National Library of Energy BETA

Sample records for doc number serial

  1. Property:NEPA SerialNumber | Open Energy Information

    Open Energy Info (EERE)

    SerialNumber Jump to: navigation, search Property Name NEPA SerialNumber Property Type String This is a property of type String. Pages using the property "NEPA SerialNumber"...

  2. Property:NEPA LeadAgencyDocNumber | Open Energy Information

    Open Energy Info (EERE)

    LeadAgencyDocNumber Jump to: navigation, search Property Name NEPA LeadAgencyDocNumber Property Type String This is a property of type String. Pages using the property "NEPA...

  3. System and method for simultaneously collecting serial number information from numerous identity tags

    DOE Patents [OSTI]

    Doty, Michael A. (Manteca, CA)

    1997-01-01

    A system and method for simultaneously collecting serial number information reports from numerous colliding coded-radio-frequency identity tags. Each tag has a unique multi-digit serial number that is stored in non-volatile RAM. A reader transmits an ASCII coded "D" character on a carrier of about 900 MHz and a power illumination field having a frequency of about 1.6 Ghz. A one MHz tone is modulated on the 1.6 Ghz carrier as a timing clock for a microprocessor in each of the identity tags. Over a thousand such tags may be in the vicinity and each is powered-up and clocked by the 1.6 Ghz power illumination field. Each identity tag looks for the "D" interrogator modulated on the 900 MHz carrier, and each uses a digit of its serial number to time a response. Clear responses received by the reader are repeated for verification. If no verification or a wrong number is received by any identity tag, it uses a second digital together with the first to time out a more extended period for response. Ultimately, the entire serial number will be used in the worst case collision environments; and since the serial numbers are defined as being unique, the final possibility will be successful because a clear time-slot channel will be available.

  4. System and method for simultaneously collecting serial number information from numerous identity tags

    DOE Patents [OSTI]

    Doty, M.A.

    1997-01-07

    A system and method are disclosed for simultaneously collecting serial number information reports from numerous colliding coded-radio-frequency identity tags. Each tag has a unique multi-digit serial number that is stored in non-volatile RAM. A reader transmits an ASCII coded ``D`` character on a carrier of about 900 MHz and a power illumination field having a frequency of about 1.6 Ghz. A one MHz tone is modulated on the 1.6 Ghz carrier as a timing clock for a microprocessor in each of the identity tags. Over a thousand such tags may be in the vicinity and each is powered-up and clocked by the 1.6 Ghz power illumination field. Each identity tag looks for the ``D`` interrogator modulated on the 900 MHz carrier, and each uses a digit of its serial number to time a response. Clear responses received by the reader are repeated for verification. If no verification or a wrong number is received by any identity tag, it uses a second digital together with the first to time out a more extended period for response. Ultimately, the entire serial number will be used in the worst case collision environments; and since the serial numbers are defined as being unique, the final possibility will be successful because a clear time-slot channel will be available. 5 figs.

  5. Property:NEPA SerialRegisterPage | Open Energy Information

    Open Energy Info (EERE)

    SerialRegisterPage Jump to: navigation, search Property Name NEPA SerialRegisterPage Property Type Page Description Serial Register Page files for NEPA Docs. Related Serial...

  6. Introduction Yucca Lady, a World War II Boeing-17G Flying Fortress Army Air Force serial number

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Yucca Lady, a World War II Boeing-17G Flying Fortress Army Air Force serial number 44-83575, was flown to the Nevada Test Site (now known as the Nevada National Security Site - NNSS) in 1952, where she was instrumented and subjected to three atmospheric nuclear tests as part of the Operation Tumbler-Snapper -- Vulnerability of Parked Aircraft to Atomic Bombs series, conducted in April and May 1952. The project would determine the effects of a nuclear device detonated above an airfield,

  7. Associate Research Physicist (Post Doc, Experimental Research...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Post Doc, Experimental Research, NSTX-U, Radio Frequency Waves) Department: Research Staff: RM1 Requisition Number: 1500421 The Princeton Plasma Physics Laboratory (PPPL) seeks to...

  8. Number

    Office of Legacy Management (LM)

    ' , /v-i 2 -i 3 -A, This dow'at consists ~f--~-_,_~~~p.~,::, Number -------of.-&--copies, 1 Series.,-a-,-. ! 1 THE UNIVERSITY OF ROCHESTER 1; r-.' L INTRAMURALCORRESPONDENCE i"ks' 3 2.. September 25, 1947 Memo.tor Dr. A. H, Dovdy . From: Dr. H. E, Stokinger Be: Trip Report - Mayvood Chemical Works A trip vas made Nednesday, August 24th vith Messrs. Robert W ilson and George Sprague to the Mayvood Chemical F!orks, Mayvood, New Jersey one of 2 plants in the U.S.A. engaged in the

  9. howtodesignandmarketenergyefficiencyprogramstospecificneighborhoods.doc |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy howtodesignandmarketenergyefficiencyprogramstospecificneighborhoods.doc howtodesignandmarketenergyefficiencyprogramstospecificneighborhoods.doc howtodesignandmarketenergyefficiencyprogramstospecificneighborhoods.doc Microsoft Office document icon howtodesignandmarketenergyefficiencyprogramstospecificneighborhoods.doc More Documents & Publications How to Design and Market Energy Efficiency Programs to Specific Neighborhoods Using Social Media to Engage the Community

  10. finance_programs.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    financeprograms.doc financeprograms.doc financeprograms.doc Microsoft Office document icon financeprograms.doc More Documents & Publications Tools for Designing & Implementing ...

  11. Doc...~En.

    Office of Legacy Management (LM)

    ' : ,:#;: .' :.' . ,.:: :,; ..,' ... ..,,..,.... - .~~._ I&i3:scD .::-:, TO-340 .":: ..' . - ' - -. ' . .." ,.. .;.. Very traly yours;, -' .~X :, Doc...~En. ' Br.:Re&ng ';;a' : _, Div. Reading File ., ,, .~, ,.~-

  12. Hallmark Cryptographic Serial Communication | Department of Energy

    Energy Savers [EERE]

    Cryptographic Serial Communication Hallmark Cryptographic Serial Communication A cryptographic card and link module integrating the Secure SCADA Communications Protocol to provide secure serial communications for existing and new energy control systems PDF icon Hallmark Cryptographic Serial Communication More Documents & Publications Hallmark Project Commercialization of the Secure SCADA Communications Protocol, a cryptographic security solution for device-to-device communication

  13. webinar_innovation_financing.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    financing.doc webinarinnovationfinancing.doc webinarinnovationfinancing.doc Microsoft Office document icon webinarinnovationfinancing.doc More Documents & Publications...

  14. webinar_innovation_planning_zoning.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    planningzoning.doc webinarinnovationplanningzoning.doc webinarinnovationplanningzoning.doc Microsoft Office document icon webinarinnovationplanningzoning.doc More...

  15. Serial Queue Available on Hopper and Edison

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Queue Available on Hopper and Edison Serial Queue Available on Hopper and Edison November 12, 2014 by Francesca Verdier The new serial queue on Hopper and Edison allows multiple serial jobs from different users to share a compute node. it is implemented via Cray's Cluster Compatibility Mode and uses wrapper commands such as qsub.serial. See Serial Queue on the Crays. Subscribe via RSS Subscribe Browse by Date January 2016 December 2015 November 2015 October 2015 September 2015 August 2015 July

  16. webinar_innovation_net_metering_interconnection.doc | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    netmeteringinterconnection.doc webinarinnovationnetmeteringinterconnection.doc webinarinnovationnetmeteringinterconnection.doc Microsoft Office document icon...

  17. webinar_innovation_organizing_strategizing.doc | Department of...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    organizingstrategizing.doc webinarinnovationorganizingstrategizing.doc webinarinnovationorganizingstrategizing.doc Microsoft Office document icon webinarinnovationorganizi...

  18. webinar_innovation_permitting_inspections.doc | Department of...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    permittinginspections.doc webinarinnovationpermittinginspections.doc webinarinnovationpermittinginspections.doc Microsoft Office document icon webinarinnovationpermitting...

  19. fed_finance_facilities_ee_upgrades_deployment.doc | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    fedfinancefacilitieseeupgradesdeployment.doc fedfinancefacilitieseeupgradesdeployment.doc fedfinancefacilitieseeupgradesdeployment.doc Microsoft Office document icon ...

  20. Serial Queue Available on Hopper and Edison

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Queue Available on Hopper and Edison Serial Queue Available on Hopper and Edison November 12, 2014 by Francesca Verdier The new serial queue on Hopper and Edison allows multiple...

  1. interiorlightingefficiencyformunicipalities.doc | Department of Energy

    Broader source: Energy.gov (indexed) [DOE]

    interiorlightingefficiencyformunicipalities.doc Microsoft Office document icon interiorlightingefficiencyformunicipalities.doc More Documents & Publications Interior Lighting Efficiency for Municipalities States & Emerging Energy Technologies stateandemergingtechnologies.doc

  2. Doc.~:Ru.

    Office of Legacy Management (LM)

    .' , .' c,j .c; Distriblition:~ ;. <; ~..,:L.D.i&%.ay,FiN-OR00 Doc.~:Ru. ,.,. 75. ' Br..Reading 'ire' ,lliv. Read&q File ,: '. ~ ,, .-' . ...: - SURNAME..

  3. Microsoft Word - NONPHMC_CoC.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    CERTIFICATE OF CONFORMANCE Container Identification Number:_________________________________________________ Section 1. Vent The vent that has been installed on this waste container and the waste packaging meet the requirements of HNF-EP-0063, Section 2.11.4. The vent is an approved vent listed in Appendix H of HNF-EP-0063 or has been approved for use. ~ N/A - Vent Not Required Per HNF-EP-0063 ~ Yes - Vent Model Number: Vent Serial Number: Section 2. Certification Signature of this Certificate

  4. Microsoft Word - BreakoutSummary.doc

    Office of Environmental Management (EM)

    H:/TECWG/January 2002/Breakout Worksheets.doc *The number appearing in brackets refer to the number of participants with the same comment. 1. On a scale of 1 (lowest) to 10 (highest), how would you rate TEC's effectiveness relative to other comparable organizations? Average score = 7.51 2. The TEC mission is to "serve as a mechanism to provide continuing and improved coordination between appropriate DOE elements, other levels of government, and outside organizations having a responsibility

  5. Microsoft Word - ContractManagementPlanningDRIVERS.doc | Department...

    Broader source: Energy.gov (indexed) [DOE]

    ContractManagementPlanningDRIVERS.doc More Documents & Publications Microsoft Word - ARRAAttachment2.doc Microsoft Word - ARRAModelWAS.doc Microsoft Word - ARRAMOModelMod.doc...

  6. transcript_pv_mapper.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    transcriptpvmapper.doc transcriptpvmapper.doc transcriptpvmapper.doc transcriptpvmapper.doc More Documents & Publications PVMapper: A Tool for Energy Siting...

  7. NVN-89276 | Open Energy Information

    Open Energy Info (EERE)

    Type NOI Decision Document Date 20101202 Relevant Numbers Lead Agency Doc Number Serial Number NVN-89276 Proposed Action Geochemical survey Documents Serial Register Page:...

  8. NVN-89275 | Open Energy Information

    Open Energy Info (EERE)

    Type NOI Decision Document Date 20101202 Relevant Numbers Lead Agency Doc Number Serial Number NVN-89275 Proposed Action Geophysical surveys. Documents Serial Register Page:...

  9. NVN-89278 | Open Energy Information

    Open Energy Info (EERE)

    Type NOI Decision Document Date 20101202 Relevant Numbers Lead Agency Doc Number Serial Number NVN-89278 Proposed Action Geophysical survey. Documents Serial Register Page:...

  10. Microsoft Word - aser_rev0.doc

    Office of Legacy Management (LM)

    Weiss Associates Environmental Science, Engineering and Management ANNUAL SITE ENVIRONMENTAL REPORT CALENDAR YEAR 2007 for the LABORATORY FOR ENERGY-RELATED HEALTH RESEARCH UNIVERSITY OF CALIFORNIA, DAVIS Submitted to: S.M. Stoller Corporation 2597 B ¾ Road Grand Junction, Colorado 81503 Prepared by: Weiss Associates 5801 Christie Avenue, Suite 600 Emeryville, California 94608-1827 September 30, 2008 Rev. 0 J:\DOE_STOLLER\4110\137\ASER 2007\REV. 0\ASER_REV0.DOC WEISS ASSOCIATES Project Number:

  11. raising_investment_funds_for_clean_energy_programs.doc | Department...

    Broader source: Energy.gov (indexed) [DOE]

    raisinginvestmentfundsforcleanenergyprograms.doc raisinginvestmentfundsforcleanenergyprograms.doc More Documents & Publications Raising Investment Funds for Clean...

  12. spurring_local_economic_development_clean_energy_programs.doc...

    Broader source: Energy.gov (indexed) [DOE]

    spurringlocaleconomicdevelopmentcleanenergyprograms.doc spurringlocaleconomicdevelopmentcleanenergyprograms.doc More Documents & Publications Spurring Local Economic...

  13. Category:NEPA Doc | Open Energy Information

    Open Energy Info (EERE)

    NEPA Doc Jump to: navigation, search GEOTHERMAL ENERGYGeothermal Home Category: NEPA Documents Collections Add.png Add a new NEPA Document Collection Pages in category "NEPA Doc"...

  14. exploringpowerpurchaseagreementsthebasicspart1.doc | Department of Energy

    Broader source: Energy.gov (indexed) [DOE]

    exploringpowerpurchaseagreementsthebasicspart1.doc Microsoft Office document icon exploringpowerpurchaseagreementsthebasicspart1.doc More Documents & Publications Exploring Power Purchase Agreements - The Basics Part 1

  15. Microsoft Word - AL2006-02.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    2.doc Microsoft Word - AL2006-02.doc PDF icon Microsoft Word - AL2006-02.doc More Documents & Publications Microsoft Word - AL2006-03.doc Archived Financial Assistance Letters Microsoft Word - FAL2006-04.doc

  16. Microsoft Word - AL2008-06.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AL2008-06.doc Microsoft Word - AL2008-06.doc PDF icon Microsoft Word - AL2008-06.doc More Documents & Publications Chapter 9 - Contracting Qualifications Microsoft Word - PART 970.doc Microsoft Word - Matrixpart2.doc

  17. Microsoft Word - 98-11.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    8-11.doc Microsoft Word - 98-11.doc PDF icon Microsoft Word - 98-11.doc More Documents & Publications Microsoft Word - AL2006-08.doc Microsoft Word - AL2005-01.doc Microsoft Word -...

  18. Serial and Westmere Queues on Carver

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    and Westmere Queues on Carver Serial and Westmere Queues on Carver September 20, 2011 by Francesca Verdier NERSC has replaced 80 8-core Intel Nehalem nodes on Carver with 80...

  19. Lipidic phase membrane protein serial femtosecond crystallography

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Source: Nature Methods Year: 2012 Volume: 9 Pages: 263-265 ABSTRACT: X-ray free electron laser (X-FEL)-based serial femtosecond crystallography is an emerging method...

  20. Microsoft Word - Rev5functionalaccountabilityimplementationplan..doc |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy Rev5functionalaccountabilityimplementationplan..doc Microsoft Word - Rev5functionalaccountabilityimplementationplan..doc PDF icon Microsoft Word - Rev5functionalaccountabilityimplementationplan..doc More Documents & Publications Microsoft Word - AL2007-01.doc module 4 Chapter 71 - Review and Approval of Contract and Financial Assistance Actions

  1. deepenergyretrofitsandstateapplications.doc | Department of Energy

    Energy Savers [EERE]

    deepenergyretrofitsandstateapplications.doc deepenergyretrofitsandstateapplications.doc deepenergyretrofitsandstateapplications.doc Microsoft Office document icon deepenergyretrofitsandstateapplications.doc More Documents & Publications Deep Energy Retrofits & State Applications Sustainable Energy Resources for Consumers Webinar on Residential Geothermal Heat Pump Retrofit Transcript Interior Lighting Efficiency for Municipalities

  2. Microsoft Word - SpecialTermsandConditions0506.doc | Department...

    Energy Savers [EERE]

    Microsoft Word - SpecialTermsandConditions0506.doc Microsoft Word - SpecialTermsandConditions0506.doc Microsoft Word - SpecialTermsandConditions0506.doc More Documents &...

  3. Microsoft Word - FY2005finaliparhandbook.doc | Department of...

    Energy Savers [EERE]

    Microsoft Word - FY2005finaliparhandbook.doc Microsoft Word - FY2005finaliparhandbook.doc Microsoft Word - FY2005finaliparhandbook.doc More Documents & Publications...

  4. Microsoft Word - ARRAAttachment2.doc | Department of Energy

    Office of Environmental Management (EM)

    ARRAAttachment2.doc Microsoft Word - ARRAAttachment2.doc More Documents & Publications Microsoft Word - ARRAAttachment12v1.doc Microsoft Word - ARRAAttachment3.rtf Microsoft Word -...

  5. Microsoft Word - ARRAMOModelMod.doc | Department of Energy

    Energy Savers [EERE]

    ARRAMOModelMod.doc Microsoft Word - ARRAMOModelMod.doc More Documents & Publications Microsoft Word - ARRAAttachment2.doc Microsoft Word - ARRAModelWAS...

  6. Microsoft Word - ARRAModelWAS.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ARRAModelWAS.doc Microsoft Word - ARRAModelWAS.doc More Documents & Publications Microsoft Word - ARRAAttachment2.doc Microsoft Word - ARRAMOModelMod...

  7. Microsoft Word - August06.doc | Department of Energy

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    August06.doc Microsoft Word - August06.doc PDF icon Microsoft Word - August06.doc More Documents & Publications Microsoft Word - April

  8. Microsoft Word - Flash2007-43.doc | Department of Energy

    Office of Environmental Management (EM)

    43.doc Microsoft Word - Flash2007-43.doc Microsoft Word - Flash2007-43.doc More Documents & Publications Microsoft Word - Policy Flash 2008-07.doc Microsoft Word - Policy Flash...

  9. Microsoft Word - AL2006-01.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    1.doc Microsoft Word - AL2006-01.doc PDF icon Microsoft Word - AL2006-01.doc More Documents & Publications Microsoft Word - al2005-06.doc Chapter 19 - Small Business Programs OPAM Policy Acquisition Guides

  10. Microsoft Word - AL2005-10.doc | Department of Energy

    Office of Environmental Management (EM)

    10.doc Microsoft Word - AL2005-10.doc PDF icon Microsoft Word - AL2005-10.doc More Documents & Publications Microsoft Word - AL2005-16.doc Audit Report: IG-0860 Microsoft Word - AL2006-08

  11. Microsoft Word - Matrixpart1.doc | Department of Energy

    Broader source: Energy.gov (indexed) [DOE]

    Matrixpart1.doc More Documents & Publications Part 1, Clauses Prescribed in FAR Part 52 Microsoft Word - Matrixpart2.doc...

  12. csep_transcript_arlington.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Office document icon cseptranscriptarlington.doc More Documents & Publications Tools for Designing & Implementing Better Finance Programs financeprograms.doc financeprograms

  13. Microsoft Word - AL2002-03.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    2-03.doc Microsoft Word - AL2002-03.doc PDF icon Microsoft Word - AL2002-03.doc More Documents & Publications Microsoft Word - AL2005-01.doc Microsoft Word - FAL2004-01.doc Microsoft Word - ARRAAttachment12v1.doc

  14. Microsoft Word - AL2005-14.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    4.doc Microsoft Word - AL2005-14.doc PDF icon Microsoft Word - AL2005-14.doc More Documents & Publications Microsoft Word - AL-Omnibus FY 2009 Apr 22 2009 all sections.doc Microsoft Word - AL-Consolidated Approps FY 2008 as of feb 21 2008 final.doc Microsoft Word - AL2006-08.doc

  15. Microsoft Word - AL2007-01.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AL2007-01.doc Microsoft Word - AL2007-01.doc PDF icon Microsoft Word - AL2007-01.doc More Documents & Publications Microsoft Word - Rev5functionalaccountabilityimplementationplan..doc Microsoft Word - Corp Impl 10-05-06.final.doc Microsoft Word - AL2006-11.doc

  16. csep_transcript_aspen.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    aspen.doc csep_transcript_aspen.doc csep_transcript_aspen.doc Microsoft Office document icon csep_transcript_aspen.doc More Documents & Publications highperformanceleasingstrategiesforstateandlocalgovernments.doc Using Social Media to Engage the Community in Energy Efficiency Projects.doc webinar_innovation_permitting_inspections

  17. csep_transcript_minneapolis.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    minneapolis.doc csep_transcript_minneapolis.doc csep_transcript_minneapolis.doc Microsoft Office document icon csep_transcript_minneapolis.doc More Documents & Publications newguideforcommunityenergystrategicplanning.doc csep_transcript_aspen.doc Marketing & Driving Demand: Social Media Tools & Strategies - January 16, 2011 (Text Version)

  18. Microsoft Word - FWP- Fact Sheet.doc | Department of Energy

    Office of Environmental Management (EM)

    FWP- Fact Sheet.doc Microsoft Word - FWP- Fact Sheet.doc PDF icon Microsoft Word - FWP- Fact Sheet.doc More Documents & Publications Microsoft Word - FOA cover sheet.doc Microsoft Word - Fact Sheet Energy Speech 082508 FINAL.doc Microsoft Word - ARRAAttachment12v1.doc

  19. Microsoft Word - ITSI award doc 06-D0008 conformed to P00001.doc |

    Office of Environmental Management (EM)

    Department of Energy ITSI award doc 06-D0008 conformed to P00001.doc Microsoft Word - ITSI award doc 06-D0008 conformed to P00001.doc More Documents & Publications Policy Flash 2015-02 Acquisition Letter No. AL 2015-01R - 06/01/2015 FOA 148 Amendment

  20. Serial Femtosecond Crystallography of G Protein-Coupled Receptors

    DOE Data Explorer [Office of Scientific and Technical Information (OSTI)]

    Liu, Liu

    2013-10-23

    Serial femtosecond crystallography data on microcrystals of 5-HT2B receptor bound to ergotamine grown in lipidic cubic phase.

  1. Ammendment 2.doc | Department of Energy

    Broader source: Energy.gov (indexed) [DOE]

    Ammendment 2.doc More Documents & Publications Attachment 6 Volume V Pricing Matrix for Optional Enhancements.xls&0; RFQ DE-RQ01-04ME90001.doc&0; Attachment 3-Past Performance...

  2. Microsoft Word - S06401_IC.doc

    Office of Legacy Management (LM)

    0 Doc. No. S06401 Page B-1 Annual Assessment of the Effectiveness of Site-Wide Institutional Controls U.S. Department of Energy Doc. No. S06401 June 2010 Page B-2 U.S. Department of Energy Annual Assessment of the Effectiveness of Site-Wide Institutional Controls June 2010 Doc. No. S06401 Page B-3 Annual Assessment of the Effectiveness of Site-Wide Institutional Controls U.S. Department of Energy Doc. No. S06401 June 2010

  3. Index2.doc | Department of Energy

    Energy Savers [EERE]

    Index2.doc Index2.doc PDF icon Index2.doc More Documents & Publications Sylvania Corporation, Hicksville, NY and Bayside, NY - Addendum to July 8, 2004 O:\HOMEPAGE\FOIA\report99.PDF&#0; U.S. Department of Energy 2004 Annual Report

  4. SubcontractingGuidelines.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    SubcontractingGuidelines.doc&#0; SubcontractingGuidelines.doc&#0; PDF icon SubcontractingGuidelines.doc&#0; More Documents & Publications Guidance of the Department of Energy Subcontracting Program Chapter 19 - Small Business Programs Business Opportunity Session Materials - December 14, 2011, Chicago

  5. SPDWRAP#1.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Please notify Aon Hewitt's Your Benefit Resources (YBR) in Appendix G to update your personal information, such as your home address and home telephone number. 2. Eligibility...

