful forest on 25 of the 73 original plots, along with soil conditions, vegetation recolonization, and competition

Note: This page contains sample records for the topic "dp road tract" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Autonomous driving manoeuvres in urban road traffic environment: a study on roundabouts  

E-Print Network (OSTI)

Autonomous driving manoeuvres in urban road traffic environment: a study on roundabouts Pérez of this evolution or they are still in the development stage. Autonomous vehicle performance on roundabouts is one implementation in real vehicles. Keywords: Lane keeping, autonomous vehicles, roundabouts, digital map

Paris-Sud XI, Université de


ION GPS '99, 14-17 September 1999, Nashville, TN Virtual Differential GPS & Road  

E-Print Network (OSTI)

ION GPS '99, 14-17 September 1999, Nashville, TN Virtual Differential GPS & Road Reduction Filtering by Map Matching George Taylor, Quality Engineering and Survey Technology Ltd. (Quest), Newcastle, University of Nevada, Reno. BIOGRAPHIES Dr George Taylor, is a director of Quest Ltd, a software engineering

Tingley, Joseph V.


Infrastructure, biotech top African science summit agenda Roads, electricity, telephones and the internet  

E-Print Network (OSTI)

N E W S Infrastructure, biotech top African science summit agenda Roads, electricity, telephones, the public-private partnership known as the Gavi Alliance, had saved the lives of more than 2 million African of medical doctors, traditional healers and the private sector in Lusaka, Zambia. The meeting is part of his

Cai, Long


Low-Latency ECDSA Signature Verification A Road Towards Safer Traffic  

E-Print Network (OSTI)

crippling efficient movement inside and towards cities resulting in mounting travel times, fuel consumption running on high end CPUs and FPGAs. These implementations are far from cost-effective nor energy efficient caused by the rising traffic densities on our roads and in our cities. Traffic congestion is increasingly


VTrack: Accurate, Energy-Aware Road Traffic Delay Estimation Using Mobile Phones  

E-Print Network (OSTI)

for travel time estimation using this sensor data that addresses two key challenges: energy consumptionVTrack: Accurate, Energy-Aware Road Traffic Delay Estimation Using Mobile Phones Arvind Thiagarajan the bat- tery quickly. In these cases, VTrack can use alternative, less energy-hungry but noisier sensors

Gummadi, Ramakrishna


INVITED REVIEWS AND META-ANALYSES A road map for molecular ecology  

E-Print Network (OSTI)

INVITED REVIEWS AND META-ANALYSES A road map for molecular ecology ROSE L. ANDREW,1 LOUIS, University of Wyoming, 1000 E. University Ave., Laramie, WY 82071, USA, 5 Department of Evolution, Ecology and Organismal Biology, 318 W. 12th Ave., The Ohio State University, Columbus, OH 43210, USA, 6 Island Ecology

Rieseberg, Loren


Kursplan fr lsret 2001/2002 ROAD-MAN-LANDSCAPE -IN THEORY ASB155  

E-Print Network (OSTI)

-operation with complementary competences, and taking into account traffic, landscape and environmental requirements. Innehåll planning, road construction, landscape architecture, urban architecture, planning processes and the use) students of engineering, architecture and landscape architecture, and future planners and managers


EA-1980: Spar Canyon-Round Valley Access Road System Improvements, Custer County, Idaho  

Energy.gov (U.S. Department of Energy (DOE))

Bonneville Power Administration is preparing an EA to assess potential environmental impacts of proposed improvements to the access road system for its existing Spar Canyon-Round Valley Transmission Line located on Bureau of Land Management land in Custer County, Idaho.



E-Print Network (OSTI)

8501 La Salle Road Baltimore, MD 21284 USA SYRACUSE UNIVERSITY PARTICIPANTS ENGAGED IN INTERNATIONAL STUDIES SPONSOR TODAY'S DATE Syracuse University Month Day Year Date of Arrival in U.S.A. From Month Day Year * Valid for 1 year from enrollment date ENROLLMENT INFORMATION Last Name First Name USA

Kovalev, Leonid



E-Print Network (OSTI)

3.d. TYPE (Street or Off-road) COMMANDER'S MOTORCYCLE SAFETY INTERVIEW AETC FORM 708, APR 98 (EF-V2-207/AETC Sup 1. PURPOSE: To gather data and background information for use in managing the unit motorcycle be susceptible to a motorcycle accident. The intent is to identify potential problems that could lead to injury


Remote Sensing of Mobile Source Air Pollutant Emissions: Variability and Uncertainty in On-Road Emissions  

E-Print Network (OSTI)

-Road Emissions Estimates of Carbon Monoxide and Hydrocarbons for School and Transit Buses Report No. FHWY/NC/97Remote Sensing of Mobile Source Air Pollutant Emissions: Variability and Uncertainty in On.0 INTRODUCTION 1 1.1 Mobile Source Emissions 2 1.2 Emission Regulations 2 1.3 Emissions Contributions of "Non

Frey, H. Christopher


Detrusor contraction power parameters (BCI and W max) rise with increasing bladder outlet obstruction grade in men with lower urinary tract symptoms: results from a urodynamic database analysis  

Science Journals Connector (OSTI)

To investigate to what extent detrusor work during voiding is influenced by bladder outlet obstruction (BOO) in adult men with lower urinary tract symptoms (LUTS).

Matthias Oelke; Kevin L. J. Rademakers



ErbB receptors in the biology and pathology of the aerodigestive tract  

SciTech Connect

The most common sites of malignancies in the aerodigestive tract include the lung, head and neck and the esophagus. Esophageal adenocarcinomas (EA), esophageal squamous cell carcinomas (ESCC), and squamous cell carcinomas of the head and neck (SCCHN) are the primary focus of this review. Traditional treatment for aerodigestive tract cancers includes primary chemoradiotherapy (CRT) or surgical resection followed by radiation (or CRT). Recent developments in treatment have focused increasingly on molecular targeting strategies including cetuximab (a monoclonal antibody against epidermal growth factor receptor (EGFR)). Cetuximab was FDA approved in 2006 for treatment of SCCHN, underscoring the importance of understanding the biology of these malignancies. EGFR is a member of the ErbB family of growth factor receptor tyrosine kinases. The major pathways activated by ErbB receptors include Ras/Raf/MAPK; PI3K/AKT; PLC{gamma} and STATs, all of which lead to the transcription of target genes that may contribute to aerodigestive tumor progression. This review explores the expression of ErbB receptors in EA, ESCC and SCCHN and the signaling pathways of EGFR in SCCHN.

Morgan, Sarah [Department of Otolaryngology, University of Pittsburgh School of Medicine, 200 Lothrop Street (United States); Suite 500, Pittsburgh, PA 15213 (United States); Grandis, Jennifer R. [Department of Otolaryngology, University of Pittsburgh School of Medicine, 200 Lothrop Street (United States); Suite 500, Pittsburgh, PA 15213 (United States)], E-mail: jgrandis@pitt.edu



eVMTeVMT Analysis of OnAnalysis of OnRoad Data fromRoad Data from PlugPlugIn Hybrid Electric andIn Hybrid Electric and  

E-Print Network (OSTI)

eVMTeVMT Analysis of OnAnalysis of OnRoad Data fromRoad Data from PlugPlugIn Hybrid Electric andIn Hybrid Electric and gov PlugPlug In Hybrid Electric andIn Hybrid Electric and AllAllElectric Vehicles Electric Vehicles www.inl.g October 2, 2014 Richard "Barney" Carlson w INL/MIS-14-32984 y Shawn Salisbury

California at Davis, University of


The Road to Net Zero (Presentation), NREL (National Renewable Energy Laboratory)  

NLE Websites -- All DOE Office Websites (Extended Search)

The Road to Net Zero The Road to Net Zero Bill Glover Deputy Laboratory Director and Chief Operating Officer The Sustainable Operations Summit May 16, 2011 NREL/PR-6A42-51124 NATIONAL RENEWABLE ENERGY LABORATORY Vision 2 NATIONAL RENEWABLE ENERGY LABORATORY * A showcase for sustainable, high-performance design o Incorporates the best in energy efficiency, environmental performance, and advanced controls using a "whole building" integrated design process * Serves as a model for cost-competitive, high-performance commercial buildings for the nation's design construction, operation, and financing communities 3 Research Support Facility Vision NATIONAL RENEWABLE ENERGY LABORATORY Design-Build Process 4 NATIONAL RENEWABLE ENERGY LABORATORY * Encourages innovation * Reduces owner's risk


Microsoft Word - CX-IndianCabinRoadRepair_PPA1908_WEB.doc  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

United States Government Department of Energy United States Government Department of Energy Bonneville Power Administration DATE: June 22, 2011 REPLY TO ATTN OF: KEP-4 SUBJECT: Environmental Clearance Memorandum Elizabeth Johnson Natural Resource Specialist - TFBV-THE DALLES Proposed Action: Indian Cabin Road Repair PP&A Project No.: 1908 Categorical Exclusions Applied (from Subpart D, 10 C.F.R. Part 1021): B1.3, Routine maintenance activities...for structures, rights of way, infrastructures such as roads, equipment... routine maintenance activities, corrective....are required to maintain...infrastructures...in a condition suitable for a facility to be used for its designated purpose. Location: The project is located in Skamania County, Washington, T3N, R8E, Sections 27


Microsoft Word - CX-Marion-AlveyMarion-LaneAccessRoad_WEB.doc  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

REPLY TO ATTN OF: KEP-Alvey SUBJECT: Environmental Clearance Memorandum Darin Bowman Manuel Campos Civil Engineer - TELF-TPP-3 Civil Engineer - TELF-TPP-3 Proposed Action: Access road improvements along portions of the Marion-Alvey #1 and Marion-Lane #1 transmission line rights-of-way. PP&A Project No: 1961 Categorical Exclusion Applied (from Subpart D, 10 C.F.R. Part 1021): B1.3 Routine maintenance activities...for structures, rights of way, infrastructures such as roads, equipment... routine maintenance activities, corrective....are required to maintain...infrastructures...in a condition suitable for a facility to be used for its designed purpose. Location: The project area is located in Marion and Linn counties, Oregon, in Bonneville


Microsoft Word - CX-Satsop-Aberdeen roads FY10_WEB.doc  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

30, 2010 30, 2010 REPLY TO ATTN OF: KEP-4 SUBJECT: Environmental Clearance Memorandum Jim Semrau Project Manager - TELF-TPP-3 Proposed Action: Maintenance of access roads serving the Satsop-Aberdeen No. 2 and No. 3, and the Aberdeen Tap to South Elma-Cosmopolis transmission lines PP&A Project No.: 1697 Categorical Exclusion Applied (from Subpart D, 10 C.F.R. Part 1021): B1.3 Routine maintenance activities...for structures, rights-of-way, infrastructures such as roads, equipment... routine maintenance activities, corrective...are required to maintain...infrastructures...in a condition suitable for a facility to be used for its designated purpose. Location: The Project is located in Gray's Harbor County, Washington, between the towns of


Microsoft Word - CX-AccessRoads-KingCoWA-FY13_WEB.doc  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

22, 2013 22, 2013 REPLY TO ATTN OF: KEPR-Covington SUBJECT: Environmental Clearance Memorandum Rick Ross Engineer - TELF-TPP-3 Proposed Action: Covington District Culvert Replacements Categorical Exclusion Applied (from Subpart D, 10 C.F.R. Part 1021): Appendix B1.3, Routine Maintenance Location: King County, WA Proposed by: Bonneville Power Administration (BPA) Description of the Proposed Action: BPA is proposing to replace existing culverts at 12 access road stream crossings that present barriers to fish passage. These improvements will be made on BPA easement access roads within DNR owned and managed lands. BPA will make these improvements by installing new fish friendly culverts and/or bridges at each stream crossing. The current stream crossings do not meet DNR fish passage standards that will be in


Monitoring 20 Silent Roads Over 10 Years In The Municipality Of Groningen  

Science Journals Connector (OSTI)

The municipality of Groningen in the northern part of the Netherlands has a wide experience with the application of silent roads. This experience covers a period of about 20 tracks with 2?layered porous asphalt and various types of thin layers. These tracks have been and are monitored regularly. The obtained data from 10 years monitoring offer a vast amount of valuable information on noise reduction durability maintenance costs contracts and policy. The municipality of Groningen in the northern part of the Netherlands has a wide experience with the application of silent roads. This experience covers a period of about 20 tracks with 2?layered porous asphalt and various types of thin layers. These tracks have been and are monitored regularly. The obtained data from 10 years monitoring offer a vast amount of valuable information on noise reduction durability maintenance costs contracts and policy.

Wim Van Keulen


Note: This page contains sample records for the topic "dp road tract" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Sustainability of Tunisia's road transport: is there an environmental Kuznets curve for negative externalities?  

Science Journals Connector (OSTI)

Negative externalities of transport sector in Tunisia have become serious problems for the environment and population. This article discusses the sustainability of this sector with the application of the environmental Kuznets curve model to a developing country like Tunisia over the period from 1989 to 2008. Results indicate an inverted U-shape relationship for all selected negative externalities: road energy consumption, road accidents, and urban traffic-related air pollutants (sulphur dioxide, suspended particulate and carbon dioxide) except a downward curve with L-shaped for nitrogen dioxide. Analysis of mobility behaviour shows that use of private vehicles increases with the amelioration of the purchasing power, life style and mobility behaviour in Tunisia's mega cities. Given the scarcity of financial resources of the country to develop rail infrastructure, it would be more convenient to apply economic and fiscal instruments to discourage the use of private cars and encourage group travel.

Rafaa Mraihi; Riadh Harizi; Sondes Alaouia



On-Road Particle Matter Emissions from a MY 2010 Compliant HD Diesel Vehicle Driving Across the U.S.  

Energy.gov (U.S. Department of Energy (DOE))

Measuring particle emissions from a 2010 compliant HD Diesel tractor while traveling on-road for 2300 miles found average gravimetric TPM over the entire route to be well below EPA's 2010 PM standard.


On-Road Vehicle Detection: A Review Zehang Sun, Member, IEEE, George Bebis, Member, IEEE, and Ronald Miller  

E-Print Network (OSTI)

On-Road Vehicle Detection: A Review Zehang Sun, Member, IEEE, George Bebis, Member, IEEE-3 percent of the world's gross domestic product [1], [2]. With the aim of reducing injury and accident

Bebis, George


Molecular medicine; the road to the better integration of the medical sciences in the twenty-first century  

Science Journals Connector (OSTI)

...the road to the better integration of the medical sciences in the twenty-first century D. J. Weatherall...period of division between the basic biological sciences and the health sciences, reflecting the seventeenth-century trends towards...



