National Library of Energy BETA

Sample records for doc number serial

  1. Property:NEPA SerialNumber | Open Energy Information

    Open Energy Info (EERE)

    SerialNumber Jump to: navigation, search Property Name NEPA SerialNumber Property Type String This is a property of type String. Pages using the property "NEPA SerialNumber"...

  2. Property:NEPA LeadAgencyDocNumber | Open Energy Information

    Open Energy Info (EERE)

    LeadAgencyDocNumber Jump to: navigation, search Property Name NEPA LeadAgencyDocNumber Property Type String This is a property of type String. Pages using the property "NEPA...

  3. System and method for simultaneously collecting serial number information from numerous identity tags

    DOE Patents [OSTI]

    Doty, Michael A.

    1997-01-01

    A system and method for simultaneously collecting serial number information reports from numerous colliding coded-radio-frequency identity tags. Each tag has a unique multi-digit serial number that is stored in non-volatile RAM. A reader transmits an ASCII coded "D" character on a carrier of about 900 MHz and a power illumination field having a frequency of about 1.6 Ghz. A one MHz tone is modulated on the 1.6 Ghz carrier as a timing clock for a microprocessor in each of the identity tags. Over a thousand such tags may be in the vicinity and each is powered-up and clocked by the 1.6 Ghz power illumination field. Each identity tag looks for the "D" interrogator modulated on the 900 MHz carrier, and each uses a digit of its serial number to time a response. Clear responses received by the reader are repeated for verification. If no verification or a wrong number is received by any identity tag, it uses a second digital together with the first to time out a more extended period for response. Ultimately, the entire serial number will be used in the worst case collision environments; and since the serial numbers are defined as being unique, the final possibility will be successful because a clear time-slot channel will be available.

  4. System and method for simultaneously collecting serial number information from numerous identity tags

    DOE Patents [OSTI]

    Doty, M.A.

    1997-01-07

    A system and method are disclosed for simultaneously collecting serial number information reports from numerous colliding coded-radio-frequency identity tags. Each tag has a unique multi-digit serial number that is stored in non-volatile RAM. A reader transmits an ASCII coded ``D`` character on a carrier of about 900 MHz and a power illumination field having a frequency of about 1.6 Ghz. A one MHz tone is modulated on the 1.6 Ghz carrier as a timing clock for a microprocessor in each of the identity tags. Over a thousand such tags may be in the vicinity and each is powered-up and clocked by the 1.6 Ghz power illumination field. Each identity tag looks for the ``D`` interrogator modulated on the 900 MHz carrier, and each uses a digit of its serial number to time a response. Clear responses received by the reader are repeated for verification. If no verification or a wrong number is received by any identity tag, it uses a second digital together with the first to time out a more extended period for response. Ultimately, the entire serial number will be used in the worst case collision environments; and since the serial numbers are defined as being unique, the final possibility will be successful because a clear time-slot channel will be available. 5 figs.

  5. Property:NEPA SerialRegisterPage | Open Energy Information

    Open Energy Info (EERE)

    SerialRegisterPage Jump to: navigation, search Property Name NEPA SerialRegisterPage Property Type Page Description Serial Register Page files for NEPA Docs. Related Serial...

  6. Introduction Yucca Lady, a World War II Boeing-17G Flying Fortress Army Air Force serial number

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Yucca Lady, a World War II Boeing-17G Flying Fortress Army Air Force serial number 44-83575, was flown to the Nevada Test Site (now known as the Nevada National Security Site - NNSS) in 1952, where she was instrumented and subjected to three atmospheric nuclear tests as part of the Operation Tumbler-Snapper -- Vulnerability of Parked Aircraft to Atomic Bombs series, conducted in April and May 1952. The project would determine the effects of a nuclear device detonated above an airfield,

  7. Associate Research Physicist (Post Doc, Experimental Research...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Post Doc, Experimental Research, NSTX-U, Radio Frequency Waves) Department: Research Staff: RM1 Requisition Number: 1500421 The Princeton Plasma Physics Laboratory (PPPL) seeks to...

  8. raising_investment_funds_for_clean_energy_programs.doc | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    raisinginvestmentfundsforcleanenergyprograms.doc raisinginvestmentfundsforcleanenergyprograms.doc raisinginvestmentfundsforcleanenergyprograms.doc Microsoft ...

  9. howtodesignandmarketenergyefficiencyprogramstospecificneighborhoods.doc |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy howtodesignandmarketenergyefficiencyprogramstospecificneighborhoods.doc howtodesignandmarketenergyefficiencyprogramstospecificneighborhoods.doc howtodesignandmarketenergyefficiencyprogramstospecificneighborhoods.doc howtodesignandmarketenergyefficiencyprogramstospecificneighborhoods.doc (117.5 KB) More Documents & Publications How to Design and Market Energy Efficiency Programs to Specific Neighborhoods Using Social Media to Engage the Community in Energy Efficiency

  10. highperformanceleasingstrategiesforstateandlocalgovernments.doc |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy highperformanceleasingstrategiesforstateandlocalgovernments.doc highperformanceleasingstrategiesforstateandlocalgovernments.doc highperformanceleasingstrategiesforstateandlocalgovernments.doc highperformanceleasingstrategiesforstateandlocalgovernments.doc (93 KB) More Documents & Publications High Performance Leasing Strategies for State and Local Governments Leveraging Portfolio Manager for Disclosure and Green Leasing Practices

  11. exploringpowerpurchaseagreementsthebasicspart1.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    exploringpowerpurchaseagreementsthebasicspart1.doc exploringpowerpurchaseagreementsthebasicspart1.doc exploringpowerpurchaseagreementsthebasicspart1.doc exploringpowerpurchaseagreementsthebasicspart1.doc (112.5 KB) More Documents & Publications Exploring Power Purchase Agreements - The Basics Part 1

  12. finance_programs.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    financeprograms.doc financeprograms.doc financeprograms.doc Microsoft Office document icon financeprograms.doc More Documents & Publications Tools for Designing & Implementing ...

  13. Doc...~En.

    Office of Legacy Management (LM)

    ' : ,:#;: .' :.' . ,.:: :,; ..,' ... ..,,..,.... - .~~._ I&i3:scD .::-:, TO-340 .":: ..' . - ' - -. ' . .." ,.. .;.. Very traly yours;, -' .~X :, Doc...~En. ' Br.:Re&ng ';;a' : _, Div. Reading File ., ,, .~, ,.~-

  14. webinar_innovation_financing.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    financing.doc webinarinnovationfinancing.doc webinarinnovationfinancing.doc Microsoft Office document icon webinarinnovationfinancing.doc More Documents & Publications ...

  15. webinar_innovation_planning_zoning.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    planningzoning.doc webinarinnovationplanningzoning.doc webinarinnovationplanningzoning.doc Microsoft Office document icon webinarinnovationplanningzoning.doc More ...

  16. webinar_innovation_net_metering_interconnection.doc | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    netmeteringinterconnection.doc webinarinnovationnetmeteringinterconnection.doc webinarinnovationnetmeteringinterconnection.doc Microsoft Office document icon ...

  17. fed_finance_facilities_ee_upgrades_deployment.doc | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    fedfinancefacilitieseeupgradesdeployment.doc fedfinancefacilitieseeupgradesdeployment.doc fedfinancefacilitieseeupgradesdeployment.doc Microsoft Office document icon ...

  18. webinar_innovation_organizing_strategizing.doc | Department of...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    organizingstrategizing.doc webinarinnovationorganizingstrategizing.doc webinarinnovationorganizingstrategizing.doc Microsoft Office document icon webinarinnovationorganizi...

  19. partneringwithutilitiespart2advancedtopicsforlocalgovernments.doc |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy partneringwithutilitiespart2advancedtopicsforlocalgovernments.doc partneringwithutilitiespart2advancedtopicsforlocalgovernments.doc partneringwithutilitiespart2advancedtopicsforlocalgovernments.doc partneringwithutilitiespart2advancedtopicsforlocalgovernments.doc (129.5 KB) More Documents & Publications Partnering With Utilities to Offer Energy Efficiency Programs Webinar Transcript Partnering with Utilities Part 2 - Advanced Topics for Local Governments in Creating

  20. Microsoft Word - FAL2003-03R.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    3-03R.doc Microsoft Word - FAL2003-03R.doc Microsoft Word - FAL2003-03R.doc (198.25 KB) More Documents & Publications WPN 06-8: Dun and Bradstreet Universal Numbering System (DUNS) and Central Contractor Registration (CCR) and Grants.Gov Reminder Microsoft Word - FAL2003-03Rattach.doc WPN 03-7: Grants.Gov: Dun and Bradstreet Universal Numbering System (Duns) and Central Contractor Registration (CCR)

  1. Doc.~:Ru.

    Office of Legacy Management (LM)

    .' , .' c,j .c; Distriblition:~ ;. <; ~..,:L.D.i&%.ay,FiN-OR00 Doc.~:Ru. ,.,. 75. ' Br..Reading 'ire' ,lliv. Read&q File ,: '. ~ ,, .-' . ...: - SURNAME..

  2. Serial Queue Available on Hopper and Edison

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Queue Available on Hopper and Edison Serial Queue Available on Hopper and Edison November 12, 2014 by Francesca Verdier The new serial queue on Hopper and Edison allows multiple serial jobs from different users to share a compute node. it is implemented via Cray's Cluster Compatibility Mode and uses wrapper commands such as qsub.serial. See Serial Queue on the Crays. Subscribe via RSS Subscribe Browse by Date August 2016 June 2016 May 2016 April 2016 January 2016 December 2015 November 2015

  3. Serial Queue Available on Hopper and Edison

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Queue Available on Hopper and Edison Serial Queue Available on Hopper and Edison November 12, 2014 by Francesca Verdier The new serial queue on Hopper and Edison allows multiple...

  4. Microsoft Word - ContractManagementPlanningDRIVERS.doc | Department...

    Broader source: Energy.gov (indexed) [DOE]

    ContractManagementPlanningDRIVERS.doc More Documents & Publications Microsoft Word - ARRAAttachment2.doc Microsoft Word - ARRAModelWAS.doc Microsoft Word - ARRAMOModelMod.doc...

  5. Microsoft Word - S0244800.doc

    Office of Legacy Management (LM)

    ... ground water from the interceptor drains and extraction wells is solar evaporation. ... Annual Performance Report, Shiprock, New Mexico U.S. Department of Energy Doc. No. ...

  6. energydisclosureandleasingstandardsbestpractices.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    energydisclosureandleasingstandardsbestpractices.doc energydisclosureandleasingstandardsbestpractices.doc energydisclosureandleasingstandardsbestpractices.doc (100.5 KB) More Documents & Publications Leveraging Portfolio Manager for Disclosure and Green Leasing Practices Communicating Success, Measuring Improvements, Sharing Results Communicating Success, Measuring Improvements, Sharing Results

  7. Microsoft Word - 08071744_DocProd.doc

    Office of Legacy Management (LM)

    ... Location Specific Information: Ticket Number Location Sample Date Description GIS 005 40-SC 812008 Cat. I GIS 006 5-SC 8122008 Cat. I GIS 007 51-SC 8132008 Cat. II; ...

