National Library of Energy BETA

Sample records for document mailings publication

  1. Classification Documents and Publications

    Broader source: Energy.gov [DOE]

    Certain documents and publications created or issued by the Office of Classification are available from this page.

  2. Archived Publications and Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Archived Publications and Documents Print ALS 20-Year Roadmap, 2003 Presentations made to the BESAC subcommittee on the 20-Year BES Facilities Roadmap, with references and relevant...

  3. Archived Publications and Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Archived Publications and Documents Print ALS 20-Year Roadmap, 2003 Presentations made to the BESAC subcommittee on the 20-Year BES Facilities Roadmap, with references and relevant links. Beamline Data Sheets Data sheets for individual ALS beamlines. The Atomic and Molecular Facility on Beamline 10.0.1 A guide to Beamline 10's facilities for general users studying atomic and molecular physics. (LBL PUB-832) World Class Protein Crystallography A guide to the facilities and capabilities of the

  4. Project Management Publications & Documents | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Publications & Documents Project Management Publications & Documents << Return to Directives & Documents | Proceed to Policy & Guidance >> Filter by Source Filter by Topic

  5. Documents and Publications | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Documents and Publications Documents and Publications Real Estate Documents Acquisition Guide for Federal Agencies Certified Reality Specialist Biography DOJ Title Standards for Acquisition

  6. Public Reading Room: Environmental Documents, Reports

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Public Reading Room: Environmental Documents, Reports Public Reading Room: Environmental Documents, Reports Environmental documents and reports are available online. Hard copies...

  7. Documents and Publications | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Documents and Publications Documents and Publications Real Estate Documents Acquisition Guide for Federal Agencies Certified Reality Specialist Biography DOJ Title Standards for ...

  8. Documents and Publications | Department of Energy

    Office of Environmental Management (EM)

    Documents and Publications Documents and Publications CERF Independent Research Assessment of Project Management (pdf) - the Civil Engineering Research Foundation (CERF) conducted ...

  9. Public Reading Room: Environmental Documents, Reports

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Public Reading Room: Environmental Documents, Reports Public Reading Room: Environmental Documents, Reports Environmental documents and reports are available online. Hard copies are available at the Laboratory's Public Reading Room in Pojoaque, New Mexico. Contact Environmental Communication & Public Involvement P.O. Box 1663 MS M996 Los Alamos, NM 87545 (505) 667-0216 Email Public Reading Room: Environmental Documents, Reports Online Annual Environmental Report Electronic Public Reading

  10. ARM - Publications: Science Team Meeting Documents: Publication...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Publication Trends of ARM Research Troyan, David Brookhaven National Laboratory This study summarizes the publication record of ARM research. Items of all types listed in the ARM ...

  11. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    and teachers is under development. The collection will contain a publicly available software repository of well-documented source code. This will allow for students and faculty...

  12. Paducah Public Documents | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Community Outreach » Paducah Public Documents Paducah Public Documents Paducah Key Regulatory Documents Paducah Federal Facility Agreement - The Federal Facility Agreement (FFA) governs the corrective action/response action process from site investigation through site remediation as agreed to by DOE, the U.S. Environmental Protection Agency, and Kentucky under the Comprehensive Environmental Response, Compensation, and Liability Act; the Resource Conservation and Recovery Act; Kentucky Revised

  13. Portsmouth Public Documents | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Outreach » Portsmouth Public Documents Portsmouth Public Documents Portsmouth Site Regulatory Agreements & Orders Ohio Consent Decree requires DOE to complete investigations to determine the nature and extent of any environmental contamination that exists at the Portsmouth Site, complete cleanup alternative studies, and implement corrective actions as needed. Portsmouth Administrative Consent Order ensures compliance by DOE at the Portsmouth Site with the Resource Recovery and Compensation

  14. Local public document room directory. Revision 7

    SciTech Connect (OSTI)

    1998-04-01

    This directory (NUREG/BR-0088, Revision 7) lists local public document rooms (LPDRs) for commercial nuclear power plants with operating or possession-only licenses or under construction, plus the LPDRs for potential high-level radioactive waste repository sites, gaseous diffusion plants, certain fuel cycle facilities, certain low-level waste disposal facilities, and any temporary LPDRs established for the duration of licensing proceedings. In some instances, the LPDR libraries maintain document collections for more than one licensed facility. The library staff members listed are the persons most familiar with the LPDR collections. Reference librarians in the NRC Headquarters Public Document Room (PDR) are also available to assist the public in locating NRC documents.

  15. Field Facilities Contacts for Printing and Mail | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Field Facilities Contacts for Printing and Mail Field Facilities Contacts for Printing and Mail This is the list of DOE field facilities contacts for Printing and Mail as of April 27, 2011. Go to Mail Services Go to Printing Services PDF icon Field_Facilities_Contacts_Print-Mail.pdf More Documents & Publications Director's Perspective by George Miller Tenant Education and Training Fire Safety Committee Membership List

  16. Document

    National Nuclear Security Administration (NNSA)

    ... public comments on this matter submitted by May 18, 2007. ADDRESSES: Comments should be submitted electronically via the Web at http:web.ead.anl.govuranium or by regular mail. ...

  17. Historical Document Released for Public Availability

    Office of Scientific and Technical Information (OSTI)

    Cover Sheet for a Hanford Historical Document Released for Public Availability Released 1994 Prepared for the U.S. Department of Energy under C o n t r a c t DE-AC06-76RlQ 1830 Pacific Northwest laboratory Operated for the U.S Department of Energy by Battelle Memorial Institute . . . *-' M I S S I O N OR REVELATION O F W H I C H I N ANY MANNER TO AN UNAUTHORIZED PERSON I S PROHIBITED BY LAW. I C ADDIT I 1 I I I I I I I I 64-5100-166 (10-6S) AEC-*LO0 RICHLAND. WAYH. (CLASSIFICATION) DISCLAIMER --

  18. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Hourly observations of 6.7 micron water vapor radiances from geostationary satellites are combined with radiosonde observations and Raman lidar measurements to document the diurnal...

  19. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    involves ARM's task management tools: Engineering Change RequestOrder, Baseline Change Request, Data Object DesignBirth of a Data Stream, eXternal Data Stream documentation. ...

  20. Request from City of Alexandria for Public Disclosure of Documents...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    EO-05-01 More Documents & Publications Comments on Department of Energy's Emergency Order To Resume Limited Operation at Mirant's Potomac River Generating Station and Proposed ...

  1. Document

    National Nuclear Security Administration (NNSA)

    60017 Federal Register / Vol. 76, No. 188 / Wednesday, September 28, 2011 / Notices 1 Enforcement of Statutes, Orders, Rules, and Regulations, 132 FERC ¶ 61,216 (2010). Persons who wish to comment only on the environmental review of this project should submit an original and two copies of their comments to the Secretary of the Commission. Environmental commentors will be placed on the Commission's environmental mailing list, will receive copies of the environmental documents, and will be

  2. Document

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ... E-mail comments must be sent to emilyslistrepeal@fec.gov. If e- mail comments include an attachment, the attachment must be in either Adobe Acrobat (.pdf) or Microsoft Word (.doc) ...

  3. Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Documents Documents Sort by: Default | Name | Date (low-high) | Date (high-low) | Source | Category White Paper Template May 7, 2015 | Download File: HEP-White-Papers-Public2.pdf | pdf | 78 KB Download File: ASCRHEPReqRevWPtemplate.docx | docx | 136 KB HEP Exascale Requirements Review Case Study Template June 2, 2015 | Download File: CaseStudyTemplate-HEPrev.docx | docx | 28 KB HEP Exascale Requirements Review Case Study Template Last edited: 2016-04-29 11:34:52

  4. Mailing List Subscription

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mail and Distribution Mail and Distribution The DOE Mail Center provides a variety of mail services for all official and other authorized mail for the Department of Energy and its employees. The services provided include the processing of all incoming postal mail, outgoing official mail, internal mail processing, accountable mail processing, pouch mail, a variety of overnight express mail services, directory services, and pick-up and delivery services. The Mail Management Memorandum (pdf)

  5. Document

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    90, Oak Ridge, TN 37831. Phone (865) 576-4025; Fax (865) 576-2347 or e-mail: halseypj@oro.doe.gov or check the Web site at http:www.oakridge.doe.govem ssab. SUPPLEMENTARY...

  6. Document

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    of Electricity Delivery & Energy Reliability (Mail Code OE-20), U.S. Department of ... will not adversely impact on the reliability of the U.S. electric power supply system. ...

  7. Enron Documents

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    f Enron Documents 1994 U.S. DEPARTMENT OF ENERGY 13S. 12 CORRESPONDENCE CONTROL FORM 1) OFFICE OF THE EXECUTIVE SECRETARIAT 8CTIVITY ADD DO NOT DETACH FROM ORIGINAL CORRESPONDENCE 0/03/Y4 10: O0 5OURCECODE PM PUBLIC MAIL :?EC INT: CONTROL NO: ES94-012853 ,ATE CORR: 04/25/94 DATE RECD: 05/02/94 DATE CNTRL: 05/03/94 DATE DUE: NONE :TTER: X MEMO: TWX: _ OTHER: TO: SECY: X DEP SEC: _ UN SEC: OTHER: )M:LAY,KENNETH L \ TX O REMARKS: RELATES TO ES94-009882. i ENRON CORP. J: PUBLIC INFORMATION NATIONAL

  8. ARM - Publications: Science Team Meeting Documents: Cloud Radiative...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Research Facility: Part 2. The Vertical Redistribution of Radiant Energy by Clouds. ... Documentation with data of the effects of clouds on the radiant energy balance of the ...

  9. NUREG-0668 MASTER* TITLE LIST PUBLICLY AVAILABLE DOCUMENTS THREE...

    Office of Scientific and Technical Information (OSTI)

    Division of Technical Information and Document Control Office of Administration U. S. Nuclear Regulatory Commission Washington, D.C. 20555 . CONTENTS Page Preface. v...

  10. This publication is available from the Superintendent of Documents, U.S. Governm

    Gasoline and Diesel Fuel Update (EIA)

    (GPO). Informa tion about purchasing this or other Energy Information Administration (EIA) publications may be obtained from the GPO or the ElA's National Energy Information Center (NEIC). Questions on energy statistics should be directed to the NEIC by mail, telephone or telecommunications device for the deaf (TDD). Addresses, telephone numbers and hours appear below. National Energy Information Center, El-231 Energy Information Administration Forrestal Building, Room 1F-048 Washington, DC

  11. Document

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    or computer diskette) on request to the program contact person listed in this section. VIII. Other Information Electronic Access to This Document: You may view this document, ...

  12. Data-Driven Mailing Helps Heat Up Untapped Seattle Market | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Data-Driven Mailing Helps Heat Up Untapped Seattle Market Data-Driven Mailing Helps Heat Up Untapped Seattle Market Abridged transcript of an interview with Community Power Works Project Manager Ruth Bell and Program/System Analyst Vince Schueler of the Washington State University Energy Program. PDF icon Seattle Focus Series More Documents & Publications The Better Buildings Neighborhood View -- January 2013 howtodesignandmarketenergyefficiencyprogramstospecificneighborhoods.doc

  13. Document

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    171 Federal Register / Vol. 75, No. 108 / Monday, June 7, 2010 / Notices an accessible format (e.g., braille, large print, audiotape, or computer diskette) on request to the contact person listed under FOR FURTHER INFORMATION CONTACT. Electronic Access to This Document You can view this document, as well as all other documents of this Department published in the Federal Register, in text or Adobe Portable Document Format (PDF) on the Internet at the following site: http://www.ed.gov/

  14. Enhanced Geothermal Systems Documents for Public Comment- Now Closed

    Broader source: Energy.gov [DOE]

    The DOE Geothermal Technologies Program invited the public's input on the technology improvement areas identified at the EGS Technology Roadmapping Information Exchange meeting held in San Francisco, California on August 3-4, 2011.

  15. Document

    Office of Environmental Management (EM)

    are cooperating agencies on this Draft EIS. DATES: The public is invited to submit oral andor written comments on this Draft EIS during the public comment period, which...

  16. Title list of documents made publicly available, March 1-31, 1996

    SciTech Connect (OSTI)

    1996-05-01

    This document is the March 1996 listing of publicly available documents published by the NRC. The documents include: (1) docketed material associated with civilian nuclear power plants and other uses of radioactive material, and (2) nondocketed material received and generated by the NRC in its role as a regulatory agency.

  17. ARM - Conference Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    govPublicationsConference Documents Publications Journal Articles Conference Documents Program Documents Technical Reports Publications Database Public Information Materials Image...

  18. Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Summation version Stakeholder Summation version DOE Documents Environmental Management SSAB 15 Year Anniversary Paper (presented at the Waste Management Symposium, March 4, 2009)...

  19. Title list of documents made publicly available, January 1-31, 1998

    SciTech Connect (OSTI)

    1998-03-01

    The Title List of Documents Made Publicly Available is a monthly publication. It describes the information received and published by the US Nuclear Regulatory Commission (NRC). This information includes (1) docketed material associated with civilian nuclear power plants and other uses of radioactive materials and (2) nondocketed material received and published by NRC pertinent to its role as a regulatory agency. As used here, docketed does not refer to Court dockets; it refers to the system by which NRC maintains its regulatory records. This series of documents is indexed by a Personal Author Index, a Corporate Source Index, and a Report Number Index. The docketed information in the Title List includes the information formerly issued through the Department of Energy publication Power Reactor Docket Information, last published in January 1979. NRC documents that are publicly available may be examined without charge at the NRC Public Document Room (PDR). Duplicate copies in paper, microfiche, or (selectively) diskette, may be obtained for a fee.

  20. Document

    National Nuclear Security Administration (NNSA)

    of the Draft EIS was also published in four local and regional newspapers (in English and Spanish) and over 200 copies of the document were distributed to federal, state...

  1. Document

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    published in the Federal Register, in text or Adobe Portable Document Format (PDF) on the Internet at the following site: http:www.ed.gov newsfedregister. To use PDF you must...

  2. Document

    National Nuclear Security Administration (NNSA)

    ... is available on the Internet through the NEPA Web site at http:www.gc.energy.govnepa. ... internet Web site at http:www.ferc.gov under the link to Documents and Filings. ...

  3. Document

    National Nuclear Security Administration (NNSA)

    The Code of Federal Regulations is sold by the Superintendent of Documents. Prices of new books are listed in the first FEDERAL REGISTER issue of each week. Rules and Regulations ...

  4. Title list of documents made publicly available: February 1--28, 1995. Volume 17, Number 2

    SciTech Connect (OSTI)

    1995-04-01

    This monthly publication contains descriptions of the information received and generated by the US Nuclear Regulatory Commission (NRC). This information includes (1) docketed material associated with civilian nuclear power plants and other uses of radioactive materials and (2) nondocketed material received and generated by NRC pertinent to its role as a regulatory agency. As used here, docketed refers to the system by which NRC maintains its regulatory records. This series of documents is indexed by a Personal Author Index, a Corporate Source Index, and a Report Number Index. NRC documents that are publicly available may be examined without charge at the NRC Public Document Room (PDR).

  5. Request from City of Alexandria for Public Disclosure of Documents Related

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    to Docket No. EO-05-01 | Department of Energy from City of Alexandria for Public Disclosure of Documents Related to Docket No. EO-05-01 Request from City of Alexandria for Public Disclosure of Documents Related to Docket No. EO-05-01 Docket No. EO-05-01: On behalf of the City of Alexandria, Virginia ("Alexandria"), we submit this request for public disclosure of documents and materials related to Order No. 202-05-3, dated December 20, 2005, in the above-referenced Department of

  6. Document

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    This Meeting Will Be Open To The Public. PERSON TO CONTACT FOR INFORMATION: Bryan Whitener, Telephone: (202) 566- 3100. Thomas R. Wilkey, Executive Director, U.S. Election ...

  7. Document

    Energy Savers [EERE]

    ... PP-362 Notice of Intent To Prepare an Environmental Impact Statement and To Conduct Public Scoping ... and the DOE NEPA implementing procedures (10 CFR part 1021) to assess the ...

  8. Document

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Act of 1954 (AEA), 42 U.S.C. 2210d., commonly known as the Price- Anderson Act, consistent with section 607 of the Energy Policy Act of 2005, Public Law 109-58 (EPAct 2005). ...

  9. Document

    National Nuclear Security Administration (NNSA)

    786 Federal Register Vol. 73, No. 148 Thursday, July 31, 2008 Notices same file as the submission itself, and not as separate files. Petitions will be available for public ...

  10. Document

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    If members of the public are interested in making an oral statement, a written statement ... requesting persons will be able to make an oral presentation of their issue during an open ...

  11. Document

    National Nuclear Security Administration (NNSA)

    1850 Federal Register / Vol. 75, No. 137 / Monday, July 19, 2010 / Notices 1 The NOI identified the title of the document as the Supplemental Environmental Impact Statement for Surplus Plutonium Disposition at the Savannah River Site. Issued in Washington, DC, on July 9, 2010. Cathy Zoi, Assistant Secretary, Energy Efficiency and Renewable Energy. [FR Doc. 2010-17514 Filed 7-16-10; 8:45 am] BILLING CODE 6450-01-P DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Project No.

  12. NUREG-0668 MASTER* TITLE LIST PUBLICLY AVAILABLE DOCUMENTS THREE MILE ISLAND UNIT 2

    Office of Scientific and Technical Information (OSTI)

    RECSIVEP ev Tin JUN 11157^; NUREG-0668 MASTER* TITLE LIST PUBLICLY AVAILABLE DOCUMENTS THREE MILE ISLAND UNIT 2 DOCKET 50-320 Cumulated to May 21,1979 Office of Administration U. S. Nuclear Regulatory Commission NUREG-0668 TITLE LIST PUBLICLY AVAILABLE DOCUMENTS THREE MILE ISLAND UNIT 2 DOCKET 50-320 Cumulated to M a y 2 1 , 1979 Division of Technical Information and Document Control Office of Administration U. S. Nuclear Regulatory Commission Washington, D.C. 20555 . CONTENTS Page Preface. v

  13. Title list of documents made publicly available, April 1-30, 1995. Volume 17, No. 4

    SciTech Connect (OSTI)

    1995-06-01

    This document is NUREG-0540, Volume 17, Number 4. The Title List of Documents Made Publicly Available is a monthly publication, It contains descriptions of the information received and generated by the US NRC. This information includes (1) docketed material associated with civilian nuclear power plants and other uses of radioactive materials, and (2) nondocketed material received and generated by the NRC pertinent to its role as a regulatory agency. As used here, docketed does not refer to Court dockets; it refers to the system by which the NRC maintains its regulatory records. This series of documents is indexed by a personal author index, a corporate source index, and a report number index.

  14. Document

    Energy Savers [EERE]

    June 30, 2003 Part II Department of Energy Privacy Act of 1974; Publication of Compilation of Systems of Records; Notice VerDate Jan<31>2003 18:47 Jun 27, 2003 Jkt 200001 PO 00000 Frm 00001 Fmt 4717 Sfmt 4717 E:\FR\FM\30JNN2.SGM 30JNN2 38756 Federal Register / Vol. 68, No. 125 / Monday, June 30, 2003 / Notices DEPARTMENT OF ENERGY Privacy Act of 1974; Publication of Compilation of Systems of Records AGENCY: Department of Energy. ACTION: Notice. SUMMARY: As required by the Privacy Act of

  15. Document

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Friday, January 9, 2009 Part II Department of Energy Privacy Act of 1974; Publication of Compilation of Privacy Act Systems of Records; Notice VerDate Nov<24>2008 15:08 Jan 08, 2009 Jkt 217001 PO 00000 Frm 00001 Fmt 4717 Sfmt 4717 E:\FR\FM\09JAN2.SGM 09JAN2 yshivers on PROD1PC62 with NOTICES2 994 Federal Register / Vol. 74, No. 6 / Friday, January 9, 2009 / Notices DEPARTMENT OF ENERGY Privacy Act of 1974; Publication of Compilation of Privacy Act Systems of Records AGENCY: U.S. Department

  16. Electronic Mail Analysis Capability

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    2001-01-08

    Establishes the pilot program to test the Department of Energy (DOE) Electronic Mail Analysis Capability (EMAC), which will be used to monitor and analyze outgoing and incoming electronic mail (e-mail) from the National Nuclear Security Administration (NNSA) and DOE laboratories that are engaged in nuclear weapons design or work involving special nuclear material. No cancellation.