The effect of standard ambient conditions used for the determination of road load to predict vehicle fuel economy  

E-Print Network (OSTI)

THE EFFECT OF STANDARD AN1BIENT CONDITIONS USED FOR THE DETERMINATION OF ROAD LOAD TO PREDICT VEHICLE FUEL ECONOMY A Thesis by Michael Lee Love Submitted to the Graduate College of Texas A&M University in partial fulfillment... of the requirement for the degree of MASTER OF SCIENCE May 198Z Major Subject: Mechanical Engineering THE EFFECT OF STANDARD AMBIENT CONDITIONS USED FOR THE DETERMINATION OF ROAD LOAD TO PREDICT VEHICLE FUEL ECONOMY A Thesis by Michael Lee Love Approved...

Love, Michael Lee



A fuel consumption model for off-road use of mobile machinery in agriculture  

Science Journals Connector (OSTI)

Abstract Until 2009, the annual reporting of emissions by off-road transport in agriculture in Belgium was based on a 1994 calculation model that needed to be updated. An energy consumption model was established for plant production in Belgium as a backbone for a new emission model. The model starts from agricultural activities involving off-road fuel consumption. Effects of soil type, tractor size, field size and machine load are modelled. Twenty-seven \\{FCIs\\} (fuel consumption indicators) were computed for plant production. \\{FCIs\\} are expressed per year and are used for emission estimates on a regional level. \\{FCIs\\} ranged from 37 to 311L/ha. Sensitivity analysis showed the highest impact of tractor size with a surplus fuel consumption between 10 and 41% depending on the crop type. Fuel consumption (L) can be further processed into greenhouse gas emissions. \\{FCIs\\} can be adopted in LCA (life cycle assessment) studies. With ?310L/ha, orchards are most fuel intensive, followed by field vegetables and sugar beets (?150L/ha). The total off-road energy consumption of field vegetables is high because second cropping is a common practice.

Veerle Van linden; Lieve Herman



Experimental study of slab solar collection on the hydronic system of road  

SciTech Connect

This paper studied the slab solar collection (SSC) process, which is one of the essential compositions of road hydronic ice-snow melting (HISM) system that stores solar energy in summer to melt ice and snow on the road in winter. Its aim is to find out the heat transfer characteristic of the SSC and heat collecting efficiency and the influence of pipe spacing and flow rate by experiment. As shown in experimental results, the average heat collecting capacity is about 150-250 W/m{sup 2} in natural summer condition, while the solar radiation intensity is about 300-1000 W/m{sup 2}. It is shown that the increment of fluid flow results in the increment of heat collection efficiency, while the increment of pipe spacing results in the decrement of the efficiency in experiment modes. The results show that the road slab can obtain about 30% solar heat in summertime, and the solar collection can lower the pavement temperature and reduce the insolation weathering. (author)

Gao, Qing; Huang, Yong; Li, Ming; Liu, Yan [Jilin University, Changchun (China); Yan, Y.Y. [University of Nottingham (United Kingdom)



Fate of Brine Applied to Unpaved Roads at a Radioactive Waste Subsurface Disposal Area  

SciTech Connect

Between 1984 and 1993, MgCl2 brine was used to suppress dust on unpaved roads at a radioactive waste subsurface disposal area. Because Cl might enhance corrosion of buried metals in the waste, we investigated the distribution and fate of Cl in the vadose zone using pore water samples collected from suction lysimeters and soluble salt concentrations extracted from sediment samples. The Cl/Br mass ratio and the total dissolved Cl concentration of pore water show that brine contamination occurs primarily within 13 m of treated roads, but can extend as much as 30 m laterally in near-surface sedimentary deposits. Within the deep vadose zone, which consists of interlayered basalt lava flows and sedimentary interbeds, brine has moved up to 110 m laterally. This lateral migration suggests formation of perched water and horizontal transport during periods of high recharge. In a few locations, brine migrated to depths of 67 m within 3 to 5 yr. Elevated Cl concentrations were found to depths of 2 m in roadbed material. In drainage ditches along roads, where runoff accumulates and recharge of surface water is high, Cl was flushed from the sediments in 3 to 4 yr. In areas of lower recharge, Cl remained in the sediments after 5 yr. Vertical brine movement is directly related to surface recharge through sediments. The distribution of Cl in pore water and sediments is consistent with estimates of vadose zone residence times and spatial distribution of surface water recharge from other investigations at the subsurface disposal area.

Larry C. Hull; Carolyn W. Bishop



An empirical study of direct rebound effect for road freight transport in China  

Science Journals Connector (OSTI)

Abstract Improving energy efficiency has been considered as a major approach to reduce transportation fuel consumption, whereas its effectiveness that reduced transportation cost may lead to incremental energy use-i.e., a direct rebound effect. This paper provides a critical review of direct rebound effect literature, adopts a double logarithmic regression equation and a error correction model respectively to measure the magnitude of long-term and short-term direct rebound effects by 31 provincial panel data of China from 1999 to 2011. The empirical study shows that: in aspect of long term, a partial rebound effect exist in Chinese road freight transportation department, and its magnitude of entire nation, eastern, central and western regions are 84%, 52%, 80% and 78%. A majority of the expected energy reduction from efficiency improvement could be offset due to the existence of rebound effect; independent policy of improving energy efficiency is not as effective as people expected. In aspect of short term, a tiny super conservation effect exists in Chinese road freight transportation department. Further investigation indicated that direct rebound effect for road freight transportation tends to decline as growth rate of urbanization decrease.

Zhaohua Wang; Milin Lu



Eph tyrosine kinase receptor EphA4 is required for the topographic mapping of the corticospinal tract  

Science Journals Connector (OSTI)

...mapping of the corticospinal tract 10.1073/pnas.0607350103 Alison J. Canty Ursula Greferath Ann M. Turnley Mark Murphy *Department...1996 ) J Neurosci 16 : 5488 5497 . 19 Goldshmit Y Galea M Wise G Bartlett P Turnley A ( 2004 ) J Neurosci 24 : 10064 10073...

Alison J. Canty; Ursula Greferath; Ann M. Turnley; Mark Murphy



On-Road Measurement of Gas and Particle Phase Pollutant Emission Factors  

NLE Websites -- All DOE Office Websites (Extended Search)

On-Road Measurement of Gas and Particle Phase Pollutant Emission Factors On-Road Measurement of Gas and Particle Phase Pollutant Emission Factors for Individual Heavy-Duty Diesel Trucks Title On-Road Measurement of Gas and Particle Phase Pollutant Emission Factors for Individual Heavy-Duty Diesel Trucks Publication Type Journal Article Year of Publication 2012 Authors Dallmann, Timothy R., Steven J. DeMartini, Thomas W. Kirchstetter, Scott C. Herndon, Timothy B. Onasch, Ezra C. Wood, and Robert A. Harley Journal Environmental Science and Technology Volume 46 Issue 15 Pagination 8511-8518 Abstract Pollutant concentrations in the exhaust plumes of individual diesel trucks were measured at high time resolution in a highway tunnel in Oakland, CA, during July 2010. Emission factors for individual trucks were calculated using a carbon balance method, in which pollutants measured in each exhaust plume were normalized to measured concentrations of carbon dioxide. Pollutants considered here include nitric oxide, nitrogen dioxide (NO2), carbon monoxide, formaldehyde, ethene, and black carbon (BC), as well as optical properties of emitted particles. Fleet-average emission factors for oxides of nitrogen (NOx) and BC respectively decreased 30 ± 6 and 37 ± 10% relative to levels measured at the same location in 2006, whereas a 34 ± 18% increase in the average NO2 emission factor was observed. Emissions distributions for all species were skewed with a small fraction of trucks contributing disproportionately to total emissions. For example, the dirtiest 10% of trucks emitted half of total NO2 and BC emissions. Emission rates for NO2 were found to be anticorrelated with all other species considered here, likely due to the use of catalyzed diesel particle filters to help control exhaust emissions. Absorption and scattering cross-section emission factors were used to calculate the aerosol single scattering albedo (SSA, at 532 nm) for individual truck exhaust plumes, which averaged 0.14 ± 0.03.


Degradation in urban air quality from construction activity and increased traffic arising from a road widening scheme  

Science Journals Connector (OSTI)

Abstract Road widening schemes in urban areas are often proposed as a solution to traffic congestion and as a means of stimulating economic growth. There is however clear evidence that new or expanded roads rapidly fill with either displaced or induced traffic, offsetting any short-term gains in eased traffic flows. What has not been addressed in any great detail is the impact of such schemes on air quality, with modelled impact predictions seldom validated by measurements after the expansion of road capacity. In this study we made use of a road widening project in London to investigate the impact on ambient air quality (particulate matter, NOX, NO2) during and after the completion of the road works. PM10 increased during the construction period up to 15?gm?3 during working hours compared to concentrations before the road works. A box modelling approach was used to determine a median emission factor of 0.0022kgPM10m?2month?1, three times larger than that used in the UK emission inventory (0.0007kgPM10m?2month?1). Peaks of activity released 0.0130kgPM10m?2month?1, three and eight times smaller than the peak values used in the European and US inventories. After the completion of the widening there was an increase in all pollutants from the road during rush hour: 24?gm?3 for PM10; 1?gm?3 for PM2.5; 40 and 8?gm?3 for NOX and NO2, respectively. NO2 EU Limit Value was breached after the road development illustrating a notable deterioration in residential air quality. Additionally, PM10, but not PM2.5, glutathione dependent oxidative potential increased after the road was widened consistent with an increase in pro-oxidant components in the coarse particle mode, related to vehicle abrasion processes. These increased air pollution indices were associated with an increase in the number of cars, taxis and LGVs.

Anna Font; Timothy Baker; Ian S. Mudway; Esme Purdie; Christina Dunster; Gary W. Fuller




Office of Environmental Management (EM)

been Ioststolen, attempts to find the lost badge, etc. Note: 1. A new badge is issued ten (10) business days after this completed form is received by the Badge Office. 2....


The Road to Hydrogen--Challenges Ahead in Technology and Manufacturing  

NLE Websites -- All DOE Office Websites (Extended Search)

Chevron 2005 Chevron 2005 The Road to Hydrogen - Challenges Ahead in Technology and Manufacturing Rick Zalesky President, Hydrogen Unit Chevron Technology Ventures July 13, 2005 2 © Chevron 2005 CTV Hydrogen Strategy Develop organizational capability to be a market leader should hydrogen be adopted in the fuels portfolio Leverage hydrogen as an extension of our existing businesses Ensure CVX is positioned to actively participate in the development of hydrogen technologies and related regulations and legislation Enhance CVX's reputation as a leader in fuel processing 3 © Chevron 2005 Chevron Hydrogen Energy Stations 4 © Chevron 2005 Integrated Hydrogen Energy Stations: Scalable, Distributed Manufacturing Technology Convergence and integration Molecular-scale design



SciTech Connect

The U.S. Department of Energy (DOE) is building a Tank Waste Treatment and Immobilization Plant (WTP) at the Hanford Site in Washington to remediate 55 million gallons of radioactive waste that is being temporarily stored in 177 underground tanks. Efforts are being made to increase the loading of Hanford tank wastes in glass while meeting melter lifetime expectancies and process, regulatory, and product quality requirements. This road map guides the research and development for formulation and processing of crystaltolerant glasses, identifying near- and long-term activities that need to be completed over the period from 2014 to 2019. The primary objective is to maximize waste loading for Hanford waste glasses without jeopardizing melter operation by crystal accumulation in the melter or melter discharge riser. The potential applicability to the Savannah River Site (SRS) Defense Waste Processing Facility (DWPF) will also be addressed in this road map. The planned research described in this road map is motivated by the potential for substantial economic benefits (significant reductions in glass volumes) that will be realized if the current constraints (T1% for WTP and TL for DWPF) are approached in an appropriate and technically defensible manner for defense waste and current melter designs. The basis of this alternative approach is an empirical model predicting the crystal accumulation in the WTP glass discharge riser and melter bottom as a function of glass composition, time, and temperature. When coupled with an associated operating limit (e.g., the maximum tolerable thickness of an accumulated layer of crystals), this model could then be integrated into the process control algorithms to formulate crystal-tolerant high-level waste (HLW) glasses targeting high waste loadings while still meeting process related limits and melter lifetime expectancies. The modeling effort will be an iterative process, where model form and a broader range of conditions, e.g., glass composition and temperature, will evolve as additional data on crystal accumulation are gathered. Model validation steps will be included to guide the development process and ensure the value of the effort (i.e., increased waste loading and waste throughput). A summary of the stages of the road map for developing the crystal-tolerant glass approach, their estimated durations, and deliverables is provided.

Fox, K.; Peeler, D.; Herman, C.



Road Transportable Analytical Laboratory (RTAL) system. Quarterly technical report, December 1992--February 1993  

SciTech Connect

The goal of this contractual effort is the development and demonstration of a Road Transportable Analytical Laboratory (RTAL) system to meet the unique needs of the Department of Energy (DOE) for rapid, accurate analysis of a wide variety of hazardous and radioactive contaminants in soil, groundwater, and surface waters. This laboratory system will be designed to provide the field and laboratory analytical equipment necessary to detect and quantify radionuclides, organics, heavy metals and other inorganics, and explosive materials. The planned laboratory system will consist of a set of individual laboratory modules deployable independently or as an interconnected group to meet each DOE site`s specific needs.

Not Available



Managing congestion and emissions in road networks with tolls and rebates  

Science Journals Connector (OSTI)

Traffic congestion and emissions are two main types of social cost, and their minimization sometimes conflicts with each other. In this paper we seek nonnegative link toll schemes and/or link toll cum rebate schemes for Pareto-efficient control and management of both vehicular congestion and emissions on road networks using a bi-objective optimization approach. We provide necessary and sufficient conditions for the existence of such schemes to decentralize a given target link flow pattern. Then, we investigate the possibility of introducing such schemes to obtain specific Pareto system optimum target link flow patterns with two types of link emission function: increasing functions and non-monotonic functions, respectively.

Linxi Chen; Hai Yang



Biofuel Facts for the Road: The Energy Department and Your Gasoline Pump  

Office of Energy Efficiency and Renewable Energy (EERE)

Before you hit the road to visit relatives or friends this holiday season, youll probably stop at the gas station to fuel up. The Energy Departments Bioenergy Technologies Office invests in research and development to help commercialize biofuelsliquid fuels produced from plant sourcesto reduce Americas dependence on foreign oil, build the economy, and reduce greenhouse gas emissions. While youre at the gas pump, pay attention to a few things. There are several biofuel options already available to you today, and the Energy Department is working to bring other second-generation biofuel options to a pump near you.