  6. U0083900.doc

    Office of Legacy Management (LM)

    GJO-2002-304-TAR MAC-GWTUB 11.11.2 Plan for Injection of Treated Ground Water at the Tuba City, Arizona, UMTRA Project Site March 2002 Prepared by U. S. Department of Energy Grand Junction Office Grand Junction, Colorado Project Number UGW-511-0023-17-000 Document Number U0083900 Work Performed Under DOE Contract No. DE-AC13-96GJ87335 Document Number U0083900 DOE/Grand Junction Office Plan for Injection of Treated Ground Water at the Tuba City UMTRA Site March 2002 Page 1 Introduction This plan

  7. N0057000.doc

    Office of Legacy Management (LM)

    000 GJO- 2002-380- TAC GJO-PIN 13.5.1-1 Pinellas Environmental Restoration Project Northeast Site Non-Aqueous Phase Liquids Interim Measures Progress Report July through September 2002 October 2002 Prepared by U.S. Department of Energy Grand Junction Office Grand Junction, Colorado Work Performed Under DOE Contract Number DE-AC13-02GJ79491 Task Order Number ST03-107 Document Number N0057000 Contents DOE/Grand Junction Office Northeast Site NAPL Interim Measures Progress Report October 2002 Page

  8. Serial and Westmere Queues on Carver

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    and Westmere Queues on Carver Serial and Westmere Queues on Carver September 20, 2011 by Francesca Verdier NERSC has replaced 80 8-core Intel Nehalem nodes on Carver with 80 12-core Intel Westmere nodes. The new processors run at the same frequency as those they replace, but have slightly larger caches. Also, the Westmere nodes are populated with 48GB of memory; the memory runs at 1333MHz. This new hardware serves two purposes. First, it provides access to more memory (48GB) than is available on

  9. Microsoft Word - 1938.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    personal information is revealed in a LANS record: Education, salary, medical history, employment history, social security number, date and place of birth, or mother's maiden name. Form 1938 (3/14) Page 1 of 3 Form 1938 Universal Beneficiary Designation/Change Form Instructions: The information on this form will replace any prior beneficiary designation. You may name anyone or any entity as your beneficiary and you may change your beneficiary at any time by completing a new Universal Beneficiary

  10. U0174100.doc

    Office of Legacy Management (LM)

    4100 DOE/EA-1452 Environmental Assessment of Ground Water Compliance at the Durango, Colorado, UMTRA Project Site Final November 2002 Prepared by U.S. Department of Energy Grand Junction Office Grand Junctio n, Colorado Work Performed Under DOE Contract Number DE-AC13-02GJ79491 DOE Grand Junction Office EA of Ground Water Compliance at the Durango Site November 2002 Final Page iii Contents Page Acronyms and Abbreviations

  11. AcqGuide38pt1.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    8pt1.doc&#0; AcqGuide38pt1.doc&#0; PDF icon AcqGuide38pt1.doc&#0; More Documents & Publications Microsoft Word - AcqGuide38pt Nov 2010 Microsoft Word - AL2005-05Revised.doc AL2007-03.doc&#0;

  12. AcqGuide41pt1.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    1pt1.doc&#0; AcqGuide41pt1.doc&#0; PDF icon AcqGuide41pt1.doc&#0; More Documents & Publications Chapter 41 - Acquisition of Utility Services AcqGuide70pt28.doc&#0; AcqGuide9pt1.doc&#0;

  13. Microsoft Word - AL2000-05.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    .doc Microsoft Word - AL2000-05.doc PDF icon Microsoft Word - AL2000-05.doc More Documents & Publications al99-06.doc&#0; Microsoft Word - AL2000-05Attachment.doc AL2004-01r2.pdf

  14. Microsoft Word - AL2004-02.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    4-02.doc Microsoft Word - AL2004-02.doc PDF icon Microsoft Word - AL2004-02.doc More Documents & Publications Microsoft Word - AL2005-02.doc Microsoft Word - al2005-04.doc Microsoft Word - AL-Omnibus FY 2009 Apr 22 2009 all sections

  15. Microsoft Word - AL2005-02.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    5-02.doc Microsoft Word - AL2005-02.doc PDF icon Microsoft Word - AL2005-02.doc More Documents & Publications Microsoft Word - AL-Omnibus FY 2009 Apr 22 2009 all sections.doc Microsoft Word - AL2004-02.doc Microsoft Word - AL-Consolidated Approps FY 2008 as of feb 21 2008 final

  16. Microsoft Word - AL2005-03.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    3.doc Microsoft Word - AL2005-03.doc PDF icon Microsoft Word - AL2005-03.doc More Documents & Publications Microsoft Word - AL2005-01.doc Microsoft Word - AL2006-08.doc Microsoft Word - Chapter 10_2006_Jun

  17. Microsoft Word - FAL2004-01.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    1.doc Microsoft Word - FAL2004-01.doc PDF icon Microsoft Word - FAL2004-01.doc More Documents & Publications Microsoft Word - FAL2004-03.doc Microsoft Word - FAL2004-02.doc Microsoft Word - FAL2003-03R

  18. csep_transcript_transportation.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    transportation.doc csep_transcript_transportation.doc csep_transcript_transportation.doc Microsoft Office document icon csep_transcript_transportation.doc More Documents & Publications csep_transcript_minneapolis.doc Marketing & Driving Demand: Social Media Tools & Strategies - January 16, 2011 (Text Version) Transcript: Biomass Clean Cities Webinar - Workforce Development

  19. Engaging Financial Institution Partners Transcript.doc | Department of

    Office of Environmental Management (EM)

    Energy Engaging Financial Institution Partners Transcript.doc Engaging Financial Institution Partners Transcript.doc Engaging Financial Institution Partners Transcript.doc Microsoft Office document icon Engaging Financial Institution Partners Transcript.doc More Documents & Publications Engaging Financial Institution Partners Transcript.doc Engaging Financial Institution Partners Case Studies-Financing Energy Improvements on Utility Bills

  20. Microsoft Word - PeerReview_SAR.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    SAR.doc Microsoft Word - PeerReview_SAR.doc PDF icon Microsoft Word - PeerReview_SAR.doc More Documents & Publications Microsoft Word - PeerReview_CCSP.doc Microsoft Word - Cross Reference Matrix Introduction.doc Assessment of the Effects of Climate Change on Federal Hydropower

  1. AL2007-05.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    7-05.doc&#0; AL2007-05.doc&#0; PDF icon AL2007-05.doc&#0; More Documents & Publications Microsoft Word - AL2006-08.doc Department of Energy Microsoft Word - AL2006-10.doc

  2. Microsoft Word - AL2005-01.doc | Department of Energy

    Office of Environmental Management (EM)

    1.doc Microsoft Word - AL2005-01.doc PDF icon Microsoft Word - AL2005-01.doc More Documents & Publications Microsoft Word - AL2006-08.doc Acquisition Letter Archive listing AL2007-05.doc&#0;

  3. Microsoft Word - AL2006-08.doc | Department of Energy

    Office of Environmental Management (EM)

    6-08.doc Microsoft Word - AL2006-08.doc PDF icon Microsoft Word - AL2006-08.doc More Documents & Publications AL2007-05.doc&#0; Microsoft Word - AL2005-14.doc Microsoft Word - AL2006-03

  4. Microsoft Word - FAL2004-03.doc | Department of Energy

    Office of Environmental Management (EM)

    FAL2004-03.doc Microsoft Word - FAL2004-03.doc PDF icon Microsoft Word - FAL2004-03.doc More Documents & Publications Microsoft Word - FAL2004-01.doc Financial Assistance Letters No. FAL 2006-04 Microsoft Word - FAL2006-04.doc

  5. Microsoft Word - toc.doc

    Office of Legacy Management (LM)

    I Ground Water Management Policy for the MMTS and Adjacent Areas U n c o n t r o l l e d c o p y U.S. Department of Energy Long-Term Surveillance and Maintenance Plan for the Monticello NPL Sites Rev. 0 Doc. No. S0038700 Rev. Date: June 25, 2007 Page I-3 U n c o n t r o l l e d c o p y Long-Term Surveillance and Maintenance Plan for the Monticello NPL Sites U.S. Department of Energy Doc. No. S0038700 Rev. 0 Page I-4 Rev. Date: June 25, 2007 U n c o n t r o l l e d c o p y U.S. Department of

  6. Microsoft Word - toc.doc

    Office of Legacy Management (LM)

    J Ground Water Remedy Performance Evaluation Plan U n c o n t r o l l e d c o p y U.S. Department of Energy Long-Term Surveillance and Maintenance Plan for Monticello NPL Sites Rev. 0 Doc. No. S0038700 Rev. Date: June 25, 2007 Page iii Contents Page J1.0 Plan Objective..................................................................................................................J-1 J2.0 Monitored Natural Attenuation Performance Evaluation Method...................................J-1 J2.1

  7. NVN-086287 | Open Energy Information

    Open Energy Info (EERE)

    Type NOI Decision Document Date 20081203 Relevant Numbers Lead Agency Doc Number Serial Number NVN-086287 Lease Numbers NVN-074855 Proposed Action Installation and sampling...

  8. NVN-087930 | Open Energy Information

    Open Energy Info (EERE)

    Decision Document Date 20090916 Relevant Numbers Lead Agency Doc Number NVN-087930 Serial Number NVN-087930 Lease Numbers NVN-018423 NVN-076291 NVN-083928 NVN-085708 NVN-085709...

  9. NVN-087809 | Open Energy Information

    Open Energy Info (EERE)

    Decision Document Date 20090612 Relevant Numbers Lead Agency Doc Number NV-087809 Serial Number NV-087809 Lease Numbers NVN-085710 NVN-085711 Proposed Action A Gravity...

  10. NVN-086761 | Open Energy Information

    Open Energy Info (EERE)

    Type NOI Decision Document Date 20090224 Relevant Numbers Lead Agency Doc Number Serial Number NVN-086761 Lease Numbers NVN-079305 NVN-079306 NVN-079307 Proposed Action...

  11. NVN-086286 | Open Energy Information

    Open Energy Info (EERE)

    NOI, POO Decision Document Date 20081201 Relevant Numbers Lead Agency Doc Number Serial Number NVN-086286 Lease Numbers NVN-085722 NVN-085723 NVN-085724 Proposed Action The...

  12. NVN-087791 | Open Energy Information

    Open Energy Info (EERE)

    Type NOI Decision Document Date 20090721 Relevant Numbers Lead Agency Doc Number Serial Number NVN-087791 Lease Numbers NVN-074854 NVN-076298 NVN-076299 NVN-076300 NVN-076301...

  13. NVN-086285 | Open Energy Information

    Open Energy Info (EERE)

    Type NOI Decision Document Date 20081201 Relevant Numbers Lead Agency Doc Number Serial Number NVN-086285 Lease Numbers NVN-083928 NVN-085708 NVN-085709 Proposed Action The...

  14. NVN-088259 | Open Energy Information

    Open Energy Info (EERE)

    Type NOI Decision Document Date 20100317 Relevant Numbers Lead Agency Doc Number Serial Number NVN-088259 Lease Numbers NVN-074308 NVN-074309 Proposed Action Closely spaced...

  15. NVN-087812 | Open Energy Information

    Open Energy Info (EERE)

    Type NOI Decision Document Date 20090721 Relevant Numbers Lead Agency Doc Number Serial Number NVN-087812 Lease Numbers NVN-074854 NVN-076298 NVN-076299 NVN-076300 NVN-076301...

  16. NVN-89274 | Open Energy Information

    Open Energy Info (EERE)

    Type NOI Decision Document Date 20101202 Relevant Numbers Lead Agency Doc Number Serial Number NVN-89274 Lease Numbers NVN-085716 NVN-086893 NVN-088920 Proposed Action...

  17. NVN-087811 | Open Energy Information

    Open Energy Info (EERE)

    Type NOI Decision Document Date 20090721 Relevant Numbers Lead Agency Doc Number Serial Number NVN-087811 Lease Numbers NVN-074854 NVN-076298 NVN-076299 NVN-076300 NVN-076301...

  18. NVN-89534 | Open Energy Information

    Open Energy Info (EERE)

    Date 20110302 Application Document Type NOI Relevant Numbers Lead Agency Doc Number Serial Number NVN-089534 Lease Numbers NVN-083928 NVN-077668 Proposed Action Two thermal...

  19. NVN-89292 | Open Energy Information

    Open Energy Info (EERE)

    Type NOI Decision Document Date 20101202 Relevant Numbers Lead Agency Doc Number Serial Number NVN-089292 Lease Numbers NVN-088435 NVN-088436 NVN-088437 Proposed Action...

  20. 3010DLFinal.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    0 Core Status: new users must complete 2 trouble-free training sessions and pass a sample exchange exam to work independently during Core sessions. Flex Status: core users must complete 4 "trouble-free" sessions and pass a driving test to work independently during Flex sessions To reserve a 3010 session, go to www/ncem.lbl.gov, click on "Microscope Scheduling", use proposal number and password to log in. You may only sign up for 2 Core sessions and 1 Flex session at a time.

  1. Nov08.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    8 ANL/EVS/NL-08-11 Technical Contact: Brad W. Orr Phone: 630-252-8665 Email: brad.orr@anl.gov Editor: Donna J. Holdridge Contributor: Lynne Roeder Website: http://www.arm.gov ACRF Southern Great Plains Newsletter is published by Argonne National Laboratory, managed by UChicago Argonne, LLC, for the U.S. Department of Energy under contract number DE-AC02-06CH11357. Site Operations Centralized Through New Tracking System With more than 300 instrument systems operating at remote sites around the

  2. Dec08.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    8 ANL/EVS/NL-08-12 Technical Contact: Brad W. Orr Phone: 630-252-8665 Email: brad.orr@anl.gov Editor: Donna J. Holdridge Contributor: Lynne Roeder Website: http://www.arm.gov ACRF Southern Great Plains Newsletter is published by Argonne National Laboratory, managed by UChicago Argonne, LLC, for the U.S. Department of Energy under contract number DE-AC02-06CH11357. AMF2 Team Surveys Storm Peak Area The U.S. Department of Energy recently announced the initial deployment of the second ARM Mobile

  3. Feb09.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    9 ANL/EVS/NL-09-02 Technical Contact: Brad W. Orr Phone: 630-252-8665 Email: brad.orr@anl.gov Editor: Donna J. Holdridge Contributor: Lynne Roeder Website: http://www.arm.gov ACRF Southern Great Plains Newsletter is published by Argonne National Laboratory, managed by UChicago Argonne, LLC, for the U.S. Department of Energy under contract number DE-AC02-06CH11357. Radiometers Used to Close Gap in Climate Models In late January, scientists initiated a five-month field campaign involving routine

  4. Jan09.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    9 ANL/EVS/NL-09-01 Technical Contact: Brad W. Orr Phone: 630-252-8665 Email: brad.orr@anl.gov Editor: Donna J. Holdridge Contributor: Lynne Roeder Website: http://www.arm.gov ACRF Southern Great Plains Newsletter is published by Argonne National Laboratory, managed by UChicago Argonne, LLC, for the U.S. Department of Energy under contract number DE-AC02-06CH11357. Routine AVP Clouds with Low Optical Water Depths (CLOWD) Optical Radiative Observations (RACORO) Field Campaign Scheduled at SGP

  5. June08.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    8 ANL/EVS/NL-08-06 Technical Contact: Brad W. Orr Phone: 630-252-8665 Email: brad.orr@anl.gov Editor: Donna J. Holdridge Contributor: Lynne Roeder Website: http://www.arm.gov ACRF Southern Great Plains Newsletter is published by Argonne National Laboratory, managed by UChicago Argonne, LLC, for the U.S. Department of Energy under contract number DE-AC02-06CH11357. Interagency Effort Will Measure Carbon Dioxide Profiles Beginning in June, the ARM Climate Research Facility (ACRF) is supporting an

  6. May08.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    May 2008 ANL/EVS/NL-08-05 Technical Contact: Brad W. Orr Phone: 630-252-8665 Email: brad.orr@anl.gov Editor: Donna J. Holdridge Contributor: Lynne Roeder Website: http://www.arm.gov ACRF Southern Great Plains Newsletter is published by Argonne National Laboratory, managed by UChicago Argonne, LLC, for the U.S. Department of Energy under contract number DE-AC02-06CH11357. Cloud Radars at the Southern Great Plains Site The flip of a switch in February solved a dilemma in detection of cirrus clouds

  7. Edwin Parks (Doc) | Department of Energy

    Energy Savers [EERE]

    Edwin Parks (Doc) About Us Edwin Parks (Doc) Team Leader, Archives and Information Management Team Dr. Ed "Doc" Parks joined the Office of Legacy Management in September 2010, as a Program Analyst in the Records Management program. He provided ongoing analytical support for records and information programs, policies, procedures, plans, cost, and operational analyses. He now serves as LM's Program Records Official, the Authorizing Official and federal official accountable for the risk

  8. Property:NEPA TieredDoc | Open Energy Information

    Open Energy Info (EERE)

    TieredDoc Jump to: navigation, search Property Name NEPA TieredDoc Property Type Page This is a property of type Page. Pages using the property "NEPA TieredDoc" Showing 25 pages...

  9. Microsoft Word - AL2005-08.doc | Department of Energy

    Office of Environmental Management (EM)

    8.doc Microsoft Word - AL2005-08.doc Microsoft Word - AL2005-08.doc More Documents & Publications OPAM Policy Acquisition Guides Attachment FY2011-28 OPAM Microsoft Word -...

  10. Microsoft Word - FAC2005-19.doc | Department of Energy

    Office of Environmental Management (EM)

    FAC2005-19.doc Microsoft Word - FAC2005-19.doc Microsoft Word - FAC2005-19.doc More Documents & Publications Acquisitlon Letter No. AL 2008-06 AL2008-06.pdf fac2001-27.pdf...

  11. Microsoft Word - FAL2004-05.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Microsoft Word - FAL2004-05.doc Microsoft Word - FAL2004-05.doc Microsoft Word - FAL2004-05.doc More Documents & Publications Archived Financial Assistance Letters Microsoft Word -...

  12. Microsoft Word - FORM46002.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    2.doc Microsoft Word - FORM46002.doc Microsoft Word - FORM46002.doc More Documents & Publications DOE F 4600.2 ATTACHMENT FLASH 2011-46(6) Attachment FY2011-63 OPAM...

  13. Microsoft Word - AL2008-05.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Microsoft Word - AL2008-05.doc Microsoft Word - AL2008-05.doc Microsoft Word - AL2008-05.doc More Documents & Publications Microsoft Word - AL 2010-07 Acquistion Letters Remaining...

  14. Microsoft Word - AL2006-07.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    7.doc Microsoft Word - AL2006-07.doc PDF icon Microsoft Word - AL2006-07.doc More Documents & Publications OPAM Policy Acquisition Guides Personal Property Management Certification Brochure Microsoft Word - AL2005-07

  15. Microsoft Word - AL2008-05.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    8-05.doc Microsoft Word - AL2008-05.doc PDF icon Microsoft Word - AL2008-05.doc More Documents & Publications Department of Energy OPAM Policy Acquisition Guides Microsoft PowerPoint - Executive Order13423rbl

  16. Microsoft Word - May2009.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    May2009.doc Microsoft Word - May2009.doc PDF icon Microsoft Word - May2009.doc More Documents & Publications Special Resource Study/Environmental Assessment for Manhattan Project Sites, DOE/EA-1868 (September 2010) Microsoft Word - April06

  17. DOC-DOE Joint China Mission Statement | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Joint China Mission Statement DOC-DOE Joint China Mission Statement DOC-DOE Joint China Mission Statement PDF icon DOC-DOE Joint China Mission Statement More Documents &...

  18. Microsoft Word - al2006-12.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    al2006-12.doc Microsoft Word - al2006-12.doc PDF icon Microsoft Word - al2006-12.doc More Documents & Publications Department of Energy Special Report: DOE/IG-0934

  19. Microsoft Word - al95-06.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    06.doc Microsoft Word - al95-06.doc PDF icon Microsoft Word - al95-06.doc More Documents & Publications ppl970-1.pdf Audit Report: IG-0589 Inspection Report: INS-O-02-01

  20. Microsoft Word - CMPTemplate031307.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    CMPTemplate031307.doc Microsoft Word - CMPTemplate031307.doc PDF icon Microsoft Word - CMPTemplate031307.doc More Documents & Publications Chapter 42 - Contract Administration Chapter 71 - Review and Approval of Contract and Financial Assistance Actions Chapter 43 - Contract Modifications

  1. Operating Guidelines Appendix C D.DOC | Department of Energy

    Energy Savers [EERE]

    Operating Guidelines Appendix C D.DOC&0; Operating Guidelines Appendix C D.DOC&0; PDF icon Operating Guidelines Appendix C D.DOC&0; More Documents & Publications Operating...

  2. Microsoft Word - April06.doc | Department of Energy

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    April06.doc Microsoft Word - April06.doc PDF icon Microsoft Word - April06.doc More Documents & Publications Secretary Directs FPO to Prepare Strategic Plan Microsoft Word - August

  3. Microsoft Word - AL2006-11.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AL2006-11.doc Microsoft Word - AL2006-11.doc PDF icon Microsoft Word - AL2006-11.doc More Documents & Publications Subject: Cost and Price Analysis Subject: Cost and Price Analysis...

  4. Microsoft Word - GJPPGPracticesDraft.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    GJPPGPracticesDraft.doc Microsoft Word - GJPPGPracticesDraft.doc PDF icon Microsoft Word - GJPPGPracticesDraft.doc More Documents & Publications 1 DOE Purchase Card Policy Natural Oils - The Next Generation of Diesel Engine Lubricants?

  5. al99-06.doc | Department of Energy

    Broader source: Energy.gov (indexed) [DOE]

    .doc&#0; More Documents & Publications Microsoft Word - AL2000-05.doc AL2007-05.doc&#0; AL2004-01r2.pdf

  6. Microsoft Word - competitionincontractingguidev2.doc | Department of Energy

    Office of Environmental Management (EM)

    competitionincontractingguidev2.doc Microsoft Word - competitionincontractingguidev2.doc PDF icon Microsoft Word - competitionincontractingguidev2.doc More Documents & Publications AcqGuide 5.2-OPAM Microsoft Word - AG Chapter 6 1 Nov 2010 Competition Requirements

  7. Microsoft Word - ACQUISITION LETTER.doc | Department of Energy

    Office of Environmental Management (EM)

    ACQUISITION LETTER.doc Microsoft Word - ACQUISITION LETTER.doc PDF icon Microsoft Word - ACQUISITION LETTER.doc More Documents & Publications ACQUISITION LETTER DEAR Part 933 OPAM Policy Acquisition Guides Chapter 33 - Protests, Disputes and Appeals

  8. Microsoft Word - ARRAAttachment12v1.doc | Department of Energy

    Office of Environmental Management (EM)

    ARRAAttachment12v1.doc Microsoft Word - ARRAAttachment12v1.doc More Documents & Publications Microsoft Word - DRAFT CRB Interview Guidance.doc Microsoft Word - ARRAGuideAttachment10v1

  9. Microsoft Word - FORM46001.doc | Department of Energy

    Office of Environmental Management (EM)

    FORM46001.doc Microsoft Word - FORM46001.doc PDF icon Microsoft Word - FORM46001.doc More Documents & Publications DOE F 4600.1 Archived Financial Assistance Letters American Recovery and Reinvestment Act, Financial Assistance Award: 212 Degrees Consulting, LLC

  10. Data Exploration Toolkit for serial diffraction experiments

    DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

    Zeldin, Oliver B.; Brewster, Aaron S.; Hattne, Johan; Uervirojnangkoorn, Monarin; Lyubimov, Artem Y.; Zhou, Qiangjun; Zhao, Minglei; Weis, William I.; Sauter, Nicholas K.; Brunger, Axel T.