  17. Document:

    Office of Legacy Management (LM)

    DATA DECISION ANALYSIS: Project Shoal prepared by Greg Pohll, John Tracy, Frank Forsgren submitted to Nevada Operations Office U.S. Department of Energy January 1999 DOE/NV/11508-42 Publication No. 45166 This report was prepared as an account of work sponsored by the United States Government. Neither the United States nor the United States Department of Energy, nor any of their employees, nor any of their contractors, subcontractors or their employees, makes any warranty, express or implied, or

  18. Document

    National Nuclear Security Administration (NNSA)

    4543 Federal Register / Vol. 72, No. 59 / Wednesday, March 28, 2007 / Notices Relations or Ms. Julie J. Johnson, Assistant Director, Advisory Committee or Student Financial Assistance, Capitol Place, 80 F Street, NW., Suite 413, Washington, DC 20202-7582, (202) 219- 2099. SUPPLEMENTARY INFORMATION: The Advisory Committee on Student Financial Assistance is established under Section 491 of the Higher Education Act of 1965 as amended by Public Law 100-50 (20 U.S.C. 1098). The Advisory Committee

  19. Document

    National Nuclear Security Administration (NNSA)

    3232 Federal Register / Vol. 74, No. 131 / Friday, July 10, 2009 / Notices 1 The Nuclear Posture Review is a congressionally mandated comprehensive review of U.S. nuclear deterrence policy and strategy that the Secretary of Defense will conduct in consultation with the Secretary of Energy and the Secretary of State. The requirement for this review can be found in the National Defense Appropriations Act for 2008, Public Law 110-181. SUMMARY: This notice announces a meeting of the Advanced

  20. Document

    Energy Savers [EERE]

    7006 Federal Register / Vol. 75, No. 180 / Friday, September 17, 2010 / Notices DRAFT EIS PUBLIC HEARINGS Location Day, date, time Directions Jacumba Highland Center, 44681 Old Highway 80, Jacumba, Cali- fornia 91934. Tuesday, Octo- ber 5, 2010, 7-9 p.m. From the West, take I-8 East and take Exit 73 toward Jacumba. Turn right (South) onto Carrizo Gorge Road and drive South 1.1 miles. Turn right at Old Highway 80. Jacumba Highland Center will be on the left hand side. From the East, take I-8 West

  1. Title list of documents made publicly available, March 1--31, 1995: Volume 17, No. 3

    SciTech Connect (OSTI)

    1995-05-01

    The Title List of Documents Made Publicly Available is a monthly publication. It contains descriptions of the information received and generated by the US Nuclear Regulatory Commission (NRC). This information includes (1) docketed material associated with civilian nuclear power plants and other uses of radioactive materials and (2) nondocketed material received and generated by NRC pertinent to its role as a regulatory agency. As used here, docketed does not refer to Court dockets; it refers to the system by which NRC maintains its regulatory records. This series of documents is indexed by a Personal Author Index, a Corporate Source Index, and a Report Number Index. The docketed information contained in the Title List includes the information formerly issued through the Department of Energy publication Power Reactor Docket Information, last published in January 1979. NRC documents that are publicly available may be examined without charge at the NRC Public Document Room (PDR). Duplicate copies may be obtained for a fee. Standing orders for certain categories of documents are also available. Clients may search for and order desired titles through the PDR computerized Bibliographic Retrieval System, which is accessible both at the PDR and remotely. The PDR is staffed by professional technical librarians, who provide reference assistance to users. See NOTES at the end of the preface for information about reaching the PDR. Microfiche of the docketed information listed in the Title List is available for sale on a subscription basis from the National Technical Information Service (NTIS).

  2. Title list of documents made publicly available, November 1-30, 1995

    SciTech Connect (OSTI)

    1996-01-01

    The Title List of Documents Made Publicly Available is a monthly publication. It contains descriptions of the information received and generated by the U.S. Nuclear Regulatory Commission (NRC). This information includes (1) docketed material associated with civilian nuclear power plants and other uses of radioactive materials and (2) nondocketed material received and generated by NRC pertinent to its role as a regulatory agency. As used here, docketed does not refer to Court dockets; it refers to the system by which NRC maintains its regulatory records. This series of documents is indexed by a Personal Author Index, a Corporate Source Index and a Report Number Index. The docketed information contained in the Title List includes the information formerly issued through the Department of Energy publication Power Reactor Docker Information, last published in January 1979. NRC documents that are publicly available may be examined without charge at the NRC Public Document Room (PDR). Duplicate copies may be obtained for a fee. Standing orders for certain categories of documents are also available. Clients may search for and order desired titles through the PDR computerized Bibliographic Retrieval System, which is accessible both at the PDR and remotely. The PDR is staffed by professional technical librarians, who provide reference assistance to users.

  3. Title list of documents made publicly available, November 1--30, 1994. Volume 16, No. 11

    SciTech Connect (OSTI)

    Not Available

    1995-01-01

    This document is a monthly publication containing descriptions of information received and generated by the US Nuclear Regulatory Commission (NRC). This information includes docketed material associated with civilian nuclear power plants and other uses of radioactive materials, and nondocketed material received and generated by NRC pertinent to its role as a regulatory agency. The following indexes are included: Personal Author, Corporate Source, Report Number, and Cross Reference of Enclosures to Principal Documents.

  4. Title list of documents made publicly available, January 1--31, 1994. Volume 16, No. 1

    SciTech Connect (OSTI)

    1994-03-01

    This document is a monthly publication containing descriptions of information received and generated by the US Nuclear Regulatory Commission (NRC). This information includes (1) docketed material associated with civilian nuclear power plants and other uses of radioactive materials, and (2) nondocketed material received and generated by NRC pertinent to its role as a regulator agency. The following indexes are included: Personal Author, Corporate Source, Report Number, and Cross Reference of Enclosures to Principal Documents.

  5. Title list of documents made publicly available: August 1--31, 1997. Volume 19, Number 8

    SciTech Connect (OSTI)

    1997-10-01

    This document is a monthly publication containing descriptions of information received and generated by the US Nuclear Regulatory Commission (NRC). This information includes (1) docketed material associated with civilian nuclear power plants and other uses of radioactive materials and (2) nondocketed material received and generated by NRC pertinent to its role as a regulatory agency. The following indexes are included: Personal Author, Corporate Source, Report Number, and Cross Reference of Enclosures to Principal Documents.

  6. Title list of documents made publicly available, September 1--30, 1994. Volume 16, No. 9

    SciTech Connect (OSTI)

    Not Available

    1994-11-01

    This document is a monthly publication containing descriptions of information received and generated by the US Nuclear Regulatory Commission (NRC). This information includes docketed material associated with civilian nuclear power plants and other uses of radioactive materials, and nondocketed material received and generated by NRC pertinent to its role as a regulatory agency. The following indexes are included: Personal Author, Corporate Source, Report Number, and Cross Reference of Enclosures to Principal Documents.

  7. Title list of documents made publicly available: December 1--31, 1996. Volume 18, Number 12

    SciTech Connect (OSTI)

    1997-03-01

    This document is a monthly publication containing descriptions of information received and generated by the US Nuclear Regulatory Commission (NRC). This information includes (1) docketed material associated with civilian nuclear power plants and other uses of radioactive materials, and (2) nondocketed material received and generated by NRC pertinent to its role as a regulatory agency. The following indexes are included: Personal Author, Corporate Source, Report Number, and Cross Reference of Enclosures to Principal Documents.

  8. Title list of documents made publicly available. Volume 17, No. 1

    SciTech Connect (OSTI)

    1995-03-01

    This document is a monthly publication containing descriptions of information received and generated by the US Nuclear Regulatory Commission (NRC). This information includes (1) docketed material associated with civilian nuclear power plants and other uses of radioactive materials, and (2) nondocketed material received and generated by NRC pertinent to its role as a regulatory agency. The following indexes are included: Personal author, corporate source, report number, and cross reference of enclosures to principal documents.

  9. Title list of documents made publicly available, August 1--31, 1993. Volume 15, No. 8

    SciTech Connect (OSTI)

    Not Available

    1993-10-01

    This document is a monthly publication containing descriptions of information received and generated by the US Nuclear Regulatory commission (NRC). This information includes docketed material associated with civilian nuclear power plants and other uses of radioactive materials, and nondocketed material received and generated by NRC pertinent to its role as a regulatory agency. The following indexes are included: Personal Author corporate Source, Report Number, and Cross Reference of Enclosures to Principal Documents.

  10. Title list of documents made publicly available: November 1--30, 1997. Volume 19, Number 11

    SciTech Connect (OSTI)

    1998-01-01

    This document is a monthly publication containing descriptions of information received and generated by the US Nuclear Regulatory Commission (NRC). This information includes (1) docketed material associated with civilian nuclear power plants and other uses of radioactive materials and (2) nondocketed material received and generated by NRC pertinent to its role as a regulatory agency. The following indexes are included: Personal Author, Corporate source, Report Number, and Cross Reference of Enclosures to Principal Documents.

  11. Title list of documents made publicly available, August 1-31, 1995

    SciTech Connect (OSTI)

    1995-10-01

    This document is the August 1995 listing of publicly available documents that are issued by the Nuclear Regulatory Commission. The compilation is broken down into docketed and undocketed items, and each of these categories is further broken down into narrower categories. In general, the docketed items pertain to specific NRC licensees, while the undocketed items are of general interest to all licensees of a particular group.

  12. Title list of documents made publicly available, December 1--31, 1995. Volume 17, No. 12

    SciTech Connect (OSTI)

    1996-02-01

    This document is a monthly publication containing descriptions of information received and generated by the US Nuclear Regulatory Commission (NRC). This information includes (1) docketed material associated with civilian nuclear power plants and other uses of radioactive materials, and (2) nondocketed material received and generated by NRC pertinent to its role as a regulatory agency. The following indexes are included: Personal Author, Corporate Source, Report Number, and Cross Reference of Enclosures to Principal Documents.

  13. Title List of documents made publicly available, September 1--30, 1993. Volume 15, No. 9

    SciTech Connect (OSTI)

    Not Available

    1993-11-01

    This document is a monthly publication containing descriptions of information received and generated by the US Nuclear Regulatory Commission (NRC). This information includes (1) docketed material associated with civilian nuclear power plants and other uses of radioactive materials, and (2) nondocketed material received and generated by NRC pertinent to its role as a regulatory agency. The following indexes are included: Personal Author, Corporate Source, Report Number, and Cross Reference of Enclosures to Principals Documents.

  14. Title list of documents made publicly available. Volume 17, No. 10

    SciTech Connect (OSTI)

    1995-12-01

    This document is a monthly publication containing descriptions of information received and generated by the US Nuclear Regulatory Commission (NRC). This information includes (1) docketed material associated with civilian nuclear power plants and other uses of radioactive materials, and (2) nondocketed material received and generated by NRC pertinent to its role as a regulatory agency. The following indexes are included: Personal Author, Corporate Source, Report Number, and Cross Reference of Enclosures to Principal Documents.

  15. Title list of documents made publicly available: February 1--29, 1996. Volume 18, Number 2

    SciTech Connect (OSTI)

    1996-04-01

    The Title List of Documents Made Publicly Available is a monthly publication. It contains descriptions of the information received and generated by the US Nuclear Regulatory Commission (NRC). This information includes (1) docketed material associated with civilian nuclear power plants and other uses of radioactive materials and (2) nondocketed material received and generated by NRC pertinent to its role as a regulatory agency. As used here, docketed does not refer to Court dockets; it refers to the system by which NRC maintains its regulatory records. This series of documents is indexed by a Personal Author Index, a Corporate Source Index, and a Report Number Index.

  16. Title list of documents made publicly available. Volume 17, No. 5

    SciTech Connect (OSTI)

    1995-07-01

    The Title List of Documents Made Publicly Available is a monthly publication. It contains descriptions of the information received and generated by the US Nuclear Regulatory Commission (NRC). This information includes (1) docketed material associated with civilian nuclear power plants and other uses of radioactive materials and (3) nondocketed material received and generated by NRC pertinent to its role as a regulatory agency. As used here, docketed does not refer to Court dockets; it refers to the system by which NRC maintains its regulatory records. This series of documents is indexed by a Personal Author Index, a Corporate Source Index, and a Report Number Index.

  17. Title list of documents made publicly available. Volume 17, No. 7

    SciTech Connect (OSTI)

    1995-09-01

    The Title List of Documents Made Publicly Available is a monthly publication. It contains descriptions of the information received and generated by the US Nuclear Regulatory Commission (NRC). This information includes (1) docketed material associated with civilian nuclear power plants and other uses of radioactive materials and (2) nondocketed material received and generated by NRC pertinent to its role as a regulatory agency. As used here, docketed does not refer to Court dockets; it refers to the system by which NRC maintains its regulatory records. This series of documents is indexed by a Personal Author Index, a Corporate Source Index, and a Report Number Index.

  18. Title list of documents made publicly available, May 1-31, 1996

    SciTech Connect (OSTI)

    Morris, E.B.

    1996-07-01

    The Title List of Documents Made Publicly Available is a monthly publication. It describes the information received and published by the U.S. Nuclear Regulatory Commission (NRC). This information includes (1) docketed, material associated with civilian nuclear power plants and other uses of radioactive materials and (2) non-docketed material received and published by NRC pertinent to its role as a regulatory agency. As used here, docketed does not refer to Court dockets; it refers to the system by which NRC maintains its regulatory records. This series of documents is indexed by a Personal Author Index, a Corporate Source Index and a Report Number Index.

  19. Title list of documents made publicly available: October 1--31, 1994. Volume 16, Number 10

    SciTech Connect (OSTI)

    Not Available

    1994-12-01

    The Title List of Documents Made Publicly Available is a monthly publication. It contains descriptions of the information received and generated by the US Nuclear Regulatory Commission (NRC). This information includes (1) docketed material associated with civilian nuclear power plants and other uses of radioactive materials and (2) nondocketed material received and generated by NRC pertinent to its role as a regulatory agency. As used here, docketed does not refer to Court dockets; it refers to the system by which NRC maintains its regulatory records. This series of documents is indexed by a Personal Author Index, a Corporate Source Index, and a Report Number Index.

  20. Title list of documents made publicly available, September 1-30, 1997

    SciTech Connect (OSTI)

    1997-11-01

    The Title List of Documents Made Publicly Available is a monthly publication. It describes the information received and published by the U.S. Nuclear Regulatory Commission (NRC). This information includes (1) docketed material associated with civilian nuclear power plants and other uses of radioactive materials and (2) nondocketed material received and published by NRC pertinent to its role as a regulatory agency. As used here, docketed does not refer to Court dockets; it refers to the system by which NRC maintains its regulatory records. This series of documents is indexed by a Personal Author Index, a Corporate Source Index, and a Report Number Index.

  1. Title list of documents made publicly available, January 1, 1997--January 31, 1997

    SciTech Connect (OSTI)

    1997-04-01

    The Title List of Documents Made Publicly Available is a monthly publication. It describes the information received and published by the US Nuclear Regulatory Commission (NRC). This information includes (1) docketed material associated with civilian nuclear power plants and other uses of radioactive materials and (2) non-docketed material received and published by NRC pertinent to its role as a regulatory agency. As used here, docketed does not refer to Court dockets; it refers to the system by which NRC maintains its regulatory records. This series of documents is indexed by a Personal Author Index, a Corporate Source Index, and a Report Number Index.

  2. Title list of documents made publicly available, March 1--31, 1998. Volume 20, Number 3

    SciTech Connect (OSTI)

    1998-05-01

    The Title List of Documents Made Publicly Available is a monthly publication. It describes the information received and published by the US Nuclear Regulatory Commission (NRC). This information includes (1) docketed material associated with civilian nuclear power plants and other uses of radioactive materials and (2) nondocketed material received and published by NRC pertinent to its role as a regulatory agency. As used here, docketed does not refer to Court dockets; it refers to the system by which NRC maintains its regulatory records. This series of documents is indexed by a personal author index, a corporate source index, and a report number index.

  3. Title list of documents made publicly available: May 1--31, 1997. Volume 19, Number 5

    SciTech Connect (OSTI)

    1997-07-01

    The Title List of Documents Made Publicly Available is a monthly publication. It describes the information received and published by the US Nuclear Regulatory Commission (NRC). This information includes (1) docketed material associated with civilian nuclear power plants and other uses of radioactive materials and (2) non-docketed material received and published by NRC pertinent to its role as a regulatory agency. As used here, docketed does not refer to Court dockets; it refers to the system by which NRC maintains its regulatory records. This series of documents is indexed by a Personal Author Index, a Corporate Source Index, and a Report Number Index.

  4. Title list of documents made publicly available, December 1--31, 1993, Volume 15, No. 12

    SciTech Connect (OSTI)

    1994-02-01

    The Title List of Documents Made Publicly Available is a monthly publication. It contains descriptions of the information received and generated by the U.S. Nuclear Regulatory Commission (NRC). This information includes (1) docketed material associated with civilian nuclear power plants and other uses of radioactive materials and (2) nondocketed material received and generated by NRC pertinent to its role as a regulatory agency. As used here, docketed does not refer to Court dockets; it refers to the system by which NRC maintains its regulatory records. This series of documents is indexed by a Personal Author Index, a Corporate Source Index, and a Report Number Index.

  5. Mail Services User's Manual

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    2000-07-12

    This Manual provides detailed information on using the Department of Energy (DOE) mail services. Canceled by DOE G 573.1-1.

  6. Title list of documents made publicly available, July 1--31, 1996: Volume 18, No. 7

    SciTech Connect (OSTI)

    1996-09-01

    This monthly publication describes information received and published by US NRC. This information includes (1) docketed material associated with civilian nuclear power plants and other uses of radioactive materials and (2) nondocketed material received and published by NRC pertinent to its role as a regulatory agency. Following indexes are included: personal author, corporate source, report number, and cross reference of enclosures to principal documents.

  7. Title list of documents made publicly available, February 1-28, 1998

    SciTech Connect (OSTI)

    Morris, E.B.

    1998-04-01

    The Title List of Documents Made Publicly Available is a monthly publication. It describes the information received and published by the U.S. Nuclear Regulatory Commission (NRC). This information includes (1) docketed material associated with civilian nuclear power plants and other uses of radioactive materials and (2) non-docketed material received and published by NRC pertinent to its role as a regulatory agency. As used here, docketed does not refer to Court dockets; it refers to the system by which NRC maintains its regulatory records. This series of documents is indexed by a Personal Author Index, a Corporate Source Index, and a Report Number Index. The docketed information contained in the Title List includes the information formerly issued through the Department of Energy publication Power Reactor Docket Information, last published in January 1979.