The importance of the use phase on the LCA of environmentally friendly solutions for asphalt road pavements  

Science Journals Connector (OSTI)

Abstract In order to assess sustainability of products and processes, different methodologies have been developed and used in the last years. In the road pavement construction area, most methodologies used for Life Cycle Assessment (LCA) are essentially focused in the construction phase. The present paper analyses the importance of the use phase of a road in the LCA of different paving alternatives, namely by evaluating energy consumption and gaseous emissions throughout the road pavements life. Therefore, a new LCA methodology for road pavements was developed, and the results of its application to a case study involving the construction of alternative pavement structures are discussed. The study intends to assess the influence of using more sustainable paving construction alternatives (asphalt recycling vs. conventional asphalt mixtures), and/or different surface course materials (which have a higher influence on the rolling resistance and, therefore, affect the performance during the use phase). The LCA results obtained for this case study showed that the reductions in energy consumption and gaseous emissions obtained during the use phase, for pavement alternatives with a lower rolling resistance surface course, are higher than the total amount of energy consumption and gas emissions produced during construction. It is therefore clear that some improvements in the characteristics of the surface course may have an effect over the road use phase that will rapidly balance the initial costs and gas emissions of those interventions. The LCA results obtained also showed that the sustainability of pavement construction may also be improved using recycled asphalt mixtures.

Joo Paulo C. Arajo; Joel R.M. Oliveira; Hugo M.R.D. Silva



C-H..O Hydrogen Bonds in Minor Groove of A-tracts in DNA Double Helices  

E-Print Network (OSTI)

C-H..O Hydrogen Bonds in Minor Groove of A-tracts in DNA Double Helices Anirban Ghosh and Manju-pair as well as cross-strand C-H..O hydrogen bonds in the minor groove. The C2-H2..O2 hydrogen bonds within leads to a narrow minor groove in these regions. # 1999 Academic Press Keywords: C-H..O hydrogen bonds

Bansal, Manju

Note: This page contains sample records for the topic "dp road tract" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Energy-Dispersive X-ray analysis of the mineral content of corn bran treated in vitro and by passage through the pig Gastrointestinal tract  

Science Journals Connector (OSTI)

Energy-dispersive X-ray (EDX) analysis was ... a method for examining the mineral contents of corn bran loaded in vitro or passed through ... tract of pigs. Particles of dry-milled corn pericarp treated in vitro ...

Frederick R. Dintzis; Frederick L. Baker


PDF Document (9307k)  

NLE Websites -- All DOE Office Websites (Extended Search)

City No. 2 Transmission Line Keeler-Pennwalt Transmission Line BPA Access Road Tracts BPA Substation Fence Lines BPA Tracts Existing BPA Facilities St. Johns to Keeler...


Separate determination of PM10 emission factors of road traffic for tailpipe emissions and emissions from abrasion and resuspension processes  

Science Journals Connector (OSTI)

Little is known about the relevance of mechanically produced particles of road traffic from abrasion and resuspension processes in relation to the exhaust pipe particles. In this paper, emission factors of PM10 and PM1 for light and heavy-duty vehicles were derived for different representative traffic regimes from concentration differences of particles and nitrogen oxides (NOx) in ambient air upwind and downwind of busy roads, or alternatively of kerbsides and nearby background sites. Hereby, PM1 was interpreted as direct exhaust emissions and PM10-PM1 as mechanically produced emissions from abrasion and resuspension processes. The results show that abrasion and resuspension processes represent a significant part of the total primary PM10 emissions of road traffic. At sites with relatively undisturbed traffic flow they are in the same range as the exhaust pipe emissions. At sites with disturbed traffic flow due to traffic lights, emissions from abrasion/resuspension are even higher than those from the exhaust pipes.

Robert Gehrig; Matz Hill; Brigitte Buchmann; David Imhof; Ernest Weingartner; Urs Baltensperger



The Online Vehicle Type Classifier Design for Road?Side Radar Detectors  

Science Journals Connector (OSTI)

This study presents an online vehicle type classifier for road?side radar detectors in multi?lane environments. An automatic learning framework which composes a parametric statistic model and algorithms is introduced. The parameters of an online vehicle type classifier are trained with vehicles passing in front of detectors. The online vehicle type classifier tries to identify the vehicle type in real time. The road?side radar detector is developed based on frequency?modulation continuous?wave (FMCW) radar with the carrier frequency at X?band. Vehicles are classified into two major categories large and small. The classification based on (i) average energy maximum and (ii) average energy variance that are extracted from the frequency?domain signatures caused by passed vehicles. A two?dimension Gaussian Mixed Model (denoted as GMM) is employed to develop the learning model. Expectation maximization (denoted EM) algorithm is implemented to obtain the parameters of GMM. Numerical examples are demonstrated with real?world experiments. In the field tests the automatic framework delivers an accuracy of minimum 88% even with extremes scenarios (including (i) small samples and (ii) large sample size difference of different vehicle types). The examples show satisfying results of the proposed online vehicle type classifier.

Yow?Jen Jou; Yu?Kuang Chen



The Effect of Fuel Price on Demands for Road and Rail Travel: An Application to the French Case  

Science Journals Connector (OSTI)

Abstract This paper analyses the fuel price sensitivity of French traffic. Crucially, it develops the use of innovative econometric models. Partial adjustment models have been selected to represent traffic between 1990 and 2010. The road traffic model includes explanatory variables such as the fuel price, GDP, the length of the motorway network, and a lagged variable of traffic. Furthermore, a rail demand model including fuel price as an explanatory variable is also processed. In the short term, an increase of 10% in fuel price leads to a fall of 1,4% in the road traffic whereas in the long term, it leads to a fall of 2,8%.

Marianne Delsaut



A linear, time-varying simulation of the respiratory tract system  

SciTech Connect

These results show that regional deposition efficiencies of inhaled particles are highly dependent on the level of physical activity in all the spectrum of thermodynamic and aerodynamic aerosol particle sizes; also it was shown that for particles in the aerodynamic size range, the values of regional deposition efficiencies at the inner regions of the lung are highly dependent on age. In addition, the shape of regional deposition efficiency curves as a function of particle size have a similar behavior for all ages; thus, any variation of the airway geometry and respiratory physiological parameters such as tidal volumes and breathing frequencies due to age difference do not cause a change in the fundamental mechanisms of deposition. Thus, for all the cases of physical activity and age dependency, the deposition of ultrafine aerosol particles is highly enhanced by diffusive processes in all regions of the respiratory tract, and for very large aerosol size particles this behavior is repeated again due to impaction and sedimentation mechanisms. Although the results presented at this work, are the result of computer simulations based on different sources of experimental data, the structure of the computer simulation code BIODEP is flexible enough to the acquisition of any kind of new experimental information in terms of biokinetic analysis and regional deposition parameters. In addition, since the design of BIODEP was intended for easy access to the users, then with exception of the subroutine DIVPAG, at this moment, the modular design of BIODEP using FORTRAN 77 allows the implementation of all the subroutines of BIODEP to be used in a interactive mode with any microcomputer.

Hernandez, O.



On-Road Emissions in Asia Measured by Remote Sensing. Donald H. Stedman and Gary A. Bishop,University of Denver, Department of Chemistry and  

E-Print Network (OSTI)

On-Road Emissions in Asia Measured by Remote Sensing. Donald H. Stedman and Gary A. Bishop Analysis, Tiburon, California 94920 ABSTRACT On-road emissions are precisely the emissions which sensing measures mass emissions of CO, HC, NO and smoke per kg (or per L) of fuel burned. On

Denver, University of


Green College,The University of British Columbia 6201 Cecil Green Park Road,Vancouver, BCV6T 1Z1  

E-Print Network (OSTI)

Green College,The University of British Columbia 6201 Cecil Green Park Road,Vancouver, BCV6T 1Z1 604.822.8660 gc.events@ubc.ca www.greencollege.ubc.ca @GreenCollegeUBC ALLTALKS ARE ATTHE COACH HOUSE, GREEN COLLEGE, 6201 CECIL GREEN PARK ROAD AND ARE OPEN TOTHE PUBLICWITHOUT CHARGE. PLEASE ARRIVE EARLYTO

Handy, Todd C.


Upon leaving the airport on Airport Road continue 1.1 miles. Turn right on Garfield Ave. (US Hwy 14 truck route) and continue 1.0 mile.  

E-Print Network (OSTI)

until Trailrace Rd. Turn left to Powerhouse Rd. Turn left into the Corps of Engineers complexAve Capitol AveSioux Ave Dakota Ave Tailrace Rd 83 1804 1804 PowerhouseR d 1806 34 14 1806 34 14 83 14 BYP 14 28563 Powerhouse Road Pierre Field Office 28563 Powerhouse Road #12;


Promega Corporation 2800 Woods Hollow Road Madison, WI 53711-5399 USA Toll Free in USA 800-356-9526 Telephone 608-274-4330 Fax 608-277-2516 www.promega.com Printed in USA. Part# TM231  

E-Print Network (OSTI)

Promega Corporation · 2800 Woods Hollow Road · Madison, WI 53711-5399 USA · Toll Free in USA 800. Technical Manual No. 231 #12;Page 2 Promega Corporation · 2800 Woods Hollow Road · Madison, WI 53711

Lebendiker, Mario


Located between Snyder Hill Road and Ellis Hollow Road, this precinct is at the periphery of the main campus and is home to the research facilities used by the College of Veterinary  

E-Print Network (OSTI)

fields. · Site and building designs should adhere to sustainable design principles. General Guidelines of the main campus and is home to the research facilities used by the College of Veterinary Medicine a defined spine running north to south along Hungerford road. The Baker Laboratory and its support buildings

Chen, Tsuhan


Colorado Cattlemen's Agricultural Land Trust 8833 Ralston Road Arvada, Colorado 80002 303-225-8677 www.ccalt.org  

E-Print Network (OSTI)

Colorado Cattlemen's Agricultural Land Trust 8833 Ralston Road · Arvada, Colorado 80002 · 303-225-8677 · www.ccalt.org About Colorado Cattlemen's Agricultural Land Trust The Colorado Cattlemen's Agricultural Land Trust (CCALT) was formed in 1995 by the membership of the Colorado Cattlemen's Association (CCA

Lawrence, Rick L.


The Road We've Traveled: 12 Years of Undergraduate Software Engineering at the Rochester Institute of Technology  

E-Print Network (OSTI)

: A Baccalaureate Degree in Software Engineering"[1]; with this paper we bring the history up to date, discus that lies in front of us. 2. History of the program While software engineering concepts had been includedThe Road We've Traveled: 12 Years of Undergraduate Software Engineering at the Rochester Institute

Vallino, James R


U.S. Fusion Road Map Study D. Meade, A. Garofalo, D. Hill, C. Kessel, B. Lipschultz(D. Whyte),  

E-Print Network (OSTI)

and assess three aggressive technically feasible paths for the US Fusion Program mo). - Technical Readiness Levels - EU Road Map used TRLs for materials and technology - NAS IFE Assessment 2013 Power Plant (FPP) - Use recent ARIES Study to define general characteristics of DEMO/FPP - Mission


ViSTREET: An Educational Virtual Environment for the Teaching of Road Safety Skills to School Students  

Science Journals Connector (OSTI)

Virtual reality (VR) has been prevalently used as a tool to help students learn and to simulate situations that are too hazardous to practice in real life. The present study aims to explore the capability of VR to achieve these two purposes and demonstrate ... Keywords: educational virtual environments, instructional technology, road safety education, virtual reality

Kee Man Chuah; Chwen Jen Chen; Chee Siong Teh



2011 Art & Science of Service Conference 1 The Long and Winding Road to a Course on Service System Design  

E-Print Network (OSTI)

2011 Art & Science of Service Conference 1 The Long and Winding Road to a Course on Service Abstract The "Service System" concept has rapidly emerged as a foundational concept in service science and pedagogical approaches in the evolution of the current course. Some key success factors for a course

Glushko, Robert J.


IEEE TRANSACTIONS ON INTELLIGENT TRANSPORTATION SYSTEMS, VOL. 6, NO. 2, JUNE 2005 125 On-Road Vehicle Detection Using Evolutionary  

E-Print Network (OSTI)

speed, and high cost. Moreover, when there is a large number of vehicles moving simultaneously-Road Vehicle Detection Using Evolutionary Gabor Filter Optimization Zehang Sun, Member, IEEE, George Bebis, Member, IEEE, and Ronald Miller Abstract--Robust and reliable vehicle detection from images acquired

Bebis, George


Limiting sediment deposition on roadways: topographic controls on vulnerable roads and cost analysis of planting grass buffer  

E-Print Network (OSTI)

Limiting sediment deposition on roadways: topographic controls on vulnerable roads and cost and summer storms lead to large scale sediment deposition on roadways, and cleanup costs are a major concern characteristics which control sediment deposition on roadways in order to compare the cost of planting grass

Boyer, Edmond


Simultaneous Measurement of On-Road Vehicle Emissions and Traffic Flow Using Remote Sensing and an Area-Wide  

E-Print Network (OSTI)

, headway, vehicle type) were simultaneously measured using a video-based area-wide traffic detection system collected via conventional and advanced vehicle monitoring systems. The project is sponsored1 Simultaneous Measurement of On-Road Vehicle Emissions and Traffic Flow Using Remote Sensing

Frey, H. Christopher


Project Description In the search for superior batteries, the road to success is paved with advanced materials: better  

E-Print Network (OSTI)

Project Description In the search for superior batteries, the road to success is paved with advanced materials: better cathodes, better anodes, better electrolytes. The universe of candidates is so of this proposal is that by leveraging the advances in informatics and high-throughput experimental

Sadoway, Donald Robert

Note: This page contains sample records for the topic "dp road tract" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


ARMO: Adaptive Road Map Optimization for Large Robot Teams Alexander Kleiner*, Dali Sun* and Daniel Meyer-Delius*  

E-Print Network (OSTI)

in static environments [4] that compute during a pre-processing phase a connectivity graph in freeARMO: Adaptive Road Map Optimization for Large Robot Teams Alexander Kleiner*, Dali Sun* and Daniel Meyer-Delius* Abstract-- Autonomous robot teams that simultaneously dis- patch transportation tasks

Nebel, Bernhard


Detection of Defects in Road Surface by a Vision N. T. Sy M. Avila, S. Begot and J. C. Bardet  

E-Print Network (OSTI)

. Bardet PRISME Institute-MCDS Team - Orleans University - IUT Chateauroux - France ) Vectra Road on a set of image processing tasks : bi-level thresholding, morphological operation, and projection. The method have been tested on three kinds of images: the first ones are images taken in laboratory in static

Paris-Sud XI, Université de


What is at the end of the road? Understanding discontinuities of on-street bicycle lanes in urban settings  

E-Print Network (OSTI)

What is at the end of the road? Understanding discontinuities of on-street bicycle lanes in urban-street bicycle facilities is often mentioned as an important strategy to encourage increased bicycle safety and bicycle travel. However, little if any literature has focused on instances where separate on- street

Levinson, David M.