    2015-01-23

    Ultrafast diffraction at X-ray free-electron lasers (XFELs) has the potential to yield new insights into important biological systems that produce radiation-sensitive crystals. An unavoidable feature of the 'diffraction before destruction' nature of these experiments is that images are obtained from many distinct crystals and/or different regions of the same crystal. Combined with other sources of XFEL shot-to-shot variation, this introduces significant heterogeneity into the diffraction data, complicating processing and interpretation. To enable researchers to get the most from their collected data, a toolkit is presented that provides insights into the quality of, and the variation present in, serial crystallography datamore » sets. These tools operate on the unmerged, partial intensity integration results from many individual crystals, and can be used on two levels: firstly to guide the experimental strategy during data collection, and secondly to help users make informed choices during data processing.« less

  11. Operating Guidelines Appendix A B.DOC | Department of Energy

    Energy Savers [EERE]

    Operating Guidelines Appendix A B.DOC&#0; Operating Guidelines Appendix A B.DOC&#0; PDF icon Operating Guidelines Appendix A B.DOC&#0; More Documents & Publications Operating Guidelines Appendix C D.DOC&#0; 2 Jun 03 Roles and Responsibilities _CSO Highlighted_.doc&#0; DOE HR Guidebook 12_15_05.DOC&#0;

  12. Microsoft Word - PeerReview_SAR.doc | Department of Energy

    Energy Savers [EERE]

    & Publications Microsoft Word - PeerReviewCCSP.doc Microsoft Word - Cross Reference Matrix Introduction.doc Assessment of the Effects of Climate Change on Federal Hydropower...

  13. Microsoft Word - FOA cover sheet.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Microsoft Word - FOA cover sheet.doc Recovery Act, Office of the Biomass Program,Funding Opportunity Announcements Special Notice Microsoft Word - FOA cover sheet.doc...

  14. Experimental Evaluation of DOC Performance Using Secondary Fuel...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Evaluation of DOC Performance Using Secondary Fuel Injection Experimental Evaluation of DOC Performance Using Secondary Fuel Injection Poster presentation at the 2007 Diesel ...

  15. DOE EIR FM.doc | Department of Energy

    Office of Environmental Management (EM)

    EIR FM.doc PDF icon DOE EIR FM.doc More Documents & Publications Contractor Statement of Work (SOW) Template (for EIR) External Independent Review (EIR) Standard Operating...

  16. Design Potential of Metal Foil Substrates for Optimized DOC Performanc...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Potential of Metal Foil Substrates for Optimized DOC Performance Design Potential of Metal Foil Substrates for Optimized DOC Performance Poster presentation at the 2007 Diesel...

  17. RetTrendReport1205.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    PDF icon RetTrendReport1205.doc&0; More Documents & Publications Pension Plans for Contractor Workers April 1-10 comments.doc&0; POLICY GUIDANCE MEMORANDUM...

  18. Project Summary-TES-SNL.doc. (Conference) | SciTech Connect

    Office of Scientific and Technical Information (OSTI)

    Project Summary-TES-SNL.doc. Citation Details In-Document Search Title: Project Summary-TES-SNL.doc. Abstract not provided. Authors: Siegel, Nathan Phillip Publication Date: 2009-02-01 OSTI Identifier: 1142774 Report Number(s): SAND2009-0912C 508394 DOE Contract Number: DE-AC04-94AL85000 Resource Type: Conference Resource Relation: Conference: Doe peer review held March 9-10, 2009 in denver, CO.; Related Information: Proposed for presentation at the doe peer review held March

  19. Microsoft Word - toc.doc

    Office of Legacy Management (LM)

    Appendix A Monticello LTS&M Project Organization and Key Personnel U n c o n t r o l l e d c o p y U.S. Department of Energy Long-Term Surveillance and Maintenance Plan for the Monticello NPL Sites Rev. 0 Doc. No. S0038700 Rev. Date: June 25, 2007 Page A-3 Utah Department of Transportation City of Monticello Monticello LM Representativ e Contractor General Manager Monticello LM Task Order Manager DOE Office of Legacy Managem ent Director U.S. EPA Region VIII Utah Departm ent of Environm

  20. Microsoft Word - toc.doc

    Office of Legacy Management (LM)

    B Document Control and Records Management Procedures U n c o n t r o l l e d c o p y U.S. Department of Energy Long-Term Surveillance and Maintenance Plan for the Monticello NPL Sites Rev. 0 Doc. No. S0038700 Rev. Date: June 25, 2007 Page B-3 B1.0 Document Control and Records Management Procedures Administrative procedures have been developed to define responsibilities, establish documentation and change control requirements, and employ standard work processes in implementing the monitoring,

  1. Microsoft Word - toc.doc

    Office of Legacy Management (LM)

    F Radiological Survey Procedures U n c o n t r o l l e d c o p y U.S. Department of Energy Long-Term Surveillance and Maintenance Plan for the Monticello NPL Sites Rev. 0 Doc. No. S0038700 Rev. Date: June 25, 2007 Page F-3 F.1 Radiological Survey Procedures This section describes the actions and method used by the Monticello Legacy Management (LM) Representative when conducting radiological surveys for the purpose of identifying radiologically contaminated material and determining the Radium-226

  2. Microsoft Word - toc.doc

    Office of Legacy Management (LM)

    G Uranium Scanning Procedure U n c o n t r o l l e d c o p y U.S. Department of Energy Long-Term Surveillance and Maintenance Plan for the Monticello NPL Sites Rev. 0 Doc. No. S0038700 Rev. Date: June 25, 2007 Page G-3 Uranium Scanning Procedure for Property MP-00211 1. Select a Ludlum Model 12 ratemeter with a 44-9 pancake Geiger-Mueller beta-gamma detector or equivalent instrument capable of meeting detection limit criteria. 2. Check that the ratemeter and the detector have calibration

  3. Microsoft Word - toc.doc

    Office of Legacy Management (LM)

    Appendix H Procedures for the Transportation of Radioactive Materials U n c o n t r o l l e d c o p y U.S. Department of Energy Long-Term Surveillance and Maintenance Plan for the Monticello NPL Sites Rev. 0 Doc. No. S0038700 Rev. Date: June 25, 2007 Page H-3 H1.0 Purpose The purpose of this procedure is to ensure that radioactive material is transported (1) using best management practices, (2) in compliance with U.S. Department of Transportation (DOT) requirements, and (3) with minimal risk to

  4. Microsoft Word - Appendix N_Historical.doc

    Office of Legacy Management (LM)

    N Example Historical Marker and Plaque U.S. Department of Energy Weldon Spring Site LTS&M Plan July 2005 Doc. No. S0079000 Page N-3 Weldon Spring Site LTS&M Plan U.S. Department of Energy Doc. No. S0079000 July 2005 Page N-4

  5. NVN-91276 | Open Energy Information

    Open Energy Info (EERE)

    Mineral Manager none provided Selected Dates Relevant Numbers Lead Agency Doc Number Serial Number NVN-091276 Data Completion Notes No documents from which to populate page. 9...

  6. NVN-091277 | Open Energy Information

    Open Energy Info (EERE)

    Relevant Numbers Lead Agency Doc Number Serial Number NVN-091277 Proposed Action Conduct water sampling, archaeological surveys, and shallow temperature surveys. Data Completion...

  7. NVN-088208 | Open Energy Information

    Open Energy Info (EERE)

    6 months earlier; BLM NOI was just a formality Relevant Numbers Lead Agency Doc Number Serial Number NVN-088208 Lease Numbers NVN-074249 NVN-074250 NVN-074253 NVN-074254 Tiered Doc...

  8. NVN-091276 | Open Energy Information

    Open Energy Info (EERE)

    Type NOI Decision Document Date 20121025 Relevant Numbers Lead Agency Doc Number Serial Number NVN-091276 Lease Numbers NVN-083928 NVN-085708 Tiered Doc DOI-NV-W010-2012-0061...

  9. Switch for serial or parallel communication networks

    DOE Patents [OSTI]

    Crosette, Dario B. (DeSoto, TX)

    1994-01-01

    A communication switch apparatus and a method for use in a geographically extensive serial, parallel or hybrid communication network linking a multi-processor or parallel processing system has a very low software processing overhead in order to accommodate random burst of high density data. Associated with each processor is a communication switch. A data source and a data destination, a sensor suite or robot for example, may also be associated with a switch. The configuration of the switches in the network are coordinated through a master processor node and depends on the operational phase of the multi-processor network: data acquisition, data processing, and data exchange. The master processor node passes information on the state to be assumed by each switch to the processor node associated with the switch. The processor node then operates a series of multi-state switches internal to each communication switch. The communication switch does not parse and interpret communication protocol and message routing information. During a data acquisition phase, the communication switch couples sensors producing data to the processor node associated with the switch, to a downlink destination on the communications network, or to both. It also may couple an uplink data source to its processor node. During the data exchange phase, the switch couples its processor node or an uplink data source to a downlink destination (which may include a processor node or a robot), or couples an uplink source to its processor node and its processor node to a downlink destination.

  10. Switch for serial or parallel communication networks

    DOE Patents [OSTI]

    Crosette, D.B.

    1994-07-19

    A communication switch apparatus and a method for use in a geographically extensive serial, parallel or hybrid communication network linking a multi-processor or parallel processing system has a very low software processing overhead in order to accommodate random burst of high density data. Associated with each processor is a communication switch. A data source and a data destination, a sensor suite or robot for example, may also be associated with a switch. The configuration of the switches in the network are coordinated through a master processor node and depends on the operational phase of the multi-processor network: data acquisition, data processing, and data exchange. The master processor node passes information on the state to be assumed by each switch to the processor node associated with the switch. The processor node then operates a series of multi-state switches internal to each communication switch. The communication switch does not parse and interpret communication protocol and message routing information. During a data acquisition phase, the communication switch couples sensors producing data to the processor node associated with the switch, to a downlink destination on the communications network, or to both. It also may couple an uplink data source to its processor node. During the data exchange phase, the switch couples its processor node or an uplink data source to a downlink destination (which may include a processor node or a robot), or couples an uplink source to its processor node and its processor node to a downlink destination. 9 figs.

  11. Microsoft Word - AL2000-01.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AL2000-01.doc Microsoft Word - AL2000-01.doc PDF icon Microsoft Word - AL2000-01.doc More Documents & Publications AL/FAL 99-01 Department of Energy No Microsoft Word - al2005-04.doc

  12. Microsoft Word - AL2005-11.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    11.doc Microsoft Word - AL2005-11.doc PDF icon Microsoft Word - AL2005-11.doc More Documents & Publications Audit Report: OAS-L-13-08 Microsoft Word - AL2005-12.doc CHAPTER 7 FINANCIAL MANAGEMENT

  13. AcqGuide42pt3.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    2pt3.doc&#0; AcqGuide42pt3.doc&#0; PDF icon AcqGuide42pt3.doc&#0; More Documents & Publications Chapter 42 - Contract Administration AcqGuide9pt2.doc&#0; Chapter 9 - Contracting Qualifications

  14. AcqGuide47pt1.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    7pt1.doc&#0; AcqGuide47pt1.doc&#0; PDF icon AcqGuide47pt1.doc&#0; More Documents & Publications Chapter 47 - Transportation TEC Working Group Topic Groups Manual Review Key Documents AcqGuide3pt1.doc&#0;

  15. AcqGuide9pt1.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    pt1.doc&#0; AcqGuide9pt1.doc&#0; PDF icon AcqGuide9pt1.doc&#0; More Documents & Publications Chapter 9 - Contracting Qualifications AcqGuide3pt1.doc&#0; OPAM Policy Acquisition Guides

  16. AcqGuide9pt2.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    pt2.doc&#0; AcqGuide9pt2.doc&#0; PDF icon AcqGuide9pt2.doc&#0; More Documents & Publications Chapter 9 - Contracting Qualifications Audit Report: IG-0432 AcqGuide42pt3.doc&#0;

  17. Microsoft Word - al2005-04.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    al2005-04.doc Microsoft Word - al2005-04.doc PDF icon Microsoft Word - al2005-04.doc More Documents & Publications AL2005-04ClassDeviation.pdf Microsoft Word - Matrixpart2.doc 2014-02 Acquistion Letter 2014-01: Management and Operating Contractors' Audit Coverage of Cost-Reimbursement Subcontracts

  18. Microsoft Word - al2005-06.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    al2005-06.doc Microsoft Word - al2005-06.doc PDF icon Microsoft Word - al2005-06.doc More Documents & Publications Microsoft Word - AL2006-01.doc OPAM Policy Acquisition Guides Acquisition Letter: AL2005-08

  19. Microsoft Word - 99-04.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    9-04.doc Microsoft Word - 99-04.doc PDF icon Microsoft Word - 99-04.doc More Documents & Publications Policy Flash 2014-18 Complex-Wide Strategic Sourcing Microsoft Word - AL2000-01.doc Microsoft Word - AL2005-1

  20. Microsoft Word - AL2005-16.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    6.doc Microsoft Word - AL2005-16.doc PDF icon Microsoft Word - AL2005-16.doc More Documents & Publications Microsoft Word - AL2005-10.doc Policy Flash 2013-33 Department of Energy Order 206.2 Identity, Credential and Access Managment (ICAM) Audit Report: IG-0860

  1. Microsoft Word - AL2006-03.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    3.doc Microsoft Word - AL2006-03.doc PDF icon Microsoft Word - AL2006-03.doc More Documents & Publications Microsoft Word - AL2006-02.doc Archived Financial Assistance Letters Financial Assistance Letters No. FAL 2006-04

  2. Microsoft Word - AL2006-09.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    9.doc Microsoft Word - AL2006-09.doc PDF icon Microsoft Word - AL2006-09.doc More Documents & Publications Microsoft PowerPoint - Executive Order13423rbl Sample Contract Language for Construction Using Energy-Efficient Products AL2007-05.doc&#0;

  3. AcqGuide39pt1.doc | Department of Energy

    Energy Savers [EERE]

    9pt1.doc&#0; AcqGuide39pt1.doc&#0; PDF icon AcqGuide39pt1.doc&#0; More Documents & Publications Chapter 39 - Acquisition of Information Technology AcqGuide38pt1.doc&#0; Microsoft Word - AcqGuide16pt1 Nov 2010

  4. Microsoft Word - AL2005-12.doc | Department of Energy

    Energy Savers [EERE]

    2.doc Microsoft Word - AL2005-12.doc PDF icon Microsoft Word - AL2005-12.doc More Documents & Publications Acquisition Letter No. AL 2012-05 Microsoft Word - AL2005-11.doc OPAM Policy Acquisition Guides

  5. Microsoft Word - FAL2006-03.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    FAL2006-03.doc Microsoft Word - FAL2006-03.doc PDF icon Microsoft Word - FAL2006-03.doc More Documents & Publications Financial Assistance Letter No. FAL 2006-03 Microsoft Word - FAL2006-03.doc For-Profit Audit Guidance (FY 2010)

  6. Microsoft Word - PART 970.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    PART 970.doc Microsoft Word - PART 970.doc PDF icon Microsoft Word - PART 970.doc More Documents & Publications Searchable Electronic Department of Energy Acquisition Regulation Microsoft Word - Matrixpart2.doc AcqGuide70.52Matrixpart2Redo-OPAM

  7. Microsoft Word - PeerReview_CCSP.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    CCSP.doc Microsoft Word - PeerReview_CCSP.doc PDF icon Microsoft Word - PeerReview_CCSP.doc More Documents & Publications Microsoft Word - PeerReview_SAR.doc EIS-0402: Advance Notice of Intent to Prepare an Environmental Impact Statement URTAC Meeting - January 2008

  8. Microsoft Word - al2007-11.doc | Department of Energy

    Office of Environmental Management (EM)

    al2007-11.doc Microsoft Word - al2007-11.doc PDF icon Microsoft Word - al2007-11.doc More Documents & Publications Acquisition Letter: AL2005-08 Microsoft Word - al2004-03.doc OPAM Policy Acquisition Guides

  9. Microsoft Word - AL2003-04.doc | Department of Energy

    Office of Environmental Management (EM)

    3-04.doc Microsoft Word - AL2003-04.doc PDF icon Microsoft Word - AL2003-04.doc More Documents & Publications Microsoft Word - AL2006-08.doc AL2004-01r2.pdf City of Tulare Renewable Biogas Fuel Cell Project

  10. Microsoft Word - AL2005-07.doc | Department of Energy

    Office of Environmental Management (EM)

    07.doc Microsoft Word - AL2005-07.doc PDF icon Microsoft Word - AL2005-07.doc More Documents & Publications Microsoft Word - AL2006-07.doc OPAM Policy Acquisition Guides Microsoft Word - 1_2011_CEG_Update_v2

  11. Microsoft Word - CERFDOE Final Report - 071204.doc | Department of Energy

    Office of Environmental Management (EM)

    CERFDOE Final Report - 071204.doc Microsoft Word - CERFDOE Final Report - 071204.doc PDF icon Microsoft Word - CERFDOE Final Report - 071204.doc More Documents & Publications Integrated Project Team RM DOE EIR FM.doc Independent Oversight Activity Report, Hanford Sludge Treatment Project - September 2013

  12. Microsoft Word - DOETTQuestions.doc | Department of Energy

    Office of Environmental Management (EM)

    DOETTQuestions.doc Microsoft Word - DOETTQuestions.doc PDF icon Microsoft Word - DOETTQuestions.doc More Documents & Publications Microsoft Word - 73FR72036_UC signed 1&#0; Microsoft Word - SRNL Fed Register Response.doc Subcontractor Rights Under CRADAs and WFO Agreements

  13. Microsoft Word - FAL2006-04.doc | Department of Energy

    Office of Environmental Management (EM)

    FAL2006-04.doc Microsoft Word - FAL2006-04.doc PDF icon Microsoft Word - FAL2006-04.doc More Documents & Publications Financial Assistance Letters No. FAL 2006-04 Microsoft Word - AL2006-03.doc Microsoft Word - FAL2004-01

  14. Microsoft Word - Federal Register Response _Jan09_.doc | Department of

    Office of Environmental Management (EM)

    Energy Federal Register Response _Jan09_.doc Microsoft Word - Federal Register Response _Jan09_.doc PDF icon Microsoft Word - Federal Register Response _Jan09_.doc More Documents & Publications Microsoft Word - Document2 Microsoft Word - Intellectual Property Provisions _NRD-1003_.doc Microsoft Word - SRNL Fed Register Response

  15. Microsoft Word - Final Sample Participant Profile November 2008.doc |

    Office of Environmental Management (EM)

    Department of Energy Final Sample Participant Profile November 2008.doc Microsoft Word - Final Sample Participant Profile November 2008.doc More Documents & Publications Microsoft Word - ARRAAttachment12v1.doc Microsoft Word - Fact Sheet Energy Speech 082508 FINAL.doc Microsoft Word - DRAFT CRB Interview Guidance

  16. AcqGuide70pt31.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    pt31.doc&#0; AcqGuide70pt31.doc&#0; PDF icon AcqGuide70pt31.doc&#0; More Documents & Publications Microsoft Word - AcqGuide70pt31A.doc Policy Flash 2014-26 Acquisition Guide Chapter 70.31A - Costs Associated with Whistleblower Actions Microsoft Word - AcqGuide70pt31B.doc

  17. leveraging_partnerships_with_faith-based_organizations.doc | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy leveraging_partnerships_with_faith-based_organizations.doc leveraging_partnerships_with_faith-based_organizations.doc leveraging_partnerships_with_faith-based_organizations.doc Microsoft Office document icon leveraging_partnerships_with_faith-based_organizations.doc More Documents & Publications Leveraging Partnerships with Faith-Based Organizations Outreach to Faith--Based Organizations Using Social Media to Engage the Community in Energy Efficiency Projects.doc

  18. Data Exploration Toolkit for serial diffraction experiments (Journal

    Office of Scientific and Technical Information (OSTI)

    Article) | SciTech Connect Data Exploration Toolkit for serial diffraction experiments Citation Details In-Document Search Title: Data Exploration Toolkit for serial diffraction experiments Ultrafast diffraction at X-ray free-electron lasers (XFELs) has the potential to yield new insights into important biological systems that produce radiation-sensitive crystals. An unavoidable feature of the 'diffraction before destruction' nature of these experiments is that images are obtained from many

  19. Towards time-resolved serial crystallography in a microfluidic device

    Office of Scientific and Technical Information (OSTI)

    (Journal Article) | SciTech Connect Towards time-resolved serial crystallography in a microfluidic device Citation Details In-Document Search Title: Towards time-resolved serial crystallography in a microfluidic device Authors: Pawate, Ashtamurthy S. ; Srajer, Vukica ; Schieferstein, Jeremy ; Guha, Sudipto ; Henning, Robert ; Kosheleva, Irina ; Schmidt, Marius ; Ren, Zhong ; Kenis, Paul J.A. ; Perry, Sarah L. [1] ; UC) [2] ; Renz) [2] ; UIUC) [2] + Show Author Affiliations (UW) ( Publication

  20. Microsoft Word - Clay Memo PMC Coburn Obama 11_9_06.doc | Department...

    Office of Environmental Management (EM)

    Clay Memo PMC Coburn Obama 11906.doc Microsoft Word - Clay Memo PMC Coburn Obama 11906.doc Microsoft Word - Clay Memo PMC Coburn Obama 11906.doc More Documents & Publications...

  1. Microsoft Word - TSLCC 2007_5_05_08 rev 1.doc | Department of...

    Office of Environmental Management (EM)

    TSLCC 200750508 rev 1.doc Microsoft Word - TSLCC 200750508 rev 1.doc Microsoft Word - TSLCC 200750508 rev 1.doc More Documents & Publications FY 2007 Total System Life...

  2. Form:NEPA Doc | Open Energy Information

    Open Energy Info (EERE)

    NEPA Doc Jump to: navigation, search Input the name of a NEPA Document below. If the document already exists, you will be able to edit its information. AddEdit a NEPA Document...

  3. NVN-085710 | Open Energy Information

    Open Energy Info (EERE)

    Decision Document Date 20080818 Relevant Numbers Lead Agency Doc Number NV-08-08-006 Serial Number NVN-085710 Documents Serial Register Page: NVN-085710 - SRP.pdf Retrieved from...

  4. NVN-085711 | Open Energy Information

    Open Energy Info (EERE)

    Decision Document Date 20080818 Relevant Numbers Lead Agency Doc Number NV-08-08-007 Serial Number NVN-085711 Documents Serial Register Page: NVN-085711 - SRP.pdf Retrieved from...

  5. Microsoft Word - Flash2008-09Attachment.doc | Department of Energy

    Broader source: Energy.gov (indexed) [DOE]

    9Attachment.doc More Documents & Publications Flash2007-02Attachment.doc&0; Microsoft Word - AL2000-05Attachment.doc Flash2007-03Attachment.doc&0;...

  6. Microsoft Word - Policy Flash 2008-04.doc | Department of Energy

    Office of Environmental Management (EM)

    4.doc Microsoft Word - Policy Flash 2008-04.doc More Documents & Publications Microsoft Word - Policy Flash 2008-07.doc Microsoft Word - Policy Flash 2008-10.doc Microsoft Word -...

  7. Microsoft Word - Policy Flash 2008-06.doc | Department of Energy

    Office of Environmental Management (EM)

    6.doc Microsoft Word - Policy Flash 2008-06.doc More Documents & Publications Microsoft Word - Policy Flash 2008-07.doc Microsoft Word - Policy Flash 2008-10.doc Microsoft Word -...