  8. mail_paycheck_111609

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Updated:
11/16/09
 P.O Box 1663 Los Alamos, New Mexico 87544 MAIL PAYCHECK FORM TO: CRAFT PAYROLL DEPARTMENT - P238 FROM: (Please Print) Z# ORG CODE PLEASE MAIL MY PAYCHECK, TO THE ADDRESS ON FILE WITH PAYROLL, FOR THE PAY PERIOD BEGINNING: EMPLOYEE SIGNATURE Z# DATE SUPERVISOR SIGNATURE Z# DATE

  9. Title list of documents made publicly available. Volume 16, Number 5

    SciTech Connect (OSTI)

    Not Available

    1994-07-01

    The Title List of Documents Made Publicly Available contains descriptions of the information received and generated by the US Nuclear Regulatory Commission (NRC). This information includes (1) docketed material associated with civilian nuclear power plants and other uses of radioactive materials and (2) nondocketed material received and generated by NRC pertinent to its role as a regulatory agency. As used here, docketed does not refer to Court dockets; it refers to the system by which NRC maintains its regulatory records. This series of documents is indexed by a Personal Author Index, a Corporate Source Index, and a Report Number Index.

  10. Title list of documents made publicly available, October 1-31, 1997

    SciTech Connect (OSTI)

    1997-12-01

    This monthly publication describes the information received and published by the U.S. Nuclear Regulatory Commission (NRC). It includes: (1) docketed material associated with civilian nuclear power plants and other uses of radioactive materials, and (2) non-docketed material received and published. This series of documents is indexed by a Personal Author Index, a Corporate Source Index, and a Report Number index. Seven docketed items are included which pertain to licensing, radioactive waste, nuclear power plant design. The 26 non-docketed items include committee reports; NRC correspondence, issuances, and reports; inspections and deficiency findings; and waste management documents.

  11. DOE Publishes Notice of Public Meeting and Availability of the Framework Document for General Service Lamps Energy Conservation Standards

    Broader source: Energy.gov [DOE]

    The Department of Energy has published a Federal Register notice of public meeting and availability of the framework document regarding energy conservation standards for general service lamps.

  12. Technical documentation for the 1990 Nationwide Truck Activity and Commodity Survey Public Use File

    SciTech Connect (OSTI)

    Not Available

    1992-09-01

    The Nationwide Truck Activity and Commodity Survey (NTACS) provides detailed activity data for a sample of trucks covered in the 1987 Truck Inventory and Use Survey (TIUS) for days selected at random over a 12-month period ending in 1990. The NTACS was conducted by the US Bureau of the Census for the US Department of Transportation (DOT). A Public Use File for the NTACS was developed by Oak Ridge National Laboratory (ORNL) under a reimbursable agreement with the DOT. The content of the Public Use File and the design of the NTACS are described in this document.

  13. Title list of documents made publicly available, June 1-30, 1997

    SciTech Connect (OSTI)

    1997-08-01

    This document is a monthly publication describing information received and published by the U.S. Nuclear Regulatory Commission (NRC). This information includes (1) docketed material associated with civilian nuclear power plants and other uses of radioactive materials and (2) nondocketed material received and published by NRC pertinent to its role as a regulatory agency. As used here, {open_quotes}docketed{close_quotes} does not refer to Court dockets; it refers to the system by which NRC maintains its regulatory records.

  14. Title of documents made publicly available, August 1--31, 1996

    SciTech Connect (OSTI)

    Yanez, V.E.

    1996-10-01

    This publication describes the information received and published by the US Nuclear Regulatory Commission (NRC). This information includes: (1) docketed material associated with civilian nuclear power plants and other uses of radioactive materials and (2) non-docketed material received and published by NRC pertinent to its role as a regulatory agency. This series of documents is indexed by a Personal Author Index, a Corporate Source Index, and a Report Number Index.

  15. Request Repository Mailing List

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Policies User Surveys NERSC Users Group User Announcements Help Staff Blogs Request Repository Mailing List Operations for: Passwords & Off-Hours Status 1-800-66-NERSC, option 1 or 510-486-6821 Account Support https://nim.nersc.gov accounts@nersc.gov 1-800-66-NERSC, option 2 or 510-486-8612 Consulting http://help.nersc.gov consult@nersc.gov 1-800-66-NERSC, option 3 or 510-486-8611 Home » For Users » Request Repository Mailing List Request Repository Mailing List Use this form to request a

  16. Mail and Distribution | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Mail and Distribution Mail and Distribution The DOE Mail Center provides a variety of mail services for all official and other authorized mail for the Department of Energy and its employees. The services provided include the processing of all incoming postal mail, outgoing official mail, internal mail processing, accountable mail processing, pouch mail, a variety of overnight express mail services, directory services, and pick-up and delivery services. The Mail Management Memorandum (pdf)

  17. By Certified Mail May

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    By Certified Mail May 4,2012 Dorothy Riehle FOIA Office U.S. Department of Energy P. O. Box 550 Richland, WA 99352 Re: FOIA RequestLand Transfer Dear Ms. Riehle: Pursuant to the...

  18. By E-Mail

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    By E-Mail May 29, 2012 Dorothy Riehle FOIA Office U.S. Department of Energy P. O. Box 550 Richland, WA 99352 Re: FOIA RequestTank Inventories Dear Ms. Riehle: Pursuant to the...

  19. Enron Documents 1995

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    5 U.S. DEPARTMENT OF ENERGY OFFICE OF THE EXECUTIVE SECRETARIAT CORRESPONDENCE CONTROL TICKET IMPORTANT ES NUMBER: ES95-000672 EXTERNAL 'E OF DOC: 01/10/95 REC'D: 01/13/95 CONTROLLED: 01/13/95 DUE: FROM: HILLINGS,E JOSEPH DC O NOTES AREA: ENRON WASHINGTON, INC. SUBJECT ENCLOSES MOST RECENT ISSUE OF SUMMARY: "ENRON BUSINESS" SOURCE: PUBLIC MAIL DOCUMENT TYPE: LETTER ADDRESSED TO: SECRETARY FOR SIGNATURE OF: ACTION TO: POLICY ACTION TYPE: For your information ACTION OFFICER:

  20. Title list of documents made publicly available: June 1--30, 1995. Volume 17, Number 6

    SciTech Connect (OSTI)

    1995-08-01

    This monthly publication contains descriptions of the information received and generated by the US Nuclear Regulatory Commission (NRC). This information includes (1) docketed material associated with civilian nuclear power plants and other uses of radioactive materials and (2) nondocketed material received and generated by NRC pertinent to its role as a regulatory agency. As used here, docketed does not refer to Court dockets; it refers to the system by which NRC maintains its regulatory records. This series of documents is indexed by a Personal Author Index, a Corporate Source Index, and a Report Number Index.

  1. Title list of documents made publicly available: April 1--30, 1996. Volume 18, Number 4

    SciTech Connect (OSTI)

    1996-06-01

    This publication describes the information received and published by the US Nuclear Regulatory Commission (NRC). This information includes (1) docketed material associated with civilian nuclear power plants and other uses of radioactive materials and (2) non-docketed material received and published by NRC pertinent to its role as a regulatory agency. As used here, docketed does not refer to Court dockets; it refers to the system by which NRC maintains its regulatory records. This series of documents is indexed by a Personal Author Index, a Corporate Source Index, and a Report Number Index.

  2. Mail Services | The Ames Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mail Management Memorandum, July 2, 2010 Mail Management Memorandum, July 2, 2010 Mail Management Memorandum prescribing policy and requirements for the effective, economical, and secure management of incoming, internal, and outgoing mail in Federal agencies. These requirements pertain to all DOE offices, and may also apply to national laboratories and other contractor facilities, depending on whether they qualify as Federal facilities as defined in the regulations. PDF icon Mail Management

  3. Document Delivery

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Services » Document Delivery Document Delivery The Research Library can order journal articles, conference papers and book chapters not found in the Library collection for LANL staff. The service is provided by our vendor, Reprints Desk, who will mail the article to you as a PDF. Easily retrieved articles may be delivered the same day, while harder-to-find material can take several days/weeks. This service is limited to LANL employees with active Z numbers. Requesting Materials Use the Request

  4. PDSF Mailing Lists

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mailing Lists PDSF Mailing Lists pdsf-status@nersc.gov This is voluntary. You have to subscribe to it. This list can be chatty, since major and minor problems are sent to this list. Also multiple status updates will be sent for extended outages. Subscribe: Send email to pdsf-status-request@nersc.gov with subscribe in the subject of the message. Unsubscribe: Send email to pdsf-status-request@nersc.gov with unsubscribe in the subject of the message. pdsf-users@nersc.gov Users are subscribed to

  5. Regulations.gov - Proposed Rule Document | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Regulations.gov - Proposed Rule Document Regulations.gov - Proposed Rule Document In response to your phone call and e-mail below the proposed rule that you reference below regarding energy efficiency standards for manufactured housing has not been issued yet by the Department of Energy (DOE) and therefore we are still in the process of drafting a proposed rule and any necessary definitions. PDF icon Proposed Rule Email More Documents & Publications ISSUANCE 2015-02-04: Energy Conservation

  6. Mail Services User's Guide

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    2005-10-03

    This Guide provides information on using Department of Energy (DOE) mail services in accordance with U.S. Postal Service, General Services Administration (GSA), and DOE regulations. Cancels DOE M 573.1-1. Canceled by DOE N 251.89.

  7. EERE Publication and Product Library

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mail Requests You have not requested any products. You can request that products and publications be mailed to you by clicking on the "Request by Mail" link in the publication...

  8. Decommissioning Documents | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Decommissioning Documents PDF icon Decommissioning Documents More Documents & Publications Decommissioning Benchmarking Study Final Report Decommissioning Handbook ...

  9. Title list of documents made publicly available: January 1--31, 1996. Volume 18, Number 1

    SciTech Connect (OSTI)

    1996-03-01

    This monthly publication contains descriptions of the information received and generated by the US Nuclear Regulatory Commission (NRC). This information includes (1) docketed material associated with civilian nuclear power plants and other uses of radioactive materials and (2) nondocketed material received and generated by NRC pertinent to its role as a regulatory agency. As used here, docketed refers to the system by which NRC maintains its regulatory records. This series of documents is indexed by a Personal Author Index, a Corporate Source Index, and a Report Number Index. Some of the topics relate to: low-level radioactive disposal sites, source material, production and utilization facilities, special nuclear material, packaging and transport and spent fuel storage.

  10. 2014-09-16 Issuance: Energy Efficiency Program for Consumer Products: Energy Conservation Standards for Ceiling Fans: Public Meeting and Availability of the Preliminary Technical Support Document

    Broader source: Energy.gov [DOE]

    This document is a pre-publication Federal Register Energy Efficiency Program for Consumer Products: Energy Conservation Standards for Ceiling Fans: Public Meeting and Availability of the Preliminary Technical Support Document.

  11. ISSUANCE 2015-06-17: Energy Conservation Standards for Fluorescent Lamp Ballasts, Notice of Public Meeting and Availability of the Framework Document

    Broader source: Energy.gov [DOE]

    Energy Conservation Standards for Fluorescent Lamp Ballasts, Notice of Public Meeting and Availability of the Framework Document

  12. ISSUANCE: 2014-11-13 Energy Conservation Standards for Commercial Packaged Boilers: Public Meeting and Availability of the Preliminary Technical Support Document

    Broader source: Energy.gov [DOE]

    Energy Conservation Standards for Commercial Packaged Boilers: Public Meeting and Availability of the Preliminary Technical Support Document

  13. 2014-07-09 Issuance: Energy Conservation Standards for Computer and Battery Backup Systems; Notice of Public Meeting and Availability of Framework Document

    Broader source: Energy.gov [DOE]

    This document is a pre-publication Federal Register notice of public meeting and availability of framework document for computer and battery backup systems, as issued by the Deputy Assistant Secretary for Energy Efficiency on July 9, 2014. Though it is not inteded or expected, should any discrepancy occur between the document posted here and the document published in the Federal Register, the Federal Register publication controls. This document is being made available through the Internet solely as a means to facilitate the public's access to this document.

  14. 2014-08-01 Issuance: Energy Conservation Standard for Refrigerated Bottled or Canned Beverage Vending Machines; Notice of Public Meeting and Availability of the Preliminary Technical Support Document

    Broader source: Energy.gov [DOE]

    This document is a pre-publication Federal Register notice of public meeting and availability of the preliminary technical support document for refrigerated bottled or canned beverage vending machines, as issued by the Deputy Assistant Secretary for Energy Efficiency on August 1, 2014. Though it is not intended or expected, should any discrepancy occur between the document posted here and the document published in the Federal Register, the Federal Register publication controls. This document is being made available through the Internet solely as a means to facilitate the public's access to this document.

  15. 2014-10-27 Issuance: Energy Conservation Standards for Ceiling Fan Light Kits; Notice of Public Meeting and Availability of the Preliminary Technical Support Document

    Broader source: Energy.gov [DOE]

    This document is a pre-publication Federal Register notice of public meeting and availability of the preliminary technical support document regarding energy conservation standards for ceiling fan light kits, as issued by the Deputy Assistant Secretary for Energy Efficiency on October 27, 2014. Though it is not intended or expected, should any discrepancy occur between the document posted here and the document published in the Federal Register, the Federal Register publication controls. This document is being made available through the Internet solely as a means to facilitate the public's access to this document.

  16. 2014-09-16 Issuance: Energy Conservation Standards for Ceiling Fans; Notice of Public Meeting and Availability of Preliminary Technical Support Document

    Broader source: Energy.gov [DOE]

    This document is a pre-publication Federal Register notice of public meeting and availability of preliminary technical support document regarding energy conservation standards for ceiling fans, as issued by the Deputy Assistant Secretary on September 16, 2014. Though it is not intended or expected, should any discrepancy occur between the document posted here and the document published in the Federal Register, the Federal Register publication controls. This document is being made available through the Internet solely as a means to facilitate the public's access to this document.

  17. Mailing List Subscription

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mailing List Subscription Jefferson Lab Home Search Contact JLab Descriptions A - C autocad: No description available briefs: On-Target Briefs cctest-alert: No description available clas_drift_chambers: Hall B Drift Chambers Group clas_offline: Discussion group for CLAS RECSIS group clas_slow_control: CLAS slow control working group clas_strangep: Hall B Strange Particles using CLAS discussion group clas_tof: CLAS Time of Flight Collaboration credit-card: List of JLab Credit Card buyers csc_all:

  18. Printing and Mail Managers Exchange Forum Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    May 16, 2013 Mail discussion Joe Whitford opened the meeting by introducing Al Majors to talk about mail related items. 1) Update on the USPS mail name changes. If approved by the Postal Regulatory Commission the following name changes will go into effective July 28, 2013: a. Express Mail will be called Priority Mail Express b. Express Mail International will be Priority Mail International c. Express Mail Corporate Account will become USPS Express Corporate Account Only the names of these

  19. Guidance document publications list - Office of Environmental Policy and Assistance RCRA/CERCLA Division (EH-413)

    SciTech Connect (OSTI)

    1995-08-01

    This document provides a listing of Guidance Documents from the RCRA/CERCLA Division for August 1995. Documents are listed under the following categories: RCRA Guidance Manuals; RCRA Information Briefs; CERCLA Guidance Manuals; CERCLA Regulatory Bulletins; RCRA/CERCLA Guidance Manuals; TSCA Guidance Manuals; TSCA Information Briefs; and, Cross Cut Manuals.

  20. How is a Document Containing OUO Marked? | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    with "Document(s) transmitted contain(s) OUO information". (DOE M 471.3-1, Admin Chg 1, Chapter I, 3f.) Marking e-mail: If the e-mail contains OUO information, the first line of ...

  1. 2015-02-13 Issuance: Energy Conservation Standards for Portable Air Conditioners; Notice of Public Meeting and Availability of the Preliminary Technical Support Document

    Broader source: Energy.gov [DOE]

    This document is a pre-publication Federal Register notice of public meeting regarding energy conservation standards for portable air conditioners, as issued by the Deputy Assistant Secretary for Energy Efficiency on February 13, 2015. Though it is not intended or expected, should any discrepancy occur between the document posted here and the document published in the Federal Register, the Federal Register publication controls. This document is being made available through the Internet solely as a means to facilitate the public's access to this document.

  2. Title list of documents made publicly available, December 1--31, 1991. Volume 13, No. 12

    SciTech Connect (OSTI)

    1992-02-01

    This document is a monthly containing descriptions of information received and generated by the US Nuclear Regulatory Commission (NRC). This information includes (1) docketed material associated with civilian nuclear power plants and other uses of radioactive materials, and (2) nondocketed material received and generated by NRC pertinent to its role as a regulatory agency. The following indexes are included: Personal Author, Corporate Source, Report Number, and Cross Reference of Enclosures to Principal Documents.

  3. Enron Documents 2000 | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    0 Enron Documents 2000 Enron Documents for 2000, enron2000.pdf PDF icon Enron Documents 2000 More Documents & Publications Enron Documents 1996 FOIA - Enron Documents Documents ...

  4. Enron Documents 1998 | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    8 Enron Documents 1998 Enron Documents 1998 PDF icon Enron Documents 1998 More Documents & Publications FOIA - Enron Documents Enron Documents 1993 Enron Documents 1996

  5. Enron Documents 1993 | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    3 Enron Documents 1993 Enron Documents 1993. enron1993.pdf PDF icon Enron Documents 1993 More Documents & Publications FOIA - Enron Documents Enron Documents 1998 Enron Documents ...

  6. Enron Documents 1996 | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    6 Enron Documents 1996 Enron Documents 1996 PDF icon Enron Documents 1996 More Documents & Publications Enron Documents 2000 FOIA - Enron Documents Enron Documents 2001

  7. Title list of documents made publicly available, January 1-31...

    Office of Scientific and Technical Information (OSTI)

    material received and published by NRC pertinent to its role as a regulatory agency. ... Country of Publication: United States Language: English Subject: 21 NUCLEAR POWER REACTORS ...

  8. ARM - Public Information Materials

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    govPublicationsPublic Information Materials Publications Journal Articles Conference Documents Program Documents Technical Reports Publications Database Public Information...

  9. The Future of Electric Vehicles and Arizona State University's MAIL

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Battery | Department of Energy The Future of Electric Vehicles and Arizona State University's MAIL Battery The Future of Electric Vehicles and Arizona State University's MAIL Battery August 11, 2010 - 4:26pm Addthis Cody Friesen and his team at Arizona State University | Photo Credit Arizona State University Cody Friesen and his team at Arizona State University | Photo Credit Arizona State University Andy Oare Andy Oare Former New Media Strategist, Office of Public Affairs What does this

  10. Minutes from the March 14, 2013 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    March 14, 2013 Mail discussion Al Majors is on leave today. Ellsworth Howell Jr. and Tony Nellums are sitting for Al. There are no agenda items for the Mail portion. A discussion period for questions, comments, or suggestions was opened without response Printing discussion Discussed suggestions for reducing printing expenses Presidential Executive Order 13589 and reducing hard copy printing in favor of electronic publishing Sec. 5. Printing. Agencies are encouraged to limit the publication and

  11. 2014-01-24 Issuance: Energy Conservation Standards for Commercial and Industrial Air Compressors; Notice of Public Meeting and Availability of the Framework Document

    Broader source: Energy.gov [DOE]

    This document is a pre-publication Federal Register notice of public meeting and availability of the framework document regarding energy conservation standards for commercial and industrial compressors, as issued by the Deputy Assistant Secretary for Energy Efficiency on January 24, 2014.

  12. Title list of documents made publicly available, December 1-31, 1997

    SciTech Connect (OSTI)

    1998-02-01

    This report includes the information received and published by the U.S. Nuclear Regulatory Commission (NRC) in December 1997. It includes: (1) docketed material associated with civilian nuclear power plants and other uses of radioactive materials, and (2) non-docketed material received and published by NRC pertinent to its role as a regulatory agency. This series of documents is indexed by author, corporate source, and report number. This report includes six docketed items and 24 non-docketed items.