Urban bus driver ride and road-friendliness. Part I: Model development and role of operating parameters  

Science Journals Connector (OSTI)

This study explores the driver-ride and road-friendliness characteristics of an urban bus through model derivation and validation, sensitivity analysis, suspension damping optimisation and field assessments. Part I of the study develops a three-dimensional urban bus model by integrating non-linear models of suspension components and tyres that were derived from laboratory-measured data. The vehicle model is validated through field tests, and employed for sensitivity analyses of different operating parameters, including forward speed, tyre inflation pressure, vehicle load and road roughness. The results demonstrate significant roles of these parameters on the dynamic responses relating to driver ride and road-friendliness, which are coupled in a complex manner. The results suggest that measures related to sustainability of urban infrastructure and vehicle structure, together with the health and safety of the drivers, are directly coupled in light of the road roughness. The validated full-vehicle model is further employed for suspension damping design optimisation and its field assessments, which are presented in Part II of the study.

Subhash Rakheja; Dongpu Cao; Zhanqi Wang



Vision-Based Road-Following Using a Small Autonomous Eric Frew, Tim McGee, ZuWhan Kim, Xiao Xiao, Stephen Jackson, Michael Morimoto, Sivakumar Rathinam, Jose Padial,  

E-Print Network (OSTI)

Vision-Based Road-Following Using a Small Autonomous Aircraft12 Eric Frew, Tim McGee, ZuWhan Kim of a small autonomous aircraft following a road. The computer vision system detects natural features roads and in conditions of up to 5 m/s of prevailing wind. Hardware experiments have also been conducted

Kim, ZuWhan


Evaluation of Range Estimates for Toyota FCHV-adv Under Open Road Driving Conditions  

NLE Websites -- All DOE Office Websites (Extended Search)

SRNS-STI-2009-00446 Evaluation of Range Estimates for Toyota FCHV-adv Under Open Road Driving Conditions Keith Wipke 1 , Donald Anton 2 , Sam Sprik 1 August 10, 2009 PTS-05 of SRNS CRADA No. CR-04-003 1 National Renewable Energy Laboratory 2 Savannah River National Laboratory Page 1 of 17 SRNS-STI-2009-00446 Objective: The objective of this evaluation was to independently and objectively verify driving ranges of >400 miles announced by Toyota for its new advanced Fuel Cell Hybrid Vehicle (FCHV-adv) utilizing 70 MPa compressed hydrogen. To accomplish this, participants from both Savannah River National Laboratory (SRNL) and the National Renewable Energy Laboratory (NREL) witnessed and participated in a 2-vehicle evaluation with Toyota Motor Engineering & Manufacturing North America, Inc. (TEMA) over a typical


The Road to Ultrahigh-Resolution X-ray Spectrometers | Advanced Photon  

NLE Websites -- All DOE Office Websites (Extended Search)

How Atoms Behave: Characteristics of Microstructural Avalanches How Atoms Behave: Characteristics of Microstructural Avalanches Iodate Refuses to Intimidate Creating the Heart of a Planet in the Heart of a Gem How a Powerful Antibody Neutralizes HIV Taking a Page from Nature to Build Better Nanomaterials Science Highlights Archives: 2013 | 2012 | 2011 | 2010 2009 | 2008 | 2007 | 2006 2005 | 2004 | 2003 | 2002 2001 | 2000 | 1998 | Subscribe to APS Science Highlights rss feed The Road to Ultrahigh-Resolution X-ray Spectrometers NOVEMBER 22, 2011 Bookmark and Share Basic phenomena underlying the AD&AT x-ray optics. In x-ray Bragg diffraction from atomic planes composing nonzero angle η to the crystal entrance face, the crystal acts (a) like an optical prism dispersing the photons into a divergent x-ray fan with photons of different energies E


Microsoft Word - Class 1 S Access Road-031611 FINAL.doc  

NLE Websites -- All DOE Office Websites (Extended Search)

Carlsbad. New Mexico 88221 Carlsbad. New Mexico 88221 Mr. James Bearzi, Chief Hazardous Waste Bureau New Mexico Environment Department 2905 Rodeo Park Drive East, Building 1 Santa Fe, New Mexico 87505-6303 MAR 1 7 2011 Subject: Notification of a Class 1 Permit Modification to the Hazardous Waste Facility Permit, Permit Number: NM4890139088· TSDF Dear Mr. Bearzi: Enclosed is a Class 1 Permit Modification Notification to: * Add South Access Road for Transportation of TRU Mixed Waste We certify under penalty of law that this document and the enclosure were prepared under our direction or supervision in accordance with a system designed to assure that qualified personnel properly gather and evaluate the information submitted . Based on our inquiry of the person or persons who manage the system, or those persons directly responsible for gathering


New York State Department of Environmental Conservation 50 Wolf Road, Albany, New York 12233  

Office of Legacy Management (LM)

State Department of Environmental Conservation State Department of Environmental Conservation 50 Wolf Road, Albany, New York 12233 Thomas Cl Jorling Commisbioner August 13, 1993 W. Alexander Williams, Ph.D. Designation 8 Certification Manager Off-Site Branch Division of Eastern Area Programs Office of Environmental Restoration U.S. Department of Energy Washington, DC 20585 J Dear Alexander: f ., Thank you for sending me the enclosed February 19, 1991 letter from Mr. R. Sorum of Afrimet Indussa to Mr. Andrew Wall, III, a former employee of a U.S. Department of Energy contracts We are examining its contents relative to more recent statemen by representatives of this corporation and will discuss this issue in the future with you. I am particularly interested in the last sentence of the first page of this letter.


Compliant mechanism road bicycle brake: a rigid-body replacement case study  

SciTech Connect

The design of high-performance bicycle brakes is complicated by the competing design objectives of increased performance and low weight. But this challenge also provides a good case study to demonstrate the design of compliant mechanisms to replace current rigid-link mechanisms. This paper briefly reviews current road brake designs, demonstrates the use of rigid-body replacement synthesis to design a compliant mechanism, and illustrates the combination of compliant mechanism design tools. The resulting concept was generated from the modified dual-pivot brake design and is a partially compliant mechanism where one pin has the dual role of a joint and a mounting pin. The pseudo-rigid-body model, finite element analysis, and optimization algorithms are used to generate design dimensions, and designs are considered for both titanium and E-glass flexures. The resulting design has the potential of reducing the part count and overall weight while maintaining a performance similar to the benchmark.

Olsen, Brian M [Los Alamos National Laboratory; Howell, Larry L [NON LANL; Magleby, Spencer P [NON LANL



Road Transport Elasticity: How Fuel Price Changes can Affect Traffic Demand on a Toll Motorway  

Science Journals Connector (OSTI)

Abstract The crisis beginning in late 2008 in Greece, and still in progress, led the Greek Government to undertake a particularly harsh program under the joint auspices of the International Monetary Fund (IMF), the European Union and the European Central Bank, aimed at restoring the primary budget surplus. The implementation of such a financial program has dramatically increased fuel taxes - about 82% for unleaded and 31% for diesel also producing a serious impact on road traffic demand. Starting from the above framework, this paper describes the main outcomes of a study aimed at identifying, assessing and forecasting the effects of fuel prices and tax changes on traffic flows along a 365km toll motorway corridor project connecting Athens to Tsakona, in the South-West of the Peloponnese.

Antonio Musso; Cristiana Piccioni; Michele Tozzi; Gilles Godard; Alexandre Lapeyre; Kostas Papandreou



Policy effectiveness for road passenger transport emissions reductions across the world  

E-Print Network (OSTI)

The effectiveness of policy for emissions reductions in private passenger road transport depends on its ability to incentivise consumers to make choices oriented towards lower emissions vehicles. However, car purchase choices are known to be strongly socially determined, and this sector is highly diverse due to significant socio-economic differences between consumer groups. Here, we present a comprehensive analysis of the structure of the 2012 private passenger vehicle fleet-years in six major economies across the World (UK, USA, China, India, Japan and Brazil) in terms of prices, engine sizes and emissions. This is done in order to evaluate the effectiveness of existing and possible fiscal and technological change policies for emissions reductions. We provide tools to understand and evaluate the effectiveness of policy taking account of the distributive structure of prices and emissions in segments of a diverse market, both for conventional as well as unconventional engine technologies. We furthermore explai...

Mercure, J -F



Evaluation of fixed? versus variable?modulation treatment modes for charged?particle irradiation of the gastrointestinal tract  

Science Journals Connector (OSTI)

The clinical usefulness of variable?modulation dose delivery of neon ion and proton beams over fixed?modulation beams is evaluated for several patients with tumors in the gastrointestinal tract by comparing dose distributions dose volume histograms and predictions of normal tissue complication probabilities calculated with the two methods. Both techniques provide excellent coverage of the target volume with neon ion and proton beams. The advantage of variable modulation is that less dose is delivered proximal to the target volume. For tumors in the gastrointestinal tract this implies that less dose is given to the liver gut kidneys and lungs. For the ten patients considered in this study variable?modulation reduced the total integral dose by an average of 17% for neon ion beams and by 18% for protons as compared to fixed?modulation. If the tumor volume is excluded the reduction in the integral dose to normal tissues ranged from 15% to 32% for neon ions and from 18% to 34% for proton beams. These gains are larger than those anticipated on the basis of an analytic study by Goitein and Chen [Med. Phys. 10 831840 (1983)] which predicted integral dose reductions of the order of 10% for protons and 14% for neon ions. They are also larger than those reported in a similar study by Urie and Goitein [Med. Phys. 16 593601 (1989)] for proton irradiation of skull?base tumors. This is probably because the tumors in the GI tract considered in this study were more irregularly shaped than Goitein and Chens analytic model assumes. The results of this study also suggest that due to increased sparing of normal tissues the number of different portal directions required to achieve a satisfactory treatment plan will be reduced for variable?modulation beam delivery systems. This implies that variable?modulation treatment plans will be easier to execute than current fixed?modulation plans.

Inder Daftari; Paula L. Petti; John M. Collier; Joseph R. Castro; Samuel Pitluck



Microsoft Word - CX-GrandCouleeDistrictWoodPoleReplacementsAccessRoadsFY13_WEB.doc  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

KEPR-Bell-1 SUBJECT: Environmental Clearance Memorandum Todd Wehner Civil Design/Access Roads - TELF-TPP-3 James Semrau Project Manager - TEP-TPP-1 Proposed Action: Wood pole replacement, equipment landing construction, and access road improvements along various transmission lines in Bonneville Power Administration's (BPA) Grand Coulee District. PP&A Project No.: 2152 (Grand Coulee-Chief Joseph No. 1), 2151 (Grand Coulee-Chief Joseph No. 2), 2121 (Grand Coulee-Foster Creek No. 1) and 1776 (Grand Coulee-Okanogan No. 2) Categorical Exclusion Applied (from Subpart D, 10 C.F.R. Part 1021): B1.3 Routine maintenance Location: Douglas and Okanogan counties, Washington. Refer to table below for project locations: Line Name Structure Township Range Section County



Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

REVIEW REVIEW LASO-10-002 CATEGORICAL EXCLUSION PAJARITO ROAD RIGHT-OF-WAY SHIFT AT TA-50 AND TA-55 1. DESCRIPTION OF PROPOSED ACTION: LANL proposes to shift a segment of Pajarito Road slightly to the south along the edge of Two-Mile Canyon in the vicinity of TA-55. The existing centerline would be moved between 36 feet and 56 feet depending on final designs. This shift would address the need to integrate security requirements related to the Chemistry and Metallurgy Building Replacement Project (CMRR) and the Nuclear Materials Safeguards and Security Upgrades Project (NMSSIJP) - specifically placement of the Perimeter Intrusion Detection, Assessment, and Delay System fence improvements in proximity to Pajarito Road. Pajarito Road is not open to the public and is secured to preclude unauthorized access to the facilities between


Application of positive matrix factorization to on-road measurements for source apportionment of diesel- and gasoline-powered vehicle emissions in Mexico City  

E-Print Network (OSTI)

The goal of this research is to quantify diesel- and gasoline-powered motor vehicle emissions within the Mexico City Metropolitan Area (MCMA) using on-road measurements captured by a mobile laboratory combined with positive ...

Thornhill, D. A.


Radiological Assessment for the Vance Road Facility Source Vault, Oak Ridge Institute for Science and Education, Oak Ridge, Tennessee  

SciTech Connect

From the 1950s, the Vance Road laboratories had been used for a broad range of nuclear medicine research involving numerous radionuclides. These radionuclides were stored in the a source vault located on the first floor of the facility. The Environmental Survey and Site Assessment Program (ESSAP) of ORISE performed a radiological assessment survey of the source vault after it had been remediated and in preparation for converting the area to office space.

J. R. Morton



Green College,The University of British Columbia 6201 Cecil Green Park Road,Vancouver, BCV6T 1Z1  

E-Print Network (OSTI)

Green College,The University of British Columbia 6201 Cecil Green Park Road,Vancouver, BCV6T 1Z1 604.822.8660 gc.events@ubc.ca www.greencollege.ubc.ca @GreenCollegeUBC ALLTALks ARE ATThE CoaCh hoUse, Green ColleGe, 6201 CeCil Green park road And ARE OPEn TOThE PUBLiCwiThOUT ChARGE. PLEAsE ARRiVE EARLYTO

Michelson, David G.


Investigation of the Roosevelt Road Transmitter Site, Fort Richardson, Alaska, using ground penetrating radar  

SciTech Connect

The Roosevelt Road Transmitter Site is the location of a decommissioned bunker on Fort Richardson, near Anchorage, Alaska. The site was used from World War II to the Korean War as part of an Alaskan communications network. The bunker and support buildings were vandalized following its decommissioning in the mid-1960s, resulting in PCB contamination of the bunker and soils around the above-ground transmitter annex. CRREL conducted a ground-penetrating radar (GPR) investigation of the site in June 1996, at the request of the Directorate of Public Works on Fort Richardson. Nine transect lines were established, each being profiled with 100- and 400-MHz antennas. Both antennas systems defined the extent of the bunker and identified the presence of buried utilities. The 100-MHz antenna provided large-scale resolution of the bunker, limits of site excavation, and large stratigraphic horizons in the undisturbed sediments. The 400-MHz antenna provided finer resolution that allowed identification of steel reinforcement in the bunker ceiling, utility walls and floor, and the walls of the inner and outer bunker. High amplitude resonance and hyperbolas in the record characterize the response from the Transmitter Annex foundation, buried pipes, and utilities. The GPR survey shows its utility for detecting the extent of abandoned underground structures and identifying the extent of original ground excavations.