  8. Category:NEPA Doc | Open Energy Information

    Open Energy Info (EERE)

    NEPA Doc Jump to: navigation, search GEOTHERMAL ENERGYGeothermal Home Category: NEPA Documents Collections Add.png Add a new NEPA Document Collection Pages in category "NEPA Doc"...

  9. NVN-89276 | Open Energy Information

    Open Energy Info (EERE)

    Type NOI Decision Document Date 20101202 Relevant Numbers Lead Agency Doc Number Serial Number NVN-89276 Proposed Action Geochemical survey Documents Serial Register Page:...

  10. NVN-89275 | Open Energy Information

    Open Energy Info (EERE)

    Type NOI Decision Document Date 20101202 Relevant Numbers Lead Agency Doc Number Serial Number NVN-89275 Proposed Action Geophysical surveys. Documents Serial Register Page:...

  11. NVN-89278 | Open Energy Information

    Open Energy Info (EERE)

    Type NOI Decision Document Date 20101202 Relevant Numbers Lead Agency Doc Number Serial Number NVN-89278 Proposed Action Geophysical survey. Documents Serial Register Page:...

  12. spurring_local_economic_development_clean_energy_programs.doc...

    Broader source: Energy.gov (indexed) [DOE]

    spurringlocaleconomicdevelopmentcleanenergyprograms.doc spurringlocaleconomicdevelopmentcleanenergyprograms.doc More Documents & Publications Spurring Local Economic...

  13. webinar_innovation_permitting_inspections.doc | Department of...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    More Documents & Publications webinarinnovationfinancing.doc raisinginvestmentfundsforcleanenergyprograms.doc Communicating Success, Measuring Improvements, Sharing Results

  14. Microsoft Word - AL2002-03.doc | Department of Energy

    Office of Environmental Management (EM)

    2-03.doc Microsoft Word - AL2002-03.doc PDF icon Microsoft Word - AL2002-03.doc More Documents & Publications Microsoft Word - AL2005-01.doc Microsoft Word - FAL2004-01.doc...

  15. Microsoft Word - FAL2004-01.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    1.doc Microsoft Word - FAL2004-01.doc PDF icon Microsoft Word - FAL2004-01.doc More Documents & Publications Microsoft Word - FAL2004-03.doc Microsoft Word - FAL2004-02.doc...

  16. Microsoft Word - AL2006-08.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    8.doc Microsoft Word - AL2006-08.doc PDF icon Microsoft Word - AL2006-08.doc More Documents & Publications AL2007-05.doc&0; Microsoft Word - AL2005-14.doc Microsoft Word - ...

  17. Microsoft Word - AL2005-03.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    5-03.doc Microsoft Word - AL2005-03.doc PDF icon Microsoft Word - AL2005-03.doc More Documents & Publications Microsoft Word - AL2005-01.doc Microsoft Word - AL2006-08.doc ...

  18. Microsoft Word - 98-11.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    8-11.doc Microsoft Word - 98-11.doc PDF icon Microsoft Word - 98-11.doc More Documents & Publications Microsoft Word - AL2006-08.doc Microsoft Word - AL2005-01.doc Microsoft Word -...

  19. Serial and Westmere Queues on Carver

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    and Westmere Queues on Carver Serial and Westmere Queues on Carver September 20, 2011 by Francesca Verdier NERSC has replaced 80 8-core Intel Nehalem nodes on Carver with 80...

  20. Microcrystallization techniques for serial femtosecond crystallography

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    using Photosystem II from Thermosynechococcus elongatus as a model system Microcrystallization techniques for serial femtosecond crystallography using Photosystem II from Thermosynechococcus elongatus as a model system Authors: Kupitz, C., Grotjohann, I., Conrad, C.E., Roy-Chowdhury, S., Fromme, R., and Fromme, P. Title: Microcrystallization techniques for serial femtosecond crystallography using Photosystem II from Thermosynechococcus elongatus as a model system Source: Phil. Trans. R. Soc.

  1. Microsoft Word - CMPTemplate031307.doc | Department of Energy

    Office of Environmental Management (EM)

    CMPTemplate031307.doc Microsoft Word - CMPTemplate031307.doc PDF icon Microsoft Word - CMPTemplate031307.doc More Documents & Publications Chapter 42 - Contract Administration...

  2. Microsoft Word - ACQUISITION LETTER.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ACQUISITION LETTER.doc Microsoft Word - ACQUISITION LETTER.doc PDF icon Microsoft Word - ACQUISITION LETTER.doc More Documents & Publications ACQUISITION LETTER DEAR Part 933 OPAM ...

  3. Microsoft Word - SpecialTermsandConditions0506.doc | Department...

    Energy Savers [EERE]

    Microsoft Word - SpecialTermsandConditions0506.doc Microsoft Word - SpecialTermsandConditions0506.doc Microsoft Word - SpecialTermsandConditions0506.doc More Documents &...

  4. Microsoft Word - FY2005finaliparhandbook.doc | Department of...

    Energy Savers [EERE]

    Microsoft Word - FY2005finaliparhandbook.doc Microsoft Word - FY2005finaliparhandbook.doc Microsoft Word - FY2005finaliparhandbook.doc More Documents & Publications...

  5. Microsoft Word - ARRAAttachment2.doc | Department of Energy

    Office of Environmental Management (EM)

    ARRAAttachment2.doc Microsoft Word - ARRAAttachment2.doc More Documents & Publications Microsoft Word - ARRAAttachment12v1.doc Microsoft Word - ARRAAttachment3.rtf Microsoft Word -...

  6. Microsoft Word - ARRAMOModelMod.doc | Department of Energy

    Energy Savers [EERE]

    ARRAMOModelMod.doc Microsoft Word - ARRAMOModelMod.doc More Documents & Publications Microsoft Word - ARRAAttachment2.doc Microsoft Word - ARRAModelWAS...

  7. Microsoft Word - ARRAModelWAS.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ARRAModelWAS.doc Microsoft Word - ARRAModelWAS.doc More Documents & Publications Microsoft Word - ARRAAttachment2.doc Microsoft Word - ARRAMOModelMod...

  8. Engaging Financial Institution Partners Transcript.doc | Department...

    Office of Environmental Management (EM)

    Engaging Financial Institution Partners Transcript.doc Engaging Financial Institution Partners Transcript.doc Engaging Financial Institution Partners Transcript.doc Microsoft ...

  9. Microsoft Word - August06.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    August06.doc Microsoft Word - August06.doc PDF icon Microsoft Word - August06.doc More Documents & Publications Microsoft Word - April

  10. Microsoft Word - FY10PropertyBSCContractor.doc | Department of...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    PropertyBSCContractor.doc Microsoft Word - FY10PropertyBSCContractor.doc PDF icon Microsoft Word - FY10PropertyBSCContractor.doc More Documents & Publications Microsoft Word - ...

  11. Microsoft Word - GJPPGPracticesDraft.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    GJPPGPracticesDraft.doc Microsoft Word - GJPPGPracticesDraft.doc PDF icon Microsoft Word - GJPPGPracticesDraft.doc More Documents & Publications 1 DOE Purchase Card Policy Natural ...

  12. Microsoft Word - Cross Reference Matrix Introduction.doc | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Cross Reference Matrix Introduction.doc Microsoft Word - Cross Reference Matrix Introduction.doc PDF icon Microsoft Word - Cross Reference Matrix Introduction.doc More Documents & ...

  13. Microsoft Word - April06.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    April06.doc Microsoft Word - April06.doc PDF icon Microsoft Word - April06.doc More Documents & Publications Secretary Directs FPO to Prepare Strategic Plan Microsoft Word - August

  14. SPDWRAP#1.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Please notify Aon Hewitt's Your Benefit Resources (YBR) in Appendix G to update your personal information, such as your home address and home telephone number. 2. Eligibility...

  15. N0057000.doc

    Office of Legacy Management (LM)

    000 GJO- 2002-380- TAC GJO-PIN 13.5.1-1 Pinellas Environmental Restoration Project Northeast Site Non-Aqueous Phase Liquids Interim Measures Progress Report July through September 2002 October 2002 Prepared by U.S. Department of Energy Grand Junction Office Grand Junction, Colorado Work Performed Under DOE Contract Number DE-AC13-02GJ79491 Task Order Number ST03-107 Document Number N0057000 Contents DOE/Grand Junction Office Northeast Site NAPL Interim Measures Progress Report October 2002 Page

  16. Microsoft Word - AL2005-16.doc | Department of Energy

    Office of Environmental Management (EM)

    6.doc Microsoft Word - AL2005-16.doc PDF icon Microsoft Word - AL2005-16.doc More Documents & Publications Microsoft Word - AL2005-10.doc Audit Report: IG-0860 Microsoft Word -...

  17. Microsoft Word - AL2005-02.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    5-02.doc Microsoft Word - AL2005-02.doc PDF icon Microsoft Word - AL2005-02.doc More Documents & Publications Microsoft Word - AL-Omnibus FY 2009 Apr 22 2009 all sections.doc...

  18. Microsoft Word - AL2005-11.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    1.doc Microsoft Word - AL2005-11.doc PDF icon Microsoft Word - AL2005-11.doc More Documents & Publications Audit Report: OAS-L-13-08 Microsoft Word - AL2005-12.doc CHAPTER 7...

  19. Microsoft Word - AL2006-02.doc | Department of Energy

    Energy Savers [EERE]

    2.doc Microsoft Word - AL2006-02.doc PDF icon Microsoft Word - AL2006-02.doc More Documents & Publications Microsoft Word - AL2006-03.doc Archived Financial Assistance Letters...

  20. Microsoft Word - AL2006-03.doc | Department of Energy

    Energy Savers [EERE]

    3.doc Microsoft Word - AL2006-03.doc PDF icon Microsoft Word - AL2006-03.doc More Documents & Publications Microsoft Word - AL2006-02.doc Archived Financial Assistance Letters...

  1. Microsoft Word - al2005-04.doc | Department of Energy

    Energy Savers [EERE]

    al2005-04.doc Microsoft Word - al2005-04.doc PDF icon Microsoft Word - al2005-04.doc More Documents & Publications AL2005-04ClassDeviation.pdf Microsoft Word - Matrixpart2.doc...

  2. Microsoft Word - AL2005-14.doc | Department of Energy

    Office of Environmental Management (EM)

    4.doc Microsoft Word - AL2005-14.doc PDF icon Microsoft Word - AL2005-14.doc More Documents & Publications Microsoft Word - AL-Omnibus FY 2009 Apr 22 2009 all sections.doc...

  3. Microsoft Word - AL2005-07.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    7.doc Microsoft Word - AL2005-07.doc PDF icon Microsoft Word - AL2005-07.doc More Documents & Publications Microsoft Word - AL2006-07.doc OPAM Policy Acquisition Guides Initial ...