  13. Title list of documents made publicly available July 1-31, 1997

    SciTech Connect (OSTI)

    1997-09-01

    This monthly publication describes the information received and published by the U.S. Nuclear Regulatory Commission (US NRC). This includes information on docketed material associated with civilian nuclear power plants and other uses of radioactive materials, and non-docketed material published by the US NRC pertinent to it`s role as a regulatory agency.

  14. Title list of documents made publicly available: September 1--30, 1996. Volume 18, Number 9

    SciTech Connect (OSTI)

    1996-11-01

    The report describes the information received and published by the US Nuclear Regulatory Commission (NRC). This information includes (1) docketed material associated with civilian nuclear power plants and other uses of radioactive materials and (2) non-docketed material received and published by NRC pertinent to its role as a regulatory agency. As used here, docketed does not refer to Court dockets; it refers to the system by which NRC maintains its regulatory records. This series of documents is indexed by a Personal Author Index, a Corporate Source Index, and a Report Number Index.

  15. ARM - Program Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Videos Publication Resources Submit a Publication Publishing Procedures ARM Style Guide (PDF, 448KB) Acronyms Glossary Logos Contacts RSS for Publications Program Documents Annual...

  16. LLNL E-Mail Utilities

    Energy Science and Technology Software Center (OSTI)

    2005-10-31

    The LLNL E-mail Utilities software library is a Java API that simplifies the creation and delivery of email in Java business applications. It consists of a database-driven template engine, various strategies for composing, queuing, dispatching email and a Java Swing GUI for creating and editing email templates.

  17. Document | Department of Energy

    Energy Savers [EERE]

    Document Document Extracted Pages PDF icon Document More Documents & Publications EIS-0396: Advance Notice of Intent o Prepare an Environmental Impact Statement EIS-0396: Notice of Intent to Prepare a Programmatic Environmental Impact Statement Meeting Minutes: February 20-21, 2007

    Document Document Extracted Pages PDF icon Document More Documents & Publications ADR Policy Federal Register Microsoft Word - ADR Revised Policy82508Reformatted.doc 2009 ECR FINAL REPORT 2010

  18. Microsoft Word - WD Proposed Plan D5 R8 MASTER 10-29-14 _final with reply mail_ rev 1

    Energy Savers [EERE]

    WD-PLN-0034, Rev. 8 1 DOE/PPPO/03-0312&D5 Aerial photo of the Portsmouth Gaseous Diffusion Plant showing the three large process buildings (center of photo) and other support facilities, facing southwest PUBLIC COMMENT PERIOD NOVEMBER 12, 2014 TO JANUARY 10, 2015 HOW YOU CAN PARTICIPATE Read this Proposed Plan and review related documents in the Administrative Record. Comment on this Proposed Plan by mail, email, or fax to: Ms. Kristi Wiehle Department of Energy P.O. Box 370 Piketon, Ohio

  19. Documents and Publications

    Broader source: Energy.gov [DOE]

    CERF Independent Research Assessment of Project Management(pdf) - the Civil Engineering Research Foundation (CERF) conducted a project management research study for the (DOE) to identify key...

  20. Documents and Publications

    Broader source: Energy.gov [DOE]

    CERF Independent Research Assessment of Project Management (pdf) - the Civil Engineering Research Foundation (CERF) conducted a project management research study for the (DOE) to identify key...

  1. Archived Publications and Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    » Archived EAC Charters, Rosters & News Archived EAC Charters, Rosters & News Previous charters, rosters, and news for the Electricity Advisory Committee. Charters 2012 Charter (August 9, 2012) 2010 Charter (August 9, 2010) 2008 Charter (March 13, 2008) Membership Rosters 2014 Membership Roster (December 4, 2014) 2014-2015 Membership Roster (September 9, 2014) 2014 Membership Roster (June 10, 2014) 2013 Membership Roster (December 15, 2013) 2012-2013 Membership Roster (December 20,

  2. Mail Management Memorandum, July 2, 2010 | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Mail Management Memorandum, July 2, 2010 Mail Management Memorandum, July 2, 2010 Mail Management Memorandum prescribing policy and requirements for the effective, economical, and ...

  3. Minutes from the Print and Mail Managers Exchange Forum Teleconference...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Minutes from the Print and Mail Managers Exchange Forum Teleconferences Minutes from the Print and Mail Managers Exchange Forum Teleconferences Minutes from the Print and Mail...

  4. Enron Documents 2001 | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    1 Enron Documents 2001 Enron Documents 2001, enron2001.pdf PDF icon Enron Documents 2001 More Documents & Publications Enron Documents 2002 Biography - Spencer Abraham, Secretary, ...

  5. Complete Experiment Safety Documentation

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Complete Experiment Safety Documentation Print User Safety Overview Upon receiving beam time: 1. Log in to ALSHub to complete an Experiment Safety Sheet (ESS). The ALS This e-mail address is being protected from spambots. You need JavaScript enabled to view it is available to support you through this process. Please contact This e-mail address is being protected from spambots. You need JavaScript enabled to view it at the email link or at (510) 486-7222 at if you have questions or need more

  6. Complete Experiment Safety Documentation

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Complete Experiment Safety Documentation Print User Safety Overview Upon receiving beam time: 1. Log in to ALSHub to complete an Experiment Safety Sheet (ESS). The ALS This e-mail address is being protected from spambots. You need JavaScript enabled to view it is available to support you through this process. Please contact This e-mail address is being protected from spambots. You need JavaScript enabled to view it at the email link or at (510) 486-7222 at if you have questions or need more

  7. Complete Experiment Safety Documentation

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Complete Experiment Safety Documentation Print User Safety Overview Upon receiving beam time: 1. Log in to ALSHub to complete an Experiment Safety Sheet (ESS). The ALS This e-mail address is being protected from spambots. You need JavaScript enabled to view it is available to support you through this process. Please contact This e-mail address is being protected from spambots. You need JavaScript enabled to view it at the email link or at (510) 486-7222 at if you have questions or need more

  8. Complete Experiment Safety Documentation

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Complete Experiment Safety Documentation Print User Safety Overview Upon receiving beam time: 1. Log in to ALSHub to complete an Experiment Safety Sheet (ESS). The ALS This e-mail address is being protected from spambots. You need JavaScript enabled to view it is available to support you through this process. Please contact This e-mail address is being protected from spambots. You need JavaScript enabled to view it at the email link or at (510) 486-7222 at if you have questions or need more

  9. Bioenergy Technologies Office: Publications

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Advanced Search Browse by Topic Mail Requests Help Key Publications Newsletter Biomass Basics Multimedia Webinars Databases Analytical Tools Glossary Student & Educator Resources...

  10. Wind Program: Publications

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Resources Publications Advanced Search Browse by Topic Mail Requests Help Energy Basics Wind Energy FAQs Small Wind Systems FAQs Multimedia Related Links Feature featured...

  11. Publications | NISAC

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Publications Publications Photo courtesy of ©iStockphoto.com/Samohin Photo courtesy of ©iStockphoto.com/Samohin The EERE Publication and Product Library will allow you to find publications and products provided by the DOE's Office of Energy Efficiency and Renewable Energy specifically for our constituents. This database will allow you to do the following: Search for publications and products Download or view publications online Request a copy to be mailed to you. Visit the EERE Publication

  12. Field Facilities Contacts for Printing and Mail

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Field Facilities Contacts for Printing and Mail Print and Mail Contacts Site Printing Contact Mail Contact NNSA, Albuquerque Deborah Miller (505) 845-6049 Thomas H. Clinkenbeard NNSA Service Center PO Box 5400 Albuquerque, NM 87185-5400 (505) 845-4602 tclinkenbeard@doeal.gov (mailto:tclinkenbeard@doeal.gov) Argonne National Laboratory Doreen Schoening Argonne National Laboratory U.S. Department of Energy 9700 South Cass Avenue Blvd 340 Lemonmt, IL 60439 (630) 840-6399 dschoening@anl.gov

  13. Printing and Mail Managers Exchange Forum Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    November 21, 2013 Mail Managers discussion Joe Whitford opened the meeting by introducing Tony Nellums to talk about mail related items. 1) Mr. Nellums introduced Derek Milner, Policy Advisor from the GSA Office of Government-wide policy. a. Mr. Milner stated that he is being replaced as primary policy contact by Linda Willoughby (Linda.Willoughby@gsa.gov) or (202) 219-1083. b. Initiatives discussed by Mr. Milner included: Upcoming mail reports. The SMART system is online and available now.

  14. Publications

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Publications JLF Science Publications JLF Facility-related Publications JLF Highlights

  15. Solar Background Document 3 | Department of Energy

    Energy Savers [EERE]

    3 Solar Background Document 3 A list of private sector investment in Solyndra. PDF icon Solar Background Document 3.pdf More Documents & Publications Solar Background Document 2...

  16. Document | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Document Document Extracted Pages PDF icon Document More Documents & Publications EIS-0396: Advance Notice of Intent o Prepare an Environmental Impact Statement EIS-0396: Notice of Intent to Prepare a Programmatic Environmental Impact Statement Meeting Minutes: February 20-21, 2007

  17. NEPA Documents | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Services » NEPA Documents NEPA Documents To see a list of available NEPA documents by type and sorted by publication date, click on the links below. Documents listed in this section are available to members of the public. To see documents not electronically available to the public see the Secure NEPA Documents page for more information. Categorical Exclusion (CX) Determinations Categorical exclusions are categories of actions that DOE has determined, by regulation, do not individually or

  18. Fuel Cell Technologies Office: Publications

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Fuel Cell Technologies Office EERE Fuel Cell Technologies Office Share this resource Publications Advanced Search Browse by Topic Mail Requests Help Feature featured product...

  19. Microsoft Word - Document2 | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Document2 Microsoft Word - Document2 More Documents & Publications Microsoft Word - ARRAAttachment12v1.doc Microsoft Word - FrequentlyAskedQuestions Microsoft Word - DRAFT CRB ...

  20. Microsoft Word - Document1 | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Document1 Microsoft Word - Document1 PDF icon Microsoft Word - Document1 More Documents & Publications Microsoft Word - Document2 Microsoft Word - ARRAAttachment12v1.doc Microsoft Word - Frequently_Asked_Questions

  1. Solar Background Document 5 | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    5 Solar Background Document 5 Graph illustrating Chinese Development Bank financing to Chinese solar companies. PDF icon Solar Background Document 5.pdf More Documents & Publications Solar Background Document 7 National Solar Jobs Census 2014 Solar Background Document 4

  2. Office of Document Reviews

    Broader source: Energy.gov [DOE]

    The Office of Document Reviews ensures that all documents prepared at DOE Headquarters are properly marked to identify the level and category of protected information they contain (if any) and to ensure that all documents the Department prepares or is required to review under applicable statutes for public release contain no information requiring protection under law, regulations and Executive orders.

  3. Minutes from the January 10, 2013 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    January 10, 2013 Mail discussion Al Majors opened the meeting by discussing the Mail Management Report and latest update on status. One final report is yet to be submitted, after which close out will be accomplished. Copies will be provided to the Mail Managers once completed. Al introduced Derrick Miliner, Program Manager from the General Services Administration, Office of Government-wide Policy, and acknowledged Mr. Miliner's role in completing the Mail Management Report. Mail Security Plans A

  4. Providing Internet access to Los Alamos National Laboratory technical reports: A case history in providing public access to previously restricted documents

    SciTech Connect (OSTI)

    Collins, K.A.

    1996-12-31

    The Los Alamos National Laboratory (LANL) Research Library recently fulfilled a strategic goal of providing worldwide desktop access via the Internet to full-image files of the complete unclassified holdings of Los Alamos technical reports in its Report Collection. This effort began in late 1994 with the scanning of paper and microfiche format reports. Concurrently, the Research Library helped to initiate shifting the model for publishing new technical reports from paper to electronic; the files could then be directly mounted on the Research Library`s Web server. Providing desktop access to these reports was instrumental in expediting the development of internal policies that would better define what documents, previously restricted to the general public, could be publicly released. Undoubtedly, the most significant category of such reports were previously classified reports that had been declassified, but had not gone through a further review for public release. Collaboration with LANL`s Classification Group led to approval for public release of 97% of these reports. The LANL Research Library`s Web site now offers unique and unprecedented access to the world of a huge body of technical reports never available before anywhere in any form. This paper discusses the issues and steps involved in this achievement.

  5. Publications

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    PADSTE » ADTSC » Publications Publications The Theory, Simulation, and Computation Science Highlight publications are available online. Contact Communications Email Covers from research highlight publications Covers from the print version of past Theory, Simulation, and Computation science highlights. All Theory, Simulation, and Computation technical papers, journal articles, and publications other than Science Highlights are available in the Research Library Catalog. Science Highlights 2013

  6. WIPP RCRA Documents menu

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    RCRA Documents Menu Permit Modifications Available for Public Comment Final Documents Draft Documents None currently available RCRA-Related Documents EEG Preliminary Comments on the Fundamental Bases of the Characterization Requirements for Disposal of Transuranic Waste at the Waste Isolation Pilot Plant and Findings and Recommendations of the Transuranic Waste Characterization Task Force Final Report EEG Response to NAS WIPP Committee Questions for May 19, 2003 Meeting Quality Assurance Program

  7. Publications

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    work. Today at Berkeley Lab: : The daily newsletter for our employees and collaborators. Publications.lbl.gov: : Over 75,000 of our laboratory's scientific publications,...

  8. Read Your E-mail | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Read Your E-mail All Argonne employees can read their e-mail through the web. Argonne E-Mail service is a robust, reliable electronic communication solution for supporting day-to-day business activities. Features include e-mail, calendar, task lists, and contact lists. While it is designed to work Microsoft Outlook, it also works with other POP- and IMAP-based clients. All employees can read their e-mail through the web. Use the login link at right to get started. Login to E-mail

  9. Document Reviews

    Broader source: Energy.gov [DOE]

    The Office of Document Reviews, within the Office of Health, Safety and Security information and document declassification efforts promote the release of information needed by an informed citizenry...

  10. TEC Working Group Topic Groups Routing Key Documents | Department...

    Office of Environmental Management (EM)

    Key Documents TEC Working Group Topic Groups Routing Key Documents KEY DOCUMENTS PDF icon Proposed Task Plan - Routing Topic Group More Documents & Publications TEC Working Group...

  11. T-618: Debian update for exim4: Mail Transport Agent

    Broader source: Energy.gov [DOE]

    It was discovered that Exim, the default mail transport agent in Debian, uses DKIM data obtain from DNS directly in a format string, potentially allowing malicious mail senders to execute arbitrary code.

  12. Enron Documents received from Office of Congressional and Intergovernmental Affairs

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Congressional Documents received from Office of Congressional and Intergovernmental Affairs 1. Document entitled "Texas Electricity Reliability Summit Agenda." 3 pages. (F2001-00630) 2. E-mail to Richard Glick from Michael Fourcher, dated May 22, 2000. Subject: RE: May 26. 1 page. (F2001-00630) 3. E-mail to Arlene Estep from Doreen Williams, dated June 11, 2002. 1 page. (F2001- 00630) 4. E-mail to Arlene Estep from Michael Ivahnenko, dated June 11, 2002. 1 page with one enclosure.

  13. Publications

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Publications Engineering Institute Publications Publications are organized by topic. Contact Institute Director Charles Farrar (505) 663-5330 Email UCSD EI Director Michael Todd (858) 534-5951 Professional Staff Assistant Ellie Vigil (505) 667-2818 Email Administrative Assistant Rebecca Duran (505) 665-8899 Email Model Verification and Validation Sensor and Sensing Technologies Structural Health Monitoring Earthquake Engineering and Structural Dynamics Damage Prognosis Other Publications Book

  14. WIPP Documents - Nuclear Safety

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Nuclear Safety DOE/WIPP-07-3372, Revision 4 WIPP Documented Safety Analysis Approved November 2013 The Documented Safety Analysis addresses all hazards (both radiological and nonradiological) and the controls necessary to provide adequate protection to the public, workers, and the environment. The WIPP DSA demonstrates the extent to which the Waste Isolation Pilot Plant can be operated safely with respect to workers, the public, and the environment. DOE/WIPP-07-3373, Revision 4 WIPP Technical

  15. Publications | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Publications Publications Photo courtesy of ©iStockphoto.com/Samohin Photo courtesy of ©iStockphoto.com/Samohin The EERE Publication and Product Library will allow you to find publications and products provided by the DOE's Office of Energy Efficiency and Renewable Energy specifically for our constituents. This database will allow you to do the following: Search for publications and products Download or view publications online Request a copy to be mailed to you. Visit the EERE Publication

  16. Publications

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Publications /newsroom/_assets/images/newsroom-icon.jpg Publications Los Alamos publications demonstrate the Lab's enduring commitment to researching and applying the best science, engineering and technology in order to meet the challenges facing our country and society in the 21st century. NSS april 2016 1663 NEW ISSUE Nss: April 2016 Welcome to this issue The Hurt-Locker School Explosive Results Questing for the Holy Grail of High Explosives Learning from (Near) Disaster A Safer Liftoff Shake,

  17. Publications

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Publications Publications Official releases of Richard P. Feynman Center for Innovation publications General Inquiries Richard P. Feynman Center for Innovation (505) 665-9090 Email All years denote Fiscal Years. Progress Report FY14 FCI Progress Report 2014 (pdf) 2013 (pdf) 2011-2012 (pdf) 2009-2010 (pdf) 2007-2008 (pdf) 2005-2006 (pdf) 2004 (pdf) outSTANDING innOVATION Awards After 2011, the outSTANDING innOVATION Awards booklet and Progress Report were combined into a single publication. FY11

  18. Other Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    since 2009 5 U.S.C. § 552 10 CFR 1004 Other Documents Transuranic Waste Defense Determination Approval Form

  19. WIPP Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Large file size alert This symbol means the document may be a large file size. Environmental Monitoring Documents about environmental monitoring at WIPP, including annual site environmental reports Environmental Protection Agency Certification Documents about WIPP's EPA certification Federal Regulations Standards and compliance criteria for WIPP Hazardous Waste Facility Permit Documents related to the state of New Mexico's oversight of WIPP under the authority of the Resource Conservation and

  20. Microsoft Word - Document3

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ...nancy@mail.house.gov; americanvoices@mail.house.gov; comments@whitehouse.gov; ... THE DESTRUCTION OF MUCH OF THE GULF OF MEXICO. DOE IS SCUM BUSHCHENEY COUNTRY AND HAS ...