Hunter, L.E.; Delaney, A.J.; Lawson, D.E.



Fate of Magnesium Chloride Brine Applied to Suppress Dust from Unpaved Roads at the INEEL Subsurface Disposal Area  

SciTech Connect

Between 1984 and 1993, MgCl2 brine was used to suppress dust on unpaved roads at a radioactive waste subsurface disposal area. Because Cl might enhance corrosion of buried metals in the waste, we investigated the distribution and fate of Cl in the vadose zone using pore water samples collected from suction lysimeters and soluble salt concentrations extracted from sediment samples. The Cl/Br mass ratio and the total dissolved Cl concentration of pore water show that brine contamination occurs primarily within 13 m of treated roads, but can extend as much as 30 m laterally in near-surface sedimentary deposits. Within the deep vadose zone, which consists of interlayered basalt lava flows and sedimentary interbeds, brine has moved up to 110 m laterally. This lateral migration suggests formation of perched water and horizontal transport during periods of high recharge. In a few locations, brine migrated to depths of 67 m within 3 to 5 yr. Elevated Cl concentrations were found to depths of 2 m in roadbed material. In drainage ditches along roads, where runoff accumulates and recharge of surface water is high, Cl was flushed from the sediments in 3 to 4 yr. In areas of lower recharge, Cl remained in the sediments after 5 yr. Vertical brine movement is directly related to surface recharge through sediments. The distribution of Cl in pore water and sediments is consistent with estimates of vadose zone residence times and spatial distribution of surface water recharge from other investigations at the subsurface

Larry Hull; Carolyn Bishop


Note: This page contains sample records for the topic "dp road tract" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Guidelines for Vocal Tract Development Lab (VT Lab) team members to access the VT Lab WebSpace via the VT Lab website  

E-Print Network (OSTI)

Guidelines for Vocal Tract Development Lab (VT Lab) team members to access the VT Lab WebSpace via the VT Lab website The VTLab WebSpace is a new and improved mechanism for VT lab team members to share files. We are replacing the former Member Login section of our website with MyWeb Space (developed by Do

Vorperian, Houri K.


Characterization of the Burma Road Rubble Pit at the Savannah River Site, Aiken, South Carolina  

SciTech Connect

The Burma Road Rubble Pit (BRRP) is located at the Savannah River Site (SRS). The BRRP unit consists of two unlined earthen pits dug into surficial soil and filled with various waste materials. It was used from 1973--1983 for the disposal of dry inert rubble such as metal, concrete, lumber, poles, light fixtures, and glass. No record of the disposal of hazardous substances at the BRRP has been found. In 1983, the BRRP was closed by covering it with soil. In September 1988, a Ground Penetrating Radar survey detected three disturbed areas of soil near the BRRP, and a detailed and combined RCRA Facility Investigation/Remedial Investigation was conducted from November 1993 to February 1994 to determine whether hazardous substances were present in the subsurface, to evaluate the nature and extent of contamination, and to evaluate the risks posed to the SRS facility due to activities conducted at the BRRP site. Metals, semi-volatile organic compounds, volatile organic compounds, radionuclides and one pesticide (Aldrin) were detected in soil and groundwater samples collected from seventeen BRRP locations. A baseline risk assessment (BRA) was performed quantitatively to evaluate whether chemical and radionuclide concentrations detected in soil and groundwater at the BRRP posed an unacceptable threat to human health and the environment. The exposure scenarios identifiable for the BRRP were for environmental researchers, future residential and occupational land use. The total site noncancer hazard indices were below unity, and cancer risk levels were below 1.0E-06 for the existing and future case environmental researcher scenario. The future case residential and occupational scenarios showed total hazard and risk levels which exceeded US EPA criterion values relative to groundwater scenarios. For the most part, the total carcinogenic risks were within the 1.0E-04 to 1.0E-06 risk range. Only the future adult residential scenario was associated with risks exceeding 1.0E-04.

Ward, K.G.; Frazier, W.L.; McAdams, T.D.; McFalls, S.L.; Rabin, M. [Westinghouse Savannah River Co., Aiken, SC (United States); Voss, L. [Westinghouse Savannah River Co., Aiken, SC (United States)]|[Neptune and Co., Los Alamos, NM (United States)



"1. Hay Road","Gas","Calpine Mid-Atlantic Generation LLC",1130  

U.S. Energy Information Administration (EIA) Indexed Site

Delaware" Delaware" "1. Hay Road","Gas","Calpine Mid-Atlantic Generation LLC",1130 "2. Indian River Operations","Coal","Indian River Operations Inc",795 "3. Edge Moor","Gas","Calpine Mid-Atlantic Generation LLC",723 "5. McKee Run","Gas","NAES Corporation",136 "6. NRG Energy Center Dover","Coal","NRG Energy Center Dover LLC",100 "7. Warren F Sam Beasley Generation Station","Gas","Delaware Municipal Electric Corp",48 "8. Christiana","Petroleum","Calpine Mid-Atlantic Generation LLC",45 "9. Van Sant Station","Gas","NAES Corporation",39


A review of "The Ends of Life: Roads to Fulfilment in Early Modern England" by Keith Thomas  

E-Print Network (OSTI)

reviews 59 future of the humanities in general and seventeenth-century studies in particular, H?fer?s study reaffirms the centrality of the grand si?cle through a timely return to a larger concept of the humanities, before that other... of Life: Roads to Fulfilment in Early Modern England. Oxford and New York: Oxford University Press, 2009. xvi + 393 pp. + 14 illus. $60.00. Review by catherine patterson, university of houston In this wide-ranging and engaging book, Keith Thomas brings...

Patterson, Catherine



Novel estimation of tyre-road friction coefficient and slip ratio using electrical parameters of traction motor for electric vehicles  

Science Journals Connector (OSTI)

The estimation of the friction coefficient and the slip ratio is crucial for advanced traction control or anti-brake control of electric vehicles. In this paper, dynamic behaviours of electrical parameters of the traction motor under road change are modelled and analysed. Novel estimation only using the measurements of the armature voltage and the current is proposed. The proposed method is much quicker than traditional methods, contributing to adjust the vehicle's motion state more quickly and precisely. Further, it can eliminate the speed measuring devices of the wheel speed and the vehicle speed. Simulations verify the effectiveness.

Guoqing Xu; Kun Xu; Weimin Li



Transport energy consumption in mountainous roads. A comparative case study for internal combustion engines and electric vehicles in Andorra  

Science Journals Connector (OSTI)

Abstract This paper analyses transport energy consumption of conventional and electric vehicles in mountainous roads. A standard round trip in Andorra has been modelled in order to characterise vehicle dynamics in hilly regions. Two conventional diesel vehicles and their electric-equivalent models have been simulated and their performances have been compared. Six scenarios have been simulated to study the effects of factors such as orography, traffic congestion and driving style. The European fuel consumption and emissions test and Artemis urban driving cycles, representative of European driving cycles, have also been included in the comparative analysis. The results show that road grade has a major impact on fuel economy, although it affects consumption in different levels depending on the technology analysed. Electric vehicles are less affected by this factor as opposed to conventional vehicles, increasing the potential energy savings in a hypothetical electrification of the car fleet. However, electric vehicle range in mountainous terrains is lower compared to that estimated by manufacturers, a fact that could adversely affect a massive adoption of electric cars in the short term.

Oriol Travesset-Baro; Marti Rosas-Casals; Eric Jover



Page not found | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

31 - 11340 of 29,416 results. 31 - 11340 of 29,416 results. Page Historic Preservation 1. What does the Programmatic Agreement on historic preservation entail? http://energy.gov/gc/action-center-office-general-counsel/faqs-related-recovery-act/historic-preservation Download Audit Report: IG-0894 Department of Energy Quality Assurance: Design Control for the Waste Treatment and Immobilization Plant at the Hanford Site http://energy.gov/ig/downloads/audit-report-ig-0894 Download Policy Flash 2013-15 Attached is Policy Flash 2013-15 DOE O 231.1B, Environment, Safety and Health Reporting http://energy.gov/management/downloads/policy-flash-2013-15 Download EA-1184: Final Environmental Assessment Transfer of the DP Road Tract to the County of Los Alamos http://energy.gov/nepa/downloads/ea-1184-final-environmental-assessment


LOS ALAMOS, New Mexico, November 1, 2012-Los Alamos National Laboratory  

NLE Websites -- All DOE Office Websites (Extended Search)

to demolish excavation to demolish excavation enclosures at Material Disposal Area B near DP Road November 1, 2012 Work is beginning this week LOS ALAMOS, New Mexico, November 1, 2012-Los Alamos National Laboratory is about to begin demolishing the metal enclosures used to cover the excavation and cleanup of a decades-old waste disposal site at the historic Technical Area 21. Pre-demolition activities are beginning this week and the work should be completed by the end of March 2013. The project brings the Laboratory closer to transferring the six- acre tract of land to Los Alamos County. The metal structures, which resemble airplane hangars, were installed in 2010 to protect workers and the public from exposure to hazardous and radiological - 2 - contamination while excavating and packaging contaminated debris and soil from


Moneyfacts Group plc, Moneyfacts House, 66 -70 Thorpe Road, Norwich. NR1 1BJ. Telephone: 0870 2250 476 Fax: 0870 2250 201 email: pressoffice@moneyfacts.co.uk  

E-Print Network (OSTI)

Moneyfacts Group plc, Moneyfacts House, 66 - 70 Thorpe Road, Norwich. NR1 1BJ. Telephone: 0870 2250 points such as half or quarter points, for example at 4%, 4.5% or 4.75%. #12;Moneyfacts Group plc 15 20 25 30 35 40 45 50 Basis Points Frequency #12;Moneyfacts Group plc, Moneyfacts House, 66 - 70

Feigon, Brooke


Advisor change form.doc; 8/10/2004 Whetten Graduate Center 438 Whitney Road Extension, Unit 1006 Storrs, Connecticut 06269-1006  

E-Print Network (OSTI)

Advisor change form.doc; 8/10/2004 Whetten Graduate Center 438 Whitney Road Extension, Unit 1006 Storrs, Connecticut 06269-1006 CHANGE OF MAJOR ADVISOR FORM Submit this form, when completed and signed are sent to the new major advisor, the former major advisor, and the student. The Graduate School retains

Kim, Duck O.


U.S. News & World Report, "Research Produces Coating for Ice Resistant Roads", Nov. 2, 2009. (http://www.usnews.com/science/articles/2009/11/02/research-  

E-Print Network (OSTI)

· U.S. News & World Report, "Research Produces Coating for Ice Resistant Roads", Nov. 2, 2009. (http://www.usnews.com/science/articles/2009/11/02/research- produces-coating-for-ice ice", p. 36, October 19, 2009. · Materials Today , Dec. 2009. · Ceramic Tech Today (by The American

Wu, Jianzhong


Lawrence Berkeley National Laboratory Earth Sciences Division 1 Cyclotron Road, MS 90-1116 Berkeley, CA 94720 510-486-6455  

E-Print Network (OSTI)

* National Science Board (2006) quoted in Neal et al. (2008) Many DOE programs moved away from this paradigm3/4/11 1 Lawrence Berkeley National Laboratory · Earth Sciences Division 1 Cyclotron Road, MS 90 during ­ the Director's Review of ESD in March 2010 ­ the LBNL-organized workplace climate surveys

Ajo-Franklin, Jonathan


Transactions in GIS, 2004, 8(3): 351366 Blackwell Publishing Ltd. 2004. 9600 Garsington Road, Oxford OX4 2DQ, UK and  

E-Print Network (OSTI)

Transactions in GIS, 2004, 8(3): 351­366 © Blackwell Publishing Ltd. 2004. 9600 Garsington Road the incorporation of geographical and environmental modeling with GIS requires software support for storage GIS software. Two complementary approaches have been used to manage the spatial and temporal

Sengupta, Raja


Transactions in GIS, 2005, 9(2): 223245 Blackwell Publishing Ltd. 2005. 9600 Garsington Road, Oxford OX4 2DQ, UK and  

E-Print Network (OSTI)

Transactions in GIS, 2005, 9(2): 223­245 © Blackwell Publishing Ltd. 2005. 9600 Garsington Road of these snapshots can provide information about changes to the phenomena of interest. However, conventional GIS data that exhibit the spatiotemporal characteristics of interest can be identified in a GIS database. To this end

Yuan, May


Oil Spill Clarifies Road Map for Sea Turtle Recovery By Jane Lubchenco, Ph.D., under secretary for oceans and atmosphere and NOAA  

E-Print Network (OSTI)

Oil Spill Clarifies Road Map for Sea Turtle Recovery By Jane Lubchenco, Ph.D., under secretary for oceans and atmosphere and NOAA Administrator Sea turtles have roamed the oceans for millennia their populations to dangerously low levels. Some, such as Kemp's ridley sea turtles, were beginning to make


European Transport Conference 2009, October 5-7, Leeuwenhorst, The Netherlands 1 / 12 On the marginal cost of road congestion: an evaluation  

E-Print Network (OSTI)

environmental effects: the reduced speeds in urban areas increase energy consumption, greenhouse gas emissions transport passenger is also subject to the same costs. A variable part of these costs is related to the road and emissions of most pollutants. The types of congestion, their associated costs and their quantitative

Paris-Sud XI, Université de


R E S E A R C H A R T I C L E Restoration of Native Plant Communities after Road  

E-Print Network (OSTI)

recognized as a crit- ical first step in the restoration of terrestrial and aquatic habitats. However reduce erosion and sedimentation, contributing to the restoration of disturbed ecosystems (Madej 2001R E S E A R C H A R T I C L E Restoration of Native Plant Communities after Road Decommissioning

Nelson, Cara


Speed-and Facility-Specific Emission Estimates for On-Road Light-Duty Vehicles based on Real-World Speed Profiles  

E-Print Network (OSTI)

06-1096 Speed- and Facility-Specific Emission Estimates for On-Road Light-Duty Vehicles based on Real-World Speed Profiles By H. Christopher Frey, Ph.D. Professor Department of Civil, Construction demand and land use models such as TransCAD, TranPlan or TRANUS produce average link speed and link VMT

Frey, H. Christopher


Nanoscale Imaging of Airborne Particles Mike Bogan Stanford PULSE Institute, SLAC National Accelerator Laboratory, 2575 Sand Hill Road,  

NLE Websites -- All DOE Office Websites (Extended Search)

Diagnostics with an X-ray Laser? Lessons from the First Diagnostics with an X-ray Laser? Lessons from the First Nanoscale Imaging of Airborne Particles Mike Bogan Stanford PULSE Institute, SLAC National Accelerator Laboratory, 2575 Sand Hill Road, Menlo Park, CA 94025, USA What does airborne particulate matter look like? How do we develop quantitative descriptors for particles of complex morphology? These challenges were highlighted in the NIST workshop report "Aerosol Metrology Needs for Climate Science" (Dec, 2011). Sure, we can capture aerosol particles on surfaces - removing them from their airborne state - and probe them with high resolution optical and chemical imaging tools, but what information do we lose about the airborne particles? How can we follow dynamics? In this talk we will explore these very basic questions and their importance to combustion


Environmental Assessment for the Construction, Operation, and Closure of the Burma Road II Borrow Pit at the Savannah River Site  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Construction, Operation, and Closure of the Construction, Operation, and Closure of the Burma Road II Borrow Pit at the Savannah River Site Agency: U.S. Department of Energy Action: Finding of No Significant Impact Summary: The U.S. Department of Energy (DOE) has prepared an environmental assessment (EA) (DOE/EA-1501) to analyze the potential environmental impacts of a new borrow pit, and its alternatives, at the Savannah River Site (SRS), located near Aiken, South Carolina. Based on the analyses in the EA, DOE has determined that this action is not a major Federal action significantly affecting the quality of the human environment within the meaning of the National Environmental Policy Act of 1969 (NEPA). Therefore, the preparation of an environmental impact statement (EIS) is not

Note: This page contains sample records for the topic "dp road tract" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.