  8. Microsoft Word - DRAFT CRB Interview Guidance.doc | Department of Energy

    Office of Environmental Management (EM)

    DRAFT CRB Interview Guidance.doc Microsoft Word - DRAFT CRB Interview Guidance.doc More Documents & Publications Microsoft Word - ARRAAttachment12v1.doc Microsoft Word - ARRAGuideAttachment10v1.doc Microsoft Word - Document2

  9. Microsoft Word - Policy Flash 2008-07.doc | Department of Energy

    Office of Environmental Management (EM)

    07.doc Microsoft Word - Policy Flash 2008-07.doc More Documents & Publications Microsoft Word - Policy Flash 2008-10...

  10. Microsoft Word - Policy Flash 2008-10.doc | Department of Energy

    Office of Environmental Management (EM)

    10.doc Microsoft Word - Policy Flash 2008-10.doc More Documents & Publications Microsoft Word - Policy Flash 2008-07...

  11. Microsoft Word - n0045000.doc

    Office of Legacy Management (LM)

    Pinellas STAR Center Building 100 Area Remediation Technology Screening Report August 2001 Prepared by U.S. Department of Energy Grand Junction Office Grand Junction, Colorado Project Number PIN-041-0004-04-000 Document Number N0045000 Work Performed Under DOE Contract Number DE-AC13-96GJ87335 Task Order Number MAC01-10 This page intentionally left blank Document Number N0045000 Contents DOE/Grand Junction Office Building 100 Area Remediation Technology Screening Report August 2001 Page iii

  12. fleetappforms04f1298.doc | Department of Energy

    Broader source: Energy.gov (indexed) [DOE]

    fleetappforms04f1298.doc&#0; More Documents & Publications pocforms06a0399.doc&#0; Inspection Report: INS-O-09-04 Inspection Report: INS-O-06-01

  13. transcript_jedi_model.doc | Department of Energy

    Broader source: Energy.gov (indexed) [DOE]

    transcript_jedi_model.doc Microsoft Office document icon transcript_jedi_model.doc More Documents & Publications TAP Webcast Transcript July-29, 2009 Scenario Jedi Tools for Designing & Implementing Better Finance Programs

  14. T-527: OpenSC Smart Card Serial Number Multiple Buffer Overflow Vulnerabilities

    Broader source: Energy.gov [DOE]

    OpenSC is prone to multiple buffer-overflow vulnerabilities because the application fails to perform adequate boundary checks on user-supplied input. Attackers may leverage these issues to execute arbitrary code in the context of the application. Failed attacks will cause denial-of-service conditions.

  15. expanding_chp_in_your_state.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    expanding_chp_in_your_state.doc expanding_chp_in_your_state.doc expanding_chp_in_your_state.doc Microsoft Office document icon expanding_chp_in_your_state.doc More Documents & Publications Combined Heat and Power: Expanding CHP in Your State Sustainable Energy Resources for Consumers (SERC) - Solar Hot Water Sustainable Energy Resources for Consumers (SERC) - Geothermal/Ground-Source Heat Pumps

  16. DOCS System Configuration Management Plan | Department of Energy

    Office of Environmental Management (EM)

    DOCS System Configuration Management Plan DOCS System Configuration Management Plan The DOCS Systems Configuration Management Plan (SCMP), from an actual DOE systems engineering project, can be used as a template to facilitate the creation of the CMP for your particular project. PDF icon DOCS System Configuration Management Plan More Documents & Publications OPC Security Whitepaper #3Hardening Guidelines for OPC Hosts NMMSS Software Quality Assurance Plan ABB SCADA/EMS System INEEL Baseline

  17. 20130226_sunshot_transcript_lbnl.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    transcript_lbnl.doc 20130226_sunshot_transcript_lbnl.doc 20130226_sunshot_transcript_lbnl.doc Microsoft Office document icon 20130226_sunshot_transcript_lbnl.doc More Documents & Publications Why Are Resiential PV Prices in Germany So Much Lower Than in the United States? text_alternative_stat_webinar_2012_7_25.docx An Analysis of Residential PV System Price Differences between the United States and Germany

  18. Microsoft Word - S06401_IC.doc

    Office of Legacy Management (LM)

    Photos of T Building Rooms with Special ICs This page intentionally left blank U.S. Department of Energy Annual Assessment of the Effectiveness of Site-Wide Institutional Controls June 2010 Doc. No. S06401 Page D-1 Figure D-1. T Building Rooms with Special ICs Annual Assessment of the Effectiveness of Site-Wide Institutional Controls U.S. Department of Energy Doc. No. S06401 June 2010 Page D-2 Figure D-2. T Bldg. Room 16 View A Figure D-3. T Bldg. Room 16 View B Figure D-4. T Bldg. Room 16 View

  19. Residential Retrofit Program Design Guide Overview Transcript.doc |

    Broader source: Energy.gov (indexed) [DOE]

    Department of Energy Residential Retrofit Program Design Guide Overview Transcript.doc Microsoft Office document icon Residential Retrofit Program Design Guide Overview Transcript.doc More Documents & Publications Residential Retrofit Program Design Guide Overview Transcript.doc Residential Retrofit Design Guide Overview Sustainable Energy Resources for Consumers Webinar on Residential Geothermal Heat Pump Retrofit Transcript

  20. Microsoft Word - FAL2004-05.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    FAL2004-05.doc Microsoft Word - FAL2004-05.doc PDF icon Microsoft Word - FAL2004-05.doc More Documents & Publications Archived Financial Assistance Letters Microsoft Word - Section 311 AL FAL Feb 17 2010 Financial Assistance Letter No. FAL 2006-03

  1. Microsoft Word - al2004-03.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    al2004-03.doc Microsoft Word - al2004-03.doc PDF icon Microsoft Word - al2004-03.doc More Documents & Publications Acquisition Letter: AL2005-08 OPAM Policy Acquisition Guides Presentations, Women-Owned Small Business Forum (May 2013)

  2. Microsoft Word - meritrev.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    meritrev.doc Microsoft Word - meritrev.doc PDF icon Microsoft Word - meritrev.doc More Documents & Publications Policy Flash 2013-38 Revised Merit Review Guide For Financial Assistance Application Content and Evaluation Criteria/Process Application Content and Evaluation Criteria/Process

  3. AcqGuide37pt1.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    7pt1.doc&#0; AcqGuide37pt1.doc&#0; PDF icon AcqGuide37pt1.doc&#0; More Documents & Publications Chapter 37 - Service Contracting Microsoft Word - AcqGuide37pt1 binney Nov 2010 Special Review: OAS-M-15-05

  4. AcqGuide4pt1.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    pt1.doc&#0; AcqGuide4pt1.doc&#0; PDF icon AcqGuide4pt1.doc&#0; More Documents & Publications Source Selection Guide Source Selection Guide Policy Flash 2013-46 Awardee in STRIPES

  5. AcqGuide70pt5.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    pt5.doc&#0; AcqGuide70pt5.doc&#0; PDF icon AcqGuide70pt5.doc&#0; More Documents & Publications Chapter 70 - DOE Management and Operating Contracts CHAPTER 3 Policy Flash 2013-62 Acquisition Letter 09 - Revision of Department of Energy (DOE) Order 350.1 and Special H Clause

  6. Microsoft Word - al96-09.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    6-09.doc Microsoft Word - al96-09.doc PDF icon Microsoft Word - al96-09.doc More Documents & Publications Subject: Cost and Price Analysis Subject: Cost and Price Analysis Policy Flash 2013-30 Acquisition Letter on Acquisition Planning Considerations for Management and Operating Contracts

  7. Microsoft Word - AL2005-15.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    5.doc Microsoft Word - AL2005-15.doc PDF icon Microsoft Word - AL2005-15.doc More Documents & Publications Appendix A. Notice of Inquiry: Preparation of Report to Congress on Price-Anderson Act. 62 Federal Register 68,272 (December 31, 1997) Public comment re Price-Anderson Act Public Comment on Price Anderson Act from the University of Chicago

  8. Microsoft Word - AL2006-10.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    0.doc Microsoft Word - AL2006-10.doc PDF icon AL2006-10 More Documents & Publications Microsoft Word - Matrixpart2.doc Microsoft Word - AcqGuide70pt52Matrixpart2Redo AcqGuide70.52Matrixpart2Redo-OPAM

  9. Microsoft Word - FOA cover sheet.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    cover sheet.doc Microsoft Word - FOA cover sheet.doc PDF icon Microsoft Word - FOA cover sheet.doc More Documents & Publications Recovery Act: Wind Energy Consortia between Institutions of Higher Learning and Industry Microsoft Word - kDE-FOA-0000090.rtf DISCLAIMER:

  10. AcqGuide3pt1.doc | Department of Energy

    Energy Savers [EERE]

    pt1.doc&#0; AcqGuide3pt1.doc&#0; PDF icon AcqGuide3pt1.doc&#0; More Documents & Publications POLICY FLASH 2016-04 Procurement Integrity PI Brief 6 15 07 final2&#0;

  11. Microsoft Word - Cross Reference Matrix Introduction.doc | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Cross Reference Matrix Introduction.doc Microsoft Word - Cross Reference Matrix Introduction.doc PDF icon Microsoft Word - Cross Reference Matrix Introduction.doc More Documents & Publications Quality Assurance Requirements USA RS Basic Contract - Contract No.: DE-RW0000005 Office of Civilian Radioactive Waste Management-Quality Assurance Requirements and Description

  12. Microsoft Word - Matrixpart2.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Matrixpart2.doc Microsoft Word - Matrixpart2.doc PDF icon Microsoft Word - Matrixpart2.doc More Documents & Publications AcqGuide70.52Matrixpart2Redo-OPAM Microsoft Word - AcqGuide70pt52Matrixpart2Redo Part 2, Clauses Prescribed in DEAR Parts 952 and 970

  13. CompleteProject List.doc | Department of Energy

    Office of Environmental Management (EM)

    CompleteProject List.doc&#0; CompleteProject List.doc&#0; PDF icon CompleteProject List.doc&#0; More Documents & Publications Tribal Energy Program February 2012 Award Project Descriptions CX-008525: Categorical Exclusion Determination 2010 Program Review Meeting

  14. al99-06attachment.doc | Department of Energy

    Broader source: Energy.gov (indexed) [DOE]

    attachment.doc&#0; More Documents & Publications Microsoft Word - AL2000-05Attachment.doc Microsoft Word - NSRC precompetitive User Agreement amended 1-18-07.doc EXHIBIT A: CRADA, WFO, PUA and NPUA Comparison Table, with suggested changes

  15. Microsoft Word - Political Activity and the Federal Employee.doc |

    Office of Environmental Management (EM)

    Department of Energy Political Activity and the Federal Employee.doc Microsoft Word - Political Activity and the Federal Employee.doc PDF icon Microsoft Word - Political Activity and the Federal Employee.doc More Documents & Publications Audit Report: IG-0473 PROCESSING INVITATIONS FOR A PRESIDENTIAL APPOINTEE EIS-0307: Withdrawal of Notice of Intent to Prepare an Environmental Impact Statement

  16. Microsoft Word - al95-14.doc | Department of Energy

    Office of Environmental Management (EM)

    al95-14.doc Microsoft Word - al95-14.doc PDF icon Microsoft Word - al95-14.doc More Documents & Publications Cooperation with the New Independent States of the Former Soviet Union CDLB-1003.PDF&#0; 10 CFR 600.325 - Intellectual Property Provisions (GDLB-1003) Grant

  17. Microsoft Word - fal2004-04.doc | Department of Energy

    Office of Environmental Management (EM)

    fal2004-04.doc Microsoft Word - fal2004-04.doc PDF icon Microsoft Word - fal2004-04.doc More Documents & Publications Financial Assistance Guide (2013) For Profit Audits - Information Related to 12/21/11 Federal Register Notice Policy Flash Search Listing (2001-2014)

  18. Microsoft Word - CSATCourseCatalog_02.doc | Department of Energy

    Office of Environmental Management (EM)

    CSATCourseCatalog_02.doc Microsoft Word - CSATCourseCatalog_02.doc classroom-1008856_960_720.jpg PDF icon Microsoft Word - CSATCourseCatalog_02.doc More Documents & Publications CSAT Course Catalog Headquarters Facilities Master Security Plan - Chapter 17, Headquarters Security Officer Program Headquarters Facilities Master Security Plan - Chapter 8, Operations Security Program

  19. Microsoft Word - FAC2005-27.doc | Department of Energy

    Office of Environmental Management (EM)

    FAC2005-27.doc Microsoft Word - FAC2005-27.doc PDF icon Microsoft Word - FAC2005-27.doc More Documents & Publications Policy Flash 2015-07 - FAC 2005-78 Policy Flash Search Listing (2001-2014) POLICY FLASH 2015-32 - FAC 2005-83

  20. Microsoft Word - FOA cover sheet.doc | Department of Energy

    Office of Environmental Management (EM)

    cover sheet.doc Microsoft Word - FOA cover sheet.doc PDF icon Microsoft Word - FOA cover sheet.doc More Documents & Publications Vehicle Technologies Office Merit Review 2014: Moving North Texas Forward by Addressing Alternative Fuel Barriers Clean Cities Regional Support & Petroleum Displacement Awards Clean Cities 2009 Petroleum Displacement Awards

  1. Microsoft Word - LibraryofPriorRulemakings.doc | Department of Energy

    Office of Environmental Management (EM)

    LibraryofPriorRulemakings.doc Microsoft Word - LibraryofPriorRulemakings.doc PDF icon Microsoft Word - LibraryofPriorRulemakings.doc More Documents & Publications Solar Background Document 1 Natural Gas Imports and Exports First Quarter Report 2014 Natural Gas Imports and Exports Second Quarter Report 2014

  2. Microsoft Word - EODchecklist1.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    New Employee Orientation FORMS CHECKLIST EOD Date: Employee Name: Organization: HR Specialist: Phone Number: Admin Contact: Phone Number: New Employee Orientation Forms to be issued and collected by HR Orientation Team: FORM COMPLETE & SIGNED FORM NAME AND NUMBER Yes No Comments 1. Photo ID 2. Passport, Birth Certificate, or U.S. Citizenship Documents Bring on 1 st Day 3. Employment & Benefits forms listed below 1. Employee Information Form 2. Statement of Prior Federal Service - SF-144

  3. Microsoft Word - cover.doc

    Office of Legacy Management (LM)

    1999-90-TAR MAC-GWGRJ 1.9 Ground Water Compliance Action Plan for the Grand Junction, Colorado, UMTRA Project Site May 2001 GJO-1999-90-TAR MAC-GWGRJ 1.9 Ground Water Compliance Action Plan for the Grand Junction, Colorado, UMTRA Project Site May 2001 Prepared by U.S. Department of Energy Grand Junction Office Grand Junction, Colorado Project Number UGW-511-0008-09-000 Document Number U0050100 Work Performed under DOE Contract No. DE-AC13-96GJ87335 Document Number U0050100 Contents DOE/Grand

  4. n0053200-sitewide.doc

    Office of Legacy Management (LM)

    3200 GJO-PIN 11.6.2 Pinellas Environmental Restoration Project Sitewide Environmental Monitoring Quarterly Progress Report for the Young-Rainey STAR Center April through June 2002 July 2002 Prepared by U.S. Department of Energy Grand Junction Office Grand Junction, Colorado Work Performed Under DOE Contract Number DE-AC13-02GJ79491 Task Order Number ST02-107 Document Number N0053200 Contents DOE/Grand Junction Office Pinellas Environmental Restoration Project July 2002 Page iii Contents Page

  5. Microsoft Word - N0049800.doc

    Office of Legacy Management (LM)

    49800 GJO-2002-306-TAR MAC-PIN 14.5.2 Pinellas Environmental Restoration Project at the Young-Rainey STAR Center Building 100 Area Plume Control Technology Selection Report February 2002 Prepared by U.S. Department of Energy Grand Junction Office Grand Junction, Colorado Work Performed Under DOE Contract Number DE-AC13-96GJ87335 Task Order Number MAC02-10 This page intentionally left blank Document Number N0049800 Contents DOE/Grand Junction Office Building 100 Area Plume Control Technology

  6. Microsoft Word - S06692_VMR.doc

    Office of Legacy Management (LM)

    Gunnison, Colorado, Processing Site September 2010 LMS/GUP/S06692 This page intentionally left blank LMS/GUP/S06692 2010 Verification Monitoring Report for the Gunnison, Colorado, Processing Site September 2010 This page intentionally left blank U.S. Department of Energy 2010 Verification Monitoring Report-Gunnison, Colorado, Processing Site September 2010 Doc. No. S06692 Page i Contents

  7. Microsoft Word - Appendix A_Background.doc

    Office of Legacy Management (LM)

    Background Information, Remedial Action Histories, Present Site Conditions U.S. Department of Energy Weldon Spring Site LTS&M Plan July 2005 Doc. No. S0079000 Page A-iii Contents A1.1 Location and Property Ownership ................................................................................1 A1.2 Physiography and Topography.....................................................................................4 A1.3 Hydrogeology

  8. LATEST_m_93.DOC

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    3 AM Change Number M-93-01-02 Federal Facility Agreement and Consent Order Change Control Form Do not use blue ink. Type or print using black ink. Date 123101 Originator Phone H....

  9. Microsoft Word - M084.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of Offers is extended, is not...

  10. Microsoft Word - expcaruso.doc

    U.S. Energy Information Administration (EIA) Indexed Site

    4.9 percent drop in overall U.S. natural gas consumption in ... SR4. The deteriorating financial condition of a number of ... to the 2000-2001 energy crisis in that region, resulted ...

  11. Microsoft Word - U0127400.doc

    Office of Legacy Management (LM)

    12-TAR MAC-GWMON 1.8 Chemistry of Phase I Phytoremediation Soils: Work Plan for the Monument Valley, Arizona, UMTRA Project Site September 2001 This page intentionally left blank UMTRA Ground Water Project Chemistry of Phase I Phytoremediation Soils: Work Plan for the Monument Valley, Arizona, UMTRA Project Site September 2001 Prepared for U.S. Department of Energy Grand Junction Office Grand Junction, Colorado Project Number UGW-511-0015-37-000 Document Number U0127400 Work Performed Under DOE

  12. Microsoft Word - table_21.doc

    Gasoline and Diesel Fuel Update (EIA)

    9 Table 21. Number of natural gas commercial consumers by type of service and state, 2013-2014 R Revised data. Note: Totals may not equal sum of components due to independent rounding. Source: Energy Information Administration (EIA), Form EIA-176, "Annual Report of Natural and Supplemental Gas Supply and Disposition." Please see the cautionary note regarding the number of residential and commercial customers located on the second page of Appendix A of this report. Alabama 67,006 130

  13. Microsoft Word - U0186500.doc

    Office of Legacy Management (LM)

    500 GJO-2003-487-TAC GJO-GWSHP 11.7 UMTRA Ground Water Project Wildlife Management Plan for the Evaporation Pond at the Shiprock, New Mexico, UMTRA Site September 2003 Prepared by U.S. Department of Energy Grand Junction Office Grand Junction, Colorado Work Performed Under DOE Contract Number DE-AC-13-02GJ79491 Document Number U0186500 DOE/Grand Junction Office Wildlife Management PlanShiprock Evaporation Pond September 2003 Page 1 1.0 Introduction The Proposed Action in the Environmental

  14. Microsoft Word - Chapter 12.doc

    National Nuclear Security Administration (NNSA)

    2 GLOSSARY 12-1 12.0 GLOSSARY absorbed dose-The energy imparted by ionizing radiation per unit mass of the irradiated material (e.g., biological tissue). The units of absorbed dose are the rad and the gray (Gy). (See gray, quality factor, rad, rem, and sievert.) accident-An unplanned sequence of events that usually results in undesirable consequences. actinides-A series of heavy radioactive metallic elements of increasing atomic number (Z number) beginning with actinium (89) and continuing

  15. Microsoft Word - n0021500.doc

    Office of Legacy Management (LM)

    PIN 16.2 Environmental Restoration Program Wastewater Neutralization Area/Building 200 Area Corrective Measures Implementation Plan Addendum January 2000 Environmental Restoration Program Wastewater Neutralization Area/Building 200 Area Corrective Measures Implementation Plan Addendum January 2000 Prepared for U.S. Department of Energy Albuquerque Operations Office Grand Junction Office Prepared by MACTEC Environmental Restoration Services, LLC Grand Junction, Colorado Project Number

  16. Request Number:

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    3023307 Name: Madeleine Brown Organization: nJa Address: --- -------- -------- -- Country: Phone Number: United States Fax Number: n/a E-mail: --- -------- --------_._------ --- Reasonably Describe Records Description: Please send me a copy of the emails and records relating to the decision to allow the underage son of Bill Gates to tour Hanford in June 2010. Please also send the emails and records that justify the Department of Energy to prevent other minors from visiting B Reactor. Optional

  17. Request Number:

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    1074438 Name: Gayle Cooper Organization: nla Address: _ Country: United States Phone Number: Fax Number: nla E-mail: . ~===--------- Reasonably Describe Records Description: Information pertaining to the Department of Energy's cost estimate for reinstating pension benefit service years to the Enterprise Company (ENCO) employees who are active plan participants in the Hanford Site Pension Plan. This cost estimate was an outcome of the DOE's Worker Town Hall Meetings held on September 17-18, 2009.

  18. AL2007-05.doc

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AL 2007-05 Acquisition Regulation Date 03/29/2007 ACQUISITION LETTER This Acquisition Letter is issued under the authority of the DOE and NNSA Procurement Executives. Acquisition Letters (AL) that remain in effect are identified below. All other previously issued ALs have been superseded by a formal rule-making, incorporated into other guidance, and/or canceled. * * * * * * * * * * * * * * * * ACQUISITION LETTERS REMAINING IN EFFECT NUMBER DATE SUBJECT 93-4 04/07/93 Displaced Workers Benefits

  19. Microsoft Word - P450.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Understanding the Role of Thiolate Ligation in Nature's Hydroxylating Heme Enzymes Michael T. Green, 1 John H. Dawson, 2 Harry B. Gray 3 1 Department of Chemistry, The Pennsylvania State University, PA 16802 2 Department of Chemistry and Biochemistry, The University of South Carolina, SC 29208 3 Beckman Institute, California Institute of Technology, Pasadena, CA 91125 Cytochromes P450 are thiolate-ligated heme enzymes that play critical roles in a number of important physiological processes.