  1. Publications

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    GCPCC's collaboration and publication policy Beamline acknowledgement Publication List Please contact us when you have a publication resulting from work done at the GCPCC PX beamline. Miller MD, Phillips GN Jr., White MA, Fox RO, Craft BC III The development of the GCPCC Protein Crystallography Beamline at CAMD. Application of Accelerators in Research and Industry -- Sixteenth Int'l Conf., J.L. Duggan and I.L. Morgan eds., 734-737 (2001). {PDF} Qiu C, Tarrant MK, Choi SH, Sathyamurthy A, Bose R,

  2. Publications

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Book Chapters and Other Publications Book Chapters and Other Publications Contact Institute Director Charles Farrar (505) 663-5330 Email UCSD EI Director Michael Todd (858) 534-5951 Professional Staff Assistant Ellie Vigil (505) 667-2818 Email Administrative Assistant Rebecca Duran (505) 665-8899 Email Book Chapters C. J. Stull, F. M. Hemez and C. R. Farrar, "On Assessing the Robustness of Structural Health Monitoring Technologies," Topics in Model Validation and Uncertainty

  3. Publications

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Model Verification and Validation Model Verification and Validation Publications Publications are organized by topic. Contact Institute Director Charles Farrar (505) 663-5330 Email UCSD EI Director Michael Todd (858) 534-5951 Professional Staff Assistant Jutta Kayser (505) 663-5649 Email Administrative Assistant Stacy Baker (505) 663-5233 Email Decision-Making for Science-Based Predictive Modeling Atamturktur, H.S., Egeberg, M.C., Hemez, F.M., Stevens, G.N., "Defining Coverage of an

  4. Publications

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Structural Health Monitoring Structural Health Monitoring Publications Publications are organized by topic. Contact Institute Director Charles Farrar (505) 663-5330 Email UCSD EI Director Michael Todd (858) 534-5951 Professional Staff Assistant Ellie Vigil (505) 667-2818 Email Administrative Assistant Rebecca Duran (505) 665-8899 Email Structural Health Monitoring is the process of implementing a damage detection strategy for aerospace, civil and mechanical engineering infrastructure is referred

  5. DOE Source Evaluation Board (SEB) Document Templates

    Broader source: Energy.gov [DOE]

    On March 30,2010, four draft SEB document templates (SEB Report, Competitive Range Determination, Source Selection Plan and Source Selection Decision) were distributed for Procurement Director (PD) and Head of Contracting Activity (HCA) review and comment. All comments received were considered and changes were made as appropriate. The final versions of the four aforementioned SEB document templates will be e-mailed directly to the Procurement Directors and made available in the STRIPES Library.

  6. Solar Background Document 1 | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Solar loan guarantee application from 2006 to 2009. PDF icon Solar Background Document 1.pdf More Documents & Publications Special Report: 11-0078-I Before the House ...

  7. Energy Storage Program Planning Document (2011) | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    PDF icon Energy Storage Program Planning Document (2011) More Documents & Publications Progress in Grid Scale Flow Batteries Energy Storage Systems 2014 Peer Review Presentations - ...

  8. NREL: Transmission Grid Integration - Publications

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Publications Want updates about future transmission grid integration webinars and publications? Join our mailing list. NREL has an extensive collection of publications related to transmission integration research. Explore the resources below to learn more. Selected Project Publications Read selected publications related to these transmission integration projects: Western Wind and Solar Integration Study Eastern Renewable Generation Integration Study Oahu Wind Integration and Transmission Study

  9. Minutes from the January 19, 2011 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    January 2010 Printing and Mail Managers Exchange Forum Teleconference Twenty-one individuals participated in the Printing and Mail Managers Exchange Forum, which included Printing and Mail Managers and Contractors Comments/Additions to last Months Minutes No comments. Printing Agenda Items......... Update on the Department-wide FY-2010 Three-Year Plan Dallas Woodruff, Headquarters in formed the group that the Department-wide Printing and Publishing Activities is currently in the concurrence

  10. Minutes from the January 20, 2010 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    , 2010 Printing and Mail Managers Exchange Forum Teleconference Twenty-one individuals participated in the Printing and Mail Managers Exchange Forum, which included Printing and Mail Managers and Contractors. Comments/Additions to last Months Minutes Dallas Woodruff, Headquarters opened the meeting by thanking everyone for participating in the today's teleconference. Printing Agenda Items... Update on the Department-wide Printing and Publishing Activities Report Three-Year Plan. Dallas Woodruff,

  11. Minutes from the July 21, 2010 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    July 21, 2010 Printing and Mail Managers Exchange Forum Teleconference Twenty-one individuals participated in the Printing and Mail Managers Exchange Forum, which included Printing and Mail Managers and Contractors. Comments/Additions to last Months Minutes Dallas Woodruff, Headquarters opened the meeting by thanking everyone for participating in the today's teleconference. Printing Agenda Items... Update on the Government Printing Office revisions to the Standard Form one (SF!), Twenty-five

  12. Minutes from the June 28, 2012 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    June 28, 2012 Mail discussion Al Majors opened the meeting by introducing United Parcel Service (UPS) Representative Shelly Scott. Ms. Scott's contact information is: Shelly Scott shellyscott@ups.com 404 402-9827 (cell) Ms. Scott discussed issues relating to various UPS services available to the department. Next Al introduced Michael R. Sanders, President and Chief Executive Officer of Intra-Mail Network, an innovative, information Technology Company that improves the delivery of mail or email

  13. Minutes from the May 26, 2010 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    26, 2010 Printing and Mail Managers Exchange Forum Teleconference Seventeen individuals participated in the Printing and Mail Managers Exchange Forum, which included Printing and Mail Managers and Contractors. Comments/Additions to last Months Minutes Dallas Woodruff, Headquarters opened the meeting by thanking everyone for participating in the today's teleconference. Printing Agenda Items... Update on the FY 2010, Congressional Joint Committee on Printing Commercial Printing Report "JCP

  14. Minutes from the November 01, 2012 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    November 1, 2012 Mail discussion Al Majors opened the meeting by introducing Derrick Milner, Program Manager from the General Services Administration, Office of Government-wide Policy. Mr. Majors and Mr. Miliner discussed the pending Official Mail Management Report for the FY-2012. The question on where to put data relating to certified and registered mail was addressed. It should be placed under the others section or under first class, standard delivery. Mr. Majors also discussed the pending

  15. Minutes from the November 17, 2010 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    November 17, 2010 Printing and Mail Managers Exchange Forum Teleconference Twenty seven individuals participated in the Printing and Mail Managers Exchange Forum, which included Printing and Mail Managers and Contractors Comments/Additions to last Months Minutes No comments. Printing Agenda Items......... Update on the Department-wide "Three-Year Plan" Dallas Woodruff, Headquarters opened the meeting by thanking everyone for providing their sites Three-Year Plan data to Headquarters in

  16. Minutes from the September 15, 2010 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    September 15, 2010 Printing and Mail Managers Exchange Forum Teleconference Twenty-four individuals participated in the Printing and Mail Managers Exchange Forum, which included Printing and Mail Managers and Contractors. Comments/Additions to last Months Minutes Dallas Woodruff, Headquarters opened the meeting by thanking everyone for participating in the today's teleconference. Printing Agenda Items... Upcoming FY 2010 Department-wide Three-Year Plan Dallas Woodruff, Headquarters informed the

  17. Headquarters Program & Staff Office Mailing Addresses | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Headquarters Program & Staff Office Mailing Addresses Headquarters Program & Staff Office Mailing Addresses The following addresses are for delivery of regular mail and small packages: Delivery to the Headquarters buildings in Washington, DC: Name of Individual Title Routing Symbol/Forrestal Building U.S. Department of Energy 1000 Independence Ave., S.W. Washington, DC 20585 Name of Individual Title Routing Symbol/L'Enfant Plaza Building U.S. Department of Energy 1000

  18. Mail-Order Metal-Organic Frameworks (MOFs): Designing Isoreticular...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mail-Order Metal-Organic Frameworks (MOFs): Designing Isoreticular MOF-5 Analogues Comprising Commercially Available Organic Molecules Previous Next List R. L. Martin, L.-C. Lin,...

  19. Minutes from the Print and Mail Managers Exchange Forum Teleconferences

    Broader source: Energy.gov [DOE]

    Minutes from the Print and Mail Managers Exchange Forum Teleconferences.  Contact the Office of Administrative Management and Support at (202) 586-4318 with any questions.

  20. Minutes from the May 3, 2012 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    http:www.gsa.govmailpolicy (for training options) https:www.intra-mail.com ... discussion Brainstorming discussion on methodsapproaches to reduce printing expenses: ...

  1. Publications

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Publications - Sandia Energy Energy Search Icon Sandia Home Locations Contact Us Employee Locator Energy & Climate Secure & Sustainable Energy Future Stationary Power Energy Conversion Efficiency Solar Energy Wind Energy Water Power Supercritical CO2 Geothermal Natural Gas Safety, Security & Resilience of the Energy Infrastructure Energy Storage Nuclear Power & Engineering Grid Modernization Battery Testing Nuclear Fuel Cycle Defense Waste Management Programs Advanced Nuclear

  2. Publications

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Damage Prognosis Publications-Damage Prognosis Journal articles for the topic Damage Prognosis. Contact Institute Director Charles Farrar (505) 663-5330 Email UCSD EI Director Michael Todd (858) 534-5951 Professional Staff Assistant Ellie Vigil (505) 667-2818 Email Administrative Assistant Rebecca Duran (505) 665-8899 Email Journal articles Gabbatto, M., Conte, J, Kosmatka, J. Farrar, C. R., "Reliability-Based Framework for Fatigue Damage Prognosis of Composite Aircraft Structures,"

  3. Publications

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Earthquake Engineering and Structural Dynamics Earthquake Engineering and Structural Dynamics Publications Journal articles are organized by date. Contact Institute Director Charles Farrar (505) 663-5330 Email UCSD EI Director Michael Todd (858) 534-5951 Professional Staff Assistant Ellie Vigil (505) 667-2818 Email Administrative Assistant Rebecca Duran (505) 665-8899 Email Journal articles D. Mascarenas, D. Macknelly, J. Mullins, H. Wiest and G. Park, "Dynamic characterization of satellite

  4. Publications

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Los Alamos Reports Los Alamos Reports Unless identified as SRD (Secret Restricted Data), these reports are available to the public from the National Technical Information Service, Springfield, VA. Contact Institute Director Charles Farrar (505) 663-5330 Email UCSD EI Director Michael Todd (858) 534-5951 Professional Staff Assistant Ellie Vigil (505) 667-2818 Email Administrative Assistant Rebecca Duran (505) 665-8899 Email Los Alamos Reports E. Figueiredo, G. Park, J. Figueiras, C. R. Farrar,

  5. Publications

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Sensors and Sensing Technologies Sensors and Sensing Technologies Publications Journal articles on Sensors and Sensing Technologies Contact Institute Director Charles Farrar (505) 663-5330 Email UCSD EI Director Michael Todd (858) 534-5951 Professional Staff Assistant Ellie Vigil (505) 667-2818 Email Administrative Assistant Rebecca Duran (505) 665-8899 Email Journal Articles Stull, C.J., Taylor, S. G., Wren, J., Mascarenas, D.L., Farrar, C. R., "Real-Time Condition Assessment of the Raptor

  6. Publications

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Directed Organization of Functional Materials at Inorganic-Macromolecular Interfaces Recent Publications R. Tunuguntla, M. Bangar, K. Kim, P. Stroeve, C.M. Ajo-Franklin, A. Noy, "Lipid Bilayer Composition can Influence the Orientation of Proteorhodopsin in Artificial Membranes", Biophys. J., accepted (2013) A. Noy "Kinetic model of gas transport in carbon nanotube channels", The Journal of Physical Chemistry C 117, 7656 (2013) A. Noy, R.W. Friddle "Practical single

  7. NREL Publications Win Awards

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Publications Win Awards For more information contact: e:mail: Public Affairs Golden, Colo., April 17, 1998 — Six publications written at the U.S. Department of Energy's National Renewable Energy Laboratory earned international awards from the Society for Technical Communications (STC). The awards were part of STC's International Technical Publications Competition. Fifteen publications (including the six international winners) also won awards in STC's Rocky Mountain Chapter's annual

  8. VPP Program Document | Department of Energy

    Office of Environmental Management (EM)

    VPP Program Document VPP Program Document VPP Program Document PDF icon VPP Program Document part I PDF icon VPP Program Document Part II PDF icon VPP Program Document Part III PDF icon VPP Program Document Part IV More Documents & Publications Voluntary Protection Program Onsite Review, Idaho Cleanup Project- June 2007 Voluntary Protection Program Onsite Review, Waste Isolation Pilot Plant - March 2009 Voluntary Protection Program Onsite Review, CH2M HILL Analytical Technical Services -

  9. Document Splash Screen for Redirecting to Updated Document

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Services » Document Library Document Library May 10, 2016 Integrated Waste Management and Consent-Based Siting Booklet Integrated Waste Management and Consent-Based Siting Booklet May 9, 2016 Document Library Consent-Based Siting Public Meeting in Denver (May 24, 2016) Consent-based siting public meeting in Denver. April 28, 2016 Quarterly Nuclear Deployment Scorecard - April 2016 News items on TVA Early Site Permit, UAMPS site use permit, south texas project license, PSEG early site permit.

  10. Publications

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Fundamental Mechanisms of Transient States in Materials Quantified by DTEM Recent Publications N.D. Browning, M.A. Bonds, G.H. Campbell, J.E. Evans, T. LaGrange, K.L. Jungjohann, D.J. Masiel, J. McKeown, S. Mehraen, B.W. Reed, M. Santala, "Recent Developments in Dynamic Transmission Electron Microscopy," Current Opinion in Solid State and Materials Science, 16 [1] 23 - 30 (2012). Thomas LaGrange, Bryan W. Reed, Melissa Santala, Joseph McKeown, Andreas Kulovits, Jörg M. K. Wiezorek,

  11. Untitled Document

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    For questions on the Environmental Assessment for Conducting Astrophysics and Other Basic Science Experiments at the WIPP Site, email Harold.Johnson@ or call (505) 234-7349. Environmental Assessment for Conducting Astrophysics and Other Basic Science Experiments at the WIPP Site Final - January, 2001 This document has been provided to you in PDF format. Please install Adobe Acrobat Reader before accessing these documents. Cover Sheet, Table of Contents, List of Tables, List of Figures, and

  12. Document Library | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Services » Document Library Document Library May 10, 2016 Integrated Waste Management and Consent-Based Siting Booklet Integrated Waste Management and Consent-Based Siting Booklet May 9, 2016 Document Library Consent-Based Siting Public Meeting in Denver (May 24, 2016) Consent-based siting public meeting in Denver. April 28, 2016 Quarterly Nuclear Deployment Scorecard - April 2016 News items on TVA Early Site Permit, UAMPS site use permit, south texas project license, PSEG early site permit.

  13. Alternative Fuels Data Center: Publications

    Alternative Fuels and Advanced Vehicles Data Center [Office of Energy Efficiency and Renewable Energy (EERE)]

    Publications Printable Version Share this resource Send a link to Alternative Fuels Data Center: Publications to someone by E-mail Share Alternative Fuels Data Center: Publications on Facebook Tweet about Alternative Fuels Data Center: Publications on Twitter Bookmark Alternative Fuels Data Center: Publications on Google Bookmark Alternative Fuels Data Center: Publications on Delicious Rank Alternative Fuels Data Center: Publications on Digg Find More places to share Alternative Fuels Data

  14. Alternative Fuels Data Center: Publications

    Alternative Fuels and Advanced Vehicles Data Center [Office of Energy Efficiency and Renewable Energy (EERE)]

    Publications Printable Version Share this resource Send a link to Alternative Fuels Data Center: Publications to someone by E-mail Share Alternative Fuels Data Center: Publications on Facebook Tweet about Alternative Fuels Data Center: Publications on Twitter Bookmark Alternative Fuels Data Center: Publications on Google Bookmark Alternative Fuels Data Center: Publications on Delicious Rank Alternative Fuels Data Center: Publications on Digg Find More places to share Alternative Fuels Data

  15. Untitled Document

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Remote-Handled Transuranic Waste Study - Main Menu DOE/CAO 95-1095 REMOTE-HANDLED TRANSURANIC WASTE STUDY U.S. Department of Energy Carlsbad Area Office Carlsbad, New Mexico October 1995 This document has been reproduced directly from the best possible copy. It is available to DOE and DOE contractors at the following address: Office of Scientific and Technical Information P. O. Box 62 Oak Ridge, TN 37831 For prices contact (615) 576-8401 The local WIPP contact for this document is George

  16. Civilian Radioactive Waste Management System Requirements Document |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy Civilian Radioactive Waste Management System Requirements Document Civilian Radioactive Waste Management System Requirements Document This document specifies the top-level requirements for the Civilian Radioactive Waste Management System (CRWMS). The document is referred to herein as the CRD, for CRWMS Requirements Document. PDF icon Civilian Radioactive Waste Management System Requirements Document More Documents & Publications FY 2007 Total System Life Cycle Cost,

  17. Presidential Documents

    Energy Savers [EERE]

    425 Federal Register / Vol. 80, No. 23 / Wednesday, February 4, 2014 / Presidential Documents Executive Order 13690 of January 30, 2015 Establishing a Federal Flood Risk Management Standard and a Process for Further Soliciting and Considering Stakeholder Input By the authority vested in me as President by the Constitution and the laws of the United States of America, and in order to improve the Nation's resilience to current and future flood risk, I hereby direct the following: Section 1.

  18. Minutes from the October 26, 2011 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Woodruff also said the files are due back to Headquarters no later November 11, 2011, and the report is due to congress by February 10, 2012. Mail Agenda Items...... Fiscal ...

  19. AFFECTED DOCUMENT

    Office of Legacy Management (LM)

    ADMIN RCD _ COMM REF _ RESPONSE TRACKING INFORMAnON I lOWED BY: (ORG) I TARGET DATE I I I CLOSING CCN COMPL. DATE I I CLOSING REF I I lOWED BY: (ORG) I I I I I TARGET DATE I CLOSING CCN COMPL DATE CLOSING REF TECHNICAL SERVICES DIVISION (TSD) BACKFIT (Documents dated prior to 1 November 1988) FUSRAP COMMUNICATIONS DISTRIBUTION DOEIORO TECHNICAL SERVICES DIVISION (CE-53) BECHTEL NATIONAl.. INC. - JOB 14501 AI$Wl E.e... COMM DATE b~5i=-'/T-'-I'''' ADDR CODE I I I I CLOSES CCN WBS 1/~ .. :2 O~

  20. AFFECTED DOCUMENT

    Office of Legacy Management (LM)

    rr-osams ADMIN RCD _ RESPONSE TRACKING INFORMATION I 'OWED BY: (ORG) I TARGET DATE { I CLOSING CCN COMPL. DATE { CLOSING REF I I lOWED BY: (ORG) { { I { { TARGET DATE I CLOSING CCN COMPL DATE CLOSING REF TECHNICAL SERVICES DIVISION (TSD) BACKFIT (Documents dated prior to 1 November 1988) FUSRAP COMMUNICATIONS DISTRIBUTION DOEIORO TECHNICAL SERVICES DIVISION (CE*53) BECHTEL NATIONAL, INC. -JOB 14501 _-....Iome....:.-R..%.JI&~S::....:::S.::...- TO_---.,!5~Z~IJ~u..~ COMM DATE &6 tlJ t.e

  1. Untitled Document

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Repository Science In the U.S., nuclear weapons production and commercial nuclear power plants have generated large quantities of radioactive materials. Providing for safe, secure, and transparent disposal of these radioactive materials promotes implementation of some arms reduction processes, reduces proliferation potential, and develops public confidence in continued use of nuclear power. It is widely accepted that the safest and most secure method for disposal of radioactive materials is

  2. Documentation Feedback | Argonne Leadership Computing Facility

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Documentation Feedback We appreciate your feedback on our user documentation. Your comments and suggestions will help us to better serve your needs as we continue to build user guides for our newest computing resources. First Name * Last Name * Feedback * E-mail Address * Verification * Refresh Type the characters you see in this picture. Type the characters you see in the picture; if you can't read them, submit the form and a new image will be generated. Not case sensitive. Switch to audio

  3. WINDExchange: Document Not Found

    Wind Powering America (EERE)

    EERE Logo WINDExchange WINDExchange Document Not Found The page you are looking for is no longer available. The U.S. Department of Energy Wind Program's stakeholder and engagement outreach information is now available through WINDExchange. WINDExchange continues DOE's efforts to make high-quality information and outreach materials readily available, including: maps of wind resources and installed wind capacity a bimonthly e-newsletter webinars and podcasts publications educational programs

  4. EFRC Management Reference Document

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    EFRC management reference document Energy Frontier Research Centers Acknowledgments of Support (v.1, October 2009) Office of Basic Energy Sciences Office of Science US Department of Energy How to Acknowledge Basic Energy Sciences-Energy Frontier Research Center (BES-EFRC) funding in papers, presentations, and other materials: For a publication on work supported wholly under your EFRC, the acknowledgement should at a minimum state that "This material is based upon work supported as part of

  5. Untitled Document

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    responses What do you think are the most important advances in nuclear reaction dynamics in the Fermi energy regime that you have been involved with during the past twenty years? What do you think are the most important advances made by others in the field? Anticipating our efforts to communicate with physicists from other fields or with the general public what, in your opinion, are the most important results coming from our field? How do these results impact other fields? What do you think are

  6. Untitled Document

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    questionnaire for the critical status report on recent progress in the studies of nuclear reaction dynamics and the equation of state in the Fermi energy regime The goal of this questionnaire is to gather the maximum input from the community about the important achievements and open questions of our field. It should not be interpreted as a public vote on science, but as a way to sort out the points of consensus and the points of debate in order to prepare the workshop. All answers will be taken

  7. Corel Office Document | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Corel Office Document Corel Office Document PDF icon Corel Office Document More Documents & Publications Microsoft Word - info quality guidelines updated 3-7-11.docx Final Report Implementing Office of Management and Budget Information Dissemination Quality Guidelines (DOE, 2002) Final Information Quality Bulletin for Peer Review

  8. CMI Guidance Documents | Critical Materials Institute

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    CMI Guidance Documents This page has links to pdf versions of CMI Guidance Documents for CMI staff: Publication process flow chart Acknowledgement text Foreign travel Press releases IP protection The Microsoft Word versions of these, and additional guidance documents, are available in the data storage server. Tags: guidance document

  9. Mailing Addresses and Information Numbers for Operations, Field, and Site

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Offices | Department of Energy About Energy.gov » Mailing Addresses and Information Numbers for Operations, Field, and Site Offices Mailing Addresses and Information Numbers for Operations, Field, and Site Offices Name Telephone Number U.S. Department of Energy Ames Site Office 111 TASF, Iowa State University Ames, Iowa 50011 515-294-9557 U.S. Department of Energy Argonne Site Office 9800 S. Cass Avenue Argonne, IL 60439 630-252-2000 U.S. Department of Energy Berkeley Site Office Berkeley

  10. PBL Document "Queue" (pbl/news)

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    that allows authorized BPA employees to quickly make documents available on the Power Services Site in advance of their official web site publication. Please note the...