Office of Legacy Management (LM)

7At 7At a z'/a tlYr'/ ORNL/RASA-85/ 42 RESULTS OF RADIOLOGICAL MEASUREMENTS TAKEN NEAR JUNCTION OF HIGHWAY 3I AND MILITARY ROAD IN NIAGARA FALLSI NEI{ YOR Accesr to thc inlormalion in thlt rcport is limitcd to tho!. indacatod on the di3tribution lilt and to oopartmont ot Encrgy lnd Oeplrtmcnt of Enorgy Contracton vd' This report was prepared as an account of work sponsored by an agency of the U nited States Government. N€ither the U nited States Government nor any agency thereof, nor any of their employees, makes any warranty, express or implied' or assum€s any legal liability or responsibility for the accuracy, completeness' or usefulness of any information, apparatus, product, or process disclosed, or represents that its use would not inf ringe privately owned rights. Reference herein


Results of the radiological survey at the ALCOA Research Laboratory, 600 Freeport Road, New Kensington, Pennsylvania (ANK001)  

SciTech Connect

At the request of the US Department of Energy (DOE), a team from Oak Ridge National Laboratory conducted a radiological survey at the ALCOA Research Laboratory, 600 Freeport Road, New Kensington, Pennsylvania. The survey was performed on November 12, 1991. The purpose of the survey was to determine whether the property was contaminated with radioactive residues, principally [sup 238]U, as a result of work done for the Manhattan Engineer District in 1944. The survey included measurement of direct alpha and beta-gamma levels in the northeast comer of the basement of Building 29, and the collection of a debris sample from a floor drain for radionuclide analysis. The survey area was used for experimental canning of uranium slugs prior to production activities at the former New Kensington Works nearby.

Foley, R.D.; Brown, K.S.



Solar-energy-system performance-evaluation update: Wood Road School, Ballston Spa, New York, October 1982-April 1983  

SciTech Connect

The Wood Road School Solar Project is a 216,000 square foot combined elementary and middle school in Ballston Spa, New York. The solar energy system supplies energy to the space heating and domestic hot water subsystems. Heat is collected by flat plate collector panels and stored in two storage tanks. Performance data are given for the system overall and for each of the four subsystems - energy collection, storage, space heating, and domestic hot water. Data are also provided on operating energy, energy savings, and weather conditions. Design and actual system solar fraction are compared, and percentage of incident solar energy and collected solar energy utilized are given. Also given are building loads analysis, system thermal losses, and system coefficient of performance. (LEW)

Kendall, P



Multicomponent Remote Sensing of Vehicle Exhaust by Dispersive Absorption Spectroscopy. 2. Direct On-Road Ammonia Measurements  

Science Journals Connector (OSTI)

The quantitative ecological impacts resulting from anthropogenic NH3 emissions are still riddled with uncertainties, but evidence is mounting (28, 29) that dry and wet deposition of NH3 and its salts can adversely affect terrestrial (30?39) and aquatic (40?42) ecosystems. ... The vehicles in our study were travelling under load, due to the moderate incline of the on-ramp, and at high velocities, explaining the relatively high NO concentrations in the vehicle exhaust plumes. ... Between 1990 and 1998, vehicular NH3 emissions are believed to have increased from 198 to 260 thousand short tons (54), probably due to a reduction of the noncatalyst, oxidation catalyst, and dual-bed catalyst vehicle portion of the on-road fleet. ...

Marc M. Baum; Eileen S. Kiyomiya; Sasi Kumar; Anastasios M. Lappas; Vadym A. Kapinus; Harry C. Lord III



Biliary Tract Disease  

Science Journals Connector (OSTI)

Laparoscopic cholecystectomy is six years old. In this short period of time, it has created a veritable revolution in the surgical world. This swift conquest has been achieved by the pioneers of the method, th...

Jacques Prissat; David E. Pitcher; Daniel T. Martin



Mineral interactions and absorption in the equine digestive tract: calcium, phosphorus, and magnesium interaction with aluminum, and calcium digestibility of alfalfa in ponies  

E-Print Network (OSTI)

. Chromic oxide (. 2%) was used as an indicator to measure flow through the digestive tract. There was a significant decrease in Ca, P, and Ng intake (P&. 05) with the addition of . 25/o Al due to a reduction in feed intake. Increased dietary Al resulted... in lower fecal excretions for both Ca and Mg. Quantity of Ca and Mg absorbed was slightly greater when Al was added to the diet, however, only Mg absorption was statistically significant. A significantly greater net loss of P (P&. 05) was observed...

Kapusniak, Linda J.



On-road emission factors of PM pollutants for light-duty vehicles (LDVs) based on urban street driving conditions  

Science Journals Connector (OSTI)

An on-road sampling campaign was conducted on two major surface streets (Wilshire and Sunset Boulevards) in Los Angeles, CA, to characterize PM components including metals, trace elements, and organic species for three PM size fractions (PM102.5, PM2.50.25, and PM0.25). Fuel-based emission factors (mass of pollutant per kg of fuel) were calculated to assess the emissions profile of a light-duty vehicle (LDV) traffic fleet characterized by stop-and-go driving conditions that are reflective of urban street driving. Emission factors for metals and trace elements were highest in PM102.5 while emission factors for \\{PAHs\\} and hopanes and steranes were highest in PM0.25. PM2.5 emission factors were also compared to previous freeway, roadway tunnel, and dynamometer studies based on an LDV fleet to determine how various environments and driving conditions may influence concentrations of PM components. The on-road sampling methodology deployed in the current study captured substantially higher levels of metals and trace elements associated with vehicular abrasion (Fe, Ca, Cu, and Ba) and crustal origins (Mg and Al) than previous LDV studies. The semi-volatile nature of \\{PAHs\\} resulted in higher levels of \\{PAHs\\} in the particulate phase for LDV tunnel studies (Phuleria etal., 2006) and lower levels of \\{PAHs\\} in the particulate phase for freeway studies (Ning etal., 2008). With the exception of a few high molecular weight PAHs, the current study's emission factors were in between the LDV tunnel and LDV freeway studies. In contrast, hopane and sterane emission factors were generally comparable between the current study, the LDV tunnel, and LDV freeway, as expected given the greater atmospheric stability of these organic compounds. Overall, the emission factors from the dynamometer studies for metals, trace elements, and organic species are lower than the current study. Lastly, n-alkanes (C19C40) were quantified and alkane carbon preference indices (CPIs) were determined to be in the range of 12, indicating substantial anthropogenic source contribution for surface streets in Los Angeles.

Winnie Kam; James W. Liacos; James J. Schauer; Ralph J. Delfino; Constantinos Sioutas



USVI Energy Road Map: Charting the Course to a Clean Energy Future (Brochure), EDIN (Energy Development in Island Nations), U.S. Virgin Islands  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

USVI Energy Road Map Charting the Course to a Clean Energy Future EDIN Energy Development in Island Nations U.S. Virgin Islands EDIN Energy Development in Island Nations U.S. Virgin Islands EDIN Energy Development in Island Nations EDIN Energy Development in Island Nations U.S. Virgin Islands EDIN Energy Development in Island Nations EDIN Energy Development in Island Nations 1 USVI Energy Road Map Energy transformation. It's an enormous undertaking. One that has been discussed for decades. Debated hotly. Pursued intermittently. And supported halfheartedly in response to various short-lived crises. Until now. Today, the need to move beyond the status quo is driven not by "doom-and-gloom" predictions but by realities on the ground. The global economy is under constant threat as


USVI Energy Road Map: Charting the Course to a Clean Energy Future (Brochure), EDIN (Energy Development in Island Nations), U.S. Virgin Islands  

NLE Websites -- All DOE Office Websites (Extended Search)

USVI Energy Road Map Charting the Course to a Clean Energy Future EDIN Energy Development in Island Nations U.S. Virgin Islands EDIN Energy Development in Island Nations U.S. Virgin Islands EDIN Energy Development in Island Nations EDIN Energy Development in Island Nations U.S. Virgin Islands EDIN Energy Development in Island Nations EDIN Energy Development in Island Nations 1 USVI Energy Road Map Energy transformation. It's an enormous undertaking. One that has been discussed for decades. Debated hotly. Pursued intermittently. And supported halfheartedly in response to various short-lived crises. Until now. Today, the need to move beyond the status quo is driven not by "doom-and-gloom" predictions but by realities on the ground. The global economy is under constant threat as


FINAL LAYOUT_ 7-24-13dp.indd  

NLE Websites -- All DOE Office Websites (Extended Search)

IMPACTS ON SANDIA BIOSCIENCES IMPACTS ON SANDIA BIOSCIENCES B i o t h re a t s t o B i o f u e l s 2 S a n d i a N a t i o n a l L a b o r a t o r i e s From the Chief Technolog y Of ficer The LDRD Program Innovates for Sandia's Biosciences Mission T he face of Sandia's Biosciences program is undergoing dramatic change and growth as the role of this foundational area in U.S. national security becomes increasingly important, for example in the areas of new biothreat organisms (arising both naturally and through genetic engineering), and the exciting prospect of multiple potential routes for improving biofuel production. Simultaneously, the scope of biomedical knowledge itself continues its recent pattern of explosive growth. This state of affairs poses both an exciting opportunity and a major challenge to the Sandia Biosciences


C:\Forms\New Forms\dp741.CDR  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site



Pantex receives eight NNSA DP awards | National Nuclear Security...  

National Nuclear Security Administration (NNSA)

Program. The awards are given for significant achievements in quality, productivity, cost savings, safety or creativity in support of the nuclear weapons program. Read about the...


ERIA-DP-2011-03 ERIA Discussion Paper Series  

E-Print Network (OSTI)

: Current Status, Challenges and Way Forward* Xunpeng SHI* Economic Research Institute for ASEAN and East


DP awards showcase collaboration at NSC | National Nuclear Security...  

National Nuclear Security Administration (NNSA)

Spin Rolamite Harvesting and Reuse Team; B83 Alt353 Production Team; Common Tester Architecture Design Team; DLC Coating Development Team; Forgings Development Team; and Preflight...



Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

7 7 (07-97) Previous editions are obsolete. OMB Control No. 1910-1800 U.S. DEPARTMENT OF ENERGY Employee Relocation Income Tax (RIT) Allowance Certification (See Reverse for Instructions and Privacy Act Statement) 18 U.S.C. SECTION 1001; ACT OF JUNE 25, 1948; 62 STAT. 749; MAKES IT A CRIMINAL OFFENSE TO MAKE A WILLFULLY FALSE STATEMENT OR PRESENTATION TO ANY DEPARTMENT OR AGENCY OF THE UNITED STATES AS TO ANY MATTERS WITHIN ITS JURISDICTION. Printed with soy ink on recycled paper NAME: SOCIAL SECURITY NUMBER: I certify that the following information, which is to be used in calculating the RIT allowance to which I am entitled, has been (or will be) shown on the income tax returns filed (or to be filed) by me (or by my spouse and me) with the applicable Federal, State, and local tax authorities as specified below, for the year .


Risks in DP Shuttle Tanker Offloading Dr Haibo Chen  

E-Print Network (OSTI)

, China Dr. Sverre Haver, Mr. Harald Kleppestø Mr. Kjell Larsen Statoil, Norway Capt. Helge Samuelsen Mr. Arve Lerstad Ship Modelling and Simulation Centre Trondheim, Norway Prof. Torgeir Moan CeSOS, Dept. of Marine Technology NTNU, Trondheim, Norway Dr. Jan Erik Vinnem Preventor AS, Stavanger Mr. Kåre Breivik

Nørvåg, Kjetil


Integrated RS, GIS and GPS approaches to archaeological prospecting in the Hexi Corridor, NW China: a case study of the royal road to ancient Dunhuang  

Science Journals Connector (OSTI)

Abstract According to historic records, the wasteland northeast of modern Dunhuang oasis contains remarkable, undiscovered monuments of medieval courier stations. In this study, statistical analysis of historic records and census data, image processing and interpretation of satellite remote sensing images, GIS analysis, and field surveys were carried out to contribute to the discovery of courier stations and the reconstruction of the medieval royal road system from Guazhou to Shazhou. Firstly, in order to obtain the existence regions of courier stations, historic records and census data were abstracted and digitized, for generating preliminary regions of interest by using GIS tools. Secondly, dried river channels and traces of the Great Wall were extracted from the remote sensing images, and GIS buffer and overlay analyses were applied to the creation of prospective sub-areas. Thirdly, prospective sub-areas were mapped from very high resolution WorldView-2 images, and suspected sites were found based on the human-computer interactive interpretation. Fourthly, suspected sites were investigated on the GPS-based archaeological survey, and were confirmed as two courier stations based on the remains of Han-Tang period observed at sites' surface. Lastly, the royal road to ancient Dunhuang, one of the most important sections of the royal road system in the Hexi Corridor, was discussed and reconstructed with the combined application of remote sensing imagery and ground-truthing.