  20. Microsoft Word - U01866.doc

    Office of Legacy Management (LM)

    186600 GJO-2003-489-TAC GJO-GWDUR 2.0 UMTRA Ground Water Project Verification Monitoring Report for the Durango, Colorado, UMTRA Project Site September 2003 Prepared by U.S. Department of Energy Grand Junction Office Grand Junction, Colorado Work Performed Under DOE Contract No. DE-AC13-02GJ79491 Document Number U0186600 Contents DOE/Grand Junction Office Verification Monitoring Report-Durango, Colorado September 2003 Page iii Contents 1.0

  1. Microsoft Word - e0399102.doc

    Office of Legacy Management (LM)

    UNCONTROLLED IF PRINTED E0399101 GJO-2003-493-TAC MNT 015.20 REV. 06 Copy No. ______ Draft-Final Monticello Site Management Plan October 2003 UNCONTROLLED IF PRINTED Prepared by U.S. Department of Energy Grand Junction, Colorado Work Performed Under DOE Contract Number DE-AC13-02GJ79491 UNCONTROLLED IF PRINTED Contents October 2003 Site Management Plan Page iii Contents Acronyms and Abbreviations

  2. Microsoft Word - April06.doc

    Office of Environmental Management (EM)

    April 2006 Volume 2, Number 1 In This Issue * DOE and ACHP Heritage Tourism Partnership * Nau Applauds DOE Executive Order Report * Want to Receive Partners in Preservation? * Atomic Testing Museum to Host Museum and Visitor Center Conference * $2 Million in FY06 Budget for Manhattan Project Preservation * Manhattan Project Web Site & Reprint * National Park Service Manhattan Project Study * 2006 DOE Cultural Resources Forum: Oak Ridge, Tennessee * Idaho to Hold Cultural Resources

  3. Microsoft Word - August06.doc

    Office of Environmental Management (EM)

    August 2006 Office of History and Heritage Resources Volume 2, Number 2 In This Issue * B-Reactor Study for Deputy Secretary * Museum and Visitor Center Conference * National Park Service Manhattan Project Resource Study * DOE Headquarters Museum/Visitor Center * Want to Receive Partners in Preservation? * 2007 DOE Cultural Resources Forum: Hanford, Washington * 2006 DOE Cultural Resources Forum: Oak Ridge, Tennessee * K-25 Racetrack? * FPO Funds Field Office Preservation * Pantex Donates Cold

  4. Microsoft Word - May2009.doc

    Office of Environmental Management (EM)

    009 Volume 4, Number 1 IN THIS ISSUE  DOE Wins ACHP Chairman's Award  Oak Ridge Hosts Energy Communities Alliance for Meeting and Secret Cities Festival  Hanford's B Reactor Named National Historic Landmark  National Trust Awards National Preservation Award for V-Site Restoration  Want to Receive Partners in Preservation?  Public Tours at Savannah River  Remember the ACHP  Status of National Park Service Manhattan Project Study  Touring the B Reactor at Hanford 

  5. Microsoft Word - Fact Sheet Energy Speech 082508 FINAL.doc | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Energy Speech 082508 FINAL.doc Microsoft Word - Fact Sheet Energy Speech 082508 FINAL.doc More Documents & Publications Microsoft Word - Press Release RECOMP 2-8-08 REV FINAL.doc Microsoft Word - ARRAAttachment12v1.doc Microsoft Word - Final Sample Participant Profile November 2008.doc

  6. Microsoft Word - ADR-Provisions-FederalAcquisitionReg.doc | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy ADR-Provisions-FederalAcquisitionReg.doc Microsoft Word - ADR-Provisions-FederalAcquisitionReg.doc PDF icon Microsoft Word - ADR-Provisions-FederalAcquisitionReg.doc More Documents & Publications ADR Provisions in Federal Acquisition Regulation (FAR) Microsoft Word - ACQUISITION LETTER.doc Microsoft Word - ADR Revised Policy82508Reformatted.doc

  7. Microsoft Word - AL2000-05Attachment.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Attachment.doc Microsoft Word - AL2000-05Attachment.doc PDF icon Microsoft Word - AL2000-05Attachment.doc More Documents & Publications al99-06attachment.doc&#0; EXHIBIT A: CRADA, WFO, PUA and NPUA Comparison Table, with suggested changes Microsoft Word - NSRC precompetitive User Agreement amended 1-18-07.doc

  8. Microsoft Word - AL2005-05Revised.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AL2005-05Revised.doc Microsoft Word - AL2005-05Revised.doc PDF icon Microsoft Word - AL2005-05Revised.doc More Documents & Publications AL2007-03.doc&#0; 2011-31 Attachment Aquisition Letter AcqGuide38pt1.doc&#0;

  9. Microsoft Word - S05428_VMR.doc

    Office of Legacy Management (LM)

    2008 and 2009 Update July 2010 LMS/SRE-SRW/S05428 This page intentionally left blank LMS/SRE-SRW/S05428 Verification Monitoring Report for the Slick Rock, Colorado, Processing Sites 2008 and 2009 Update July 2010 This page intentionally left blank U.S. Department of Energy Verification Monitoring Report-Slick Rock, Colorado, 2008 and 2009 Update July 2010 Doc. No. S05428 Page i Contents

  10. Microsoft Word - S05527_VMR 2009.DOC

    Office of Legacy Management (LM)

    Report for the Gunnison, Colorado, Processing Site August 2009 LMS/GUP/S05527 This page intentionally left blank LMS/GUP/S05527 2009 Verification Monitoring Report for the Gunnison, Colorado, Processing Site August 2009 This page intentionally left blank U.S. Department of Energy 2009 Verification Monitoring Report-Gunnison, Colorado, Processing Site August 2009 Doc. No. S05527 Page i Contents

  11. Microsoft Word - S06371_VMR_060210.doc

    Office of Legacy Management (LM)

    Naturita, Colorado, Processing Site May 2010 LMS/NAP/S06371 This page intentionally left blank LMS/NAP/S06371 Office of Legacy Management Verification Monitoring Report for the Naturita, Colorado, Processing Site May 2010 This page intentionally left blank U.S. Department of Energy Verification Monitoring Report⎯Naturita, Colorado May 2010 Doc. No. S06371 Page i Contents 1.0 Introduction

  12. Microsoft Word - S07050_WM.doc

    Office of Legacy Management (LM)

    Monitoring Report for Wetland Area near the Naturita, Colorado, Processing Site September 2010 LMS/NAP/S07050 This page intentionally left blank LMS/NAP/S07050 Monitoring Report for Wetland Area near the Naturita, Colorado, Processing Site September 2010 This page intentionally left blank U.S. Department of Energy Naturita-Monitoring Report for Wetland Area September 2010 Doc. No. S07050 Page i Contents 1.0 Introduction

  13. Microsoft Word - S03736_ FMP010609.doc

    Office of Legacy Management (LM)

    Fluid Management Plan Central Nevada Test Area Corrective Action Unit 443 January 2009 LMS/CNT/S03736 This page intentionally left blank LMS/CNT/S03736 Fluid Management Plan Central Nevada Test Area Corrective Action Unit 443 January 2009 This page intentionally left blank U.S. Department of Energy Fluid Management Plan For CAU 443: CNTA, Subsurface, Nevada January 2009 Doc. No. S0373600 Page i Contents Acronyms and Abbreviations

  14. Microsoft Word - S04019_GSB.doc

    Office of Legacy Management (LM)

    Long-Term Hydrologic Monitoring Program Evaluation Report June 2009 LMS/GSB/S04019 This page intentionally left blank LMS/GSB/S04019 Gasbuggy, New Mexico Long-Term Hydrologic Monitoring Program Evaluation Report June 2009 This page intentionally left blank U.S. Department of Energy Gasbuggy, New Mexico Long-Term Hydrologic Monitoring Program Evaluation Report June 2009, Rev. 3 Doc. No. S04019 Page i Contents Abbreviations

  15. Microsoft Word - S05094_VMR.doc

    Office of Legacy Management (LM)

    08 May 2009 LMS/RVT/S05094 This page intentionally left blank LMS/RVT/S05094 Verification Monitoring Report for the Riverton, Wyoming, Processing Site Update for 2008 May 2009 This page intentionally left blank U.S. Department of Energy Riverton, Wyoming, Verification Monitoring Report May 2009 Doc. No. S05094 Page i Contents 1.0 Introduction ........................................................................................................................1-1 2.0 Site Conditions

  16. Microsoft Word - S05575_AP.doc

    Office of Legacy Management (LM)

    8 through March 2009 for the Shiprock, New Mexico, Site December 2009 LMS/SHP/S05575 This page intentionally left blank LMS/SHP/S05575 Annual Performance Report April 2008 through March 2009 for the Shiprock, New Mexico, Site December 2009 This page intentionally left blank U.S. Department of Energy Annual Performance Report, Shiprock, New Mexico December 2009 Doc. No. S05575 Page i Contents

  17. Microsoft Word - S05949_IR.doc

    Office of Legacy Management (LM)

    Annual Inspection of the Monticello Mill Tailings (USDOE) and Monticello Radioactively Contaminated Properties Sites December 2009 LMS/MNT/S05949 This page intentionally left blank LMS/MNT/S05949 2009 Annual Inspection of the Monticello Mill Tailings (USDOE) and Monticello Radioactively Contaminated Properties Sites December 2009 This page intentionally left blank U.S. Department of Energy 2009 Annual Inspection-Monticello, Utah December 2009 Doc. No. S05949 Page i Contents Executive

  18. Microsoft Word - S06093_VMR.doc

    Office of Legacy Management (LM)

    09 April 2010 LMS/RVT/S06093 This page intentionally left blank LMS/RVT/S06093 Verification Monitoring Report for the Riverton, Wyoming, Processing Site Update for 2009 April 2010 This page intentionally left blank U.S. Department of Energy Riverton, Wyoming, Verification Monitoring Report April 2010 Doc. No. S06093 Page i Contents 1.0 Introduction ........................................................................................................................1-1 2.0 Site Conditions

  19. Microsoft Word - S06178_MP.doc

    Office of Legacy Management (LM)

    Rulison Monitoring Plan July 2010 Approved for public release; further dissemination unlimited LMS/RUL/S06178 This page intentionally left blank LMS/RUL/S06178 Rulison Monitoring Plan July 2010 Approved for public release; further dissemination unlimited This page intentionally left blank U.S. Department of Energy Rulison Monitoring Plan July 2010 Doc. No. S06178 Page i Contents 1.0

  20. Microsoft Word - S06182_GCAP.doc

    Office of Legacy Management (LM)

    Groundwater Compliance Action Plan for the Lakeview, Oregon, Processing Site June 2010 LMS/LKP/S06182 This page intentionally left blank LMS/LKP/S06182 Groundwater Compliance Action Plan for the Lakeview, Oregon, Processing Site June 2010 This page intentionally left blank U.S. Department of Energy Groundwater Compliance Action Plan for the Lakeview, Oregon, Processing Site June 2010 Doc. No.S06182 Page i Contents

  1. Microsoft Word - S06596_GW.doc

    Office of Legacy Management (LM)

    Annual Groundwater Report May 2009 through April 2010 September 2010 LMS/MNT/S06596 This page intentionally left blank LMS/MNT/S06596 Monticello Mill Tailings Site Operable Unit III Annual Groundwater Report May 2009 through April 2010 September 2010 This page intentionally left blank U.S. Department of Energy Monticello Mill Tailings Site OU III Annual Groundwater Report May 2009-April 2010 September 2010 Doc. No. S06596 Page i Contents

  2. Microsoft Word - S06654_ESL.doc

    Office of Environmental Management (EM)

    and Geochemical Modeling of Vanadium Contamination in Groundwater New Rifle Processing Site, Colorado July 2010 LMS/RFN/S06654 ESL-RPT-2010-01 This page intentionally left blank LMS/RFN/S06654 ESL-RPT-2010-01 Analysis and Geochemical Modeling of Vanadium Contamination in Groundwater New Rifle Processing Site, Colorado July 2010 This page intentionally left blank U.S. Department of Energy Analysis and Geochemical Modeling of Vanadium Contamination in Groundwater, Rifle, Colorado July 2010 Doc.

  3. Microsoft Word - Appendix A.doc

    Office of Legacy Management (LM)

    Background Information, Remedial Action Histories, Final Site Conditions U.S. Department of Energy Weldon Spring Site LTS&M Plan February 2005 Second Draft Final Doc. No. S00790AG Page A-iii Contents A1.0 Weldon Spring Site Description and History................................................................... A-1 A1.1 Location and Property Ownership .......................................................................... A-1 A1.2 Physiography and

  4. Microsoft Word - Appendix B.doc

    Office of Legacy Management (LM)

    Risk Assessment Information U.S. Department of Energy Weldon Spring Site LTS&M Plan February 2005 Second Draft Final Doc. No. S00790AG Page B-3 Summary of Post-Remediation Risk Status at the Weldon Spring Site Baseline risk assessments addressing both human health and ecological risks were performed as part of the remedial investigation phase of the remedial investigation/feasibility study processes conducted. A limited assessment was performed for the Quarry Bulk Waste Operable Unit (OU)

  5. Microsoft Word - S01382_September2004.doc

    Office of Legacy Management (LM)

    S0138200 Verification Monitoring Report for the Gunnison, Colorado, UMTRCA Title I Processing Site September 2004 Work Performed by S.M. Stoller Corporation under DOE Contract No. DE-AC01-02GJ79491 for the U.S. Department of Energy Office of Legacy Management, Grand Junction, Colorado U.S. Department of Energy Verification Monitoring Report-Gunnison, Colorado September 2004 Doc. No. S0138200 Page iii Contents Acronyms and Abbreviations

  6. Microsoft Word - S06350_EA.doc

    Office of Legacy Management (LM)

    Draft Environmental Assessment Photovoltaic Solar Project at the Durango, Colorado, Site August 2010 LMS/DUD/S06350 DOE/EA 1770 This page intentionally left blank LMS/DUD/S06350 DOE/EA 1770 Draft Environmental Assessment Photovoltaic Solar Project at the Durango, Colorado, Disposal Site August 2010 This page intentionally left blank U.S. Department of Energy Photovoltaic Solar Project at the Durango, Colorado, Site August 2010 Doc. No. S06350 Page i Contents Summary

  7. Microsoft Word - DOE RFI.doc

    Office of Environmental Management (EM)

    Ms. Patricia Hoffman Assistant Secretary United States Department of Energy 1000 Independence Avenue, SW, Room 8H033 Washington, DC 20585 RE: Smart Grid RFI Dear Assistant Secretary Hoffman, Thank you for the opportunity to provide information to the Department of Energy Federal Register Doc. 2010-23251 filed September 16, 2010. With our recent acquisition of Ventyx, ABB is one of the few companies in the smart grid space that can approach the entire smart grid value chain, from distributed

  8. Fixed target matrix for femtosecond time-resolved and in situ serial micro-crystallography

    DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

    Mueller, C.; Marx, A.; Epp, S. W.; Zhong, Y.; Kuo, A.; Balo, A. R.; Soman, J.; Schotte, F.; Lemke, H. T.; Owen, R. L.; et al

    2015-08-18

    We present a crystallography chip enabling in situ room temperature crystallography at microfocus synchrotron beamlines and X-ray free-electron laser (X-FEL) sources. Compared to other in situ approaches, we observe extremely low background and high diffraction data quality. The chip design is robust and allows fast and efficient loading of thousands of small crystals. The ability to load a large number of protein crystals, at room temperature and with high efficiency, into prescribed positions enables high throughput automated serial crystallography with microfocus synchrotron beamlines. In addition, we demonstrate the application of this chip for femtosecond time-resolved serial crystallography at the Linacmore » Coherent Light Source (LCLS, Menlo Park, California, USA). As a result, the chip concept enables multiple images to be acquired from each crystal, allowing differential detection of changes in diffraction intensities in order to obtain high signal-to-noise and fully exploit the time resolution capabilities of XFELs.« less

  9. CM300DLFinal.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    CM300 Core Status: new users must complete 2 trouble-free training sessions, pass the Core driver's test and execute a sample exchange exam to to work independently during Core sessions. Flex Status: core users must complete 5 trouble-free sessions and pass the FLEX driver's test to work during Flex sessions. To reserve a CM300 session, go to www/ncem.lbl.gov, click on "Microscope Scheduling", use proposal number and password to log in. You may only sign up for 2 sessions per month,

  10. word2pdf43408.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    YOUR BENEFIT PLAN LOS ALAMOS NATIONAL SECURITY, LLC Retiree Voluntary Accidental Death and Dismemberment Plan (ADD) Questions about Your Coverage In the event You have questions regarding any aspect of Your coverage, You should contact Your Employee Benefits Manager or You may write to us at: The Hartford Group Benefits Division, Customer Service P.O. Box 2999 Hartford, CT 06104-2999 Or call Us at: 1-800-523-2233 When calling, please give Us the following information: 1) the policy number; and

  11. Microsoft Word - Technetium.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Investigations to Identify the Soluble, Non-pertechnetate Species in the High-level Nuclear Waste at the Hanford Site Wayne W. Lukens 1 , David K. Shuh 1 , Norman C. Schroeder 2 , Kenneth R. Ashley 3 1 Lawrence Berkeley National Laboratory, Berkeley, CA 2 Los Alamos National Laboratory, Los Alamos, NM 3 Texas A&M University-Commerce, Commerce, TX Technetium ( 99 Tc) is an abundant fission product that presents a number of challenges for the safe, long-term disposal of high-level nuclear

  12. Microsoft Word - U01804.doc

    Office of Legacy Management (LM)

    0400 GJO-2003-422-TAC GJO-GWTUB 30.13.2-2 UMTRA Ground Water Project Tuba City UMTRA Project Site Semi-Annual Performance Evaluation through August 2002 May 2003 Prepared by U.S. Department of Energy Grand Junction Office Grand Junction, Colorado Work Performed Under DOE Contract No. DE-AC13-02GJ79491 This page intentionally left blank Document Number U0180400 Contents DOE/Grand Junction Office Tuba City UMTRA Project Site Semi-Annual Performance Evaluation May 2003 Page iii Contents 1.0

  13. Microsoft Word - U0195900.doc

    Office of Legacy Management (LM)

    Diffusion Multilayer Sampling of Ground Water in Five Wells at the Tuba City, Arizona, Site February 2004 GJO-2004-589-TAC ESL-RPT-2004-02 ESL-RPT-2004-02 U0195900 Office of Legacy Management Diffusion Multilayer Sampling of Ground Water in Five Wells at the Tuba City, Arizona, Site February 2004 Work Performed by S.M. Stoller Corporation under DOE Contract No. DE-AC01-02GJ79491 for the U.S. Department of Energy, Grand Junction, Colorado Document Number U0195900 Contents DOE/Office of Legacy

  14. Microsoft Word - U0197300.doc

    Office of Legacy Management (LM)

    MSE Cores Tuba City, Arizona, Site March 2004 GJO-2004-591-TAC ESL-RPT-2004-03 ESL-RPT-2004-03 U0197300 Office of Legacy Management Analysis of MSE Cores Tuba City, Arizona, Site March 2004 Work Performed by S.M. Stoller Corporation under DOE Contract No. DE-AC01-02GJ79491 for the U.S. Department of Energy Office of Legacy Management, Grand Junction, Colorado Signature Page Document Number U0197300 Analysis of MSE Cores DOE/Office of Legacy Management Page iv March 2004 End of current text

  15. Microsoft Word - U0197800.doc

    Office of Legacy Management (LM)

    Contaminant Rebound in Ground Water in Extraction Wells at the Tuba City, Arizona, Site April 2004 DOE-LM/GJ625-2004 ESL-RPT-2004-04 ESL-RPT-2004-04 U0197800 Analysis of Contaminant Rebound in Ground Water in Extraction Wells at the Tuba City, Arizona, Site April 2004 Work Performed by S.M. Stoller Corporation under DOE Contract No. DE-AC01-02GJ79491 for the U.S. Department of Energy Office of Legacy Management, Grand Junction, Colorado Signature Page Document Number U0197800 Analysis of

  16. Microsoft Word - Factsheet.doc

    National Nuclear Security Administration (NNSA)

    NEVADA DIVISION OF ENVIRONMENTAL PROTECTION FACT SHEET (Pursuant to NAC 445A.236) Permittee Name: United States Air Force (USAF) 99 th CES/CEV 4349 Duffer Drive, Suite 1601 Nellis AFB, NV 89191-7007 Permit Number: NEV20001 Location: Tonopah Test Range (TTR) Wastewater Treatment Facility (WWTF) WWTF is located 32 miles SE of Tonopah, Nye County, Nevada Latitude: 37° 52' 20" N, Longitude: 116° 47' 12" W Township 1S, Range 46E, Section 11 NW ¼ Wellhead Protection Area: The TTR WWTF is

  17. AL2007-02.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    2.doc&#0; AL2007-02.doc&#0; PDF icon AL2007-02.doc&#0; More Documents & Publications Attached is Policy Flash 2013-34 Department of Energy Acquisition Letter 2013-04 on Executive Compensation Acquisition Letter No. AL 2014-07 Policy Flash 2014-29 Acquisition Letter 2014-07 - Benchmark Compensation Amount for Individual Executive Salary Actions

  18. AcqGuide70pt4.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    pt4.doc&#0; AcqGuide70pt4.doc&#0; PDF icon AcqGuide70pt4.doc&#0; More Documents & Publications Chapter 70 - DOE Management and Operating Contracts 2014-02 Acquistion Letter 2014-01: Management and Operating Contractors' Audit Coverage of Cost-Reimbursement Subcontracts Acquisition Letter No. AL 2014-01

  19. Microsoft Word - AL2005-13.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    3.doc Microsoft Word - AL2005-13.doc PDF icon Microsoft Word - AL2005-13.doc More Documents & Publications PBA2007 Presentation-short-6-19-07DOE&#0; Accident Investigation of the February 7, 2013, Scissor Lift Accident in the West Hackberry Brine Tank-14 Resulting in Injury, Strategic Petroleum Reserve West Hackberry, LA Microsoft Word - AcqGuide37pt1 binney Nov 2010

  20. Microsoft Word - table_20.doc

    Gasoline and Diesel Fuel Update (EIA)

    8 Table 20. Number of natural gas residential consumers by type of service and state, 2013-2014 Alabama 765,957 0 765,957 769,418 0 769,418 Alaska 124,411 0 124,411 126,416 0 126,416 Arizona 1,171,997 6 1,172,003 1,186,788 6 1,186,794 Arkansas R 549,764 0 R 549,764 549,034 0 549,034 California 10,471,814 283,094 10,754,908 10,372,973 408,747 10,781,720 Colorado 1,672,307 5 1,672,312 1,690,576 5 1,690,581 Connecticut 512,110 1,382 513,492 521,460 1,198 522,658 Delaware 155,627 0 155,627 158,502 0

  1. Microsoft Word - table_22.doc

    Gasoline and Diesel Fuel Update (EIA)

    0 Table 22. Number of natural gas industrial consumers by type of service and state, 2013-2014 Alabama 2,876 267 3,143 2,973 271 3,244 Alaska 2 1 3 1 0 1 Arizona 257 126 383 256 130 386 Arkansas 513 507 1,020 531 478 1,009 California 32,662 5,334 37,996 32,266 5,282 37,548 Colorado 946 6,347 7,293 986 6,837 7,823 Connecticut 3,360 1,094 4,454 3,340 877 4,217 Delaware 28 110 138 28 113 141 Florida 166 362 528 165 355 520 Georgia 984 1,258 2,242 887 1,594 2,481 Hawaii 22 0 22 23 0 23 Idaho 109 R

  2. Enter the Post-Doc: The Untapped Sourcing Pipeline

    SciTech Connect (OSTI)

    Boscow, Ryan B.

    2011-07-30

    This article addresses the potential formulation and utilization of an industry-based Post-Doc program in order to create workforce candidate pipelines with targeted universities.

  3. Microsoft Word - DOE_Staffing_Study_Cover.doc | Department of...

    Office of Environmental Management (EM)

    Word - DOEStaffingStudyCover.doc More Documents & Publications 2010 DOE Strategic Sustainability Performance Plan - Report to the White House Council on Environmental...

  4. Doc Cambell's Post Greenhouse Low Temperature Geothermal Facility...

    Open Energy Info (EERE)

    Low Temperature Geothermal Facility Facility Doc Cambell's Post Sector Geothermal energy Type Greenhouse Location Las Cruces, New Mexico Coordinates 32.3123157,...

  5. DOC-DOE China Mission Announcement Press Release | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Press Release More Documents & Publications DOC-DOE Joint China Mission Statement China 2015 Business Development Mission Marketing Flyer DOE-LPOEmail-Update001Through11

  6. pocforms06a0399.doc | Department of Energy

    Broader source: Energy.gov (indexed) [DOE]

    More Documents & Publications fleetappforms04f1298.doc&0; OPC Security Whitepaper 3Hardening Guidelines for OPC Hosts Critical Decision 2 (CD-2) Approval Template...