  11. FOIA Frequently Requested Documents: Definitized Subcontract...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ZDO-2-30628-09. Subcontract between Midwest Research Institute National Renewable Energy Laboratory and ... More Documents & Publications CO2 Heat Pump Water Heater Prototype
    ...

  12. TEC Working Group Topic Groups Rail Key Documents Intermodal...

    Office of Environmental Management (EM)

    Intermodal Subgroup TEC Working Group Topic Groups Rail Key Documents Intermodal Subgroup Intermodal Subgroup PDF icon Draft Work Plan More Documents & Publications TEC Working...

  13. Sandia Energy - Customer Interface Document for the Molten Salt...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Customer Interface Document for the Molten Salt Test Loop at the NSTTF Home Partnership News News & Events Publications Customer Interface Document for the Molten Salt Test Loop at...

  14. Cray XE Documentation

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Cray XE Documentation Cray XE Documentation Last edited: 2014-01-22 15:12:50

  15. E-mail et Web : pour une navigation sans risque

    ScienceCinema (OSTI)

    None

    2011-10-06

    Présentation orale en français, support visuel en anglais. À travers des exemples concrets, vous consoliderez vos connaissances et pourrez ainsi réajuster vos habitudes concernant l?utilisation sécurisée de votre boîte e-mail et de votre navigateur Web.

  16. This form may be submitted to the EIA by mail, fax, e-mail, or...

    U.S. Energy Information Administration (EIA) Indexed Site

    under the Federal Energy Administration Act of 1974 (Public Law 93-275). Failure to comply may result in criminal fines, civil penalties and other sanctions as provided by law. ...

  17. This form may be submitted to the EIA by mail, fax, e-mail, or...

    U.S. Energy Information Administration (EIA) Indexed Site

    "REPORT YEAR 2011" "This report is mandatory under Public Law 93-275. Failure to comply may result in criminal fines, civil penalties and other sanctions as provided by law. ...

  18. CSC Public Meeting Agenda | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Public Meeting Agenda CSC Public Meeting Agenda PDF icon CSC Public Meeting Agenda More Documents & Publications 2012 Peer Review Overview Agenda FINALAPRILSEABAGENDA.pdf Spectrum ...

  19. ARM - XDC Documentation

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Documentation External Data Center Order Data Description of External Data Streams Data Viewers and Plots (selected data sets) XDC Documentation XDC Documentation BNL's ARM Related...

  20. ARM - Data Documentation

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Documentation Policies, Plans, Descriptions Data Documentation Home Data Sharing and Distribution Policy Data Management and Documentation Plan Data Product Registration and ...

  1. Using regulations.gov to find dockets and documents

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    regulations.gov to find dockets and documents Regulations.gov is a web-based repository of Federal regulatory documents. Publicly accessible documents associated with DOE Appliance and Equipment Standards rulemakings and related Federal Register notices are now accessible on regulations.gov On regulations.gov, you can: View Proposed and Final Rules and other regulatory documents or notices Read public comments, as well as public meeting presentations and transcripts These documents are part of a

  2. MIE Milestone Documents | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    MIE Milestone Documents MIE Milestone Documents PDF icon 2014 MIE Year One Anniversary Forum Booklet PDF icon Congressional Forum on Minorities in Energy More Documents & Publications Program Booklet - November 13 2013 Before the House Subcommittee on Energy and Power, Committee on Energy and Commerce Minorities in Energy Strategic Plan

  3. V-147: IBM Lotus Notes Mail Client Lets Remote Users Execute...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    7: IBM Lotus Notes Mail Client Lets Remote Users Execute Java Applets V-147: IBM Lotus Notes Mail Client Lets Remote Users Execute Java Applets May 2, 2013 - 6:00am Addthis...

  4. Mail-Order Metal-Organic Frameworks (MOFs) | Center for Gas

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    SeparationsRelevant to Clean Energy Technologies | Blandine Jerome Mail-Order Metal-Organic Frameworks (MOFs)

  5. Minutes from the February 23, 2012 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Minutes Printing and Mail Managers Exchange Forum Teleconference February 23, 2012 Participants: Headquarters (5) National Energy Technology Laboratory, PA National Security Complex Y-12 (2) Oak Ridge National Laboratory Y-12 Site Office (2) Hanford Site Office Oak Ridge Association University Oak Ridge Operations Office BWXT Pantex Site Office JanTec Corporation, Richland, Washington Los Alamos National Laboratory Chicago Office Bettis Atomic Power Laboratory National Security Technology C1,

  6. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    of the Asymmetry Parameter and Volume Extinction Coefficient in Arctic Clouds Gerber, H., Gerber Scientific; Garrett, T.J., University of Washington; Hobbs, P.V.,...

  7. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Characterizating Stratiform Clouds Variability from Millimeter-Wave Radar Data Kogan, Z.N.(a), Mechem, D.B.(b), and Kogan, Y.L.(c), Cooperative Institute for Mesoscale...

  8. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Great Plains Region from Multiple Satellites Trishchenko, A.P.(a), Li, Z. (a,b), and Park, W. (a), Canada Centre for Remote Sensing, Ottawa, Canada (a), Now at ESSIC, Department...

  9. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    View Observations Ma, Y.-T.(a) and Ellingson, R. G.(b), University of Maryland at College Park (a), Florida State University (b) Twelfth Atmospheric Radiation Measurement (ARM)...

  10. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    with ARM WSI Musat, I.C.(a) and Ellingson, R.G.(b), University of Maryland at College Park (a), Florida State University (b) Twelfth Atmospheric Radiation Measurement (ARM)...

  11. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    A Subgrid Representation of Precipitating Marine Boundary Layer Clouds Leung, L.R., and Ghan, S.J., Pacific Northwest National Laboratory; Feingold, G., Cooperative Institute for...

  12. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    hours are estimated based on incomplete raw data; we have developed criteria for choosing between this estimate and imputing from adjacent hours or sites. An objective...

  13. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Measurement (ARM) Science Team Meeting ARMs newest site at Darwin in Northern Australia has been collecting data since April 2002. This poster will present a view of the...

  14. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    remote sensing (including the University of Utah high-resolution Polarization Diversity Lidar, W-band Doppler radar, and radiometer), thermodynamic, synoptic, and all-sky imagery...

  15. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Sizes, Fractional Coverage, and Radar Doppler Moments Profiles of Fair-Weather Cumulus Clouds at the TWP ARM Site Kollias, P., Albrecht B.A., and Dow B.J., University of Miami...

  16. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Effects of Pyrgeometer Dome Heating on Calculated Longwave Radiation Richardson, S.J., University of Oklahoma Eleventh Atmospheric Radiation Measurement (ARM) Science Team Meeting...

  17. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    formation as part of a constellation of satellites including Aqua, CALIPSO, PARASOL and Aura. We develop an algorithm that will be implemented operationally to identify significant...

  18. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    D.A.(a) and Charlock, T.P.(b), Analytical Services & Materials Inc.(a), Atmospheric Sciences Competency, NASA Langley Research Center (b) Twelfth Atmospheric Radiation...

  19. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mining the ARM Data Set: A WWW-Staged Prototype Relational Database of ARM Data Mace, G.G. and Hudach, D.P., University of Utah Twelfth Atmospheric Radiation Measurement (ARM)...

  20. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    from Narrow-Field-of-View Spectral Radiometers Marshak, A.(a), Knyazikhin, Y.(b), Evans, K.(c), and Wiscombe, W.(a), NASAGSFC (a), Boston University (b), UMBCJCET (c)...

  1. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    of Cumulus Cloud Fields for Solar Radiative Transfer Pincus, R.(a), Hannay, C.(a), and Evans, K.F.(b), NOAA-CIRES Climate Diagnostics Center (a), University of Colorado (b)...

  2. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Forcing Over the Beaufort Sea and North Slope of Alaska Key, E.L.(a), Minnett, P.J.(a), Evans, R.H.(a), and Papakyriakou, T.N.(b), University of Miami, RSMAS (a), University of...

  3. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Between 3-D Model Computations and Spectral and Broadband Observations of Column Solar Radiation Absorption During ARESE II O'Hirok, W. (a), Gautier, C. (a), Ellingson,...

  4. ARM - Publications: Science Team Meeting Documents: Characterization...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    at SIRTA Haeffelin, Martial Institut Pierre Simon Laplace Chepfer, Helene IPSL LMD, France Protat, A. Institut Pierre Simon Laplace Morille, Y. Institut Pierre Simon Laplace...

  5. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Y., Institut Pierre Simon Laplace, Laboratoire de Mtorologie Dynamique, Palaiseau, France (a), University of California at Santa Barbara, USA (b) Institut Pierre Simon...

  6. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Jensen, M.P.(a) and DelGenio, A.D.(b), Department of Applied Physics and Applied Mathematics, Columbia University, NASA GISS (a), NASA GISS (b) Twelfth Atmospheric Radiation ...

  7. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Observations of Mid-level Convective Clouds During Nauru99 Jensen, M.P.(a) and Del Genio, A.D.(b), Department of Applied Physics and Applied Mathematics, Columbia University NASA ...

  8. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Humidity Measurements at the ARM SGPCART Site Soden, B.J. (a), Turner, D.D. (b), and Goldsmith, J.E.M. (c), NOAAGFDL (a), Pacific Northwest National Laboratory (b), Sandia...

  9. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    R.A.(a), Turner, D.D.(b), Clayton, M.B.(c), Brasseur, L.H.(c), Tooman, T.P.(d), Goldsmith, J.E.M.(d), Ogren, J.(e), and Andrews, E.(f), NASA Langley (a), Pacific Northwest...

  10. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    E.V. (a), Kooi, S.A. (b), Brasseur L.H. (b), Clayton, M.B. (b), Brackett, V. (b), Goldsmith, J.E.M. (c), Whiteman, D.N. (d), and Barrick, J. (a), NASA Langley Research Center...

  11. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    the CARL UT water vapor profiles. Incorporating the temperature dependence of the Raman water vapor filter response would also slightly reduce the CARL UT water vapor...

  12. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Narrowband, Narrow Field-of-View Fast Infrared Filter Radiometry: Future Operation at CART Sites and Some Aspects of Water Vapor Absorption and Emission Platt, C.M.R. (a), Bennett,...

  13. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Cohn, S.A. (a), and Yoneyama, K. (b), National Center for Atmospheric Research (a), Japan Marine Science and Technology Center (b) Eleventh Atmospheric Radiation Measurement...

  14. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Dong, X., Analytical Service and Materials, Inc. Ackerman, T.P., The Pennsylvania State University; Liljegren, J.C., Ames Laboratory Ninth Atmospheric Radiation Measurement...

  15. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Scientific themes driving the needs for such a site are for example: - dynamics, thermodynamics, and microphysics of clouds - radiative forcing of clouds and aerosols - dynamics...

  16. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    model is employed to quantify the influence of the stochastic approach on model thermodynamics for times when broken cloud fields were observed in the Spring of 1998. In the...

  17. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    G.L., and Labonnote, L., Colorado State University This poster presents some inferred properties of cirrus clouds by using data from a suite of instruments flown in the PROTEUS...

  18. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    they be used to accurately predict the downwelling surface fluxes observed by collocated instruments? We retrieve vertical profiles of liquid and ice cloud properties from several...

  19. ARM - Publications: Science Team Meeting Documents: Millimeter...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    the 183.31 GHz water vapor resonance line. The combination of 0.1 K delta T measurement precision and less than 1 K accuracy integrated hot (350 K) and warm (300 K) calibration...

  20. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Radiation Measurement (ARM) Science Team Meeting Our goal for this study was to determine any measurable effects of the present maintenance schedule for broadband shortwave...

  1. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    If we want to determine the top of the atmosphere aerosol radiative forcing with the accuracy of 0.5 Wm2 we need to know the aerosol optical depth (AOD) over the land with the...

  2. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    for computing the single-scattering properties of spheroidal particles using the Separation of Variables Method (SVM). The single-scattering properties are needed for every...

  3. ARM - Publications: Science Team Meeting Documents: Investigation...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Investigation of the impact of aerosols on clouds during the 2003 Aerosol IOP at the SGP Guo, Huan University of Michigan Aerosol-cloud interaction, that is, the aerosol indirect...

  4. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    D. (b), and Orr, B. (b), Cooperative Institute for Research in Environmental Science, University of Colorado, Boulder (a), Environmental Technology Laboratory, National Oceanic...

  5. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    EPIC Hazen, D.A.(a), Westwater, E.R.(b), and Fairall, C.W.(a), NOAA-ETL (a), CIRES (University of ColoradoNOAA-ETL (b) Twelfth Atmospheric Radiation Measurement (ARM)...

  6. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    thickness of optically thick clouds is retrieved. In this paper we describe the THOR system, demonstrate that the halo signal is stronger for thicker clouds, and validate...

  7. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Science and Engineering Services, Inc. of Burtonsville, Maryland, has studied the feasibility of constructing a Micropulse Raman Lidar for measuring boundary layer water vapor...

  8. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Large Eddy Simulations of Fair-Weather Cumulus Case at SGP Site Zhu, P. and Albrecht, B.A., University of Miami Twelfth Atmospheric Radiation Measurement (ARM) Science Team Meeting...

  9. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Using GFS Weather Model to Reduce Diurnal Differences Between GPS PW and ARM MWR PW Van Hove, T.(a), Liljegren, J.C.(b), Rocken, C.(a), and Braun, J.(a), University Corporation for...

  10. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    ... Comparison of Mesoscale Model and Tower Measurements of Surface Fluxes During Winter Icing ... Data Assimilation of the Winter Icing and Storms ProgramAtmospheric Radiation ...

  11. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    not successful owing to the aircraft's inability to fly under severe icing conditions. ... Extensive research is underway on the topic of icing mitigation. A limited but successful ...

  12. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Research, Inc. (a) University of Wisconsin - Madison (b) Thirteenth Atmospheric Radiation Measurement (ARM) Science Team Meeting For the first time since its inception, a...

  13. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    and pyranometer instruments supported by spectral information from the AERI and RSS instruments. The specification of the molecular and cloud characteristics in the column is...

  14. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    cloud products and the ARM SGP observation for individual cirrus cloud and stratus cloud cases. At the same time, statistical comparison of optically thin cirrus clouds is also...

  15. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Dust-Climate Interactions: A Conceptual Model Shell, K. M. and Somerville, R. C. J., Scripps Institution of Oceanography, University of California, San Diego Thirteenth Atmospheric...

  16. ARM - Publications: Science Team Meeting Documents: Establishing...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Delamere, Jennifer Atmospheric and Environmental Research, Inc. Turner, David Pacific ... Atmospheric Emitted Radiance Interferometer measurements (ARM 2005 Turner M-PACE poster). ...

  17. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Cirrus Cloud Optical Properties Derived from AERI Measurements DeSlover, D.H.(a) and Turner, D.D.(b), University of Wisconsin - Madison; Cooperative Institute for Meteorological ...

  18. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Correction of Sonde Upper Tropospheric Humidity Through Radiance Assimilation Soden, B.J.(a), Turner, D.D.(b), and Lesht, B.M.(c), NOAAGFDL (a), Pacific Northwest Natinal ...

  19. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AERI-Measured Cirrus Cloud Optical Depth and Particle Size DeSlover, D.H.(a), Turner, D.D.(b), and Knuteson, R.O.(a), University of Wisconsin-Madison(a) Pacific Northwest National ...

  20. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Photon Counting Issues for the CART Raman Lidar Turner, D.D., Pacific Northwest National Laboratory; Whiteman, D.N., NASAGoddard Space Flight Center Eighth Atmospheric Radiation ...

  1. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    shapes such as spheroids, cylinders, and even hexagonal columns with aspect ratios near unity, but not for general particle shapes. A Monte Carlo approach to single scattering...

  2. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    in conventional approach. However, for rarer large drops, the exponents fall below unity for scales between the smallest sampling volume and a "saturation" scale. At these...

  3. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    The Global Energy and Water Cycle Experiment (GEWEX) Surface Radiation Budget Project ... the Layered Bispectral Threshold Method (LBTM, see Khaiyer et al., 2001 this conference). ...

  4. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    ... Cribb, M. Developing a Multi-Year Surface Radiation Budget Dataset in Support of Model ... Cruz-Pol, S. Sample Observations from the 2001 Multi-Frequency Radar IOP Curry, J.A. ...

  5. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    A-band) versus cloud optical depth observed by Pfeilsticker 1999 and Min et al. 2001. ... Gamma-ICA model for the solar radiation budget in GCM grid-scale domains Barker, 1996. ...

  6. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    UIC Science Division Barrow (c) Over the past year, the NSAAAO CRS has seen a lot of action. In July, 2003, the DOE Office of Biological and Environmental Research announced...

  7. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    State University in Bozeman, Montana in development and application of optical remote sensors, including lidars and radiometers. The remote sensor program builds on...

  8. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Retrieving Cloud Height Using Infrared Thermometer Measurements Sengupta, M., and Long, C.N., Pacific Northwest National Laboratory Thirteenth Atmospheric Radiation Measurement...