  4. Microsoft Word - AL2005-01.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    1.doc Microsoft Word - AL2005-01.doc PDF icon Microsoft Word - AL2005-01.doc More Documents & Publications Microsoft Word - AL2006-08.doc Acquisition Letter Archive listing ...

  5. Microsoft Word - AL2006-01.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    1.doc Microsoft Word - AL2006-01.doc PDF icon Microsoft Word - AL2006-01.doc More Documents & Publications Microsoft Word - al2005-06.doc Chapter 19 - Small Business Programs OPAM...

  6. Microsoft Word - Flash2007-43.doc | Department of Energy

    Office of Environmental Management (EM)

    43.doc Microsoft Word - Flash2007-43.doc Microsoft Word - Flash2007-43.doc More Documents & Publications Microsoft Word - Policy Flash 2008-07.doc Microsoft Word - Policy Flash...

  7. al99-06attachment.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    attachment.doc&0; al99-06attachment.doc&0; PDF icon al99-06attachment.doc&0; More Documents & Publications Microsoft Word - AL2000-05Attachment.doc Microsoft Word - NSRC...

  8. Microsoft Word - AL2005-10.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AL2005-10.doc Microsoft Word - AL2005-10.doc Microsoft Word - AL2005-10.doc (133.11 KB) More Documents & Publications Microsoft Word - AL2005-16.doc Audit Report: IG-0860 Microsoft ...

  9. Microsoft Word - PeerReview_SAR.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    SAR.doc Microsoft Word - PeerReviewSAR.doc Microsoft Word - PeerReviewSAR.doc (13.47 KB) More Documents & Publications Microsoft Word - PeerReviewCCSP.doc Microsoft Word - Cross ...

  10. Microsoft Word - al2007-11.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    al2007-11.doc Microsoft Word - al2007-11.doc PDF icon Microsoft Word - al2007-11.doc More Documents & Publications Acquisition Letter: AL2005-08 Microsoft Word - al2004-03.doc OPAM...

  11. Microsoft Word - FWP- Fact Sheet.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    FWP- Fact Sheet.doc Microsoft Word - FWP- Fact Sheet.doc PDF icon Microsoft Word - FWP- Fact Sheet.doc More Documents & Publications Microsoft Word - FOA cover sheet.doc Microsoft ...

  12. Report2003.doc

    Broader source: Energy.gov (indexed) [DOE]

    III. Definitions of Terms and Acronyms Used in the Report. ... current fiscal year 1013 (Enter this number also in Line ... (some records involved search adequacy) 5: Remand: 9 7 ...

  13. LibraDLFinal.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    To reserve a Libra session, go to wwwncem.lbl.gov, click on "Microscope Scheduling", use proposal number and password to log in.You may only sign up for 1 Core sessions and 1 Flex ...

  14. FIBDLFinal.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    To reserve a FIB session, go to wwwncem.lbl.gov, click on "Microscope Scheduling", use proposal number and password to log in.You may only sign up for 2 Core sessions and 2 Flex ...

  15. 3010DLFinal.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    go to wwwncem.lbl.gov, click on "Microscope Scheduling", use proposal number and password to log in. You may only sign up for 2 Core sessions and 1 Flex session at a time. ...

  16. TecnaiDLFinal.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    To reserve a Tecnai session, go to wwwncem.lbl.gov, click on "Microscope Scheduling", use proposal number and password to log in. You may only sign up for 1 Core session and 1 ...

  17. 2B-01.doc

    Energy Savers [EERE]

    ... performed under DOE contract number DE-AC01-02GJ79491 by the S.M. Stoller Corporation for the U.S. Department of Energy, Office of Legacy Man- agement, Grand Junction, Colorado. ...

  18. Microsoft Word - S06401_IC.doc

    Office of Legacy Management (LM)

    U.S. Department of Energy Doc. No. S06401 June 2010 Page B-2 U.S. Department of Energy Annual Assessment of the Effectiveness of Site-Wide Institutional Controls June 2010 Doc. ...

  19. Ammendment 2.doc | Department of Energy

    Broader source: Energy.gov (indexed) [DOE]

    Ammendment 2.doc More Documents & Publications Attachment 6 Volume V Pricing Matrix for Optional Enhancements.xls&0; RFQ DE-RQ01-04ME90001.doc&0; Attachment 3-Past Performance...

  20. Microsoft Word - Matrixpart1.doc | Department of Energy

    Broader source: Energy.gov (indexed) [DOE]

    Matrixpart1.doc More Documents & Publications Part 1, Clauses Prescribed in FAR Part 52 Microsoft Word - Matrixpart2.doc...

  1. csep_transcript_aspen.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    More Documents & Publications highperformanceleasingstrategiesforstateandlocalgovernments.doc Using Social Media to Engage the Community in Energy Efficiency Projects.doc ...

  2. csep_transcript_minneapolis.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    More Documents & Publications newguideforcommunityenergystrategicplanning.doc cseptranscriptaspen.doc Marketing & Driving Demand: Social Media Tools & Strategies - January 16, ...

  3. csep_transcript_arlington.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Office document icon cseptranscriptarlington.doc More Documents & Publications Tools for Designing & Implementing Better Finance Programs financeprograms.doc financeprograms

  4. Index2.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Index2.doc Index2.doc Index2.doc (11.46 KB) More Documents & Publications Sylvania Corporation, Hicksville, NY and Bayside, NY - Addendum to July 8, 2004 O:\HOMEPAGE\FOIA\report99.PDF&#0; U.S. Department of Energy 2004 Annual Report

  5. SubcontractingGuidelines.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    SubcontractingGuidelines.doc&#0; SubcontractingGuidelines.doc&#0; SubcontractingGuidelines.doc&#0; (245.71 KB) More Documents & Publications Guidance of the Department of Energy Subcontracting Program Acquisition Guide Chapter 19 Update Chapter 19 - Small Business Programs

  6. Microsoft Word - toc.doc

    Office of Legacy Management (LM)

    Maintenance Plan for the Monticello NPL Sites Rev. 0 Doc. No. S0038700 Rev. Date: June 25, 2007 Page I-3 U n c o n t r o l l e d c o p y Long-Term Surveillance and Maintenance ...

  7. Microsoft Word - 1938.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    personal information is revealed in a LANS record: Education, salary, medical history, employment history, social security number, date and place of birth, or mother's maiden name. Form 1938 (3/14) Page 1 of 3 Form 1938 Universal Beneficiary Designation/Change Form Instructions: The information on this form will replace any prior beneficiary designation. You may name anyone or any entity as your beneficiary and you may change your beneficiary at any time by completing a new Universal Beneficiary

  8. Dec08.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    8 ANL/EVS/NL-08-12 Technical Contact: Brad W. Orr Phone: 630-252-8665 Email: brad.orr@anl.gov Editor: Donna J. Holdridge Contributor: Lynne Roeder Website: http://www.arm.gov ACRF Southern Great Plains Newsletter is published by Argonne National Laboratory, managed by UChicago Argonne, LLC, for the U.S. Department of Energy under contract number DE-AC02-06CH11357. AMF2 Team Surveys Storm Peak Area The U.S. Department of Energy recently announced the initial deployment of the second ARM Mobile

  9. Oct08.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    8 ANL/EVS/NL-08-10 Technical Contact: Brad W. Orr Phone: 630-252-8665 Email: brad.orr@anl.gov Editor: Donna J. Holdridge Contributor: John Schatz Website: http://www.arm.gov ACRF Southern Great Plains Newsletter is published by Argonne National Laboratory, managed by UChicago Argonne, LLC, for the U.S. Department of Energy under contract number DE-AC02-06CH11357. Leadership Noble County Members Tour SGP Site Members of the non-profit organization Leadership Noble County

  10. Sep08.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    8 ANL/EVS/NL-08-09 Technical Contact: Brad W. Orr Phone: 630-252-8665 Email: brad.orr@anl.gov Editor: Donna J. Holdridge Website: http://www.arm.gov ACRF Southern Great Plains Newsletter is published by Argonne National Laboratory, managed by UChicago Argonne, LLC, for the U.S. Department of Energy under contract number DE-AC02-06CH11357. 3D Water Vapor Field Campaign Concludes Researchers from the Colorado State University recently concluded a week-long field experiment at the SGP (August

  11. Jan09.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    9 ANL/EVS/NL-09-01 Technical Contact: Brad W. Orr Phone: 630-252-8665 Email: brad.orr@anl.gov Editor: Donna J. Holdridge Contributor: Lynne Roeder Website: http://www.arm.gov ACRF Southern Great Plains Newsletter is published by Argonne National Laboratory, managed by UChicago Argonne, LLC, for the U.S. Department of Energy under contract number DE-AC02-06CH11357. Routine AVP Clouds with Low Optical Water Depths (CLOWD) Optical Radiative Observations (RACORO) Field Campaign Scheduled at SGP

  12. June08.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    8 ANL/EVS/NL-08-06 Technical Contact: Brad W. Orr Phone: 630-252-8665 Email: brad.orr@anl.gov Editor: Donna J. Holdridge Contributor: Lynne Roeder Website: http://www.arm.gov ACRF Southern Great Plains Newsletter is published by Argonne National Laboratory, managed by UChicago Argonne, LLC, for the U.S. Department of Energy under contract number DE-AC02-06CH11357. Interagency Effort Will Measure Carbon Dioxide Profiles Beginning in June, the ARM Climate Research Facility (ACRF) is supporting an

  13. Serial Femtosecond Crystallography of G Protein-Coupled Receptors

    DOE Data Explorer [Office of Scientific and Technical Information (OSTI)]

    Liu, Liu

    2013-10-23

    Serial femtosecond crystallography data on microcrystals of 5-HT2B receptor bound to ergotamine grown in lipidic cubic phase.

  14. Microsoft Word - AL2000-05.doc | Department of Energy

    Energy Savers [EERE]

    .doc Microsoft Word - AL2000-05.doc PDF icon Microsoft Word - AL2000-05.doc More Documents & Publications al99-06.doc&0; Microsoft Word - AL2000-05Attachment.doc AL2004-01r2.pdf...

  15. Microsoft Word - AL2007-01.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    7-01.doc Microsoft Word - AL2007-01.doc Microsoft Word - AL2007-01.doc (151.65 KB) More Documents & Publications Microsoft Word - Rev5functionalaccountabilityimplementationplan..doc Microsoft Word - Corp Impl 10-05-06.final.doc Microsoft Word - AL2006-11

  16. Microsoft Word - FAL2004-03.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    4-03.doc Microsoft Word - FAL2004-03.doc Microsoft Word - FAL2004-03.doc (538.96 KB) More Documents & Publications Microsoft Word - FAL2004-01.doc Financial Assistance Letter No. FAL 2006-04 Microsoft Word - FAL2006-04.doc

  17. transcript_pv_mapper.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    transcript_pv_mapper.doc transcript_pv_mapper.doc transcript_pv_mapper.doc transcript_pv_mapper.doc (74.5 KB) More Documents & Publications PVMapper: A Tool for Energy Siting transcript_jedi_model.doc 2009 National Electric Transmission Congestion Study - San Francisco Workshop

  18. Microsoft Word - Appendix-B.doc

    Office of Legacy Management (LM)

    1 Site Environmental Report May 2012 Doc. No. S08629 Page B-i Contents Abbreviations ................................................................................................................................. iii Measurement Abbreviations .......................................................................................................... iii References

  19. Microsoft Word - S05575_AP.doc

    Office of Legacy Management (LM)

    ... Department of Energy Annual Performance Report, Shiprock, New Mexico December 2009 Doc. ... groundwater from the interceptor drains and extraction wells is solar evaporation. ...