  7. Microsoft Word - S05767_PostClosureInspRpt.doc

    Office of Legacy Management (LM)

    09 Doc. No. S05767 Page A-1 Post-Closure Inspection & Monitoring Report for CAU 417 U.S. Department of Energy Doc. No. S05767 October 2009 Page A-2 U.S. Department of Energy Post-Closure Inspection & Monitoring Report for CAU 417 October 2009 Doc. No. S05767 Page A-3 Post-Closure Inspection & Monitoring Report for CAU 417 U.S. Department of Energy Doc. No. S05767 October 2009 Page A-4 U.S. Department of Energy Post-Closure Inspection & Monitoring Report for CAU 417 October 2009

  8. Microsoft Word - S05827_WCR_Final.doc

    Office of Legacy Management (LM)

    Response to Comments This page intentionally left blank U.S. Department of Energy Well Completion Report for CAU 443 CNTA December 2009 Doc. No. S05827 Page G-1 Well Completion Report for CAU 443 CNTA U.S. Department of Energy Doc. No. S05827 December 2009 Page G-2 U.S. Department of Energy Well Completion Report for CAU 443 CNTA December 2009 Doc. No. S05827 Page G-3 Well Completion Report for CAU 443 CNTA U.S. Department of Energy Doc. No. S05827 December 2009 Page G-4

  9. Microsoft Word - S0130700_Mar 2008Rev June 2008.doc

    Office of Legacy Management (LM)

    NRC Concurrence with Completion of Remedial Action This page intentionally left blank U.S. Department of Energy LTSP for the Falls City, Texas, Disposal Site March 2008 Doc. No. S0130700 Page A-3 LTSP for the Falls City, Texas, Disposal Site U.S. Department of Energy Doc. No. S0130700 March 2008 Page A-4 U.S. Department of Energy LTSP for the Falls City, Texas, Disposal Site March 2008 Doc. No. S0130700 Page A-5 LTSP for the Falls City, Texas, Disposal Site U.S. Department of Energy Doc. No.

  10. Microsoft Word - S0130700_Mar 2008Rev June 2008.doc

    Office of Legacy Management (LM)

    Real Estate Documentation This page intentionally left blank U.S. Department of Energy LTSP for the Falls City, Texas, Disposal Site March 2008 Doc. No. S0130700 Page B-3 LTSP for the Falls City, Texas, Disposal Site U.S. Department of Energy Doc. No. S0130700 March 2008 Page B-4 U.S. Department of Energy LTSP for the Falls City, Texas, Disposal Site March 2008 Doc. No. S0130700 Page B-5 LTSP for the Falls City, Texas, Disposal Site U.S. Department of Energy Doc. No. S0130700 March 2008 Page B-6

  11. Microsoft Word - S0130700_Mar 2008Rev June 2008.doc

    Office of Legacy Management (LM)

    NRC Technical Evaluation Report on Revised LTSP This page intentionally left blank U.S. Department of Energy LTSP for the Falls City, Texas, Disposal Site March 2008 Doc. No. S0130700 Page D-3 LTSP for the Falls City, Texas, Disposal Site U.S. Department of Energy Doc. No. S0130700 March 2008 Page D-4 U.S. Department of Energy LTSP for the Falls City, Texas, Disposal Site March 2008 Doc. No. S0130700 Page D-5 LTSP for the Falls City, Texas, Disposal Site U.S. Department of Energy Doc. No.

  12. Microsoft Word - S0130700_Mar 2008Rev June 2008.doc

    Office of Legacy Management (LM)

    Agency Notification Agreements This page intentionally left blank U.S. Department of Energy LTSP for the Falls City, Texas, Disposal Site March 2008 Doc. No. S0130700 Page E-3 LTSP for the Falls City, Texas, Disposal Site U.S. Department of Energy Doc. No. S0130700 March 2008 Page E-4 U.S. Department of Energy LTSP for the Falls City, Texas, Disposal Site March 2008 Doc. No. S0130700 Page E-5 LTSP for the Falls City, Texas, Disposal Site U.S. Department of Energy Doc. No. S0130700 March 2008

  13. Microsoft Word - FFATA Memo 30 March 2007.doc | Department of...

    Broader source: Energy.gov (indexed) [DOE]

    FFATA Memo 30 March 2007.doc More Documents & Publications Policy Flash 2014-35 Rescission of American Recovery and Reinvestment Act Reporting Requirements. Flash2008-44attachment....

  14. Microsoft Word - AL-ARRAGAODeviation 6.12.09.doc | Department...

    Energy Savers [EERE]

    ARRAGAODeviation 6.12.09.doc Microsoft Word - AL-ARRAGAODeviation 6.12.09.doc Microsoft Word - AL-ARRAGAODeviation 6.12.09.doc More Documents & Publications Microsoft Word -...

  15. Microsoft Word - Flash2009dashxxFAC34.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Flash2009dashxxFAC34.doc Microsoft Word - Flash2009dashxxFAC34.doc Microsoft Word - Flash2009dashxxFAC34.doc More Documents & Publications Federal Acquisition Regulation; Federal...

  16. Microsoft Word - Flash2008-08attachmentFAC22.doc | Department...

    Energy Savers [EERE]

    Flash2008-08attachmentFAC22.doc Microsoft Word - Flash2008-08attachmentFAC22.doc Microsoft Word - Flash2008-08attachmentFAC22.doc More Documents & Publications Policy Flash 2013-75...

  17. Microsoft Word - Flash2007-61FACAttachment.doc | Department of...

    Energy Savers [EERE]

    Flash2007-61FACAttachment.doc Microsoft Word - Flash2007-61FACAttachment.doc Microsoft Word - Flash2007-61FACAttachment.doc More Documents & Publications Microsoft Word -...

  18. Microsoft Word - PolicyFlash2007-10Attch2.doc | Department of...

    Energy Savers [EERE]

    PolicyFlash2007-10Attch2.doc Microsoft Word - PolicyFlash2007-10Attch2.doc Microsoft Word - PolicyFlash2007-10Attch2.doc More Documents & Publications Policy Flash 2013-37 Federal...

  19. Microsoft Word - Policy Flash 2008-02.doc | Department of Energy

    Energy Savers [EERE]

    Microsoft Word - Policy Flash 2008-02.doc Microsoft Word - Policy Flash 2008-02.doc More Documents & Publications Microsoft Word - Policy Flash 2008-07.doc Microsoft Word - Policy...

  20. Microsoft Word - Policy Flash 2008-03.doc | Department of Energy

    Energy Savers [EERE]

    Microsoft Word - Policy Flash 2008-03.doc Microsoft Word - Policy Flash 2008-03.doc More Documents & Publications Microsoft Word - Policy Flash 2008-07.doc Microsoft Word - Policy...

  1. Microsoft Word - ARRAGuideAttachment10v1.doc | Department of Energy

    Office of Environmental Management (EM)

    ARRAGuideAttachment10v1.doc Microsoft Word - ARRAGuideAttachment10v1.doc More Documents & Publications Microsoft Word - ARRAAttachment12v1.doc Microsoft Word - DRAFT CRB Interview Guidance

  2. Microsoft Word - table_05.doc

    Gasoline and Diesel Fuel Update (EIA)

    3 Table 5. Number of producing gas wells by state and the Gulf of Mexico, December 31, 2010-2014 Alabama 7,026 7,063 6,327 R 6,165 6,118 Alaska 269 277 185 R 159 170 Arizona 5 5 5 5 5 Arkansas 7,397 8,388 8,538 R 9,843 10,150 California 1,580 1,308 1,423 R 1,335 1,118 Colorado 28,813 30,101 32,000 R 32,468 38,346 Gulf of Mexico 1,852 1,559 1,474 R 1,146 1,400 Illinois 50 40 40 R 34 36 Indiana 620 914 819 R 921 895 Kansas 22,145 25,758 24,697 R 23,792 24,354 Kentucky 17,670 14,632 17,936 R 19,494

  3. DOE HR Guidebook 12_15_05.DOC | Department of Energy

    Office of Environmental Management (EM)

    DOE HR Guidebook 12_15_05.DOC&#0; DOE HR Guidebook 12_15_05.DOC&#0; PDF icon DOE HR Guidebook 12_15_05.DOC&#0; More Documents & Publications Operating Guidelines Appendix A B.DOC&#0; 2 Jun 03 Roles and Responsibilities _CSO Highlighted_.doc&#0; Operating Guidelines Appendix C D.DOC&#0;

  4. Serial femtosecond X-ray diffraction of enveloped virus microcrystals

    DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

    Lawrence, Robert M.; Conrad, Chelsie E.; Zatsepin, Nadia A.; Grant, Thomas D.; Liu, Haiguang; James, Daniel; Nelson, Garrett; Subramanian, Ganesh; Aquila, Andrew; Hunter, Mark S.; et al

    2015-08-20

    Serial femtosecond crystallography (SFX) using X-ray free-electron lasers has produced high-resolution, room temperature, time-resolved protein structures. We report preliminary SFX of Sindbis virus, an enveloped icosahedral RNA virus with ~700 Å diameter. Microcrystals delivered in viscous agarose medium diffracted to ~40 Å resolution. Small-angle diffuse X-ray scattering overlaid Bragg peaks and analysis suggests this results from molecular transforms of individual particles. Viral proteins undergo structural changes during entry and infection, which could, in principle, be studied with SFX. This is a pertinent step toward determining room temperature structures from virus microcrystals that may enable time-resolved studies of enveloped viruses.

  5. Serial femtosecond X-ray diffraction of enveloped virus microcrystals

    SciTech Connect (OSTI)

    Lawrence, Robert M.; Conrad, Chelsie E.; Zatsepin, Nadia A.; Grant, Thomas D.; Liu, Haiguang; James, Daniel; Nelson, Garrett; Subramanian, Ganesh; Aquila, Andrew; Hunter, Mark S.; Liang, Mengning; Boutet, Sbastien; Coe, Jesse; Spence, John C. H.; Weierstall, Uwe; Liu, Wei; Fromme, Petra; Cherezov, Vadim; Hogue, Brenda G.

    2015-08-20

    Serial femtosecond crystallography (SFX) using X-ray free-electron lasers has produced high-resolution, room temperature, time-resolved protein structures. We report preliminary SFX of Sindbis virus, an enveloped icosahedral RNA virus with ~700 diameter. Microcrystals delivered in viscous agarose medium diffracted to ~40 resolution. Small-angle diffuse X-ray scattering overlaid Bragg peaks and analysis suggests this results from molecular transforms of individual particles. Viral proteins undergo structural changes during entry and infection, which could, in principle, be studied with SFX. This is a pertinent step toward determining room temperature structures from virus microcrystals that may enable time-resolved studies of enveloped viruses.

  6. Hi-speed versatile serial crate controller for CAMAC

    SciTech Connect (OSTI)

    Horelick, D.

    1984-10-01

    A serial crate controller, primarily for use in the SLC CAMAC control system, has been designed, and has been in use for about 2 years. The design supports a party line approach, with up to 16 crates on a single twisted pair for data transfers, plus another pair for prompt L response. The bit rate is 5 megabits/s, and complete transaction times of about 10 ..mu..s are achieved for 16-bit data transfers over cables up to 1000 feet long. One of the primary objects of the design was simplicity - there are approximately 60 chips in the two-board unit.

  7. Microsoft Word - US_Japan_REE_agenda_ver7.doc | Department of...

    Office of Environmental Management (EM)

    Microsoft Word - USJapanREEagendaver7.doc Microsoft Word - USJapanREEagendaver7.doc U.S. - Japan Roundtable on Rare Earth Elements Research PDF icon Microsoft Word -...

  8. OP-PR-0015.001.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    OP-PR-0015.001.doc Begin Shutdown Date: 2000/12/08 To eliminate the possibility of going into a state of operations when people may be working on ladders or in the ring, the following SOP's are required of every shutdown. A shutdown is defined as a period wherein there are no accelerator operations. This procedure is in effect for all scheduled shutdowns and for non-scheduled shutdowns lasting more than 24 hours. 1. The accelerator staff must inform the CAMD staff of a shutdown via e-mail. In

  9. Microsoft Word - S0131700_NOV04.doc

    Office of Legacy Management (LM)

    S0131700 DOE-LM/GJ757-2004 Office of Legacy Management Monument Valley Ground Water Remediation: Pilot Study Work Plan November 2004 Work Performed by S.M. Stoller Corporation under DOE Contract No. DE-AC01-02GJ79491 for the U.S. Department of Energy, Office of Legacy Management, Grand Junction, Colorado This page intentionally left blank U.S. Department of Energy Monument Valley GW Remediation Pilot Study Work Plan November 2004 Doc. No. S0131700 Page 3 Signature Page Authors: J. Waugh, S.

  10. Microsoft Word - S03273_Rev1.doc

    Office of Legacy Management (LM)

    Surface, Hot Creek Valley, Nevada, for Calendar Year 2007 September 2008 Rev. 1 DOE-LM/1558-2007 This page intentionally left blank DOE-LM/1558-2008 Post-Closure Inspection and Monitoring Report for Corrective Action Unit 417: Central Nevada Test Area Surface, Hot Creek Valley, Nevada for Calendar Year 2007 September 2008 Rev. 1 This page intentionally left blank U.S. Department of Energy CY 2007 Post-Closure Inspection & Monitoring Report for CAU 417 September 2008, Rev. 1 Doc. No. S0327300

  11. Microsoft Word - S05069_ROD.doc

    Office of Legacy Management (LM)

    Record of Decision for DOE Areas at the Laboratory for Energy-Related Health Research University of California, Davis September 2009 LMS/LEH/S05069 This page intentionally left blank LMS/LEH/S05069 Record of Decision for DOE Areas at the Laboratory for Energy-Related Health Research University of California, Davis September 2009 This page intentionally left blank U.S. Department of Energy ROD for DOE Areas for LEHR September 2009 Doc. No. S05069, Rev. 0 Page i Contents Acronyms and Abbreviations

  12. Microsoft Word - S06713_SER.doc

    Office of Legacy Management (LM)

    09 August 2010 LMS/WEL/S06713 LMS/WEL/S06713 ENERGY Legacy Management U.S. DEPARTMENT OF U.S. Department of Energy Office of Legacy Management This page intentionally left blank LMS/WEL/S06713 U.S. Department of Energy Office of Legacy Management Weldon Spring Site Environmental Report for Calendar Year 2009 August 2010 This page intentionally left blank U.S. Department of Energy Weldon Spring Site Environmental Report for Calendar Year 2009 August 2010 Doc. No. S06713 Page i Contents

  13. Microsoft Word - U0194500July2005.doc

    Office of Legacy Management (LM)

    4500 GJO-2004-579-TAC Office of Legacy Management Refinement of Conceptual Model and Recommendations for Improving Remediation Efficiency at the Shiprock, New Mexico, Site July 2005 Work Performed by S.M. Stoller Corporation under DOE Contract No. DE-AC01-02GJ79491 for the U.S. Department of Energy Office of Legacy Management, Grand Junction, Colorado This page intentionally left blank U.S. Department of Energy Conceptual Model Refinement and Efficiency Recommendations July 2005 Doc. No.

  14. Microsoft Word - S06401_IC.doc

    Office of Legacy Management (LM)

    Annual Assessment Checklists For Parcels D, H, 4, and 3 and Phase I Land Parcel (Physical Walkover Conducted on April 14, 2009) This page intentionally left blank CHECKLIST WORKSHEET - COMBINED - ALL PARCELS Review of Effectiveness of Institutional Controls U.S. Department of Energy Annual Assessment of the Effectiveness of Site-Wide Institutional Controls June 2010 Doc. No. S06401 Page A-1 Parcels reviewed: D, H, 3, 4, 6, 7, 8, and Phase I (A, B, and C) Preliminary inspections performed on:

  15. Microsoft Word - S06401_IC.doc

    Office of Legacy Management (LM)

    Effectiveness of Site-Wide Institutional Controls Applied to the Former DOE Mound Site Property June 2010 LMS/MND/S06401 This page intentionally left blank LMS/MND/S06401 Annual Assessment of the Effectiveness of Site-Wide Institutional Controls Applied to the Former DOE Mound Site Property June 2010 This page intentionally left blank U.S. Department of Energy Annual Assessment of the Effectiveness of Site-Wide Institutional Controls June 2010 Doc. No. S06401 Page i Contents

  16. energyefficiencyink12schoolsandstateapplications.doc | Department of Energy

    Broader source: Energy.gov (indexed) [DOE]

    energyefficiencyink12schoolsandstateapplications.doc Microsoft Office document icon energyefficiencyink12schoolsandstateapplications.doc More Documents & Publications Energy Efficiency in K-12 Schools & State Applications CERTIFICATE OF AUTHENTICITY Successful Partnerships and Lessons from the Field, Part 1, Webinar Transcript

  17. Serially connected solid oxide fuel cells having monolithic cores

    DOE Patents [OSTI]

    Herceg, Joseph E. (Naperville, IL)

    1987-01-01

    A solid oxide fuel cell for electrochemically combining fuel and oxidant for generating galvanic output, wherein the cell core has an array of cell segments electrically serially connected in the flow direction, each segment consisting of electrolyte walls and interconnect that are substantially devoid of any composite inert materials for support. Instead, the core is monolithic, where each electrolyte wall consists of thin layers of cathode and anode materials sandwiching a thin layer of electrolyte material therebetween. Means direct the fuel to the anode-exposed core passageways and means direct the oxidant to the cathode-exposed core passageways; and means also direct the galvanic output to an exterior circuit. Each layer of the electrolyte composite materials is of the order of 0.002-0.01 cm thick; and each layer of the cathode and anode materials is of the order of 0.002-0.05 cm thick. Between 2 and 50 cell segments may be connected in series.

  18. Serial femtosecond crystallography of soluble proteins in lipidic cubic phase

    DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

    Fromme, Raimund; Ishchenko, Andrii; Metz, Markus; Chowdhury, Shatabdi Roy; Basu, Shibom; Boutet, Sébastien; Fromme, Petra; White, Thomas A.; Barty, Anton; Spence, John C. H.; et al

    2015-08-04

    Serial femtosecond crystallography (SFX) at X-ray free-electron lasers (XFELs) enables high-resolution protein structure determination using micrometre-sized crystals at room temperature with minimal effects from radiation damage. SFX requires a steady supply of microcrystals intersecting the XFEL beam at random orientations. An LCP–SFX method has recently been introduced in which microcrystals of membrane proteins are grown and delivered for SFX data collection inside a gel-like membrane-mimetic matrix, known as lipidic cubic phase (LCP), using a special LCP microextrusion injector. Here, it is shown enabling a dramatic reduction in the amount of crystallized protein required for data collection compared with crystals deliveredmore » by liquid injectors. High-quality LCP–SFX data sets were collected for two soluble proteins, lysozyme and phycocyanin, using less than 0.1 mg of each protein.« less

  19. Microsoft Word - TSLCC 2007_5_05_08 rev 1.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    TSLCC 2007_5_05_08 rev 1.doc Microsoft Word - TSLCC 2007_5_05_08 rev 1.doc PDF icon Microsoft Word - TSLCC 2007_5_05_08 rev 1.doc More Documents & Publications FY 2007 Total System Life Cycle Cost, Pub 2008 Microsoft Word - TSLCC 2007_5_05_08 rev 1.doc FY 2007 Fee Adequacy, Pub 2008

  20. AcqGuideChapter39pt2.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AcqGuideChapter39pt2.doc&#0; AcqGuideChapter39pt2.doc&#0; PDF icon AcqGuideChapter39pt2.doc&#0; More Documents & Publications Chapter 39 - Acquisition of Information Technology Department of Energy (DOE) Acquisition Guide Microsoft Word - AL2006-08.doc

  1. Microsoft Word - ALonEO13423Last.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ALonEO13423Last.doc Microsoft Word - ALonEO13423Last.doc PDF icon Microsoft Word - ALonEO13423Last.doc More Documents & Publications Microsoft Word - AL2008-05.doc Tri-Party Agreement for Energy Savings Performance Contracts Photovoltaics at DOE's National Renewable Energy Laboratory License

  2. Microsoft Word - FAL2003-03R.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    3-03R.doc Microsoft Word - FAL2003-03R.doc PDF icon Microsoft Word - FAL2003-03R.doc More Documents & Publications Microsoft Word - FAL2003-03Rattach.doc FAL2003-03Attachment.pdf FAL2003-03.pdf

  3. Microsoft Word - FY08AnnualReport.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    FY08AnnualReport.doc Microsoft Word - FY08AnnualReport.doc PDF icon Microsoft Word - FY08AnnualReport.doc More Documents & Publications Microsoft Word - FY09AnnualReportv1.doc Audit Report: IG-0857 Audit Report: OAS-M-13-07

  4. Energy Savings Performance Contracting-Savings Measurement and Verification Transcript 2-24-2011.doc

    Broader source: Energy.gov [DOE]

    Energy Savings Performance Contracting-Savings Measurement and Verification Transcript 2-24-2011.doc

  5. Community Development Finance Institutions-Opportunities for Partnerships with Energy Efficiency Programs Transcript.doc

    Office of Energy Efficiency and Renewable Energy (EERE)

    Community Development Finance Institutions-Opportunities for Partnerships with Energy Efficiency Programs Transcript.doc

  6. Microsoft Word - PPL 970-Materials and Inventory 5-9-05.doc | Department of

    Office of Environmental Management (EM)

    Energy PPL 970-Materials and Inventory 5-9-05.doc Microsoft Word - PPL 970-Materials and Inventory 5-9-05.doc PDF icon Microsoft Word - PPL 970-Materials and Inventory 5-9-05.doc More Documents & Publications Microsoft Word - al95-06.doc DOE-HDBK-1139-2006 ppl970-3.pdf

  7. Microsoft Word - 1_2011_CEG_Update_v2.doc | Department of Energy

    Office of Environmental Management (EM)

    1_2011_CEG_Update_v2.doc Microsoft Word - 1_2011_CEG_Update_v2.doc PDF icon Microsoft Word - 1_2011_CEG_Update_v2.doc More Documents & Publications OPAM Policy Acquisition Guides Microsoft Word - AL2006-07.doc IT Project Management Profile

  8. Microsoft Word - GC Mediation Evaluation _2-06-09_.doc | Department of

    Office of Environmental Management (EM)

    Energy GC Mediation Evaluation _2-06-09_.doc Microsoft Word - GC Mediation Evaluation _2-06-09_.doc PDF icon Microsoft Word - GC Mediation Evaluation _2-06-09_.doc More Documents & Publications Mediation Survey Form Microsoft Word - ARRAAttachment12v1.doc Microsoft Word - DRAFT CRB Interview Guidance

  9. Microsoft Word - S05767_PostClosureInspRpt.doc

    Office of Legacy Management (LM)

    NDEP Correspondence and Record of Review This page intentionally left blank U.S. Department of Energy Post-Closure Inspection & Monitoring Report for CAU 417 October 2009 Doc. No. S05767 Page D-1 Post-Closure Inspection & Monitoring Report for CAU 417 U.S. Department of Energy Doc. No. S05767 October 2009 Page D-2 U.S. Department of Energy Post-Closure Inspection & Monitoring Report for CAU 417 October 2009 Doc. No. S05767 Page D-3 Due Date 12-23-09 Review No. 1 Project Offsites -

  10. Microsoft Word - Appendix M_ContingencyTrees.doc

    Office of Legacy Management (LM)

    M Groundwater Operable Unit Contingency Trees U.S. Department of Energy Weldon Spring Site LTS&M Plan July 2005 Doc. No. S0079000 Page M-3 Figure M-1. Validation and Statistical Evaluation Scheme Weldon Spring Site LTS&M Plan U.S. Department of Energy Doc. No. S0079000 July 2005 Page M-4 Figure M-2. Decision Tree for Objective 1 Data U.S. Department of Energy Weldon Spring Site LTS&M Plan July 2005 Doc. No. S0079000 Page M-5 Figure M-3. Decision Tree for Objective 2 Data Weldon

  11. Microsoft Word - AcqGuide70pt31A.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AcqGuide70pt31A.doc Microsoft Word - AcqGuide70pt31A.doc PDF icon Microsoft Word - AcqGuide70pt31A.doc More Documents & Publications AcqGuide70pt31.doc&#0; Policy Flash 2014-26 Acquisition Guide Chapter 70.31A - Costs Associated with Whistleblower Actions Microsoft Word - AcqGuide70pt31B.doc

  12. Microsoft Word - NationalPolicyAssurancesAwardTermsFinal81804.doc |

    Office of Environmental Management (EM)

    Department of Energy NationalPolicyAssurancesAwardTermsFinal81804.doc Microsoft Word - NationalPolicyAssurancesAwardTermsFinal81804.doc PDF icon Microsoft Word - NationalPolicyAssurancesAwardTermsFinal81804.doc More Documents & Publications Microsoft Word - National Policy AssurancesAwardTermsREVJuly2005.doc National Policy Assurances to be Incorporated as Award Terms Microsoft Word - NationalPolicyAssurances5-06.doc

  13. Microsoft Word - S08266_App_A-3.doc

    Office of Legacy Management (LM)

    Score 0 Fernald Preserve, Ohio, Wetland Mitigation Monitoring Report U.S. Department of Energy Doc. No. S08266 Appendix A-3, 2011 Amphibian Index of Biotic Integrity Data...