Lei Luo; Xinyuan Wang; Chuansheng Liu; Huadong Guo; Xiaocui Du



Genome-Wide Mapping of Cystitis Due to Streptococcus agalactiae and Escherichia coli in Mice Identifies a Unique Bladder Transcriptome That Signifies Pathogen-Specific Antimicrobial Defense against Urinary Tract Infection  

Science Journals Connector (OSTI)

...Urinary Tract Infection Editor: S. M. Payne Chee K. Tan a Alison J. Carey a Xiangqin Cui b c Richard I. Webb g Deepak Ipe a...2002. Relative expression software tool (REST) for group-wise comparison and statistical analysis of relative expression results...

Chee K. Tan; Alison J. Carey; Xiangqin Cui; Richard I. Webb; Deepak Ipe; Michael Crowley; Allan W. Cripps; William H. Benjamin Jr.; Kimberly B. Ulett; Mark A. Schembri; Glen C. Ulett



The state road map  

SciTech Connect

In the past year, electric industry restructuring has become a hot issue in virtually every state - not only those with high retail rates. So far this year, retail access legislation has been introduced in 23 states, and study bills have been introduced in another nine. Several of these states have already taken action. Oklahoma enacted the Electric Restructuring Act of 1997 in late April, mandating retail choice of generation suppliers by 2002, and legislatures in Maryland, Utah, Arkansas and Idaho adopted study bills. On the regulatory front, formal and substantive commission proceedings are moving forward in well over half the states. State legislatures and regulatory commissions around the country are keenly focused on those states which already enacted retail access legislation and are now slogging through the details of implementation. Even with new laws in place, heated debates on the issues surrounding both deregulation of generation and the evolution of the retail energy service market continue, and delays are possible. Retail energy service companies could begin competing for up to 20 million retail customers next year in Massachusetts, California, New Hampshire and Rhode Island, along with a significant number of new pilot-program customers in Pennsylvania and New York. This article gives a brief progress report on the states closest to retail choice.

Simon, K.M.; Vavro, S.L.; Shapiro, D.



The Road to Serfdom  

Science Journals Connector (OSTI)

... the best' at the time of the middle Roman Empire. The aristocratic quality of liberty, such as Signor Croce applauds, is at a discount. Prof. Hayek reminds Englishmen ... now lost confidence. He quotes Milton: "They who seek nothing but their own just liberty have always the right to win it". Milton adds, "wherever they have the ...



Note: This page contains sample records for the topic "dp road tract" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.



NLE Websites -- All DOE Office Websites (Extended Search)

approach for the implementation of the system is a scalable, dis- tributed, service-oriented architecture. The framework combines information from different kinds of measure-...


Road Traffic Signalling  

Science Journals Connector (OSTI)

... of the speakers suggested that the amber light should be regarded as the signal for pedestrians. Much was said in favour of a gyratory system being adopted in Oxford Circus. ... times of the day, although the green lights are showing, by the crowds of pedestrians in Oxford Street. A model for the automatic control of signals at crossings was ...



Valley Road University Drive  

E-Print Network (OSTI)

WATER AND ENVIRONMENTAL SCIENCE BUILDING (WE) THE BREEZEWAY THE GROVE THE QUAD UNIVERSITY HALL (UH and Teaching (Trading Room) · Faculty of Health Sciences · Faculty of Management · Simulation Health Centre Centre · Science Labs · Subway · The Urban Market · Tim Hortons · University of Calgary Faculty of Social

Seldin, Jonathan P.


KALELE ROAD Annexes 913  

E-Print Network (OSTI)

Wist Hall KHET TV/ PBS Hawai`i Dean Hall Hawai`i Hall Crawford Hall Architecture School Gartley Hall Path Dole Street Parking Structure Bus Shelter Bus Shelter Art Building Sustainability Courtyard


KALELE ROAD Parking Office  

E-Print Network (OSTI)

`i Dean Hall Hawai`i Hall Crawford Hall Architecture School Gartley Hall Saunders Hall Queen Lili Bus Shelter Bus Shelter Art Building Sustainability Courtyard Kuykendall Hall Campus Center Jakuan Tea



E-Print Network (OSTI)

Bicycle path Traffic light Underpass Barrier-free parking available in all lots Roadway barrier LTC city Lawson Hall University College Somerville House 3M Centre Thames Hall HBA Building Music Building Talbot 2204 2130 C 2130 B 10 25 Elborn College Richard Ivey Building Physics & Astronomy Building Thames Hall

Sinnamon, Gordon J.


The Road to REDD  

Science Journals Connector (OSTI)

Carbon markets, already in place for industrial emissions, work like this: industries or other polluters in developed countries pay companies or communities in developing countries to reduce emissions. ... Moskovits and her colleagues in Peru received funds from the utility company Exelon to figure out how a REDD project could be implemented in the region. ... But for most people who think and breathe REDD, the real deadline is next years climate change conference in Copenhagen (often called COP-15), where leaders are hoping to formalize an agreement on how to move forward with this mechanism. ...

Rhitu Chatterjee



The Road to Quasars  

E-Print Network (OSTI)

Although the extragalactic nature of 3C 48 and other quasi stellar radio sources was discussed as early as 1960 by John Bolton and others, it was rejected largely because of preconceived ideas about what appeared to be unrealistically high radio and optical luminosities. Not until the 1962 occultations of the strong radio source 3C 273 at Parkes, which led Maarten Schmidt to identify 3C 273 with an apparent stellar object at a redshift of 0.16, was the true nature understood. Successive radio and optical measurements quickly led to the identification of other quasars with increasingly large redshifts and the general, although for some decades not universal, acceptance of quasars as the very luminous nuclei of galaxies. Curiously, 3C 273, which is one of the strongest extragalactic sources in the sky, was first cataloged in 1959 and the magnitude 13 optical counterpart was observed at least as early as 1887. Since 1960, much fainter optical counterparts were being routinely identified using accurate radio inte...

Kellermann, K I



The road not chosen  

Science Journals Connector (OSTI)

Analysis of data for historical consumption of the most important energy sources and carbon emission leads to a method to calculate the carbon emission with another fuel mix than the actual one. It is shown that a continued growth of nuclear power could have replaced the whole Kyoto process.

Bertel Lohmann Andersen



Localisation of freight consolidation centres serving small road hauliers in a wider urban area: barriers for more efficient freight deliveries in Gothenburg  

Science Journals Connector (OSTI)

Abstract This paper discusses the negative impacts of freight transport growth, especially in and around urban areas. Over time, a growing number of road freight vehicles have delivered less freight over longer distances, while average load factors have been reduced. This development is unsatisfactory, as transport capacity that could have been used more efficiently is lost. To mitigate negative impact, it has been suggested that freight consolidation and better planned localisation of freight consolidation centres (FCCs) would improve city logistics. Based on primary data, this paper investigates the potential to establish urban \\{FCCs\\} intended for small road hauliers (SRHs) delivering goods to the retail sector in a wider geographical area, the Gothenburg region in Sweden. While the findings show that a large majority of \\{SRHs\\} could reach potential FCC locations in a short time, congestion affects deliveries and several factors, many of which were observed already in the 1970s, restrict FCC establishments. Under present conditions, there is little scope for \\{SRHs\\} to successfully deliver goods to retailers in the Gothenburg region from FCCs; therefore, a more efficient urban transport system from a business or societal perspective is unlikely. Policy makers need to take into consideration the different segments, requirements, and characteristics of different cities before venturing into costly FCC projects.

Jerry Olsson; Johan Woxenius



215 Euston Road London NW1 2BE UK T +44 (0)20 7611 8888 F +44 (0)20 7611 8545 E contact@wellcome.ac.uk  

E-Print Network (OSTI)

fossil fuels leads to almost $120 billion in health costs per year. Most of those costs are premature consequences too. Relying on fossil fuels leads to unhealthy lifestyles, increases our chances of getting sick Euston Road, London NW1 2BE, UK. Health benefits of reducing greenhouse gas emissions Kathleen Sebelius

Rambaut, Andrew


On-Road Motor Vehicle Emissions including Ammonia, Sulfur Dioxide and Nitrogen Dioxide Don Stedman, Gary Bishop, Allison Peddle, University of Denver Department of Chemistry and Biochemistry Denver CO 80208. www.feat.biochem.du.edu  

E-Print Network (OSTI)

On-Road Motor Vehicle Emissions including Ammonia, Sulfur Dioxide and Nitrogen Dioxide Don Stedman Nitrogen dioxide: Less than 5% of the NOx BUT with an outstanding peak for the 2007 MY in Fresno 0. Nitrogen dioxide: less than 5% of NOx except the Fresno fleet containing the 2007 Sprinter ambulances. #12;

Denver, University of


Results of the radiological survey at the ALCOA Research Laboratory, 600 Freeport Road, New Kensington, Pennsylvania (ANK001). Environmental Restoration and Waste Management Non-Defense Programs  

SciTech Connect

At the request of the US Department of Energy (DOE), a team from Oak Ridge National Laboratory conducted a radiological survey at the ALCOA Research Laboratory, 600 Freeport Road, New Kensington, Pennsylvania. The survey was performed on November 12, 1991. The purpose of the survey was to determine whether the property was contaminated with radioactive residues, principally {sup 238}U, as a result of work done for the Manhattan Engineer District in 1944. The survey included measurement of direct alpha and beta-gamma levels in the northeast comer of the basement of Building 29, and the collection of a debris sample from a floor drain for radionuclide analysis. The survey area was used for experimental canning of uranium slugs prior to production activities at the former New Kensington Works nearby.

Foley, R.D.; Brown, K.S.



Curecanti-Blue Mesa-Salida 115-kV transmission lines access roads rehabilitation, maintenance, and construction project. Environmental Assessment  

SciTech Connect

Western Area Power Administration (Western) is a power marketing agency of the US Department of Energy, with jurisdiction in 15 western states. The Salt Lake City Area (SLCA) of Western performs the agency`s mission in parts of Colorado, New Mexico, Texas, Utah, Arizona, Wyoming, and Nevada. As part of its mission, Western owns, operates, and maintains a system of transmission lines for transmitting bulk electrical energy from points of generation to and between delivery points. Part of that system in southwestern Colorado includes the Blue Mesa-Curecanti and Blue Mesa-Salida 115-kV transmission lines. Western proposes to conduct maintenance and improve its access roads for these two transmission lines. This paper discusses the impacts to the existing environment as well as the environmental consequences resulting from the maintenance and construction that is proposed.

Not Available



Polycyclic aromatic hydrocarbons in road-deposited sediments, water sediments, and soils in Sydney, Australia: Comparisons of concentration distribution, sources and potential toxicity  

Science Journals Connector (OSTI)

Abstract Sixteen polycyclic aromatic hydrocarbons (PAHs) considered as priority environmental pollutants were analysed in surface natural soils (NS), road-deposited sediments (RDS), and water sediments (WS) at Kogarah in Sydney, Australia. Comparisons were made of their concentration distributions, likely sources and potential toxicities. The concentrations (mg/kg) in NS, RDS, and WS ranged from 0.40 to 7.49 (mean 2.80), 1.65 to 4.00 (mean 2.91), and 0.49 to 5.19 (mean 1.76), respectively. \\{PAHs\\} were dominated by relatively high molecular weight compounds with more than three fused benzene rings, indicating that high temperature combustion processes were their predominant sources. The proportions of high molecular weight \\{PAHs\\} with five or six fused benzene rings were higher in NS than in RDS, whereas the low molecular weight \\{PAHs\\} were higher in RDS. Concentrations of all \\{PAHs\\} compounds were observed to be the lowest in WS. The concentrations of most of the high molecular weight \\{PAHs\\} significantly correlated with each other in RDS and WS. All \\{PAHs\\} (except naphthalene) were significantly correlated in NS suggesting a common PAH source. Ratios for individual diagnostic \\{PAHs\\} demonstrated that the primary source of \\{PAHs\\} in WS and NS was of pyrogenic origin (combustion of petroleum (vehicle exhaust), grass, and wood) while in RDS it was petrogenic (i.e. unburned or leaked fuel and oil, road asphalt, and tyre particles) as well as pyrogenic. The potential toxicities of \\{PAHs\\} calculated using a toxicity equivalent quotient (TEQ) were all low but higher for NS compared to WS and RDS.

Thuy Chung Nguyen; Paripurnanda Loganathan; Tien Vinh Nguyen; Saravanamuthu Vigneswaran; Jaya Kandasamy; Danny Slee; Gavin Stevenson; Ravi Naidu



Short term accommodation and Bed and Breakfasts  

E-Print Network (OSTI)

hotels in central London. *Premier Inn County Hall Belvedere Road London SE1 7PB Website: http.indianymca.org Journey's ­ Kings Cross 54 ­ 58 Caledonian Road Kings Cross London N1 9DP Tel: 020 7833 3893 http.dovercastlehostel.com Ashlee House 261 ­ 265 Grays Inn Road Kings Cross London WC1X 8QT Tel: 020 7833 9400 Fax: 020 7833 9677

Kühn, Reimer


Uranium Lease Tracts Location Map  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site




E-Print Network (OSTI)

) in percentage. ............................................ 121 1 I. INTRODUCTION I.A. Statement of problem The diesel engine plays a vital role in transportation, power generation, farming, construction and industrial activities. The primary advantages... that are capable of collecting duty-cycle data and yield a more accurate emission profile. Historically the air emission contributions from off-road vehicles have been overlooked since this equipment tends to be small in number and their use is generally...

Guerra, Sergio



Preparation of the First Shipment of Transuranic Waste by the Los Alamos National Laboratory: A Rest Stop on the Road to WIPP  

SciTech Connect

The Los Alamos National Laboratory (LANL) achieved a national milestone on the road to shipping transuranic (TRU) waste to the Waste Isolation Pilot Plant (WIPP) when it received certification authority on September 12, 1997. Since that time, LANL has been characterizing a non-mixed TRU waste stream and preparing shipments of this TRU waste for disposal in the WIPP. The paper describes the TRU waste identified as waste stream TA-55-43 Lot No. 01 from LANL Technical Area-55 and the process used to determine that it does not contain hazardous waste regulated by the Resource Conservation Recovery Act (RCRA) or the New Mexico Hazardous Waste Act (HWA). The non-mixed determination is based on the acceptable knowledge (AK) characterization process, which clearly shows that the waste does not exhibit any RCRA characteristics nor meet any RCRA listing descriptions. LANL has certified TRU waste from waste stream TA-55-43 Lot No. 01 and is prepared to certify additional quantities of TRU waste horn other non-mixed TRU waste streams. Assembly and preparation of AK on the processes that generated TRU waste is recognized as a necessary part of the process for having waste ready for shipment to the WIPP.

Allen, G.; Barr, A.; Betts, S.E.; Farr, J.; Foxx, J.; Gavett, M.A.; Janecky, D.R.; Kosiewicz, S.T.; Liebman, C.P.; Montoya, A.; Poths, H.; Rogers, P.S.Z.; Taggart, D.P.; Triay, I.R.; Vigil, G.I.; Vigil, J.J.; Wander, S.G.; Yeamans, D.