  9. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    community. Aeromet has long been concerned about the impact of these clouds on airborne infrared and optical sensors and has conducted airborne studies of high-altitude tropical...

  10. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    of energy reflected affect cloud albedo. The difference between reflection by "bumpy" and plane-parallel clouds is greatest when both clouds and bumps are optically thick and solar...

  11. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    aircraft and ground radiometers we need to reach closure. Based on spectral fluxes from Solar Spectral Flux Radiometer (SSFR) and other ARESE II instruments, we made a...

  12. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    (3D) radiative transfer model has been developed to simulate the transfer of solar and thermal infrared radiation in inhomogeneous cirrus clouds. The model utilizes a...

  13. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Atmospheric Radiation Measurement (ARM) Science Team Meeting Domain-averaged, broadband solar radiative budgets for an evolving tropical mesoscale convective cloud system are...

  14. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    with Supercooled Liquid Water Generating Heads from the SGP Central Facility Campbell, J.R.(a), Welton, E.J.(b), Spinhirne, J.D.(c), Starr, D.O'C.(d), and Ferrare,...

  15. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Global Lidar Observations of Cloud and Aerosol Campbell, J.R. (a), Welton, E.J. (b), Spinhrine, J.D. (c), and Flynn, C.J. (d), Science Systems Applications, Inc. (a), University of...

  16. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    ARESE II Measurements of Broadband Absorptance Valero, F.P.J. (a), Bucholtz, A. (a), Bush, B.C. (a), Cess, R.D. (b), Leitner, A.S. (a), Pope, S.K. (a), and Tooman, T.P. (c),...

  17. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    A Data Correction Algorithm for Improved Measurement of Surface Insolation, by Bush, Valero, Simpson, and Bignone, J. Atmos. Res. and Ocean. Tech., Vol. 17, No. 2, pp....

  18. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Wang, Z. and Sassen, K., University of Utah Eleventh Atmospheric Radiation Measurement (ARM) Science Team Meeting The Atmospheric Radiation Measurements Program (ARM) is making ...

  19. ARM - Publications: Science Team Meeting Documents: Comparison...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Kollias, Pavlos RSMASUniversity of Miami Albrecht, Bruce University of Miami The Department of Energy (DOE) Atmospheric Radiation Measurements (ARM) Program operates a ...

  20. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Observational data from the Atmospheric Radiation Measurements (ARM) Program at the Southern Great Plain (SGP) Oklahoma Central Facility and the Tropical Western Pacific (TWP) ...

  1. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    aircraft (RAMS), and surface (BSRN, SIROS, and RAMS) measurements of irradiance obtained during the Atmospheric Radiation Measurements Enhanced Shortwave Experiment (ARESE). ...

  2. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Proceedings of the Fourth Atmospheric Radiation Measurement (ARM) Science Team Meeting ... Modeling Objectives of the AtmosphericRadiation Measurement Program Bradley, M.M. ...

  3. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Cover image Proceedings of the Seventh Atmospheric Radiation Measurement (ARM) Science ... Observations During the Atmospheric Radiation Measurement Program Water Vapor ...

  4. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Proceedings of the Second Atmospheric Radiation Measurement (ARM) Science Team Meeting ... in Support of the Atmospheric Radiation Measurement Program Tropical Western ...

  5. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Proceedings of the Second Atmospheric Radiation Measurement (ARM) Science Team Meeting ... in Support of the Atmospheric Radiation Measurement Program T. Ackerman, B. ...

  6. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Proceedings of the Fourth Atmospheric Radiation Measurement (ARM) Science Team Meeting ... Session Papers Atmospheric Radiation Measurement Program--Unmanned Aerospace Vehicle: The ...

  7. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Proceedings of the Fifth Atmospheric Radiation Measurement (ARM) Science Team Meeting ... Instrument Development for Atmospheric Radiation Measurement (ARM): Status of the ...

  8. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Proceedings of the Sixth Atmospheric Radiation Measurement (ARM) Science Team Meeting ... Concept Verification Using Atmospheric RadiationMeasurement Southern Great Plains ...

  9. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Treatment Using a Single-Column Model and ARM Observations Iacobellis, S.F. (a), Mitchell, D.L. (b), and Somerville, R.C.J. (a), Scripps Institution of Oceanography (a),...

  10. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Water Content from Two-Dimensional Imagery Baker, B., Lawson, P., Schmitt, C., and Mitchell, D., SPEC, Inc. Thirteenth Atmospheric Radiation Measurement (ARM) Science Team...

  11. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Retrievals of Cirrus Cloud Physical Properties d'Entremont, R.P.(a) and Mitchell, D.L.(b), Atmospheric and Environmental Research, Inc. (a), Desert Research Institute...

  12. ARM - Publications: Science Team Meeting Documents: Deployment...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    approximately 1km apart. The instrument transmitter includes two arrays of nearIR LEDs which emit light in a 125-Hz pulsed mode. The receiver measures the temporal...

  13. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Particle Size Distributions Estimated During the 2001 Multi-Frequency Radar IOP Williams, C.R.(a) and Sekelsky, S.M.(b), University of Colorado at Boulder (a), University of...

  14. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Measurement (ARM) Science Team Meeting The focus of this study is to estimate the confidence intervals of the Atmospheric Radiation Measurement (ARM) Enhanced Shortwave...

  15. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    in the lidar beam. Theory shows that the multiple scattering is robustly related to the angular width of the diffraction peak in the scattering phase function and this width is a...

  16. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    data. The netcdf format is relatively compact, is capable of storing descriptive "meta-data" along with measurement data, and is platform-independent. However, platform...

  17. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    chamber measurements of ice cloud particle size spectra have been performed using three methods: a Forward Scattering Spectrometer Probe (FSSP), a video impactor or cloudscope,...

  18. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Parcel Model Simulations of Crystalline Clouds Using a New Treatment of Heterogeneous Ice Nucleation Development of the Heterogeneous Ice Nucleation Theory and Applications for the...

  19. ARM - Publications: Science Team Meeting Documents: Improved...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Improved Techniques for Deriving Thin Cirrus Cloud Heights from Daytime GOES Data Heck, Patrick University of Wisconsin Minnis, Patrick NASA Langley Research Center Khaiyer,...

  20. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    and models, and the coupling carbon, water and energy fluxes from natural and agricultural systems. The ARMLBNL Carbon project is making a coordinated suite of carbon...

  1. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Institute for Research in Environmental Sciences CMDL (c) Twelfth Atmospheric Radiation Measurement (ARM) Science Team Meeting Data collected during the SHEBA (Surface Heat...

  2. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Evaluation of MODIS Cloud Mask Products (MOD35) with MMCR Data Zhang, Q. and Mace, G.G., University of Utah Thirteenth Atmospheric Radiation Measurement (ARM) Science Team Meeting...

  3. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    K.-M.(c), BMRC (a), NOAACIRES CDC (b), NASA Langley (c) Thirteenth Atmospheric Radiation Measurement (ARM) Science Team Meeting It is highly desirable to use cloud radar data in...

  4. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    A Dataset of the Evaluation of Large-Scale Models Using ARM Data at Manus and Nauru Jakob, C. and May, P.T., BMRC Thirteenth Atmospheric Radiation Measurement (ARM) Science Team...

  5. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Application and Evaluation of Accelerated Radiative Transfer Schemes in General Circulation Models Gabriel, P., Stephens, G.L., and Partain, P.T., Colorado State University Ninth...

  6. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Evaluation of Cirrus Cloud Simulations Using ARM Data - Development of a Case Study Data Set Starr, D. (a), Demoz, B.D. (b), Lare, A. (c), Mace, G.G. (d), Sassen, K. (e),...

  7. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Using the Global Positioning System to Improve the Characterization of Water Vapor in the Southern Great Plains Braun, J., VanHove, T., and Rocken, C., University Corporation for...

  8. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    greater than 10% among intercomparisons of total integrated water vapor from Global Positioning System (GPS), Microwave Radiometers (MWRs), sondes, and solar radiometers....

  9. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    remote sensing instruments (lidars, radar, Microwave Radiometer MWR, Global Positioning System GPS-receiver, Infrared-radiometer, visual and Infrared video) was combined...

  10. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Science Team Meeting This is a new mid-latitude cirrus parameterization, based on our current analysis of 996 bimodal size distributions(SDs), obtained from 17 flights,...

  11. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Measurement (ARM) Science Team Meeting For reasons of computational efficiency, current radiation parameterizations in GCMs are uniformly based on analytical 2-stream...

  12. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    A.D.(a), and Minnis, P.(b), Analytical Services & Materials, Inc. (a), National Aeronautics and Space Administration-Langley Research Center (b) Twelfth Atmospheric Radiation...

  13. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Powell, D.M., and Reagan, J.A., University of Arizona; Spinhirne, J.D., National Aeronautics and Space Administration-Goddard Space Flight Center; Campbell, J.R., and Hlavka,...

  14. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    F., and McFarlane, S., University of Colorado, Boulder; Wiscombe, W., National Aeronautics and Space Administration-Goddard Space Flight Center Ninth Atmospheric Radiation...

  15. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    E.E., and Ackerman, T.P., The Pennsylvania State University; Kato, S., National Aeronautics and Space Administration-Langley Research Center Ninth Atmospheric Radiation...

  16. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    D.A., Analytical Services and Materials, Inc.; Minnis, P., and Young, D.F., National Aeronautics and Space Administration-Langley Research Center Ninth Atmospheric Radiation...

  17. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    maritime character. Coastal convection has been sampled by the recent CRYSTAL-FACE and EMERALD experiments. Therefore, we are proposing a large experiment that focuses on monsoonal...

  18. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    as calculated cloud forcing values allow an assessment of (1) cloud occurrence and morphology differences between the Arctic Coastal Zone and the Open Arctic Ocean, (2) how the...

  19. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Meeting Fair-weather cumuli are fundamental in regulating the vertical structure of water vapor and entropy in the lowest 2 km of the Earths atmosphere over vast areas of the...

  20. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    MODIS Data Alexandrov, M.D.(a,b), Marshak, A.(b), Cairns, B.(a,b), Lacis, A.A.(b), and Carlson, B.E.(b), Columbia University (a), NASA (b) Thirteenth Atmospheric Radiation...

  1. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Properties from Aircraft Measurements Over the SGP Cairns, B. (a), Lacis, A.A. (b), Carlson, B.E. (b), Alexandrov, A. (a), and Barnard, J.C. (c), Columbia University (a), NASA...

  2. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Scattering Albedo of Aerosols During the Aerosol IOP Cairns, B.(a), Gianelli, S.M.(a), Carlson, B.E.(b), and Lacis, A.A.(b), Columbia University (a), NASA GISS (b) Fourteenth...

  3. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    University of Utah, National Oceanic and Atmospheric Administration-Environmental Technology Laboratory Ninth Atmospheric Radiation Measurement (ARM) Science Team Meeting We...

  4. ARM - Publications: Science Team Meeting Documents: Evaluation...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    from the Ground-based Remote Sensing at SGP Kim, Byung-Gon Princeton University Klein, Stephen Lawrence Livermore National Laboratory Mace, Gerald University of Utah Benson, Sally...

  5. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Research (d), Pacific Northwest National Laboratory (e), NOAA ETL (f), Naval Postgraduate School (g) Thirteenth Atmospheric Radiation Measurement (ARM) Science Team Meeting ARM...

  6. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    T.P. (e), Remer, L. (f), and Gao, B-C. (g), NASA Langley Research Center (a), Science Applications International CorporationNASALaRC (b), Pacific Northwest National Laboratory ...

  7. ARM - Publications: Science Team Meeting Documents: Comparison...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Hallar, Anna NASA Ames Research Center Strawa, Anthony Ames Research Center Schmid, Beat ... Ogren, John NOAACMDL Ferrare, Richard NASA Langley Research Center Covert, David ...

  8. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Cahalan, R.F., NASAGoddard Space Flight Center Eleventh ... results may be found on the web at http:i3rc.gsfc.nasa.gov

  9. ARM - Publications: Science Team Meeting Documents: Evaluation...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Oreopoulos, Lazaros JCETUMBC and NASAGSFC Bacmeister, Julio GESTUMBC and NASAGSFC Cahalan, Robert NASAGoddard Space Flight Ctr913 Barker, Howard Meteorological Service of ...

  10. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Cahalan, R.F., Kolasinski, J., and McGill, M., NASAGoddard, Laboratory for Atmospheres ... obtained from the NASAGoddard THOR System (THOR THickness from Offbeam Returns). ...

  11. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    NASAGSFC Scanning Raman Lidar Measurements of Water Vapor and Cirrus Clouds During ... Schmidlin, F.J.(g), and Bosenberg, J.(h), NASAGoddard Space Flight Center (a), ...

  12. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    a function of temperature. Then using observed MODIS solar radiances for the CEPEX case study, the small mode was adjusted slightly to yield the observed radiances. We are...

  13. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    the diurnal cycle of convection seen at Darwin compared with other locations in the maritime continent and the TWP as well as ISCCP cluster analysis of the cloud and radiation...

  14. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Radiation Measurement (ARM) site. Results suggest that aerosol associated with maritime or northerly air trajectories tend to have a stronger effect on clouds than aerosol...

  15. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    records, and for capturing each of four broad classes of aerosol airmass types: maritime, biomass burning, desert dust, and continental aerosols. For instantaneous matchups...

  16. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Regional Climate System Model Pinto, J.O.(a), Curry, J.A.(b), Cassano, J.(a), and Lynch, A.H.(a), University of Colorado (a), Georgia Tech University (b) Thirteenth...

  17. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Instant Temperature Profiles in Winter and Summer Conditions and their Connection to the Variation of Radiation Field Koprov, B.M. and Golitsyn, G.S., A.M. Oboukhov Institute of...

  18. ARM - Publications: Science Team Meeting Documents: Spectral...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    results will be analyzed. Satellite and ground observations are available from the CCRS ftp site at ftp:ftp.ccrs.nrcan.gc.caadCCRSARM ftp:ftp.ccrs.nrcan.gc.caadCCRSARM...

  19. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Agents in ARM: Applying Artificial Intelligence to ARM Data Mining Kuchar, O.A. and Reyes-Spindola, J., Pacific Northwest National Laboratory Fourteenth Atmospheric Radiation...

  20. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Testing and improving radiation parameterization schemes and models in general requires a good knowledge of the SRB over a wide range of spatial and temporal scales under different...

  1. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Cloud Characteristics and Components of the Surface Heat Budget Curry, J.A., and Webster, P.J., University of Colorado; Clayson, C.A., Purdue University Eighth Atmospheric...

  2. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Such land ocean phase differences have been the topic of considerable research and debate. Many of the most widely studied diurnal variations, such as precipitation, cloud...

  3. ARM - Publications: Science Team Meeting Documents: Investigation...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    NASAGoddard Space Flight Center Starr, David NASAGoddard Space Flight Center Yang, Ping SSAINASA-GSFC Ice crystal formation occurs when the threshold energy to create...

  4. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Development of Consistent Cirrus Models for Use in the Satellite Community Yang, P. (a), Baum, B.A. (b), Nasiri, S.L. (c), Heymsfield, A.J. (d), McFarquhar, G.M. (d), Gao, B.-C....

  5. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Infrared Radiative Properties Stackhouse, P.W., Jr. (a), Mitchell, D.L. (b), and Yang, P. (c), NASA Langley Research Center (a), Desert Research Institute (b), NASA Goddard...

  6. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Irradiances Wendisch, M.(a, b), Pilewskie, P.(b), Heymsfield, A.J.(c), Schmitt, C.(c), Yang, P.(d), Pommier, J.(b), and Howard, S.(b), Leibniz-Institute for Tropospheric Research...

  7. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Spectral Irradiance During CRYSTAL-FACE Pilewskie, P.(a), Guan, H.(b), Platnick, S.(c), Yang, P.(d), Bergstrom, R.(b), Wendisch, M.(e), Howard, S.(b), and Pommier, J.(b), Ames...

  8. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    wind velocity was found. The estimates of the aerosol fluxes depending on both particle size and wind velocity were obtained. The model can be used for estimates of the radiative...

  9. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    (a), Mlawer, E.J. (a), Cady-Pereira, K. (a), Clough, S.A. (a), Stamnes, K. (b), and Bates, J.J. (c), Atmospheric and Environmental Research Inc. (a), Stevens Institute of...

  10. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Correlaton Between Satellite-Derived Water Cloud Microphysical Properties and ARM Aerosol Data at the SGP Smith, W.L., Jr.(a), Minnis, P.(a), Ferrare, R.A.(a), and Khaiyer,...

  11. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Evaluation of Terra Aerosol and Water Vapor Measurements Using ARM SGP Data Ferrare, R.A.(a), Brasseur, L.H.(b), Clayton, M.B.(b), Turner, D.D.(c), Remer, L.(d), and Gao, B.C.(e),...

  12. ARM - Publications: Science Team Meeting Documents: Retrieval...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Retrieval of optical thickness of low-level water cloud using the MSG multi-channel data Inoue, Toshiro MRIJMA We studied the optical thickness of low-level water cloud using MSG...

  13. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    with measurements. Within the limitations of SCMs, this comparison provides a straightforward evaluation of the realism of the parameterizations. In the case of cloud...

  14. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    model (see Zhang and Ramanathan abstract). Future improvements of the model are straightforward, as soon as more detailed data and self consistent microphysical information...

  15. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Inferring Optical Depth of Broken Clouds above Green Vegetation. Part I:Methodology for Surface- and Aircraft-based Observations Barker, H.W. (a), Marshak, A. (b), Pavloski C.F....

  16. ARM - Publications: Science Team Meeting Documents: Assessing...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Assessing the response of several GCMs to the McICA radiative transfer methodology Barker, Howard Meteorological Service of Canada Cole, Jason Meteorological Service of Canada...

  17. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    ... and Preliminary Results for Case 1 Kukla, G.J. Surface Solar Radiation in the United ... Larsen, N. Larson, N. A Comparison of Modeled and Measured Surface Shortwave Irradiance ...

  18. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Hollars, S.(a), Comstock, J.M.(b), Fu, Q.(a), and Ackerman, T.P. (a), University of ... anvil clouds will remain constant during climate change (Hartmann and Larson 2002). ...

  19. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    To infer values of direct solar irradiance using data from a Multi-Filter Rotating Shadowband Radiometer (MFRSR) and a broadband pyranometer measuring global horizontal irradiance. ...

  20. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Time Series Analyses* Effect of Stratus on Solar Radiation: A Study using Millimeter Wave Cloud Radar and Microwave Radiometer Data from the Southern Great Plains (SGP) ...

  1. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Near Real-Time Geographic Representation of Solar Radiation Measurement Data for the Southern Great Plains Network Brady, E., Gray-Hann, P., Anderberg, M.H.L., Wilcox, S.M., and ...

  2. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Association of the Cirrus Properties Over the Western Tropical Pacific with Tropical Deep Convection Deng, M.(a), Mace, G.G.(a), and Soden, B.J.(b), Univesity of Utah (a),...

  3. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    of Cirrus over the Western Tropical Pacific as a Function of Their Assocaition with Deep Convective Outflows Deng, M.(a), Mace, G.G.(a), and Soden, B.J.(b), University of Utah...

  4. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    due to atmospheric aerosols. Laboratory measurements are available for dry ammonium sulfate Toon and Pollack, 1976 over the spectral range 0.3 40 ?m, and for dry sea salt...

  5. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    episode for which a chemical transport and transformation model indicates that sulfate aerosol in a remote area of the North Atlantic experienced a substantial excursion...

  6. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    will be shown: one run with pre-industrial and the other run with present-day sulfate aerosol concentrations. The modeled solar radiation fluxes and total cloud coverage...