  14. Microsoft Word - ex15-ITER-sept10.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    - ITER UT-B Contracts Div Sept 2010 Page 1 of 1 ex15-ITER-sept10.doc Exhibit 15-ITER Ref: FAR 52.227-17 RIGHTS IN DATA SPECIAL WORKS ITER (Sept 2010) (a) Definitions. (1)...

  15. Petascale Post-Doc Project a Supercomputing Success Story

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Petascale Post-Doc Project a Supercomputing Success Story Petascale Post-Doc Project a Supercomputing Success Story ARRA-funded program takes petascale computing researchers to the next level March 24, 2014 Contact: Kathy Kincade, +1 510 495 2124, kkincade@lbl.gov petascalepostdocs.jpg From left: Jihan Kim, Filipe Maia, Alice Koniges, Robert Preissl, Brian Austin, Wangyi (Bobby) Liu , Kirsten Fagnan and Praveen Narayanan. The first post-doctoral research project centered at the Department of

  16. Experimental Evaluation of DOC Performance Using Secondary Fuel Injection |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy Evaluation of DOC Performance Using Secondary Fuel Injection Experimental Evaluation of DOC Performance Using Secondary Fuel Injection Poster presentation at the 2007 Diesel Engine-Efficiency & Emissions Research Conference (DEER 2007). 13-16 August, 2007, Detroit, Michigan. Sponsored by the U.S. Department of Energy's (DOE) Office of FreedomCAR and Vehicle Technologies (OFCVT). PDF icon deer07_Yetkin.pdf More Documents & Publications Engine Tests of an Active PM

  17. Design Potential of Metal Foil Substrates for Optimized DOC Performance |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy Potential of Metal Foil Substrates for Optimized DOC Performance Design Potential of Metal Foil Substrates for Optimized DOC Performance Poster presentation at the 2007 Diesel Engine-Efficiency & Emissions Research Conference (DEER 2007). 13-16 August, 2007, Detroit, Michigan. Sponsored by the U.S. Department of Energy's (DOE) Office of FreedomCAR and Vehicle Technologies (OFCVT). PDF icon deer07_rice.pdf More Documents & Publications Components for Optimized SCR

  18. Serially connected solid oxide fuel cells having monolithic cores

    DOE Patents [OSTI]

    Herceg, J.E.

    1985-05-20

    Disclosed is a solid oxide fuel cell for electrochemically combining fuel and oxidant for generating galvanic output. The cell core has an array of cell segments electrically serially connected in the flow direction, each segment consisting of electrolyte walls and interconnect that are substantially devoid of any composite inert materials for support. Instead, the core is monolithic, where each electrolyte wall consists of thin layers of cathode and anode materials sandwiching a thin layer of electrolyte material therebetween. Means direct the fuel to the anode-exposed core passageways and means direct the oxidant to the cathode-exposed core passageways; and means also direct the galvanic output to an exterior circuit. Each layer of the electrolyte composite materials is of the order of 0.002 to 0.01 cm thick; and each layer of the cathode and anode materials is of the order of 0.002 to 0.05 cm thick. Between 2 and 50 cell segments may be connected in series.

  19. A novel inert crystal delivery medium for serial femtosecond crystallography

    SciTech Connect (OSTI)

    Conrad, Chelsie E.; Basu, Shibom; James, Daniel; Wang, Dingjie; Schaffer, Alexander; Roy-Chowdhury, Shatabdi; Zatsepin, Nadia A.; Aquila, Andrew; Coe, Jesse; Gati, Cornelius; Hunter, Mark S.; Koglin, Jason E.; Kupitz, Christopher; Nelson, Garrett; Subramanian, Ganesh; White, Thomas A.; Zhao, Yun; Zook, James; Boutet, Sbastien; Cherezov, Vadim; Spence, John C. H.; Fromme, Raimund; Weierstall, Uwe; Fromme, Petra

    2015-06-30

    Serial femtosecond crystallography (SFX) has opened a new era in crystallography by permitting nearly damage-free, room-temperature structure determination of challenging proteins such as membrane proteins. In SFX, femtosecond X-ray free-electron laser pulses produce diffraction snapshots from nanocrystals and microcrystals delivered in a liquid jet, which leads to high protein consumption. A slow-moving stream of agarose has been developed as a new crystal delivery medium for SFX. It has low background scattering, is compatible with both soluble and membrane proteins, and can deliver the protein crystals at a wide range of temperatures down to 4C. Using this crystal-laden agarose stream, the structure of a multi-subunit complex, phycocyanin, was solved to 2.5 resolution using 300 g of microcrystals embedded into the agarose medium post-crystallization. The agarose delivery method reduces protein consumption by at least 100-fold and has the potential to be used for a diverse population of proteins, including membrane protein complexes.

  20. A novel inert crystal delivery medium for serial femtosecond crystallography

    DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

    Conrad, Chelsie E.; Basu, Shibom; James, Daniel; Wang, Dingjie; Schaffer, Alexander; Roy-Chowdhury, Shatabdi; Zatsepin, Nadia A.; Aquila, Andrew; Coe, Jesse; Gati, Cornelius; et al

    2015-06-30

    Serial femtosecond crystallography (SFX) has opened a new era in crystallography by permitting nearly damage-free, room-temperature structure determination of challenging proteins such as membrane proteins. In SFX, femtosecond X-ray free-electron laser pulses produce diffraction snapshots from nanocrystals and microcrystals delivered in a liquid jet, which leads to high protein consumption. A slow-moving stream of agarose has been developed as a new crystal delivery medium for SFX. It has low background scattering, is compatible with both soluble and membrane proteins, and can deliver the protein crystals at a wide range of temperatures down to 4°C. Using this crystal-laden agarose stream, themore » structure of a multi-subunit complex, phycocyanin, was solved to 2.5 Å resolution using 300 µg of microcrystals embedded into the agarose medium post-crystallization. The agarose delivery method reduces protein consumption by at least 100-fold and has the potential to be used for a diverse population of proteins, including membrane protein complexes.« less

  1. Property:NEPA FundingAgencyDocNumber | Open Energy Information

    Open Energy Info (EERE)

    + DOEEA-1676 + N NV-020-03-26 + DE-PS07-02ID14264 + O One Nevada + NA + S Sigurd Red Butte No2 + NA + Retrieved from "http:en.openei.orgwindex.php?titleProperty:NEPAF...

  2. Microsoft Word - frm-1901rev1.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Form FRM-1901 ASBESTIFORM SHIPMENT NOTIFICATION Fax to (702) 295-1153 02/14/08 Rev. 01 Page 1 of 1 The generator signed below shall submit this notification to NNSA/NSO at least seven days in advance of arrival of shipment of Asbestiform low-level waste to the Area 5 Radioactive Waste Management Site (RWMS). Generator: Generator Address: Generator Telephone Number: Fax Number: Transporter Name: Transporter Address: Transporter Telephone Number: Fax Number: Waste Stream Identification Number:

  3. NV-020-08-CX-65 | Open Energy Information

    Open Energy Info (EERE)

    Document Date 20080911 Relevant Numbers Lead Agency Doc Number NV-020-08-CX-65 Serial Number NVN-085777 CX Authorization 516 DM 11.9 Proposed Action Ormat Nevada has...

  4. USDA-FS-EA-NV-030-06-025 2007 | Open Energy Information

    Open Energy Info (EERE)

    Document Date 20070417 Relevant Numbers Lead Agency Doc Number EA-NV-030-06-025 Serial Number NVN-088208 Proposed Action See US Department of Agriculture Forest Service...

  5. USDA-FS-EA-NV-030-06-025 2012 | Open Energy Information

    Open Energy Info (EERE)

    Document Date 20120216 Relevant Numbers Lead Agency Doc Number EA-NV-030-06-025 Serial Number NVN-088208 Proposed Action See US Department of Agriculture Forest Service...

  6. Automated matching and segmentation of lymphoma on serial CT examinations

    SciTech Connect (OSTI)

    Yan Jiayong; Zhao Binsheng; Curran, Sean; Zelenetz, Andrew; Schwartz, Lawrence H.

    2007-01-15

    In patients with lymphoma, identification and quantification of the tumor extent on serial CT examinations is critical for assessing tumor response to therapy. In this paper, we present a computer method to automatically match and segment lymphomas in follow-up CT images. The method requires that target lymph nodes in baseline CT images be known. A fast, approximate alignment technique along the x, y, and axial directions is developed to provide a good initial condition for the subsequent fast free form deformation (FFD) registration of the baseline and the follow-up images. As a result of the registration, the deformed lymph node contours from the baseline images are used to automatically determine internal and external markers for the marker-controlled watershed segmentation performed in the follow-up images. We applied this automated registration and segmentation method retrospectively to 29 lymph nodes in 9 lymphoma patients treated in a clinical trial at our cancer center. A radiologist independently delineated all lymph nodes on all slices in the follow-up images and his manual contours served as the ''gold standard'' for evaluation of the method. Preliminary results showed that 26/29 (89.7%) lymph nodes were correctly matched; i.e., there was a geometrical overlap between the deformed lymph node from the baseline and its corresponding mass in the follow-up images. Of the matched 26 lymph nodes, 22 (84.6%) were successfully segmented; for these 22 lymph nodes, several metrics were calculated to quantify the method's performance. Among them, the average distance and the Hausdorff distance between the contours generated by the computer and those generated by the radiologist were 0.9 mm (stdev. 0.4 mm) and 3.9 mm (stdev. 2.1 mm), respectively.

  7. Fixed target matrix for femtosecond time-resolved and in situ serial micro-crystallography

    SciTech Connect (OSTI)

    Mueller, C.; Marx, A.; Epp, S. W.; Zhong, Y.; Kuo, A.; Balo, A. R.; Soman, J.; Schotte, F.; Lemke, H. T.; Owen, R. L.; Pai, E. F.; Pearson, A. R.; Olson, J. S.; Anfinrud, P. A.; Ernst, O. P.; Miller, R. J. Dwayne

    2015-08-18

    We present a crystallography chip enabling in situ room temperature crystallography at microfocus synchrotron beamlines and X-ray free-electron laser (X-FEL) sources. Compared to other in situ approaches, we observe extremely low background and high diffraction data quality. The chip design is robust and allows fast and efficient loading of thousands of small crystals. The ability to load a large number of protein crystals, at room temperature and with high efficiency, into prescribed positions enables high throughput automated serial crystallography with microfocus synchrotron beamlines. In addition, we demonstrate the application of this chip for femtosecond time-resolved serial crystallography at the Linac Coherent Light Source (LCLS, Menlo Park, California, USA). As a result, the chip concept enables multiple images to be acquired from each crystal, allowing differential detection of changes in diffraction intensities in order to obtain high signal-to-noise and fully exploit the time resolution capabilities of XFELs.

  8. Microsoft Word - 46ED31B8-1E53-08CF52.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    46ED31B8-1E53-08CF52.doc Microsoft Word - 46ED31B8-1E53-08CF52.doc PDF icon Microsoft Word - 46ED31B8-1E53-08CF52.doc More Documents & Publications Microsoft Word - ARRAAttachment12v1.doc Microsoft Word - DRAFT CRB Interview Guidance.doc Microsoft Word - ARRAGuideAttachment10v1.doc

  9. Microsoft Word - 48D7DF19-707E-28B27A.doc | Department of Energy

    Office of Environmental Management (EM)

    48D7DF19-707E-28B27A.doc Microsoft Word - 48D7DF19-707E-28B27A.doc PDF icon Microsoft Word - 48D7DF19-707E-28B27A.doc More Documents & Publications Microsoft Word - ARRAAttachment12v1.doc Microsoft Word - Fact Sheet Energy Speech 082508 FINAL.doc Microsoft Word - GSP_Charter.doc

  10. ON-DEMAND SERIAL DILUTION USING QUANTIZED NANO/PICOLITER-SCALE DROPLETS

    SciTech Connect (OSTI)

    Jambovane, Sachin R.; Prost, Spencer A.; Sheen, Allison M.; Magnuson, Jon K.; Kelly, Ryan T.

    2014-10-29

    This paper describes a fully automated droplet-based microfluidic device for on-demand serial dilution that is capable of achieving a dilution ratio of >6000 (concentration ranges from 1 mM to 160nM) over 35 nanoliter-scale droplets. This serial diluter can be applied to high throughput and label-free kinetic assays by integrating with our previously developed on-demand droplet-based microfluidic with mass spectrometry detection.

  11. Microsoft Word - 0-PEP-6-14-07.doc | Department of Energy

    Energy Savers [EERE]

    Word - 0-PEP-6-14-07.doc Microsoft Word - 0-PEP-6-14-07.doc PSF.pdf More Documents & Publications Sample Project Execution Plan Project Execution Plan Review Module (RM) Microsoft...

  12. Microsoft Word - g413.3-10Final5-6-08.doc | Department of Energy

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    g413.3-10Final5-6-08.doc Microsoft Word - g413.3-10Final5-6-08.doc DOEEVMSGoldCardSep2011.pdf More Documents & Publications EVMS and Project Analysis Standard Operating...

  13. Microsoft Word - FY07AnnualReport.doc | Department of Energy

    Broader source: Energy.gov (indexed) [DOE]

    FY07AnnualReport.doc More Documents & Publications Microsoft Word - FY08AnnualReport.doc Audit Report: IG-0857 Attachment 5 Volume II Pricing Matrix.xls...

  14. PRESSURE RELIEF DEVICE DATA SHEET FORM PS-5 Pressure System Number: Date:

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    RELIEF DEVICE DATA SHEET FORM PS-5 Pressure System Number: Date: Pressure System Name: Pressure Vessel Number (if Applicable): Device installed directly on vessel?: __Yes __No Code: System Fluid: Code Year: Fluid State: Fluid Category: RELIEF DEVICE DATA Device Type ___Safety Relief Valve ____Rupture Disk ___Other (specify) Certification Type: ___ASME ___CE/PED ___Other (specify) Manufacturer Rated Flow Capacity: Part Number Converted Flow Capacity: Serial Number Set Pressure Inspection/Test

  15. Microsoft Word - National Policy AssurancesAwardTermsREVJuly2005.doc |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy National Policy AssurancesAwardTermsREVJuly2005.doc Microsoft Word - National Policy AssurancesAwardTermsREVJuly2005.doc PDF icon Microsoft Word - National Policy AssurancesAwardTermsREVJuly2005.doc More Documents & Publications Microsoft Word - NationalPolicyAssurancesAwardTermsFinal81804.doc National Policy Assurances to be Incorporated as Award Terms Microsoft Word - NationalPolicyAssurances5-06

  16. Microsoft Word - Press Release RECOMP 2-8-08 REV FINAL.doc | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Press Release RECOMP 2-8-08 REV FINAL.doc Microsoft Word - Press Release RECOMP 2-8-08 REV FINAL.doc PDF icon Microsoft Word - Press Release RECOMP 2-8-08 REV FINAL.doc More Documents & Publications Microsoft Word - Fact Sheet Energy Speech 082508 FINAL.doc USA RS Basic Contract - Contract No.: DE-RW0000005 Microsoft Word - AL-Consolidated Approps FY 2008 as of feb 21 2008 final

  17. RFQ DE-RQ01-04ME90001.doc | Department of Energy

    Energy Savers [EERE]

    RFQ DE-RQ01-04ME90001.doc&#0; RFQ DE-RQ01-04ME90001.doc&#0; PDF icon RFQ DE-RQ01-04ME90001.doc&#0; More Documents & Publications Ammendment 2.doc Attachment 6 Volume V Pricing Matrix for Optional Enhancements.xls&#0; Operating Guidelines Appendix A B

  18. Microsoft Word - DP_cover_and_front matter_FINAL1.DOC | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy FINAL1.DOC Microsoft Word - DP_cover_and_front matter_FINAL1.DOC PDF icon Microsoft Word - DP_cover_and_front matter_FINAL1.DOC More Documents & Publications Microsoft Word - DP_cover_and_front matter_R1_Draft_3.DOC EA-1552: Final Environmental Assessment Probabilistic Modeling and Phase 2 Decision Making at the West Valley Demonstration Project and the Western New York Nuclear Service Center

  19. advanced_biofuels_pathways_webinar_alt_text.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    advanced_biofuels_pathways_webinar_alt_text.doc advanced_biofuels_pathways_webinar_alt_text.doc advanced_biofuels_pathways_webinar_alt_text.doc Microsoft Office document icon advanced_biofuels_pathways_webinar_alt_text.doc More Documents & Publications Sustainability for the Global Biofuels Industry: Minimizing Risks and Maximizing Opportunities Webinar Transcript "The Promise and Challenge of Algae as Renewable Sources of Biofuels" 9-8-2010 - Transcript NABC Webinar

  20. First NESAP Post-doc Takes on BoxLib

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    First NESAP Post-doc Takes on BoxLib First NESAP Post-doc Takes on BoxLib Brian Friesen to Work with Ann Almgren's Group in CCSE June 22, 2015 brianfriesenphoto Brian Friesen, PhD The first of eight post-doctoral researchers participating in the NERSC Exascale Science Applications Program (NESAP) is now working full time at NERSC. Brian Friesen, a graduate student in computational astrophysics at the University of Oklahoma, joined the NESAP team May 18. He's been assigned to Ann Almgren's group

  1. Microsoft Word - AL-PO-0001-0007.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Authorized List Doc. ID: OP-AL-0001-007.doc Off-Hours Shift Operator Date: 2001/11/20 This policy is effective 11/20/2001 and denotes those individuals who have been authorized for Off-Hours Shift Operation. 1. Alderman, Steven 2. Aigeldinger, Georg 3. Baethke, Niko 4. Bauer, Benjamin 5. Brendebach, Boris 6. Day, Lorraine 7. Desta, Yohannes 8. Doomes, Edward 9. Dust, Reinhard 10. Farquar, George 11. Fluegge, Michael 12. Goettert, Jost 13. Koch, Kevin 14. Kong, Jong Ren 15. Lian, Kun 16. Ling,

  2. Microsoft Word - Appendix D_LegalDescription.doc

    Office of Legacy Management (LM)

    Legal Descriptions and Ownership Information of Institutional Control Areas U.S. Department of Energy Weldon Spring Site LTS&M Plan July 2005 Doc. No. S0079000 Page D-3 Figure D-1. DOE Property Boundary for the Chemical Plant Area Weldon Spring Site LTS&M Plan U.S. Department of Energy Doc. No. S0079000 July 2005 Page D-4 Legal Description for the Chemical Plant Area All that parcel of land lying within St. Charles County, Missouri, comprising the Federal facility identified as the

  3. Microsoft Word - AcqGuide71pt1.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    1pt1.doc Microsoft Word - AcqGuide71pt1.doc PDF icon Microsoft Word - AcqGuide71pt1.doc More Documents & Publications Chapter 71 - Review and Approval of Contract and Financial Assistance Actions SEB Secretariat and Knowledge Manager Policy Flash 2015-09

  4. Microsoft Word - AcqGuide7pt1.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    pt1.doc Microsoft Word - AcqGuide7pt1.doc ACQUISITION PLANNING PDF icon Microsoft Word - AcqGuide7pt1.doc More Documents & Publications Policy Flash 2013-09 ACQUISITION PLANNING Policy Flash 2015-13

  5. Microsoft Word - Brochure_Senior Officials.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Brochure_Senior Officials.doc Microsoft Word - Brochure_Senior Officials.doc PDF icon Microsoft Word - Brochure_Senior Officials.doc More Documents & Publications Preservation of Department of Energy Federal Records Records Management Exit Procedures Procedures for Departing Employees

  6. Microsoft Word - FEMP-State MOU pdf version.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    FEMP-State MOU pdf version.doc Microsoft Word - FEMP-State MOU pdf version.doc PDF icon Microsoft Word - FEMP-State MOU pdf version.doc More Documents & Publications FEMP Peer Review 2001 FEMP Customer Survey Report (Appendices) Federal Utility Partnership Working Group Meeting: Washington Update

  7. Microsoft Word - Fact Sheet Environment 100808 FINAL.doc | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Environment 100808 FINAL.doc Microsoft Word - Fact Sheet Environment 100808 FINAL.doc PDF icon Microsoft Word - Fact Sheet Environment 100808 FINAL.doc More Documents & Publications Major Communications Report May 5, 2009 Major Communications Report April 30, 2009 Major Communications Report April 28, 2009

  8. Microsoft Word - NationalPolicyAssurances5-06.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    NationalPolicyAssurances5-06.doc Microsoft Word - NationalPolicyAssurances5-06.doc PDF icon Microsoft Word - NationalPolicyAssurances5-06.doc More Documents & Publications Microsoft Word - NationalPolicyAssurances907.rtf

  9. Effectiveness of a Diesel Oxidation Catalyst (DOC) to control CO and

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    hydrocarbon emissions from Reactivity Controlled Compression Ignition (RCCI) combustion | Department of Energy Effectiveness of a Diesel Oxidation Catalyst (DOC) to control CO and hydrocarbon emissions from Reactivity Controlled Compression Ignition (RCCI) combustion Effectiveness of a Diesel Oxidation Catalyst (DOC) to control CO and hydrocarbon emissions from Reactivity Controlled Compression Ignition (RCCI) combustion Performance of two commercially available DOCs with different precious

  10. Fact Sheet -- Climate VISION 02-12-031.doc | Department of Energy

    Office of Environmental Management (EM)

    Sheet -- Climate VISION 02-12-031.doc&#0; Fact Sheet -- Climate VISION 02-12-031.doc&#0; PDF icon Fact Sheet -- Climate VISION 02-12-031.doc&#0; More Documents & Publications Meeting President Bush's Climate Change Challenge to Business and Industry Climate Vision Progress Report 2007 Climate VISION Progress Report 2007

  11. Microsoft Word - 2005 FOIA ANNUAL REPORT.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    2005 FOIA ANNUAL REPORT.doc Microsoft Word - 2005 FOIA ANNUAL REPORT.doc report2005.pdf PDF icon Microsoft Word - 2005 FOIA ANNUAL REPORT.doc More Documents & Publications U.S. Department of Energy 2008 Annual FOIA Report Office of Information Resources (MA-90) ANNUAL FOIA REPORT FOR 2009

  12. Microsoft Word - va_Final3a_06-04-032.doc | Department of Energy

    Office of Environmental Management (EM)

    va_Final3a_06-04-032.doc Microsoft Word - va_Final3a_06-04-032.doc PDF icon Microsoft Word - va_Final3a_06-04-032.doc More Documents & Publications DOE F 473.2 Headquarters Facilities Master Security Plan - Chapter 1, Physical Security DOE F 473.2

  13. NDIA_PMSC_SurveillanceGuide_Oct2004.doc | Department of Energy

    Office of Environmental Management (EM)

    NDIA_PMSC_SurveillanceGuide_Oct2004.doc NDIA_PMSC_SurveillanceGuide_Oct2004.doc PDF icon NDIA_PMSC_SurveillanceGuide_Oct2004.doc More Documents & Publications EVMS Surveillance Standard Operating Procedure (ESSOP) NDIA_PMSC_EVMS_IntentGuide_Nov_2006.pdf Enhancing Earned Value (EV) Analysis Using Project Assessment & Reporting System (PARS II) - Road Show Presentation

  14. Microsoft Word - ADR Revised Policy82508Reformatted.doc | Department of

    Office of Environmental Management (EM)

    Energy ADR Revised Policy82508Reformatted.doc Microsoft Word - ADR Revised Policy82508Reformatted.doc PDF icon Microsoft Word - ADR Revised Policy82508Reformatted.doc More Documents & Publications ADR Revised Policy ADR Policy Federal Register Document

  15. Microsoft Word - CHAP02ESH _REVISED1_3.doc | Department of Energy

    Office of Environmental Management (EM)

    CHAP02ESH _REVISED1_3.doc Microsoft Word - CHAP02ESH _REVISED1_3.doc PDF icon Microsoft Word - CHAP02ESH _REVISED1_3.doc More Documents & Publications Chapter 70 - DOE Management and Operating Contracts Regulatory Aspects of ISM COMMENTS&#0;

  16. AcqGuide35pt1rev2.doc | Department of Energy

    Energy Savers [EERE]

    AcqGuide35pt1rev2.doc&0; AcqGuide35pt1rev2.doc&0; AcqGuide35pt1rev2.doc&0; More Documents & Publications Attachment FY2011-58 OPAM Chapter 35 - Research and Development...