  20. Microsoft Word - S05914_MR.doc

    Office of Legacy Management (LM)

    ... Energy 2009 Groundwater Monitoring Report Project Shoal Area, CAU 447 March 2010 Doc. No. ... The contaminant boundary (Figure 2) is a probabilistic forecast of the maximum extent over ...

  1. PIC DOC 01/08/11 ? SOS

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    PIC DOC 010811 - SOS Content Outline 1) Usable Quotes We shouldn't equate public involvement with meetings. Maynard Plahuta Meetings, of many kinds, are probably the most...

  2. Microsoft Word - S05527_VMR 2009.DOC

    Office of Legacy Management (LM)

    ... Wells - Golf Course and Residential, Near the Gunnison Site U.S. Department of Energy 2009 Verification Monitoring Report-Gunnison, Colorado, Processing Site August 2009 Doc. ...

  3. Microsoft Word - S06692_VMR.doc

    Office of Legacy Management (LM)

    ... DOE Monitoring Wells - Golf Course and Residential, Near the Gunnison Site ... Monitoring Report-Gunnison, Colorado, Processing Site U.S. Department of Energy Doc. No. ...

  4. Microsoft Word - S07050_WM.doc

    Office of Legacy Management (LM)

    ... NI), Setaria viridis (green foxtail, UPL), Xanthium strumarium (cocklebur, FAC) Naturita-Monitoring Report for Wetland Area U.S. Department of Energy Doc. No. S07050 September ...

  5. Microsoft Word - toc.doc

    Office of Legacy Management (LM)

    F Radiological Survey Procedures U n c o n t r o l l e d c o p y U.S. Department of Energy Long-Term Surveillance and Maintenance Plan for the Monticello NPL Sites Rev. 0 Doc. No. S0038700 Rev. Date: June 25, 2007 Page F-3 F.1 Radiological Survey Procedures This section describes the actions and method used by the Monticello Legacy Management (LM) Representative when conducting radiological surveys for the purpose of identifying radiologically contaminated material and determining the Radium-226

  6. Microsoft Word - toc.doc

    Office of Legacy Management (LM)

    G Uranium Scanning Procedure U n c o n t r o l l e d c o p y U.S. Department of Energy Long-Term Surveillance and Maintenance Plan for the Monticello NPL Sites Rev. 0 Doc. No. S0038700 Rev. Date: June 25, 2007 Page G-3 Uranium Scanning Procedure for Property MP-00211 1. Select a Ludlum Model 12 ratemeter with a 44-9 pancake Geiger-Mueller beta-gamma detector or equivalent instrument capable of meeting detection limit criteria. 2. Check that the ratemeter and the detector have calibration

  7. Microsoft Word - toc.doc

    Office of Legacy Management (LM)

    Appendix H Procedures for the Transportation of Radioactive Materials U n c o n t r o l l e d c o p y U.S. Department of Energy Long-Term Surveillance and Maintenance Plan for the Monticello NPL Sites Rev. 0 Doc. No. S0038700 Rev. Date: June 25, 2007 Page H-3 H1.0 Purpose The purpose of this procedure is to ensure that radioactive material is transported (1) using best management practices, (2) in compliance with U.S. Department of Transportation (DOT) requirements, and (3) with minimal risk to

  8. Serial and Westmere Queues on Carver

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    and Westmere Queues on Carver Serial and Westmere Queues on Carver September 20, 2011 by Francesca Verdier NERSC has replaced 80 8-core Intel Nehalem nodes on Carver with 80 12-core Intel Westmere nodes. The new processors run at the same frequency as those they replace, but have slightly larger caches. Also, the Westmere nodes are populated with 48GB of memory; the memory runs at 1333MHz. This new hardware serves two purposes. First, it provides access to more memory (48GB) than is available on

  9. Lipidic phase membrane protein serial femtosecond crystallography

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Lipidic phase membrane protein serial femtosecond crystallography Authors: Johansson LC, Arnlund D, White TA, Katona G, Deponte DP, Weierstall U, Doak RB, Shoeman RL, Lomb L, Malmerberg E, Davidsson J, Nass K, Liang M, Andreasson J, Aquila A, Bajt S, Barthelmess M, Barty A, Bogan MJ, Bostedt C, Bozek JD, Caleman C, Coffee R, Coppola N, Ekeberg T, Epp SW, Erk B, Fleckenstein H, Foucar L, Graafsma H, Gumprecht L, Hajdu J, Hampton CY, Hartmann R, Hartmann A, Hauser G, Hirsemann H, Holl P, Hunter

  10. Microsoft Word - AL2000-01.doc | Department of Energy

    Office of Environmental Management (EM)

    AL2000-01.doc Microsoft Word - AL2000-01.doc PDF icon Microsoft Word - AL2000-01.doc More Documents & Publications ALFAL 99-01 Department of Energy No Microsoft Word -...

  11. Microsoft Word - AL2008-06.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AL2008-06.doc Microsoft Word - AL2008-06.doc PDF icon Microsoft Word - AL2008-06.doc More Documents & Publications Chapter 9 - Contracting Qualifications Microsoft Word - PART...

  12. Microsoft Word - 99-04.doc | Department of Energy

    Broader source: Energy.gov (indexed) [DOE]

    Word - 99-04.doc More Documents & Publications Policy Flash 2014-18 Complex-Wide Strategic Sourcing Microsoft Word - AL2000-01.doc Microsoft Word - AL2005-11.doc...

  13. Microsoft Word - AL2006-10.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    0.doc Microsoft Word - AL2006-10.doc PDF icon AL2006-10 More Documents & Publications Microsoft Word - Matrixpart2.doc Microsoft Word - AcqGuide70pt52Matrixpart2Redo...

  14. Microsoft Word - AL2004-02.doc | Department of Energy

    Broader source: Energy.gov (indexed) [DOE]

    Microsoft Word - AL2004-02.doc More Documents & Publications Microsoft Word - AL2005-02.doc Microsoft Word - al2005-04.doc Microsoft Word - AL-Omnibus FY 2009 Apr 22 2009 all...

  15. Microsoft Word - al95-06.doc | Department of Energy

    Energy Savers [EERE]

    5-06.doc Microsoft Word - al95-06.doc PDF icon Microsoft Word - al95-06.doc More Documents & Publications ppl970-1.pdf Audit Report: IG-0589 Inspection Report: INS-O-02-01...

  16. Microsoft Word - meritrev.doc | Department of Energy

    Energy Savers [EERE]

    Microsoft Word - meritrev.doc Microsoft Word - meritrev.doc PDF icon Microsoft Word - meritrev.doc More Documents & Publications Policy Flash 2013-38 Revised Merit Review Guide For...

  17. Microsoft Word - al95-14.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    al95-14.doc Microsoft Word - al95-14.doc PDF icon Microsoft Word - al95-14.doc More Documents & Publications Cooperation with the New Independent States of the Former Soviet Union ...

  18. Microsoft Word - AL2006-07.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    7.doc Microsoft Word - AL2006-07.doc PDF icon Microsoft Word - AL2006-07.doc More Documents & Publications OPAM Policy Acquisition Guides Personal Property Management Certification ...

  19. Microsoft Word - FAC2005-27.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    FAC2005-27.doc Microsoft Word - FAC2005-27.doc PDF icon Microsoft Word - FAC2005-27.doc More Documents & Publications Policy Flash 2015-07 - FAC 2005-78 Policy Flash Search Listing ...

  20. Microsoft Word - al2005-06.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    - al2005-06.doc PDF icon Microsoft Word - al2005-06.doc More Documents & Publications Microsoft Word - AL2006-01.doc OPAM Policy Acquisition Guides Acquisition Letter: AL2005-08...

  1. Microsoft Word - al96-09.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    6-09.doc Microsoft Word - al96-09.doc PDF icon Microsoft Word - al96-09.doc More Documents & Publications Subject: Cost and Price Analysis Subject: Cost and Price Analysis Chapter...

  2. Microsoft Word - AL2005-08.doc | Department of Energy

    Office of Environmental Management (EM)

    8.doc Microsoft Word - AL2005-08.doc Microsoft Word - AL2005-08.doc More Documents & Publications OPAM Policy Acquisition Guides Attachment FY2011-28 OPAM Microsoft Word -...

  3. Microsoft Word - FAC2005-19.doc | Department of Energy

    Office of Environmental Management (EM)

    FAC2005-19.doc Microsoft Word - FAC2005-19.doc Microsoft Word - FAC2005-19.doc More Documents & Publications Acquisitlon Letter No. AL 2008-06 AL2008-06.pdf fac2001-27.pdf...

  4. Microsoft Word - FAL2004-05.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Microsoft Word - FAL2004-05.doc Microsoft Word - FAL2004-05.doc Microsoft Word - FAL2004-05.doc More Documents & Publications Archived Financial Assistance Letters Microsoft Word -...

  5. Microsoft Word - FORM46002.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    2.doc Microsoft Word - FORM46002.doc Microsoft Word - FORM46002.doc More Documents & Publications DOE F 4600.2 ATTACHMENT FLASH 2011-46(6) Attachment FY2011-63 OPAM...

  6. Microsoft Word - AL2008-05.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Microsoft Word - AL2008-05.doc Microsoft Word - AL2008-05.doc Microsoft Word - AL2008-05.doc More Documents & Publications Microsoft Word - AL 2010-07 Acquistion Letters Remaining...

  7. Microsoft Word - ARRAAttachment12v1.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ARRAAttachment12v1.doc Microsoft Word - ARRAAttachment12v1.doc More Documents & Publications Microsoft Word - DRAFT CRB Interview Guidance.doc Microsoft Word - ARRAGuideAttachment10v1

  8. Property:NEPA TieredDoc | Open Energy Information

    Open Energy Info (EERE)

    TieredDoc Jump to: navigation, search Property Name NEPA TieredDoc Property Type Page This is a property of type Page. Pages using the property "NEPA TieredDoc" Showing 25 pages...

  9. Microsoft Word - Brochure_Senior Officials.doc | Department of...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    BrochureSenior Officials.doc Microsoft Word - BrochureSenior Officials.doc Microsoft Word - BrochureSenior Officials.doc (29.28 KB) More Documents & Publications Preservation of ...

  10. Microsoft Word - CSATCourseCatalog_02.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    CSATCourseCatalog02.doc Microsoft Word - CSATCourseCatalog02.doc classroom-1008856960720.jpg Microsoft Word - CSATCourseCatalog02.doc (554.38 KB) More Documents & Publications ...