  7. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    have been approved by the STEC and the Engineering Change review process as ECO-00286. (1) The operating systems of all AERIs should be upgraded. (2) The temporal...

  8. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    vertical and horizontal components, variance and vertical flux of the prognostic thermodynamic variables as well as momentum flux are also presented. The most interesting aspect...

  9. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    cycle of continental shallow cumuli. Both subgrid cloud properties and the resolved thermodynamic structures and the surface energy budget are well simulated by the model. Using...

  10. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    ARM SGP domain, as a result of correlated subgrid-scale vertical velocity and thermodynamic structure, can reach 2000 Wm2 during strong convective events. This energy...

  11. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Impact of an Improved Longwave Radiation Model, RRTM, on the Energy Budget and Thermodynamic Properties of the NCAR Climate Model, CCM3 Iacono, M.J., Mlawer, E.J., and Clough,...

  12. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Finally, radiosonde soundings and MWR measurements are used to describe the thermodynamic regimes under which each of the regimes is likely to occur. Several conclusions...

  13. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    New Meteorological Applications Using AERI Thermodynamic Profiling Feltz, W.F.(a), Howell, H.B.(a), Knuteson, R.O.(a), Mecikalski, J.(b), Bedka, K.(a), Tanamachi, R.L.(c), and...

  14. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Project in the Southern Great Plains Torn, M.S.(a), Berry, J.(b), Riley, W.J.(a), Fischer, M.L.(a), Billesbach, B.(c), Helliker, B.(b), and Giles, L.(b), Lawrence Berkeley...

  15. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Carbon Monitoring at the ARM Southern Great Plains Site Torn, M.S. (a), Berry, J. (b), Fischer, M.L. (a), Billesbach, D. (c), Riley, W. (a), and Zhao, W. (a), Lawrence Berkeley...

  16. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Longwave Irradiance Uncertainty Philipona, R. (a), Dutton, E.G. (b), Wood, N. (b), Anderson, G. (b), Stoffel, T. (c), Reda, I. (c), Michalsky, J.J. (d), Wendling, P. (e),...

  17. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Inferring Cloud Optical Depth in Realistic Cumulus Fields: Error Analysis for Simulated and Observed Clouds Pavloski, C.F.(a), Clothiaux, E.E.(a), Barker, H.W.(b), Marshak, A.(c),...

  18. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Profiles of the aerosol extinctionbackscattering ratio, Sa, were derived from the CARL data acquired during 1998 and 1999. Large (>15%) variations in the vertical profile of Sa ...

  19. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    relation between the infrared absorption coefficient sa (km-1) and the temperature of cirrus clouds. The parameterizations sa 0.3963 + 6.175x10-3 T + 2.882x10-5T2 for ambient ...

  20. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    optical characteristics on variations of the relative humidity Rh of air. The particle growth factor, which can be found as the ratio of radii corresponding to the same value of...

  1. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Provide Useful Characterization of Ambient Atmospheric Conditions Bartholomew, M.J., Miller, M.A., and Smith, S., Brookhaven National Laboratory In the past the ARM project has...

  2. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Rate Profile (BBHRP) Value Added Product (VAP) OHirok, W.(a), Gautier, C.(a), and Miller, M.A.(b), University of California, Santa Barbara (a), Brookhaven National Laboratory...

  3. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Heating Rate Profile (BBHRP) VAP Mlawer, E.J.(a), Shippert, T.R.(b), Long, C.N.(b), Miller, M.A.(c), Johnson, K.L.(c), Troyan, D.T.(c), Mace, G.G.(d), Clough, S.A.(a), Zhang,...

  4. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Retrieval (MICROBASE): Status of SGP Version 1.2 and Prototype TWP Version Miller, M.A.(a), Johnson, K.L.(a), Jensen, M.P.(b), Mace, G.G.(c), Dong, X.(d), and...

  5. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    A Shipboard Fast-Rotating Shadowband Spectral Radiometer Reynolds, R.M., Miller, M.A., and Bartholemew, M.J., Brookhaven National Laboratory Ninth Atmospheric Radiation Measurement...

  6. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Structure Using Surface-Based Remote Sensors and Parameterized Microphysics Miller, M.A. and Johnson, K.L., Brookhaven National Laboratory Twelfth Atmospheric Radiation...

  7. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Across the TWP Regime Jensen, M.P.(a)(b), Del Genio, A.D.(b), Vogelmann, A.M.(c), Miller, M.A.(c), and Johnson, K.L.(c), Columbia University (a), NASAGISS (b), Brookhaven...

  8. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Evidence of Island Effects on Nauru Cole, H., and Miller, E., National Center for Atmospheric Research Ninth Atmospheric Radiation Measurement (ARM) Science Team Meeting Nauru...

  9. ARM - Publications: Science Team Meeting Documents: MICROBASE...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    MICROBASE, A Continuous Baseline Microphysical Retrieval: Status and Future Plans Miller, Mark Brookhaven National Laboratory Johnson, Karen Brookhaven National Laboratory Michael,...

  10. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Heating Rate Profile (BBHRP) VAP Mlawer, E.J.(a), Delamere, J.S.(a), Clough, S.A.(a), Miller, M.A.(b), Johnson, K.L.(b), Shippert, T.R.(c), Long, C.N.(c), Zhang, M.H.(d), Ferrare,...

  11. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Radiative Parameters of Stratus Clouds in ARESE II Austin, R.T. (a), Davis, J.M. (a), Miller, S.D. (b), and Stephens, G.L. (a), Colorado State University, Fort Collins (a), Naval...

  12. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    The MERGEDSOUNDING VAP: A Status Report and Description Miller, M.A.(a), Troyan, D.T.(a), and Mace, G.G.(b), Brookhaven National Laboratory (a), University of Utah (b) The...

  13. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    ARM Mobile Facility - Overview and Status Miller, M.A.(a), Widener, K.B.(b), and Jones, L.(c), Brookhaven National Laboratory(a) Pacific Northwest National Laboratory (b), Los...

  14. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Modes and the ARSCL VAP New Merge Strategy Kollias, P.(a), Clothiaux, E.E.(b), Miller, M.A.(c), Johnson, K.L.(c), Widener, K.B.(d), and Moran, K.P.(e), CIRESETL,...

  15. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Retrieval Utilizing Whole Sky Imagers Tooman, T.P., Sandia National Laboratories; Moore, S., and Sowle, D., Mission Research Corporation; Shields, J., Marine Physical...

  16. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Algorithms for GRAMS Fisk, M., Moore, S., Sowle, D., and Terry, D., Mission Research Corporation Ninth Atmospheric Radiation Measurement (ARM) Science Team Meeting Automated data...

  17. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Status Website Peppler, R.A.(a), Sonntag, K.L.(a), Dean, A.R.(a), Bahrmann, C.P.(a), Moore, S.T.(b), and Bottone, S.(b), Cooperative Institute for Mesoscale Meteorological...

  18. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Analysis for the Shortwave Spectrometer Fisk, M., Moore, S., Sowle, D., and Terry, D., Mission Research Corporation Ninth Atmospheric Radiation Measurement (ARM) Science Team...

  19. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Laboratory, Scripps Institution of Oceanography, University of California San Diego; Moore, S., and Sowle, D., Mission Research Corporation Ninth Atmospheric Radiation...

  20. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Data Analysis and Quality Control Software for ARM Datasets Moore, S.T., Sowle, D.H., and Fisk, M., Mission Research Corporation Eleventh Atmospheric Radiation Measurement (ARM)...

  1. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    They have the proper homogeneous and independent-column limits and have been coded in FORTRAN for fast flux calculations, including both solar and terrestrial radiation. This new...

  2. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    purpose programs is also pre-installed. * Adobe Acrobat Viewer * Cygnus GNU C and Fortran compilers * ftp client and server * GhostView postscript utilties * HyperSnapDX...

  3. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    along the 165E meridian. The next year, the entire 165E line (8N, 5N, 2N, 0, 2S, 5S, and 8S) was completed. Since that time, pyranometers have been placed on TAO buoys...

  4. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    others do not, two regions in the Pacific Ocean have been selected; a western region (5S-10N, 100E-170E) which incorporates the warm pool, and an eastern region (30S-0,...

  5. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    and Ricchiazzi,P. (a), ICESS, University California Santa Barbara (a), LMDCNRS, Paris, France (b) Eleventh Atmospheric Radiation Measurement (ARM) Science Team Meeting...

  6. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    of translucent clouds (the disk of the Sun is visible). Using the digital video camera KODAK DC200, mounted on the sun tracker, the sky images with the angle of view 38 0) have...

  7. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    aerosol, and height of smoke aerosol layer was estimated. It changed from several kilometers to hundreds meters. One of the main parameters, determining the effects of smoke...

  8. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    additional nine stations in 2000. The entire network covers approximately 40 square kilometers roughly centered around the SGP CF. This network constitutes a single instrument to...

  9. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    MPL profiles where no significant cloud or aerosol return is evident above a few kilometers. It assumes that the scattering above this range is purely Rayleigh molecular...

  10. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    cloud optical depth, on a variety of scales ranging from tens of meters to tens of kilometers, even for relatively uniform liquid water clouds. Retrievals of cloud effective...

  11. ARM - Publications: Science Team Meeting Documents: External...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    External Data Stream Review Wagener, Richard Brookhaven National Laboratory Ma, Lynn DOEBrookhaven National Laboratory Gregory, Laurie Brookhaven National Laboratory Tichler,...

  12. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Domain-Averaged Cloud Properties from the ARM Observations and Testing the PCLOS Models Ma, Y.(a) and Ellingson, R.G.(b), University of Maryland (a), Florida State University (b)...

  13. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Lagrangian Evolution of Cirrus Clouds Over the ARMCART Sites Soden, B.J.(a) and Mace, G.G.(b), NOAAGFDL (a), University of Utah (b) Thirteenth Atmospheric Radiation Measurement...

  14. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Optical Depth Using Spectrally Varying Surface Albedo: Frozen Turbulence vs. Time Evolution Barker, H.W.(a), Pavloski, C.F.(b), Ovtchinnikov, M.(c), Kassianov, E.(c),...

  15. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    The March 2000 Cloud Intensive Observing Period; The Evolution of the Synoptic-Scale Atmosphere and the Associated Cloud Radiative Forcing Mace, G.G.(a), Sonntag, K.L.(b), Kato,...

  16. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    H.-L.(b), University of Utah (a), EMCNCEPNOAA (b) Twelfth Atmospheric Radiation Measurement (ARM) Science Team Meeting Using cloud radar observations of cirrus cloud...

  17. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    In contrast however, Norris 2001 reported an increase in CC over the northern Indian Ocean between 1952 and 1996, when soot aerosol has presumably greatly increased. It remains ...

  18. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Links Between Mesoscale Dynamics and Cloud Water in High-Resolution March 2000 RAMS Simulations Weaver, C.P.(a), Gordon, N.D.(b), Norris, J.R.(b), and Klein, S.A.(d), Rutgers ...

  19. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Variability of Continental Liquid-Water Cloud and Its Parameterization Using ARM Data Kim, B.-G.(a), Klein, S.A.(b), and Norris, J.R.(c), Princeton University (a), GFDL (b), ...

  20. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Regional Atmospheric Modeling System (RAMS) Simulations of March 2000 IOP Frontal Clouds Weaver, C.P.(a), Gordon, N.D.(b), Norris, J.R.(c), and Klein, S.A.(d), Rutgers University ...

  1. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Towards Parameterization of Frontal Mesoscale Circulations and Cloudiness in GCMs Based on ARM Observations Norris, J.R.(a), Weaver, C.P.(b), Gordon, N.D.(c), and Klein, S.A.(d), ...

  2. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    forcing produces, perhaps, similar types of weather, or similar statistics. In Arctic research, breaking the year into seasons is also done to examine clouds synoptic-scale...

  3. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Effective Diameter in Radiation Transfer: Definition, Applications and Limitations Mitchell, D. L., Desert Research Institute Eleventh Atmospheric Radiation Measurement (ARM)...

  4. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    The International Intercomparison of 3-Dimensional Radiation Codes Cahalan, R.F., NASAGoddard Space Flight Center Twelfth Atmospheric Radiation Measurement (ARM) Science Team...

  5. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Retrieval of Ice Water Path, Ice Particle Size, and Shape Mitchell, D.L., Arnott, W.P., and Ivanova, D.C., Desert Research Institute Twelfth Atmospheric Radiation Measurement (ARM)...

  6. ARM - Publications: Science Team Meeting Documents: Comparison...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    chronicle the methods necessary to correct fixed platform measurements for aircraft pitch, roll and heading and will highlight the magnitude of the irradiance uncertainties...

  7. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Best Estimate Data Product Shippert, T.R., Pacific Northwest National Laboratory Eighth Atmospheric Radiation Measurement (ARM) Science Team Meeting The first ARM best estimate...

  8. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    ... Fan, T.-F. Determination of Ice-Water Path Over the ARM SGP Using Combined Surface and Satellite Datasets Fargion, G. Sun Photometer Laser and Lamp Based Radiometric Calibrations* ...

  9. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    For the surface data, the cloud-base height is derived laser ceilometer and cloud top height is derived cloud radar, and cloud temperatures are measured from ARM radiosonde ...

  10. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    demonstrate the potential for using MFRSR data, available over many parts of the globe, for validating satellite cloud retrievals in many different surface and atmospheric...

  11. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Evaluation of Simulated Clouds in the Community Atmospheric Model (CAM2): Over the Globe and at the ARM Site Zhang, M.H.(a) and Lin, W.Y.(a), Stony Brook University Thirteenth...

  12. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    column data from the NCEP Medium Range Forecast (MRF) model for various sites over the globe. Four of these sites coincide with ARM facilities at Manus, Nauru, Barrow, and the...

  13. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    The Impact of a Revised Treatment of Cirrus Microphysics on the Radiation Budget of the Unified Model Edwards, J.M. (a), Mitchell, D.L. (b), Ivanova, D. (b), and Wilson, D.R. (a), ...

  14. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    The Site and Computer Access Request System Doty, K.J.(a), Eagan, R.(b), Sisterson, D.L.(b), and Wagener, R.(a), Brookhaven National Laboratory (a), Argonne National Laboratory (b)...

  15. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    and the parameterization. The radiative properties contain cloud optical depth (tau), effective solar transmission (gama), and cloudtop-of-atmosphere albedos (RcldyRTOA)...

  16. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    and Precipitation Data Set for Cloud Model Evaluation Xu, K.-M.(a), Wielicki, B.A.(a), Wong, T.(a), and Randall, D.A.(b), NASA Langley Research Center (a), Colorado State...

  17. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Optical Depth due to Unknown Optical Properties in Smoke Aerosols Li, Z. (a,b) and Wong, J. (a,c), Canada Centre for Remote Sensing (a), Now at ESSIC, Department of...

  18. ARM - Publications: Science Team Meeting Documents: Spatially...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    here a methodology to estimate surface energy fluxes and net ecosystem CO2 Exchange (NEE) continuously over the Southern Great Plains, using (1) data from ARM program in...

  19. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    ARM Engineering Process Workflow Using ExtraView Hull, T.R., Pacific Northwest National Laboratory, ARM Engineering Group Fourteenth Atmospheric Radiation Measurement (ARM) Science...

  20. ARM - Publications: Science Team Meeting Documents: Increasing...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Artifact? Li, Zhanqing University of Maryland Yuan, Tianle University of Maryland Vant-Hull, Brian University of Maryland Since the Twomey effect was proposed in 1977, it has been...

  1. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    of Atmospheric Sciences University of California, Los Angeles Thirteenth Atmospheric Radiation Measurement (ARM) Science Team Meeting A new cloud detection scheme has been...

  2. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Detection of Thin Cirrus Using MODIS 1.38 Micron Reflection Roskovensky, J.K. and Liou, K.N., University of California, Los Angeles Twelfth Atmospheric Radiation Measurement (ARM)...

  3. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    CCPP-ARM Parameterization Testbed (CAPT) Framework Xie, S.C.(a), Cederwall, R.T.(a), Potter, G.L.(a), Boyle, J.S.(a), Yio, J.J.(a), Zhang, M.H.(b), and Lin, W.Y.(b), Lawrence...

  4. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    The CCPP-ARM Parameterization Test Bed (CAPT) Potter, G.L.(a), Williamson, D.L.(b), Cederwall, R.T.(a), and Xie, S.(a), Lawrence Livermore National Laboratory (a), National Center...

  5. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    During the 199798 El Nio: A Test for Two Climate Models Lu, R.(a), Dong, B.(b), Potter, G.L.(c), and Cess, R.D.(d), Institute of Atmospheric Physics, Chinese Academy of...

  6. ARM - Publications: Science Team Meeting Documents: Assessing...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Morcrette, Jean-Jacques European Centre for Medium-Range Weather Forecasts Viterbo, Pedro ECMWF In this study, we compare short-term weather forecasts of the ECMWF model...

  7. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    from Dendrochronologic Data Zuev, V.V. and Bondarenko, S.L., Institute of Atmospheric Optics Russian Academy of Sciences Tomsk, Russia Thirteenth Atmospheric Radiation Measurement...

  8. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    of Cirrus Contamination on Satellite Retrieved Microphysical Properties of Water Clouds Chang, F.-L. and Li, Z., University of Maryland Thirteenth Atmospheric Radiation Measurement...

  9. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    on the TOGA-COARE Bulk Algorithm for Computing the Air-Sea Fluxes Fairall, C.W., and Hare, J.E., National Oceanic and Atmospheric Administration- Environmental Technology...

  10. ARM - Publications: Science Team Meeting Documents: Investigation...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    (CPI) it is now possible to capture ice crystal images with 2.3 m resolution and 256 gray scales of illumination, providing an unprecedented wealth of information to utilize in...

  11. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    measurements, improved reporting of calibration results, the ability to perform tilt calibrations for increasing pyranometer angular response measurements, improved event...

  12. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    cloud scenes created by a large eddy simulation model. Progressively greater degrees of tilt and stretching were imposed on these scenes, so that an ensemble of scenes were...

  13. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    distribution of cloud water, with emphasis on cloud ice water, using available high-frequency microwave satellite measurements (currently NOAA AMSU-B). Our research...

  14. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Lamp Based Radiometric Calibrations Allen, D.W.(a), Souaidia, N.(a), Pietras, C.(b), Brown, S.(a), Lykke, R.(a), Frouin, R.(c), Deschamps, P.Y.(d), Fargion, G.(b), and Johnson,...

  15. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    data have been collected and archived on our web site (see arctic HSRL at "lidar.ssec.wisc.edu"). A web interface to browse and visualize data is provided along with tools to...

  16. ARM - Publications: Science Team Meeting Documents: Seasonal...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    of the seasonal variation of land cover which is dominated by the agricultural land use, primarily winter wheat production. http:gi.ssec.wisc.eduairsknutesonindex.html...

  17. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Radiation Measurement (ARM) Science Team Meeting A description of the four ARM sites (BillingsBRS, E13, Manus and Nauru) currently included in the Baseline Surface Radiation...

  18. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    both near the ground and within the atmosphere, column contents of water vapor, ozone, CH4, NO2, CO, NO. Aerological sounding and AVHRRNOAA14 data were used to determine...

  19. ARM - Publications: Science Team Meeting Documents: Sensitivities...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    CSU Multiscale-Modeling Framework (MMF) based on the NCAR Community Atmopshere Model (CAM). While individual deep clouds and meso-scale cloud systems are explicitly resolved by...

  20. ARM - Publications: Science Team Meeting Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    models. This poster presents a methodology using the new Community Atmospheric Model (CAM) from the Community Climate System Model (CCSM). This work was performed under the...