Regulated and Unregulated Exhaust Emissions Comparison for Three Tier II Non-Road Diesel Engines Operating on Ethanol-Diesel Blends  

SciTech Connect

Regulated and unregulated emissions (individual hydrocarbons, ethanol, aldehydes and ketones, polynuclear aromatic hydrocarbons (PAH), nitro-PAH, and soluble organic fraction of particulate matter) were characterized in engines utilizing duplicate ISO 8178-C1 eight-mode tests and FTP smoke tests. Certification No. 2 diesel (400 ppm sulfur) and three ethanol/diesel blends, containing 7.7 percent, 10 percent, and 15 percent ethanol, respectively, were used. The three, Tier II, off-road engines were 6.8-L, 8.1-L, and 12.5-L in displacement and each had differing fuel injection system designs. It was found that smoke and particulate matter emissions decreased with increasing ethanol content. Changes to the emissions of carbon monoxide and oxides of nitrogen varied with engine design, with some increases and some decreases. As expected, increasing ethanol concentration led to higher emissions of acetaldehyde (increases ranging from 27 to 139 percent). Benzene emissions were reduced by up to 50 percent with the ethanol-blended fuels. Emissions of 1,3-butadiene were also substantially decreased, with reductions ranging from 24 to 82 percent. Isolated trends were noted for certain PAHs. There was a decrease in 1-nitropyrene with use of ethanol in all cases. Particulate phase 1-nitropyrene was reduced from 18 to 62 percent. There was also a general increase in the proportion of heavy PAHs in the particulate phase with ethanol use, and although less pronounced, a general decrease in light PAHs in the particulate phase.

Merritt, P. M.; Ulmet, V.; McCormick, R. L.; Mitchell, W. E.; Baumgard, K. J.


Note: This page contains sample records for the topic "dp road tract" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Radiological characterization survey of the former Diamond Magnesium Company Company site, 720 Fairport-Nursery Road, Painesville, Ohio (DMP001, DMP002)  

SciTech Connect

At the request of the US Department of Energy (DOE), a group from Oak Ridge National Laboratory performed an investigative radiological survey at the former Diamond Magnesium Company (DMC) site at 720 Fairport-Nursery Road, Painesville, Ohio, in September 1990. The purpose of the survey was to determine if the site is contaminated with radioactive residues as a result of federal government operation in the development of nuclear energy for defense-related projects. The survey of the site, separate parcels of which are currently owned by the Uniroyal Chemical Company (DMP001) and the Lonza Chemical Company (DMP002), included a gamma scan over the ground surface, determination of gamma exposure rates at the surface and at 1 m above the surface at grid points, collection and radionuclide analysis of soil samples, and directly measured radiation levels inside three buildings used during original DMC processing. Results of the survey revealed widespread radiological contamination outdoors on the Uniroyal property and several isolated spots of elevated radiation levels on the Lonza property. The contaminants consisted of radium, uranium, and thorium in surface and subsurface soil in concentrations exceeding DOE guidelines for the release of property for unrestricted use.

Foley, R.D.; Carrier, R.F.



DOE/EIS-0293 Final Environmental Impact Statement for the Conveyance and Transfer of Certain Land Tracts Administered by the U.S. Department of Energy and Located at Los Alamos National Laboratory, Los Alamos and Santa Fe Counties, New Mexico (Oct. 1999)  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

A-1 A-1 Final CT EIS APPENDIX A PUBLIC LAW 105-119 This appendix contains the text of Public Law 105-119, which was passed by Congress on November 26, 1997. Public Law 105-119, the "Departments of Commerce, Justice, and State, the Judiciary, and Related Agencies Appropriations Act," 1998 (section 632, 42 United States Code [U.S.C.] §§2391; "the Act"), directs the DOE to convey or transfer parcels of DOE land in the vicinity of LANL to the Incorporated County of Los Alamos, New Mexico, and the Secretary of the Interior, in trust for the Pueblo of San Ildefonso. The Act sets forth the criteria, processes and dates by which the tracts will be selected, titles to the tracts reviewed, environmental issues evaluated, and decisions made as to the allocation of the tracts between the


Laboratory to demolish excavation enclosures at Material Disposal Area B  

NLE Websites -- All DOE Office Websites (Extended Search)

Excavation Enclosures At MDA B Excavation Enclosures At MDA B Laboratory to demolish excavation enclosures at Material Disposal Area B near DP Road Pre-demolition activities are beginning this week and the work should be completed by the end of March 2013. November 1, 2012 The Laboratory plans to demolish the enclosures used to safely excavate and clean up the Lab's oldest waste disposal site near DP Road in Los Alamos. The Laboratory plans to demolish the enclosures used to safely excavate and clean up the Lab's oldest waste disposal site near DP Road in Los Alamos. Contact Communications Office (505) 667-7000 "We look forward to the day we officially turn the property over for the benefit of our community." Work is beginning this week LOS ALAMOS, New Mexico, November 1, 2012-Los Alamos National Laboratory


Laboratory to demolish excavation enclosures at Material Disposal Area B  

NLE Websites -- All DOE Office Websites (Extended Search)

Excavation enclosures at MDA B Excavation enclosures at MDA B Laboratory to demolish excavation enclosures at Material Disposal Area B near DP road Pre-demolition activities are beginning this week and the work should be completed by the end of March 2013. November 1, 2012 The Laboratory plans to demolish the enclosures used to safely excavate and clean up the Lab's oldest waste disposal site near DP Road in Los Alamos. The Laboratory plans to demolish the enclosures used to safely excavate and clean up the Lab's oldest waste disposal site near DP Road in Los Alamos. Contact Colleen Curran Communications Office (505) 664-0344 Email "We look forward to the day we officially turn the property over for the benefit of our community." Work is beginning this week LOS ALAMOS, New Mexico, November 1, 2012-Los Alamos National Laboratory


Laboratory to demolish excavation enclosures at Material Disposal Area B  

NLE Websites -- All DOE Office Websites (Extended Search)

Excavation Enclosures At MDA B Excavation Enclosures At MDA B Laboratory to demolish excavation enclosures at Material Disposal Area B near DP Road Pre-demolition activities are beginning this week and the work should be completed by the end of March 2013. November 1, 2012 The Laboratory plans to demolish the enclosures used to safely excavate and clean up the Lab's oldest waste disposal site near DP Road in Los Alamos. The Laboratory plans to demolish the enclosures used to safely excavate and clean up the Lab's oldest waste disposal site near DP Road in Los Alamos. Contact Communications Office (505) 667-7000 "We look forward to the day we officially turn the property over for the benefit of our community." Work is beginning this week LOS ALAMOS, New Mexico, November 1, 2012-Los Alamos National Laboratory


Variation in indoor particle number and PM2.5 concentrations in a radio station surrounded by busy roads before and after an upgrade of the HVAC system  

Science Journals Connector (OSTI)

Indoor particle number and PM2.5 concentrations were investigated in a radio station surrounded by busy roads. Two extensive field measurement campaigns were conducted to determine the critical parameters affecting indoor air quality. The results indicated that indoor particle number and PM2.5 concentrations were governed by outdoor air, and were significantly affected by the location of air intake and design of HVAC system. Prior to the upgrade of the HVAC system and relocation of the air intake, the indoor median particle number concentration was 7.4103particles/cm3 and the median PM2.5 concentration was 7?g/m3. After the relocation of air intake and the redesign of the HVAC system, the indoor particle number concentration was between 2.3103 and 3.4103particles/cm3, with a median value of 2.7103particles/cm3, and the indoor PM2.5 concentration was in the range of 35?g/m3, with a median value of 4?g/m3. By relocating the air intake of the HVAC, the outdoor particle number and PM2.5 concentrations near the air intake were reduced by 35% and 55%, respectively. In addition, with the relocation of air intake and the redesign of the HVAC system, the particle number penetration rate was reduced from 42% to 14%, and the overall filtration efficiency of the HVAC system (relocation of air intake, pre-filter, AHU and particle losses in the air duct) increased from 58% to 86%. For PM2.5, the penetration rate after the upgrade was approximately 18% and the overall filtration efficiency was 82%. This study demonstrates that by using a comprehensive approach, including the assessment of outdoor conditions and characterisation of ventilation and filtration parameters, satisfactory indoor air quality can be achieved, even for those indoor environments facing challenging outdoor air conditions.

L. Morawska; M. Jamriska; H. Guo; E.R. Jayaratne; M. Cao; S. Summerville



The Bumpy Road to Hydrogen  

E-Print Network (OSTI)

in the cost of hydrogen production, distribution, and use.accelerate R&D of zero-emission hydrogen production methods.Renewable hydrogen production is a key area for focused

Sperling, Dan; Ogden, Joan M




E-Print Network (OSTI)

electricity usage accounts for roughly 22% of the overall energy consumption within the US. Air conditioning use is due to the inefficiencies of your average home air conditioning unit. Though there are many alternative air conditioning options to reduce energy consumption for homes, they have yet to be adopted

California at Davis, University of


KALELE ROAD D Dormitory Lot  

E-Print Network (OSTI)

Wist Hall KHET TV/ PBS Hawai`i Dean Hall Hawai`i Hall Crawford Hall Architecture School Gartley Hall Shelter Art Building Sustainability Courtyard Kuykendall Hall UH Bookstore Jakuan Tea House Sinclair


Chevron 2005 The Road to  

E-Print Network (OSTI)

's reputation as a leader in fuel processing #12;3© Chevron 2005 Chevron Hydrogen Energy Stations #12;4© Chevron 2005 Integrated Hydrogen Energy Stations: Scalable, Distributed Manufacturing Technology Convergence Reformate to PSA Combustor Air Combustor Exhaust PSA Off-gas Water Natural Gas 1.6 m 2.0 m 0.2 m Process



E-Print Network (OSTI)

Rozelle Glebe Forest Lodge Newtown Petersham Camperdown Annandale Stanmore Enmore Erskineville Lily eld Leichhardt Redfern Waterloo Surry Hills Chippendale Ultimo City Pyrmont Port Jackson Darling Harbour White

Viglas, Anastasios


Road Design TTP Orientation Seminar  

E-Print Network (OSTI)

.0 New Jersey 10.5 4.0 14.5 32.9 Alaska 8.0 0 8.0 26.4 US Average diesel 24.4 53.6 * (general sales tax Engineers (ITE) ­ American Association of State Highway and Transportation Officials (AASHTO) #12;http

Handy, Susan L.


Low Road to the Heavens  

Science Journals Connector (OSTI)

...acuity limited only by the size of its mirror and the quickness of its pointing apparatus. If technological...skyward. Nearly a century later, Martin Schwarzschild's Stratoscope instruments captured...target image down to the resolution of the mirror at a speed of up to 30 adjustments per...

Mark Anderson



Murdoch University Dixon Road, Rockingham  

E-Print Network (OSTI)

. These research themes comprise: pre-treatment, reverse osmosis desalting, novel desalting Evaluation of non-chemical pulsed power technology as an antifouling pre- treatment for reverse osmosis-treatment process for reverse osmosis desalination Prof. Linda Zou, University of South Australia


The Bumpy Road to Hydrogen  

E-Print Network (OSTI)

will trump hydrogen and fuel cell vehicles. Advocates ofbenefits sooner than hydrogen and fuel cells ever could.emissions from a hydrogen fuel cell vehicle will be about

Sperling, Dan; Ogden, Joan M



TIMCHAMPION 11055 Painted Tree Road  

E-Print Network (OSTI)

).The solution is then extracted with carbon tetrachloride, and the I2 concentra- tion in the nonpolar to the halogenated solvents used in this ex- periment. At first we simply replaced carbon tetrachloride kith what we are identified by extraction into carbon tetrachloride.. Safety It is important to realize that substituting p

Bodner, George M.


Gas Pipelines, County Roads (Indiana)  

Energy.gov (U.S. Department of Energy (DOE))

A contract with any Board of County Commissioners is required prior to the construction of a pipeline, conduit, or private drain across or along any county highway. The contract will include terms...


OxfordRoadOxfordRoadOxfordRoad UpperBrookStreetUpperBrookStreet  

E-Print Network (OSTI)

West Whitworth Street Fairfield Street Charles Street Charles St Altrincham Street Mancunian Way St OXFORD RD STATION OXFORD RD STATION PICCADILLY TRAIN STATION AND METROLINK BBC CITY CENTRE, Platt Church of England 47. Platt Fields Park, open space with a lake. 48. Allen Hall 49. The Islah


DOE/EIS-0293 Final Environmental Impact Statement for the Conveyance and Transfer of Certain Land Tracts Administered by the U.S. Department of Energy and Located at Los Alamos National Laboratory, Los Alamos and Santa Fe Counties, New Mexico (Oct. 1999)  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

293 293 Final Environmental Impact Statement for the Conveyance and Transfer of Certain Land Tracts Administered by the U.S. Department of Energy and Located at Los Alamos National Laboratory, Los Alamos and Santa Fe Counties, New Mexico October 1999 U.S. Department of Energy Los Alamos Area Office Los Alamos, New Mexico THE FINAL ENVIRONMENTAL IMPACT STATEMENT FOR THE CONVEYANCE AND TRANSFER OF CERTAIN LAND TRACTS ADMINISTERED BY THE U.S. DEPARTMENT OF ENERGY AND LOCATED AT LOS ALAMOS NATIONAL LABORATORY, LOS ALAMOS AND SANTA FE COUNTIES, NEW MEXICO Section 102 (c) of the National Environmental Policy Act (NEPA) states that all Federal agencies shall prepare a detailed statement for major Federal actions significantly affecting the quality of the human environment. The U.S. Department of Energy (DOE) published the Conveyance and


(DOE/EIS-0128-SA-02): Supplement Analysis: Los Banos-Gates (Path 15) Transmission line project changes to alignment, access road stream crossing, and basis for Supplemental EIS Determination  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Los Banos-Gates (Path 15) Transmission Line Project DOE/EIS-0128-SA02 Western Area Power Administration Sierra Nevada Customer Service Region U.S. Department of Energy Changes to Alignment, Access Road Stream Crossing, and Basis for Supplemental Environmental Impact Statement Determination Background The Los Banos-Gates 500-kilovolt Transmission Line project was originally proposed as part of the California-Oregon Transmission Project in the 1980s. These two projects were the subject of a single set of documents prepared in 1986 (draft) and 1988 (final) that served as the Environmental Impact Statement (EIS) under the National Environmental Policy Act and the Environmental Impact Report (EIR) under the California Environmental Quality Act. The EIS is entitled "Final Environmental Impact