  11. Microsoft Word - May2009.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    May2009.doc Microsoft Word - May2009.doc Microsoft Word - May2009.doc (6.77 MB) More Documents & Publications Special Resource StudyEnvironmental Assessment for Manhattan Project ...

  12. Microsoft Word - AL2006-11.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AL2006-11.doc Microsoft Word - AL2006-11.doc PDF icon Microsoft Word - AL2006-11.doc More Documents & Publications Subject: Cost and Price Analysis Subject: Cost and Price Analysis...

  13. Operating Guidelines Appendix C D.DOC | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Operating Guidelines Appendix C D.DOC&0; Operating Guidelines Appendix C D.DOC&0; PDF icon Operating Guidelines Appendix C D.DOC&0; More Documents & Publications Operating ...

  14. Microsoft Word - FAL2006-03.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    FAL2006-03.doc Microsoft Word - FAL2006-03.doc PDF icon Microsoft Word - FAL2006-03.doc More Documents & Publications Financial Assistance Letter No. FAL 2006-03 Microsoft Word - ...

  15. Microsoft Word - Fact Sheet Energy Speech 082508 FINAL.doc |...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Speech 082508 FINAL.doc Microsoft Word - Fact Sheet Energy Speech 082508 FINAL.doc More Documents & Publications Microsoft Word - Press Release RECOMP 2-8-08 REV FINAL.doc ...

  16. Microsoft Word - 2005 FOIA ANNUAL REPORT.doc | Department of...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    2005 FOIA ANNUAL REPORT.doc Microsoft Word - 2005 FOIA ANNUAL REPORT.doc report2005.pdf PDF icon Microsoft Word - 2005 FOIA ANNUAL REPORT.doc More Documents & Publications U.S. ...

  17. Microsoft Word - AL2008-05.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AL2008-05.doc Microsoft Word - AL2008-05.doc PDF icon Microsoft Word - AL2008-05.doc More Documents & Publications Acquisition Letters Remaining In Effect Acquisition Letters ...

  18. Microsoft Word - Matrixpart2.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Matrixpart2.doc Microsoft Word - Matrixpart2.doc PDF icon Microsoft Word - Matrixpart2.doc More Documents & Publications AcqGuide70.52Matrixpart2Redo-OPAM Microsoft Word - ...

  19. Microsoft Word - al2004-03.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    al2004-03.doc Microsoft Word - al2004-03.doc PDF icon Microsoft Word - al2004-03.doc More Documents & Publications Acquisition Letter: AL2005-08 OPAM Policy Acquisition Guides ...

  20. Microsoft Word - FY09PropertyBSCContractor.doc | Department of...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    FY09PropertyBSCContractor.doc Microsoft Word - FY09PropertyBSCContractor.doc PDF icon Microsoft Word - FY09PropertyBSCContractor.doc More Documents & Publications FY09 Property ...

  1. Microsoft Word - FAL2004-05.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    FAL2004-05.doc Microsoft Word - FAL2004-05.doc PDF icon Microsoft Word - FAL2004-05.doc More Documents & Publications Archived Financial Assistance Letters Microsoft Word - Section ...

  2. Operating Guidelines Appendix A B.DOC | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Operating Guidelines Appendix A B.DOC&#0; Operating Guidelines Appendix A B.DOC&#0; Operating Guidelines Appendix A B.DOC&#0; (73.17 KB) More Documents & Publications Operating Guidelines Appendix C D.DOC&#0; 2 Jun 03 Roles and Responsibilities _CSO Highlighted_.doc&#0; DOE HR Guidebook 12_15_05.DOC&#0;

  3. Microsoft Word - Appendix N_Historical.doc

    Office of Legacy Management (LM)

    N Example Historical Marker and Plaque U.S. Department of Energy Weldon Spring Site LTS&M Plan July 2005 Doc. No. S0079000 Page N-3 Weldon Spring Site LTS&M Plan U.S. Department of Energy Doc. No. S0079000 July 2005 Page N-4

  4. DOE EIR FM.doc | Department of Energy

    Office of Environmental Management (EM)

    EIR FM.doc PDF icon DOE EIR FM.doc More Documents & Publications Contractor Statement of Work (SOW) Template (for EIR) External Independent Review (EIR) Standard Operating...

  5. Microsoft Word - ADR-Provisions-FederalAcquisitionReg.doc | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    More Documents & Publications ADR Provisions in Federal Acquisition Regulation (FAR) Microsoft Word - ACQUISITION LETTER.doc Microsoft Word - ADR Revised Policy82508Reformatted.doc...

  6. Microsoft Word - AL2005-12.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    PDF icon Microsoft Word - AL2005-12.doc More Documents & Publications Microsoft Word - AL2005-11.doc OPAM Policy Acquisition Guides Chapter 31 - Contract Cost Principles...

  7. Microsoft Word - CERFDOE Final Report - 071204.doc | Department...

    Office of Environmental Management (EM)

    Microsoft Word - CERFDOE Final Report - 071204.doc (394.42 KB) More Documents & Publications Integrated Project Team RM DOE EIR FM.doc Independent Oversight Activity Report, ...

  8. Design Potential of Metal Foil Substrates for Optimized DOC Performanc...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Design Potential of Metal Foil Substrates for Optimized DOC Performance Design Potential of Metal Foil Substrates for Optimized DOC Performance Poster presentation at the 2007 ...

  9. Microsoft Word - PeerReview_SAR.doc | Department of Energy

    Energy Savers [EERE]

    & Publications Microsoft Word - PeerReviewCCSP.doc Microsoft Word - Cross Reference Matrix Introduction.doc Assessment of the Effects of Climate Change on Federal Hydropower...

  10. NVN-086287 | Open Energy Information

    Open Energy Info (EERE)

    Type NOI Decision Document Date 20081203 Relevant Numbers Lead Agency Doc Number Serial Number NVN-086287 Lease Numbers NVN-074855 Proposed Action Installation and sampling...

  11. NVN-087930 | Open Energy Information

    Open Energy Info (EERE)

    Decision Document Date 20090916 Relevant Numbers Lead Agency Doc Number NVN-087930 Serial Number NVN-087930 Lease Numbers NVN-018423 NVN-076291 NVN-083928 NVN-085708 NVN-085709...

  12. NVN-087809 | Open Energy Information

    Open Energy Info (EERE)

    Decision Document Date 20090612 Relevant Numbers Lead Agency Doc Number NV-087809 Serial Number NV-087809 Lease Numbers NVN-085710 NVN-085711 Proposed Action A Gravity...

  13. NVN-086761 | Open Energy Information

    Open Energy Info (EERE)

    Type NOI Decision Document Date 20090224 Relevant Numbers Lead Agency Doc Number Serial Number NVN-086761 Lease Numbers NVN-079305 NVN-079306 NVN-079307 Proposed Action...

  14. NVN-086286 | Open Energy Information

    Open Energy Info (EERE)

    NOI, POO Decision Document Date 20081201 Relevant Numbers Lead Agency Doc Number Serial Number NVN-086286 Lease Numbers NVN-085722 NVN-085723 NVN-085724 Proposed Action The...

  15. NVN-087791 | Open Energy Information

    Open Energy Info (EERE)

    Type NOI Decision Document Date 20090721 Relevant Numbers Lead Agency Doc Number Serial Number NVN-087791 Lease Numbers NVN-074854 NVN-076298 NVN-076299 NVN-076300 NVN-076301...

  16. NVN-086285 | Open Energy Information

    Open Energy Info (EERE)

    Type NOI Decision Document Date 20081201 Relevant Numbers Lead Agency Doc Number Serial Number NVN-086285 Lease Numbers NVN-083928 NVN-085708 NVN-085709 Proposed Action The...

  17. NVN-088259 | Open Energy Information

    Open Energy Info (EERE)

    Type NOI Decision Document Date 20100317 Relevant Numbers Lead Agency Doc Number Serial Number NVN-088259 Lease Numbers NVN-074308 NVN-074309 Proposed Action Closely spaced...

  18. NVN-087812 | Open Energy Information

    Open Energy Info (EERE)

    Type NOI Decision Document Date 20090721 Relevant Numbers Lead Agency Doc Number Serial Number NVN-087812 Lease Numbers NVN-074854 NVN-076298 NVN-076299 NVN-076300 NVN-076301...

  19. NVN-89274 | Open Energy Information

    Open Energy Info (EERE)

    Type NOI Decision Document Date 20101202 Relevant Numbers Lead Agency Doc Number Serial Number NVN-89274 Lease Numbers NVN-085716 NVN-086893 NVN-088920 Proposed Action...

  20. NVN-087811 | Open Energy Information

    Open Energy Info (EERE)

    Type NOI Decision Document Date 20090721 Relevant Numbers Lead Agency Doc Number Serial Number NVN-087811 Lease Numbers NVN-074854 NVN-076298 NVN-076299 NVN-076300 NVN-076301...

  1. NVN-89534 | Open Energy Information

    Open Energy Info (EERE)

    Date 20110302 Application Document Type NOI Relevant Numbers Lead Agency Doc Number Serial Number NVN-089534 Lease Numbers NVN-083928 NVN-077668 Proposed Action Two thermal...

  2. NVN-89292 | Open Energy Information

    Open Energy Info (EERE)

    Type NOI Decision Document Date 20101202 Relevant Numbers Lead Agency Doc Number Serial Number NVN-089292 Lease Numbers NVN-088435 NVN-088436 NVN-088437 Proposed Action...

  3. Data Exploration Toolkit for serial diffraction experiments

    DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

    Zeldin, Oliver B.; Brewster, Aaron S.; Hattne, Johan; Uervirojnangkoorn, Monarin; Lyubimov, Artem Y.; Zhou, Qiangjun; Zhao, Minglei; Weis, William I.; Sauter, Nicholas K.; Brunger, Axel T.

    2015-01-23

    Ultrafast diffraction at X-ray free-electron lasers (XFELs) has the potential to yield new insights into important biological systems that produce radiation-sensitive crystals. An unavoidable feature of the 'diffraction before destruction' nature of these experiments is that images are obtained from many distinct crystals and/or different regions of the same crystal. Combined with other sources of XFEL shot-to-shot variation, this introduces significant heterogeneity into the diffraction data, complicating processing and interpretation. To enable researchers to get the most from their collected data, a toolkit is presented that provides insights into the quality of, and the variation present in, serial crystallography datamore » sets. These tools operate on the unmerged, partial intensity integration results from many individual crystals, and can be used on two levels: firstly to guide the experimental strategy during data collection, and secondly to help users make informed choices during data processing.« less

  4. Microsoft Word - Chapter 05 a.doc | Department of Energy

    Office of Environmental Management (EM)

    Microsoft Word - Chapter 05 a.doc Microsoft Word - Chapter 05 a.doc Microsoft Word - Chapter 05 a.doc (7.05 MB) More Documents & Publications Microsoft Word - Chapter 01.doc EIS-0426: Record of Decision EIS-0426: Final Environmental Impact Statement

  5. Microsoft Word - Chapter 01.doc | Department of Energy

    Office of Environmental Management (EM)

    Microsoft Word - Chapter 01.doc Microsoft Word - Chapter 01.doc Microsoft Word - Chapter 01.doc (10.76 MB) More Documents & Publications Microsoft Word - Chapter 05 a.doc EIS-0426: Record of Decision EIS-0426: Final Environmental Impact Statement

  6. RetTrendReport1205.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    RetTrendReport1205.doc&#0; RetTrendReport1205.doc&#0; RetTrendReport1205.doc&#0; (2.58 MB) More Documents & Publications Pension Plans for Contractor Workers April 1-10 comments.doc&#0; POLICY GUIDANCE MEMORANDUM #39 Phased Retirement

  7. AcqGuide70pt5.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AcqGuide70pt5.doc&#0; AcqGuide70pt5.doc&#0; AcqGuide70pt5.doc&#0; (16.21 KB) More Documents & Publications Chapter 70.3102-05-6: Contractor Compensation - Variable Pay Policy Flash 2016-34 AcqGuide41pt1.doc&#0;

  8. Microsoft Word - DOETTQuestions.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    DOETTQuestions.doc Microsoft Word - DOETTQuestions.doc Microsoft Word - DOETTQuestions.doc (48.9 KB) More Documents & Publications Microsoft Word - 73FR72036_UC signed 1&#0; Microsoft Word - SRNL Fed Register Response.doc Subcontractor Rights Under CRADAs and WFO Agreements

  9. Microsoft Word - FAL2006-04.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    FAL2006-04.doc Microsoft Word - FAL2006-04.doc Microsoft Word - FAL2006-04.doc (74.69 KB) More Documents & Publications Financial Assistance Letter No. FAL 2006-04 Microsoft Word - AL2006-03.doc Microsoft Word - FAL2004-01

  10. Microsoft Word - Federal Register Response _Jan09_.doc | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Federal Register Response _Jan09_.doc Microsoft Word - Federal Register Response _Jan09_.doc Microsoft Word - Federal Register Response _Jan09_.doc (13.88 KB) More Documents & Publications Microsoft Word - Document2 Microsoft Word - Intellectual Property Provisions _NRD-1003_.doc Microsoft Word - ARRAAttachment12v1

  11. Microsoft Word - Final Sample Participant Profile November 2008.doc |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy Final Sample Participant Profile November 2008.doc Microsoft Word - Final Sample Participant Profile November 2008.doc More Documents & Publications Microsoft Word - ARRAAttachment12v1.doc Microsoft Word - Fact Sheet Energy Speech 082508 FINAL.doc Microsoft Word - DRAFT CRB Interview Guidance

  12. Microsoft Word - PART 970.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    PART 970.doc Microsoft Word - PART 970.doc Microsoft Word - PART 970.doc (1.03 MB) More Documents & Publications Searchable Electronic Department of Energy Acquisition Regulation Microsoft Word - Matrixpart2.doc AcqGuide70.52Matrixpart2Redo-OPAM

  13. DOC-DOE Joint China Mission Statement | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Joint China Mission Statement DOC-DOE Joint China Mission Statement DOC-DOE Joint China Mission Statement DOC-DOE Joint China Mission Statement (109.75 KB) More Documents & Publications DOC-DOE China Mission Announcement Press Release FACT SHEET: U.S.-China Clean Energy Cooperation Announcements US-China Clean Energy Cooperation

  14. expanding_chp_in_your_state.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    expanding_chp_in_your_state.doc expanding_chp_in_your_state.doc expanding_chp_in_your_state.doc expanding_chp_in_your_state.doc (130 KB) More Documents & Publications Combined Heat and Power: Expanding CHP in Your State Sustainable Energy Resources for Consumers (SERC) - Solar Hot Water Sustainable Energy Resources for Consumers (SERC) - Geothermal/Ground-Source Heat Pumps

  15. Microsoft Word - EODchecklist1.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    New Employee Orientation FORMS CHECKLIST EOD Date: Employee Name: Organization: HR Specialist: Phone Number: Admin Contact: Phone Number: New Employee Orientation Forms to be ...

  16. Microsoft Word - Appendix A_Background.doc

    Office of Legacy Management (LM)

    ... and Maintenance (LTSM) Program records at the DOE Grand ... Weldon Spring Site LTS&M Plan U.S. Department of Energy Doc. ... (DOE 2003c). The two communities closest to the Chemical ...

  17. Microsoft Word - Appendix A.doc

    Office of Legacy Management (LM)

    ... and Maintenance (LTSM) Program records at the DOE Grand ... Weldon Spring Site LTS&M Plan U.S. Department of Energy Doc. ... (DOE 2003c). The two communities closest to the Chemical ...

  18. Edwin Parks (Doc) | Department of Energy

    Office of Environmental Management (EM)

    Doc Parks has over 27 years of active-duty military service with the U.S. Air Force (USAF), serving a broad range of command and staff positions in nuclear operations policy, ...

  19. Microsoft Word - S06401_IC.doc

    Office of Legacy Management (LM)

    and Recovery Act Cleanups This page intentionally left blank U.S. Department of Energy Annual Assessment of the Effectiveness of Site-Wide Institutional Controls June 2010 Doc. ...

  20. Microsoft Word - S05949_IR.doc

    Office of Legacy Management (LM)

    ... erosion. 2.1.4 Pond 4 Pond 4 is a lined solar evaporation pond that collects water ... store U.S. Department of Energy 2009 Annual Inspection-Monticello, Utah December 2009 Doc. ...

  1. Form:NEPA Doc | Open Energy Information

    Open Energy Info (EERE)

    NEPA Doc Jump to: navigation, search Input the name of a NEPA Document below. If the document already exists, you will be able to edit its information. AddEdit a NEPA Document...

  2. State Energy Program - Program Year 2014 - Formula Award - Administrative and Legal Requirement Doc

    Broader source: Energy.gov (indexed) [DOE]

    Weatherization and Intergovernmental Programs Office (WIPO) STATE: Mult PROJECT TITLE : State Energy Program - Program Year 2014 - Formula Award - Administrative and Legal Requirement Doc (ALRD) Funding Opportunity Announcement Number Procurement Instrument Number NEPA Control Number CID Number SEP-ALRD-2014 GFO-SEP-ALRD-2014 Based on my review of the information concerning the proposed action, as NEPA Compliance Officer (authorized under DOE Order 451.1A), I have made the following

  3. Switch for serial or parallel communication networks

    DOE Patents [OSTI]

    Crosette, D.B.

    1994-07-19

    A communication switch apparatus and a method for use in a geographically extensive serial, parallel or hybrid communication network linking a multi-processor or parallel processing system has a very low software processing overhead in order to accommodate random burst of high density data. Associated with each processor is a communication switch. A data source and a data destination, a sensor suite or robot for example, may also be associated with a switch. The configuration of the switches in the network are coordinated through a master processor node and depends on the operational phase of the multi-processor network: data acquisition, data processing, and data exchange. The master processor node passes information on the state to be assumed by each switch to the processor node associated with the switch. The processor node then operates a series of multi-state switches internal to each communication switch. The communication switch does not parse and interpret communication protocol and message routing information. During a data acquisition phase, the communication switch couples sensors producing data to the processor node associated with the switch, to a downlink destination on the communications network, or to both. It also may couple an uplink data source to its processor node. During the data exchange phase, the switch couples its processor node or an uplink data source to a downlink destination (which may include a processor node or a robot), or couples an uplink source to its processor node and its processor node to a downlink destination. 9 figs.

  4. Switch for serial or parallel communication networks

    DOE Patents [OSTI]

    Crosette, Dario B.

    1994-01-01

    A communication switch apparatus and a method for use in a geographically extensive serial, parallel or hybrid communication network linking a multi-processor or parallel processing system has a very low software processing overhead in order to accommodate random burst of high density data. Associated with each processor is a communication switch. A data source and a data destination, a sensor suite or robot for example, may also be associated with a switch. The configuration of the switches in the network are coordinated through a master processor node and depends on the operational phase of the multi-processor network: data acquisition, data processing, and data exchange. The master processor node passes information on the state to be assumed by each switch to the processor node associated with the switch. The processor node then operates a series of multi-state switches internal to each communication switch. The communication switch does not parse and interpret communication protocol and message routing information. During a data acquisition phase, the communication switch couples sensors producing data to the processor node associated with the switch, to a downlink destination on the communications network, or to both. It also may couple an uplink data source to its processor node. During the data exchange phase, the switch couples its processor node or an uplink data source to a downlink destination (which may include a processor node or a robot), or couples an uplink source to its processor node and its processor node to a downlink destination.

  5. NVN-091277 | Open Energy Information

    Open Energy Info (EERE)

    Relevant Numbers Lead Agency Doc Number Serial Number NVN-091277 Proposed Action Conduct water sampling, archaeological surveys, and shallow temperature surveys. Data Completion...

  6. NVN-91276 | Open Energy Information

    Open Energy Info (EERE)

    Mineral Manager none provided Selected Dates Relevant Numbers Lead Agency Doc Number Serial Number NVN-091276 Data Completion Notes No documents from which to populate page. 9...

  7. NVN-088208 | Open Energy Information

    Open Energy Info (EERE)

    6 months earlier; BLM NOI was just a formality Relevant Numbers Lead Agency Doc Number Serial Number NVN-088208 Lease Numbers NVN-074249 NVN-074250 NVN-074253 NVN-074254 Tiered Doc...

  8. NVN-091276 | Open Energy Information

    Open Energy Info (EERE)

    Type NOI Decision Document Date 20121025 Relevant Numbers Lead Agency Doc Number Serial Number NVN-091276 Lease Numbers NVN-083928 NVN-085708 Tiered Doc DOI-NV-W010-2012-0061...

  9. Microsoft Word - Clay Memo PMC Coburn Obama 11_9_06.doc | Department...

    Office of Environmental Management (EM)

    Clay Memo PMC Coburn Obama 11906.doc Microsoft Word - Clay Memo PMC Coburn Obama 11906.doc Microsoft Word - Clay Memo PMC Coburn Obama 11906.doc More Documents & Publications...

  10. Microsoft Word - TSLCC 2007_5_05_08 rev 1.doc | Department of...

    Office of Environmental Management (EM)

    TSLCC 200750508 rev 1.doc Microsoft Word - TSLCC 200750508 rev 1.doc Microsoft Word - TSLCC 200750508 rev 1.doc More Documents & Publications FY 2007 Total System Life...

  11. Microsoft Word - DP_cover_and_front matter_FINAL1.DOC | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    FINAL1.DOC Microsoft Word - DPcoverandfront matterFINAL1.DOC PDF icon Microsoft Word - DPcoverandfront matterFINAL1.DOC More Documents & Publications Microsoft Word - ...

  12. Microsoft Word - TSLCC 2007_5_05_08 rev 1.doc | Department of...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    TSLCC 200750508 rev 1.doc Microsoft Word - TSLCC 200750508 rev 1.doc PDF icon Microsoft Word - TSLCC 200750508 rev 1.doc More Documents & Publications FY 2007 Total System ...

  13. AcqGuide42pt3.doc | Department of Energy

    Office of Environmental Management (EM)

    1pt1.doc&#0; AcqGuide41pt1.doc&#0; AcqGuide41pt1.doc&#0; (13.23 KB) More Documents & Publications Chapter 41 - Acquisition of Utility Services Policy Flash 2016-31 Chapter 41: Utilities

    2pt3.doc&#0; AcqGuide42pt3.doc&#0; AcqGuide42pt3.doc&#0; (56.38 KB) More Documents & Publications Chapter 42 - Contract Administration Acquisition Guide Chapter 42.1202 - Novation Agreements Chapter 9.2: Performance Guarantees

  14. Microsoft Word - lesht.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Relative Humidity Climatology at the ARM NSA, SGP, and TWP Climate Research Facility ... ACRF Site Start Date End Date Number of Soundings NSA 04282002 11302003 402 SGP 0501...

  15. AL2007-05.doc

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AL 2007-05 Acquisition Regulation Date 03292007 ACQUISITION LETTER This Acquisition ... LETTERS REMAINING IN EFFECT NUMBER DATE SUBJECT 93-4 040793 Displaced Workers ...

  16. Microsoft Word - meritrev.doc

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ... Preference: In merit reviewer selection, there should be no preference based on race, ethnic identity, gender, religion, region, age, or institutional affiliation. 3 Number of ...

  17. Microsoft Word - TP22135.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Sandia National Laboratories will not be liable for any loss ... Although ferrite is typically not observed in bar stock, ... of deuterium in a number of austenitic stainless ...

  18. Microsoft Word - Highlights.doc

    Gasoline and Diesel Fuel Update (EIA)

    ... Source: National Oceanic and Atmospheric Administration, ... or commercial-sector generators to third parties, ... number in this table is net of re-injection and water cut. ...

  19. Microsoft Word - IG-0648.doc

    Energy Savers [EERE]

    ... Further, although the Department's Environment, Safety and Health personnel investigate ... to either OSHA logs or CAIRS. Safety Statistics For a number of years, the Department ...

  20. Microsoft Word - U0186500.doc

    Office of Legacy Management (LM)

    New Mexico, UMTRA Site September 2003 Prepared by U.S. Department of Energy Grand Junction Office Grand Junction, Colorado Work Performed Under DOE Contract Number ...

  1. Microsoft Word - N0049800.doc

    Office of Legacy Management (LM)

    49800 GJO-2002-306-TAR MAC-PIN 14.5.2 Pinellas Environmental Restoration Project at the Young-Rainey STAR Center Building 100 Area Plume Control Technology Selection Report February 2002 Prepared by U.S. Department of Energy Grand Junction Office Grand Junction, Colorado Work Performed Under DOE Contract Number DE-AC13-96GJ87335 Task Order Number MAC02-10 This page intentionally left blank Document Number N0049800 Contents DOE/Grand Junction Office Building 100 Area Plume Control Technology

  2. Microsoft Word - FY08AnnualReport.doc | Department of Energy

    Office of Environmental Management (EM)

    FY08AnnualReport.doc Microsoft Word - FY08AnnualReport.doc PDF icon Microsoft Word - FY08AnnualReport.doc More Documents & Publications Microsoft Word - FY09AnnualReportv1.doc...

  3. Microsoft Word - AL2005-05Revised.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AL2005-05Revised.doc Microsoft Word - AL2005-05Revised.doc PDF icon Microsoft Word - AL2005-05Revised.doc More Documents & Publications AL2007-03.doc&0; 2011-31 Attachment...

  4. Microsoft Word - ALonEO13423Last.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ALonEO13423Last.doc Microsoft Word - ALonEO13423Last.doc PDF icon Microsoft Word - ALonEO13423Last.doc More Documents & Publications Microsoft Word - AL2008-05.doc Tri-Party ...

  5. Microsoft Word - ITSI award doc 06-D0008 conformed to P00001...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ITSI award doc 06-D0008 conformed to P00001.doc Microsoft Word - ITSI award doc 06-D0008 conformed to P00001.doc More Documents & Publications Policy Flash 2015-02 Acquisition ...

  6. Microsoft Word - Flash2008-09Attachment.doc | Department of Energy

    Broader source: Energy.gov (indexed) [DOE]

    9Attachment.doc More Documents & Publications Flash2007-02Attachment.doc&0; Microsoft Word - AL2000-05Attachment.doc Flash2007-03Attachment.doc&0;...

  7. Microsoft Word - Policy Flash 2008-04.doc | Department of Energy

    Office of Environmental Management (EM)

    4.doc Microsoft Word - Policy Flash 2008-04.doc More Documents & Publications Microsoft Word - Policy Flash 2008-07.doc Microsoft Word - Policy Flash 2008-10.doc Microsoft Word -...

  8. Microsoft Word - Policy Flash 2008-06.doc | Department of Energy

    Office of Environmental Management (EM)

    6.doc Microsoft Word - Policy Flash 2008-06.doc More Documents & Publications Microsoft Word - Policy Flash 2008-07.doc Microsoft Word - Policy Flash 2008-10.doc Microsoft Word -...

  9. Microsoft Word - AL2000-05Attachment.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Attachment.doc Microsoft Word - AL2000-05Attachment.doc PDF icon Microsoft Word - AL2000-05Attachment.doc More Documents & Publications al99-06attachment.doc&0; EXHIBIT A: CRADA,...

  10. Microsoft Word - DRAFT CRB Interview Guidance.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    DRAFT CRB Interview Guidance.doc Microsoft Word - DRAFT CRB Interview Guidance.doc More Documents & Publications Microsoft Word - ARRAAttachment12v1.doc Microsoft Word - ARRAGuideAttachment10v1.doc Microsoft Word - Document2

  11. LATEST_m_93.DOC

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    3 AM Change Number M-93-01-02 Federal Facility Agreement and Consent Order Change Control Form Do not use blue ink. Type or print using black ink. Date 123101 Originator Phone H....

  12. Microsoft Word - M084.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of Offers is extended, is not...

  13. Microsoft Word - U0195900.doc

    Office of Legacy Management (LM)

    GJO-2004-589-TAC ESL-RPT-2004-02 ESL-RPT-2004-02 U0195900 Office of Legacy Management ... Number U0195900 Contents DOEOffice of Legacy Management Diffusion Multilayer Sampling ...

  14. CM300DLFinal.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    To reserve a CM300 session, go to wwwncem.lbl.gov, click on "Microscope Scheduling", use proposal number and password to log in. You may only sign up for 2 sessions per month, ...

  15. AcqGuide39pt1.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    PDF icon AcqGuide39pt1.doc&0; More Documents & Publications Chapter 39 - Acquisition of Information Technology AcqGuide38pt1.doc&0; Microsoft Word - AcqGuide16pt1...

  16. AcqGuide70pt31.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    PDF icon AcqGuide70pt31.doc&0; More Documents & Publications Microsoft Word - AcqGuide70pt31A.doc Policy Flash 2014-26 Acquisition Guide Chapter 70.31A - Costs...

  17. AcqGuide47pt1.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AcqGuide47pt1.doc&0; PDF icon AcqGuide47pt1.doc&0; More Documents & Publications Chapter 47 - Transportation TEC Working Group Topic Groups Manual Review Key Documents ...

  18. Microsoft Word - FOA cover sheet.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    22.62 KB) More Documents & Publications Microsoft Word - FOA cover sheet.doc Recovery Act, Office of the Biomass Program,Funding Opportunity Announcements Special Notice Microsoft Word - FOA cover sheet.doc

  19. Microsoft Word - U0127400.doc

    Office of Legacy Management (LM)

    12-TAR MAC-GWMON 1.8 Chemistry of Phase I Phytoremediation Soils: Work Plan for the Monument Valley, Arizona, UMTRA Project Site September 2001 This page intentionally left blank UMTRA Ground Water Project Chemistry of Phase I Phytoremediation Soils: Work Plan for the Monument Valley, Arizona, UMTRA Project Site September 2001 Prepared for U.S. Department of Energy Grand Junction Office Grand Junction, Colorado Project Number UGW-511-0015-37-000 Document Number U0127400 Work Performed Under DOE

  20. NVN-085710 | Open Energy Information

    Open Energy Info (EERE)

    Decision Document Date 20080818 Relevant Numbers Lead Agency Doc Number NV-08-08-006 Serial Number NVN-085710 Documents Serial Register Page: NVN-085710 - SRP.pdf Retrieved from...

  1. NVN-085711 | Open Energy Information

    Open Energy Info (EERE)

    Decision Document Date 20080818 Relevant Numbers Lead Agency Doc Number NV-08-08-007 Serial Number NVN-085711 Documents Serial Register Page: NVN-085711 - SRP.pdf Retrieved from...

  2. Microsoft Word - Policy Flash 2008-07.doc | Department of Energy

    Office of Environmental Management (EM)

    07.doc Microsoft Word - Policy Flash 2008-07.doc More Documents & Publications Microsoft Word - Policy Flash 2008-10...

  3. Microsoft Word - Policy Flash 2008-10.doc | Department of Energy

    Office of Environmental Management (EM)

    10.doc Microsoft Word - Policy Flash 2008-10.doc More Documents & Publications Microsoft Word - Policy Flash 2008-07...

  4. csep_transcript_transportation.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    More Documents & Publications cseptranscriptminneapolis.doc Marketing & Driving Demand: Social Media Tools & Strategies - January 16, 2011 (Text Version) Transcript: Biomass ...

  5. comm_pace_updates_field_resources_prog_design_implementation.doc |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy comm_pace_updates_field_resources_prog_design_implementation.doc comm_pace_updates_field_resources_prog_design_implementation.doc comm_pace_updates_field_resources_prog_design_implementation.doc comm_pace_updates_field_resources_prog_design_implementation.doc (126.5 KB) More Documents & Publications Commercial PACE: Updates from the Field & New Resources for Design and Implementation Combined Heat and Power: Expanding CHP in Your State expanding_chp_in_your_state

  6. DOCS System Configuration Management Plan | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    DOCS System Configuration Management Plan DOCS System Configuration Management Plan The DOCS Systems Configuration Management Plan (SCMP), from an actual DOE systems engineering project, can be used as a template to facilitate the creation of the CMP for your particular project. DOCS System Configuration Management Plan (654.98 KB) More Documents & Publications OPC Security Whitepaper #3Hardening Guidelines for OPC Hosts NMMSS Software Quality Assurance Plan ABB SCADA/EMS System INEEL

  7. 20130226_sunshot_transcript_lbnl.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    transcript_lbnl.doc 20130226_sunshot_transcript_lbnl.doc 20130226_sunshot_transcript_lbnl.doc 20130226_sunshot_transcript_lbnl.doc (73.5 KB) More Documents & Publications Why Are Resiential PV Prices in Germany So Much Lower Than in the United States? text_alternative_stat_webinar_2012_7_25.docx An Analysis of Residential PV System Price Differences between the United States and Germany

  8. AcqGuide3pt1.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    pt1.doc&0; AcqGuide3pt1.doc&0; PDF icon AcqGuide3pt1.doc&0; More Documents & Publications POLICY FLASH 2016-04 Procurement Integrity PI Brief 6 15 07 final2&0;

  9. CompleteProject List.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    CompleteProject List.doc&#0; CompleteProject List.doc&#0; CompleteProject List.doc&#0; (9.47 KB) More Documents & Publications Tribal Energy Program February 2012 Award Project Descriptions CX-008525: Categorical Exclusion Determination 2010 Program Review Meeting

  10. AcqGuide41pt1.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    1pt1.doc&#0; AcqGuide41pt1.doc&#0; AcqGuide41pt1.doc&#0; (13.23 KB) More Documents & Publications Chapter 41 - Acquisition of Utility Services Policy Flash 2016-31 Chapter 41: Utilities

  11. AcqGuide9pt2.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AcqGuide9pt2.doc&#0; AcqGuide9pt2.doc&#0; AcqGuide9pt2.doc&#0; (16.88 KB) More Documents & Publications Chapter 9.2: Performance Guarantees Policy Flash 2016-32 Chapter 9 - Contracting Qualifications

  12. Microsoft Word - AL2003-04.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    3-04.doc Microsoft Word - AL2003-04.doc Microsoft Word - AL2003-04.doc (254.1 KB) More Documents & Publications AL2004-01r2.pdf City of Tulare Renewable Biogas Fuel Cell Project

  13. Microsoft Word - LibraryofPriorRulemakings.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    LibraryofPriorRulemakings.doc Microsoft Word - LibraryofPriorRulemakings.doc Microsoft Word - LibraryofPriorRulemakings.doc (28.89 KB) More Documents & Publications Solar Background Document 1 Natural Gas Imports and Exports First Quarter Report 2014 Natural Gas Imports and Exports Second Quarter Report 2014

  14. Microsoft Word - Political Activity and the Federal Employee.doc |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy Political Activity and the Federal Employee.doc Microsoft Word - Political Activity and the Federal Employee.doc Microsoft Word - Political Activity and the Federal Employee.doc (165.92 KB) More Documents & Publications Political Activity at DOE Facilities by DOE Contractors Audit Report: IG-0473 PROCESSING INVITATIONS FOR A PRESIDENTIAL APPOINTEE

  15. Microsoft Word - competitionincontractingguidev2.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    competitionincontractingguidev2.doc Microsoft Word - competitionincontractingguidev2.doc Microsoft Word - competitionincontractingguidev2.doc (215.28 KB) More Documents & Publications AcqGuide 5.2-OPAM Acquisition Guide, Chapter 6.1, Competition Requirements Microsoft Word - AG Chapter 6 1 Nov 2010

  16. Microsoft Word - fal2004-04.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    fal2004-04.doc Microsoft Word - fal2004-04.doc Microsoft Word - fal2004-04.doc (132.28 KB) More Documents & Publications U.S. Department of Energy - Guide to Financial Assistance - Audit Requirements for For-Profit Organizations Financial Assistance Guide (2013) Revised Guide for Financial Assistance

  17. Microsoft Word - table_21.doc

    U.S. Energy Information Administration (EIA) Indexed Site

    9 Table 21. Number of natural gas commercial consumers by type of service and state, 2013-2014 R Revised data. Note: Totals may not equal sum of components due to independent rounding. Source: Energy Information Administration (EIA), Form EIA-176, "Annual Report of Natural and Supplemental Gas Supply and Disposition." Please see the cautionary note regarding the number of residential and commercial customers located on the second page of Appendix A of this report. Alabama 67,006 130

  18. Microsoft Word - n0021500.doc

    Office of Legacy Management (LM)

    PIN 16.2 Environmental Restoration Program Wastewater Neutralization Area/Building 200 Area Corrective Measures Implementation Plan Addendum January 2000 Environmental Restoration Program Wastewater Neutralization Area/Building 200 Area Corrective Measures Implementation Plan Addendum January 2000 Prepared for U.S. Department of Energy Albuquerque Operations Office Grand Junction Office Prepared by MACTEC Environmental Restoration Services, LLC Grand Junction, Colorado Project Number

  19. Microsoft Word - e0399102.doc

    Office of Legacy Management (LM)

    UNCONTROLLED IF PRINTED E0399101 GJO-2003-493-TAC MNT 015.20 REV. 06 Copy No. ______ Draft-Final Monticello Site Management Plan October 2003 UNCONTROLLED IF PRINTED Prepared by U.S. Department of Energy Grand Junction, Colorado Work Performed Under DOE Contract Number DE-AC13-02GJ79491 UNCONTROLLED IF PRINTED Contents October 2003 Site Management Plan Page iii Contents Acronyms and Abbreviations

  20. Microsoft Word - U01866.doc

    Office of Legacy Management (LM)

    186600 GJO-2003-489-TAC GJO-GWDUR 2.0 UMTRA Ground Water Project Verification Monitoring Report for the Durango, Colorado, UMTRA Project Site September 2003 Prepared by U.S. Department of Energy Grand Junction Office Grand Junction, Colorado Work Performed Under DOE Contract No. DE-AC13-02GJ79491 Document Number U0186600 Contents DOE/Grand Junction Office Verification Monitoring Report-Durango, Colorado September 2003 Page iii Contents 1.0

  1. Microsoft Word - August06.doc

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    August 2006 Office of History and Heritage Resources Volume 2, Number 2 In This Issue * B-Reactor Study for Deputy Secretary * Museum and Visitor Center Conference * National Park Service Manhattan Project Resource Study * DOE Headquarters Museum/Visitor Center * Want to Receive Partners in Preservation? * 2007 DOE Cultural Resources Forum: Hanford, Washington * 2006 DOE Cultural Resources Forum: Oak Ridge, Tennessee * K-25 Racetrack? * FPO Funds Field Office Preservation * Pantex Donates Cold

  2. chap4_3.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    CALORIMETRY V.E. Viola and R. Bougault In any attempt to describe a system in terms of thermodynamic variables, a knowledge of heat content is fundamental. For hot nuclei, this energetic factor is usually expressed in terms of excitation energy per nucleon, E*/A. Because nuclei are finite systems, size is important. Thus, it is necessary to determine both the heat content E* and the number of nucleons A that characterize the disintegrating ensemble. In this chapter we examine the methods by

  3. word2pdf43408.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    YOUR BENEFIT PLAN LOS ALAMOS NATIONAL SECURITY, LLC Retiree Voluntary Accidental Death and Dismemberment Plan (ADD) Questions about Your Coverage In the event You have questions regarding any aspect of Your coverage, You should contact Your Employee Benefits Manager or You may write to us at: The Hartford Group Benefits Division, Customer Service P.O. Box 2999 Hartford, CT 06104-2999 Or call Us at: 1-800-523-2233 When calling, please give Us the following information: 1) the policy number; and

  4. T-527: OpenSC Smart Card Serial Number Multiple Buffer Overflow Vulnerabilities

    Broader source: Energy.gov [DOE]

    OpenSC is prone to multiple buffer-overflow vulnerabilities because the application fails to perform adequate boundary checks on user-supplied input. Attackers may leverage these issues to execute arbitrary code in the context of the application. Failed attacks will cause denial-of-service conditions.

  5. Microsoft Word - table_20.doc

    U.S. Energy Information Administration (EIA) Indexed Site

    8 Table 20. Number of natural gas residential consumers by type of service and state, 2013-2014 Alabama 765,957 0 765,957 769,418 0 769,418 Alaska 124,411 0 124,411 126,416 0 126,416 Arizona 1,171,997 6 1,172,003 1,186,788 6 1,186,794 Arkansas R 549,764 0 R 549,764 549,034 0 549,034 California 10,471,814 283,094 10,754,908 10,372,973 408,747 10,781,720 Colorado 1,672,307 5 1,672,312 1,690,576 5 1,690,581 Connecticut 512,110 1,382 513,492 521,460 1,198 522,658 Delaware 155,627 0 155,627 158,502 0

  6. Microsoft Word - table_22.doc

    U.S. Energy Information Administration (EIA) Indexed Site

    0 Table 22. Number of natural gas industrial consumers by type of service and state, 2013-2014 Alabama 2,876 267 3,143 2,973 271 3,244 Alaska 2 1 3 1 0 1 Arizona 257 126 383 256 130 386 Arkansas 513 507 1,020 531 478 1,009 California 32,662 5,334 37,996 32,266 5,282 37,548 Colorado 946 6,347 7,293 986 6,837 7,823 Connecticut 3,360 1,094 4,454 3,340 877 4,217 Delaware 28 110 138 28 113 141 Florida 166 362 528 165 355 520 Georgia 984 1,258 2,242 887 1,594 2,481 Hawaii 22 0 22 23 0 23 Idaho 109 R

  7. Microsoft Word - S03736_ FMP010609.doc

    Office of Legacy Management (LM)

    Fluid Management Plan Central Nevada Test Area Corrective Action Unit 443 January 2009 LMS/CNT/S03736 This page intentionally left blank LMS/CNT/S03736 Fluid Management Plan Central Nevada Test Area Corrective Action Unit 443 January 2009 This page intentionally left blank U.S. Department of Energy Fluid Management Plan For CAU 443: CNTA, Subsurface, Nevada January 2009 Doc. No. S0373600 Page i Contents Acronyms and Abbreviations

  8. Microsoft Word - S04019_GSB.doc

    Office of Legacy Management (LM)

    Long-Term Hydrologic Monitoring Program Evaluation Report June 2009 LMS/GSB/S04019 This page intentionally left blank LMS/GSB/S04019 Gasbuggy, New Mexico Long-Term Hydrologic Monitoring Program Evaluation Report June 2009 This page intentionally left blank U.S. Department of Energy Gasbuggy, New Mexico Long-Term Hydrologic Monitoring Program Evaluation Report June 2009, Rev. 3 Doc. No. S04019 Page i Contents Abbreviations

  9. Microsoft Word - S06178_MP.doc

    Office of Legacy Management (LM)

    Rulison Monitoring Plan July 2010 Approved for public release; further dissemination unlimited LMS/RUL/S06178 This page intentionally left blank LMS/RUL/S06178 Rulison Monitoring Plan July 2010 Approved for public release; further dissemination unlimited This page intentionally left blank U.S. Department of Energy Rulison Monitoring Plan July 2010 Doc. No. S06178 Page i Contents 1.0

  10. Microsoft Word - S06596_GW.doc

    Office of Legacy Management (LM)

    Annual Groundwater Report May 2009 through April 2010 September 2010 LMS/MNT/S06596 This page intentionally left blank LMS/MNT/S06596 Monticello Mill Tailings Site Operable Unit III Annual Groundwater Report May 2009 through April 2010 September 2010 This page intentionally left blank U.S. Department of Energy Monticello Mill Tailings Site OU III Annual Groundwater Report May 2009-April 2010 September 2010 Doc. No. S06596 Page i Contents