  17. Microsoft Word - Attachment A3.doc

    Office of Environmental Management (EM)

    A3 DRAWING NUMBER 51-W-214-W UNDERGROUND FACILITIES TYPICAL DISPOSAL PANEL Waste Isolation Pilot Plant Hazardous Waste Permit November 30, 2010 (This page intentionally blank)...

  18. Microsoft Word - 20050821_Appendix_A.doc

    U.S. Energy Information Administration (EIA) Indexed Site

    0. U.S. Number of Vehicles, Vehicle-Kilometers, Motor Fuel Consumption and Expenditures, 2001 ENERGY INFORMATION ADMINISTRATION HOUSEHOLD VEHICLES ENERGY USE: LATEST A N D TRENDS...

  19. Microsoft Word - 090713HanfordARRAupdate.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Backgrounder Contacts: July 13, 2009 Geoff Tyree, DOE (509) 376-4171, Geoff_Tyree@rl.gov Cameron Hardy, DOE (509) 376-5365, Cameron_M_Hardy@rl.gov Update on Hiring and Recovery Act Funding at the Hanford Site, Richland Operations Office Projects Total Number of Jobs Saved/Created The total number of jobs saved to date with Recovery Act funding for DOE Richland Operations Office projects is approximately 300. The total number of jobs created to date is approximately 900. New Hires in June

  20. Microsoft Word - VI_12_Degrees Awarded 2015.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    4 - March 31, 2015 Name Year Thesis Title Advisor Present Position Hua Zheng 2014 Density and temperature in quantum nuclear systems A. Bonasera Post Doc. at INFN - Laboratori Nazionali del Sud, Catania, Italy STUDENTS WHO RECEIVED GRADUATE DEGREES FROM NON-THESIS April 1, 2014 - March 31, 2015 Name Year Advisor Present Position Issac Sarver 2014 R. Rapp

  1. M_16_01_05.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    0, 2402,11:26 AM Change Number M-16-01-05 Federal Facility Agreement and Consent Order Change Control Form Do not use blue ink. Type or print using black ink. Date 12312001...

  2. M_016_01_06.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    5 AM Change Number M-016-01-06 Federal Facility Agreement and Consent Order Change Control Form Do not use blue ink. Type or print using black ink. Date 123101 Originator Phone...

  3. Microsoft Word - A112, Funding.DOC

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of Offers is extended, is not...

  4. Microsoft Word - A100 Funding.DOC

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of Offers is extended, is not...

  5. Microsoft Word - M088.SF30.DOC

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of Offers is extended, is not...

  6. Microsoft Word - M093.SF30.DOC

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of Offers is extended, is not...

  7. Microsoft Word - SF30 A062.DOC

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of offers is extended, is not...

  8. Microsoft Word - M117 Melter.DOC

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of Offers is extended, is not...

  9. Microsoft Word - A113 Funding.DOC

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of Offers is extended, is not...

  10. Microsoft Word - SF30 A056.DOC

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of offers is extended, is not...

  11. Microsoft Word - SF30 A064.DOC

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of offers is extended, is not...

  12. Microsoft Word - SF30 A061.DOC

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of offers is extended, is not...

  13. Microsoft Word - M092.SF30.DOC

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of Offers is extended, is not...

  14. Microsoft Word - A109 Funding.DOC

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of Offers is extended, is not...

  15. Microsoft Word - SF30 A070.DOC

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of offers is extended, is not...

  16. Microsoft Word - SF30 A072.DOC

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of offers is extended, is not...

  17. Microsoft Word - A094_SF30.DOC

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of Offers is extended, is not...

  18. Microsoft Word - M128 Word _2_.DOC

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of Offers is extended, is not...

  19. Microsoft Word - Final A139.DOC

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of Offers is extended, is not...

  20. Microsoft Word - SF30 A060.DOC

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of offers is extended, is not...

  1. Microsoft Word - M068 SF 30.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of offers is extended, is not...

  2. Microsoft Word - A111 Funding.DOC

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of Offers is extended, is not...

  3. Microsoft Word - M071 SF 30.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of offers is extended, is not...

  4. Microsoft Word - M069 SF 30.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of offers is extended, is not...

  5. Microsoft Word - A119 Funding.DOC

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of Offers is extended, is not...

  6. Microsoft Word - SF30 A058.DOC

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of offers is extended, is not...

  7. Microsoft Word - SF30 A059.DOC

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of offers is extended, is not...

  8. Microsoft Word - Final M135.DOC

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of Offers is extended, is not...

  9. Microsoft Word - SF30 A074.DOC

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of offers is extended, is not...

  10. Microsoft Word - Draft A142 _2_.DOC

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of Offers is extended, is not...

  11. Microsoft Word - M134 Word.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of Offers is extended, is not...

  12. Microsoft Word - A105 Funding.DOC

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of Offers is extended, is not...

  13. Microsoft Word - A138- Draft.DOC

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of Offers is extended, is not...

  14. Microsoft Word - A116 Funding.DOC

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of Offers is extended, is not...

  15. Microsoft Word - M090.SF30.DOC

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of Offers is extended, is not...

  16. Microsoft Word - M091.SF30.DOC

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of Offers is extended, is not...

  17. Microsoft Word - A089 Funding.DOC

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of Offers is extended, is not...

  18. Microsoft Word - M066 SF 30.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of offers is extended, is not...

  19. Microsoft Word - fellows_nomination_reworked.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    the National Nuclear Security Administration of the U.S. Department of Energy To be completed for each individual nomination Candidate Last Name: First Name: Middle Initial: Z Number: Organization: Phone: Mail Stop: Email Address: Nominator Last Name: First Name: Middle Initial: Z Number: Organization: Phone: Mail Stop: Email Address: Package Includes (please check all that apply): 1) Table of Contents ____ 2) Letter of Nomination ____ 3) Letters of Endorsement ____ 4) CV/Resume ____ 5)

  20. A serial-kinematic nanopositioner for high-speed atomic force microscopy

    SciTech Connect (OSTI)

    Wadikhaye, Sachin P. Yong, Yuen Kuan; Reza Moheimani, S. O.

    2014-10-15

    A flexure-guided serial-kinematic XYZ nanopositioner for high-speed Atomic Force Microscopy is presented in this paper. Two aspects influencing the performance of serial-kinematic nanopositioners are studied in this work. First, mass reduction by using tapered flexures is proposed to increased the natural frequency of the nanopositioner. 25% increase in the natural frequency is achieved due to reduced mass with tapered flexures. Second, a study of possible sensor positioning in a serial-kinematic nanopositioner is presented. An arrangement of sensors for exact estimation of cross-coupling is incorporated in the proposed design. A feedforward control strategy based on phaser approach is presented to mitigate the dynamics and nonlinearity in the system. Limitations in design approach and control strategy are discussed in the Conclusion.

  1. Microsoft Word - Annual DOERPT2003.doc

    Office of Scientific and Technical Information (OSTI)

    Title: Integrating P-Wave and S-Wave Seismic Data to Improve Characterization of Oil Reservoirs Type of Report: Annually Reporting Period: September 1, 2002 to August 31, 2003 Author: Innocent J. Aluka Date of Report: January 12, 2004 Grant Number: DE-FG26-00NT40832 Institution: Prairie View A&M University Address: P.O. Box 2516, Prairie View, TX 77446 Telephone: 936-857-4510 Fax Number: 936-857-4148 E-Mail Address: innocent_aluka@pvamu.edu Subcontractor: Bureau of Economic Geology, Austin,

  2. Microsoft Word - S00790AG.doc

    Office of Legacy Management (LM)

    Website: http://www.lm.doe.gov/land/sites/mo/weldon/weldon.htm DOE office in Grand Junction 24-hour toll free security telephone number: (877) 695-5322 DOE-WSS local telephone number: (636) 300-0012 S00790AG DOE-LM/GJ688-2004 Long-Term Surveillance and Maintenance Plan for the U.S Department of Energy Weldon Spring, Missouri, Site February 2005 Work Performed by S.M. Stoller Corporation under DOE Contract No. DE-AC01-02GJ79491 for the U.S. Department of Energy Office of Legacy Management, Grand

  3. Microsoft Word - Append E waterlevels.doc

    Office of Legacy Management (LM)

    Groundwater Level Data Since 2000 This page intentionally left blank Groundwater Levels a ______________________________________________________________________________________________________ a Numbers in parentheses indicate elevation of bottom of well for dry measurements. ______________________________________________________________________________________________________ Well Id Collect Depth to Water Well Id Collect Depth to Water Date Water Elevation Date Water Elevation

  4. Microsoft Word - Attachment A3.doc

    Office of Environmental Management (EM)

    A3 DRAWING NUMBER 51-W-214-W UNDERGROUND FACILITIES TYPICAL DISPOSAL PANEL Waste Isolation Pilot Plant Hazardous Waste Permit November 30, 2010 (This page intentionally blank) Waste Isolation Pilot Plant Hazardous Waste Permit November 30, 2010 PERMIT ATTACHMENT A3 Page A3-1 of 1 Drawing 51-W-214-W Underground Facilities Typical Disposal Panel 1

  5. Microsoft Word - AAFS_Proposal_VB.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    PROPOSAL FACT SHEET PAC cycle: _ ________ _______ (Do not complete) Date: _ ________ _______ Assigned Experiment Number Title: Experiment Spokesperson and Alternate: Telephone and e-mail: ** Please list all additional Participants and their home institute on a separate sheet or on the proposal itself. Targets: Beams: Energies (MeV): Intensities (pnA): Beam Stop Material: Additional Beam Requirements: Beam Sweeper Yes:___ Period:_______________ Rebuncher/Debuncher Yes:___ Max. Width: __________ps

  6. Microsoft Word - Final Report.doc

    Office of Scientific and Technical Information (OSTI)

    New Cyclotron Targetry to Enhance F-18 Clinical Position Emission Tomography Covering Period: Aug 15, 2004 - Aug 14, 2008 Date of Report: December 19, 2008 Recipient: North Carolina State University, Raleigh NC 27695-7909 Award Number: DE-FG07-04ID14593 Subcontractors: -------- Other Partners: -------- Contact(s): J. Michael Doster, 919-515-3658, doster@eos.ncsu.edu Project Team: Nancy Elizondo, US DOE, Idaho Operations Office Project Objective: This project proposes to develop cyclotron targets

  7. Microsoft Word - FIA-12-0063.doc

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    the Native Hawaiian Legal ) Corporation. ) ) Filing Date: October 12, 2012 ) Case No.: FIA-12-0063 ) ) Issued: October 31, 2012 _______________ Decision and Order _______________ On October 12, 2012, the Native Hawaiian Legal Corporation ("Appellant") filed an Appeal from a determination issued to it on September 11, 2012, by the Golden Field Office (GFO) of the United States Department of Energy (DOE) (FOIA Request Number GO-12-296). In its determination, the GFO responded to the

  8. Microsoft Word - ISDAC_orientation_pkt.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    ORIENTATION PACKAGE ISDAC Field Campaign March 29 - May 2 Fairbanks, Alaska 1 Welcome to Alaska! This information package is to help you become familiar with the area and answer some questions you might have as you arrive. If you have any questions please feel free to contact Debbie at 509.392.1854. Contents Cell Phone Numbers Fairbanks * Campaign Info Site Locations in Fairbanks Badging and Access Mission Schedule Safety Network and Communications Office Equipment * Local Information * Map Cell

  9. Microsoft Word - Actinin_Safinya.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    3 Structure of Actin Cross-linked with α-Actinin: A Network of Bundles Olivier Pelletier, Elena Pokidysheva, Linda S. Hirst, Nate Bouxsein, Youli Li and Cyrus R. Safinya Materials and Physics Departments, Biomolecular Science & Engineering Program, Materials Research Laboratory, University of California, Santa Barbara, California 93106 With the emerging proteomics era, the biosciences community is now challenged to elucidate the structures and functions of a large number of interacting

  10. Microsoft Word - Q00336-Sept- 2004.doc

    Office of Legacy Management (LM)

    652 U.S. Department of Energy Remedial Action Report for the Interim Remedial Action Record of Decision Operable Unit III, Surface Water and Ground Water Monticello Mill Tailings (USDOE) Site, Monticello, Utah EPA CERCLIS Identification Number UT 3890090035 September 2004 Work Performed Under DOE Contract No. for the U.S. Department of Energy Office of Legacy Management. DE-AC01-02GJ79491 Approved for public release; distribution is unlimited. Office of Legacy Management Office of Legacy

  11. Microsoft Word - UPDATE 4 - Unit 4.doc

    Office of Environmental Management (EM)

    4 to: A Dispersion Modeling Analysis of Downwash from Mirant's Potomac River Power Plant Modeling Unit 4 Emissions at Maximum and Minimum Loads ENSR Corporation December 23, 2005 Document Number 10350-002-410 (Update 4) December, 2005 1-1 1.0 INTRODUCTION This report describes dispersion modeling performed for Unit 4 at Mirant's Potomac River Generating Station. The modeling was performed according to the Protocol approved by the Virginia Department of Environmental Quality. The purpose of the

  12. Microsoft Word - FIA-12-0061.doc

    Office of Environmental Management (EM)

    matter of John P. Newton ) ) Filing Date: October 9, 2012 ) Case No.: FIA-12-0061 ) ) Issued: October 31, 2012 _______________ Decision and Order _______________ On October 9, 2012, John P. Newton ("Appellant") filed an Appeal from determinations issued to him on September 6, 2012, and September 12, 2012, by the Office of Information Resources (OIR) of the Department of Energy (DOE) (FOIA Request Numbers HQ-2012-01768-F & HQ-2012-01835-F). In those determinations, OIR responded to

  13. Microsoft Word - PA MP FY02.doc

    National Nuclear Security Administration (NNSA)

    91-Rev. 1 Maintenance Plan for the Performance Assessments and Composite Analyses for the Area 3 and Area 5 Radioactive Waste Management Sites at the Nevada Test Site Prepared by Prepared for U.S. Department of Energy National Nuclear Security Administration Nevada Operations Office under Contract Number DE-AC08-96NV11718 September 2002 DISCLAIMER NOTICE Reference herein to any specific commercial product, process, or service by trade name, trade mark, manufacturer, or otherwise does not

  14. Number | Open Energy Information

    Open Energy Info (EERE)

    Property:NumOfPlants Property:NumProdWells Property:NumRepWells Property:Number of Color Cameras Property:Number of Devices Deployed Property:Number of Plants included in...

  15. Coupled Serial and Parallel Non-uniform SQUIDs

    SciTech Connect (OSTI)

    Longhini, Patrick; In, Visarath; Berggren, Susan; Palacios, Antonio; Leese de Escobar, Anna

    2011-04-19

    In this work we numerical model series and parallel non-uniform superconducting quantum interference device (SQUID) array. Previous work has shown that series SQUID array constructed with a random distribution of loop sizes, (i.e. different areas for each SQUID loop) there exists a unique 'anti-peak' at the zero magnetic field for the voltage versus applied magnetic field (V-B). Similar results extend to a parallel SQUID array where the difference lies in the arrangement of the Josephson junctions. Other system parameter such as bias current, the number of loops, and mutual inductances are varied to demonstrate the change in dynamic range and linearity of the V-B response. Application of the SQUID array as a low noise amplifier (LNA) would increase link margins and affect the entire communication system. For unmanned aerial vehicles (UAVs), size, weight and power are limited, the SQUID array would allow use of practical 'electrically small' antennas that provide acceptable gain.

  16. Microsoft Word - AppendixH_CommentResponse.doc

    Office of Legacy Management (LM)

    NFSS Vicinity Property Report October 2010 Doc. No. S06246 Page H-1 Responsiveness Summary The U.S. Department of Energy (DOE) released the Formerly Utilized Sites Remedial Action Program Niagara Falls Storage Site Vicinity Properties, New York: Review of Radiological Conditions at Six Vicinity Properties and Two Drainage Ditches on April 23, 2010, for public comment. Report availability was announced through a message to stakeholders sent on behalf of DOE by USACE. The announcement provided a

  17. Microsoft Word - S04674_2008VMR.doc

    Office of Legacy Management (LM)

    for the Durango, Colorado, Processing Site September 2008 LMS/DUP/S04674 This page intentionally left blank LMS/DUP/S04674 Office of Legacy Management Verification Monitoring Report for the Durango, Colorado, Processing Site September 2008 This page intentionally left blank U.S. Department of Energy Verification Monitoring Report-Durango, Colorado, Processing Site September 2008 Doc. No. S0467400 Page iii Contents Acronyms and Abbreviations

  18. Microsoft Word - S05767_PostClosureInspRpt.doc

    Office of Legacy Management (LM)

    2009 Revegetation Success Monitoring This page intentionally left blank 2009 Revegetation Success Monitoring Central Nevada Test Area Corrective Action Unit 417 UC-1 Central Mud Pit This page intentionally left blank U.S. Department of Energy Post-Closure Inspection & Monitoring Report for CAU 417 October 2009 Doc No. S05767 Page C-i Contents 1.0 Introduction and Purpose ..................................................................................................C-1 2.0 Monitoring

  19. Microsoft Word - S05775_2009 VMR.doc

    Office of Legacy Management (LM)

    Report for the Old and New Rifle, Colorado, Processing Sites September 2009 LMS/RFO/RFN/S05775 This page intentionally left blank LMS/RFO/RFN/S05775 2009 Verification Monitoring Report for the Old and New Rifle, Colorado, Processing Sites September 2009 This page intentionally left blank U.S. Department of Energy 2009 Verification Monitoring Report for the Old and New Rifle, Colorado, Processing Sites September 2009 Doc. No. S05775 Page i Contents

  20. Microsoft Word - S07012_RFL_2010_VMR_LEC.doc

    Office of Legacy Management (LM)

    Old and New Rifle, Colorado, Processing Sites September 2010 LMS/RFO/RFN/S07012 This page intentionally left blank LMS/RFO/RFN/S07012 2010 Verification Monitoring Report for the Old and New Rifle, Colorado, Processing Sites September 2010 This page intentionally left blank U.S. Department of Energy 2010 Verification Monitoring Report for the Old and New Rifle, Colorado, Processing Sites September 2010 Doc. No. S07012 Page i Contents

  1. Microsoft Word - S07033_2nd qtr 2010.doc

    Office of Legacy Management (LM)

    Second Quarter Calendar Year 2010 October 2010 LMS/RFS/S07033 This page intentionally left blank LMS/RFS/S07033 U.S. Department of Energy Office of Legacy Management Rocky Flats Site Quarterly Report of Site Surveillance and Maintenance Activities Second Quarter Calendar Year 2010 October 2010 This page intentionally left blank U.S. Department of Energy Quarterly Report of Site Surveillance and Maintenance Activities-2nd Quarter CY 2010 October 2010 Doc. No. S07033 Page i Contents

  2. Microsoft Word - NO1113_Dewatering report.doc

    Office of Legacy Management (LM)

    Hydrologic Assessment of Dewatering for Installation of the Belcher Road Water Transmission Line This page intentionally left blank U.S. Department of Energy Dewatering Evaluation Report for Road Const. & Water Line Replacement June 2008 Doc. No. N0111300 Page C-3 The rate of pumping resulting from aquifer dewatering for installation of the planned water transmission line beneath Belcher Road is expected be larger than any of the discharge rates associated with drainage infrastructure

  3. Microsoft Word - S04801_Avian2008 _2_ revised.doc

    Office of Legacy Management (LM)

    Final Report Avian Wetland Surveys at Monticello Mill Tailings Site, 2008 November 2008 LMS/MNT/S04801 This page intentionally left blank LMS/MNT/S04801 Final Report Avian Wetland Surveys at Monticello Mill Tailing Site, 2008 November 2008 This page intentionally left blank U.S. Department of Energy Avian Wetland Surveys at Monticello Mill Tailing Site, 2008 November 2008 Doc. No. S0480100 Page i Contents 1.0 Summary

  4. Microsoft Word - S04816_InvestigationPlan.doc

    Office of Legacy Management (LM)

    New Brunswick, New Jersey, Site Investigation Plan to Identify Potential Radiological Contamination in a Sanitary Sewer December 2008 LMS/NBL/S04816 This page intentionally left blank New Brunswick, New Jersey, Site Investigation Plan to Identify Potential Radiological Contamination in a Sanitary Sewer December 2008 This page intentionally left blank U.S. Department of Energy Investigation Plan to Identify Contamination in a Sanitary Sewer December 2008 Doc. No. S0481600 Page i Contents 1.0

  5. Microsoft Word - S04877_AnnInspRpt2008.doc

    Office of Legacy Management (LM)

    Annual Inspection of the Monticello Mill Tailings (USDOE) and Monticello Radioactively Contaminated Properties Sites December 2008 LMS/MNT/S04877 This page intentionally left blank LMS/MNT/S04877 2008 Annual Inspection of the Monticello Mill Tailings (USDOE) and Monticello Radioactively Contaminated Properties Sites December 2008 This page intentionally left blank U.S. Department of Energy 2008 Annual Inspection-Monticello, Utah December 2008 Doc. No. S487700 Page i Contents Executive

  6. Microsoft Word - S04929_GW_Mon_NDEP_Final.doc

    Office of Legacy Management (LM)

    Groundwater Monitoring Report Central Nevada Test Area, Corrective Action Unit 443 March 2009 Rev. 1 LMS/CNT/S04929 This page intentionally left blank LMS/CNT/S04929 2008 Groundwater Monitoring Report Central Nevada Test Area, Corrective Action Unit 443 March 2009 Rev. 1 This page intentionally left blank U.S. Department of Energy 2008 Groundwater Monitoring Report-CNTA, CAU 443 March 2009 Doc. No. S04929 Rev. 1 Page i Contents 1.0

  7. Microsoft Word - S04932 History final.doc

    Office of Legacy Management (LM)

    FUSRAP History of the Chupadera Mesa, NM, Site December 2008 Doc. No. S0493200 (FUSRAP NM.04-5) Page 1 of 9 FUSRAP History of the Chupadera Mesa, NM, Site The following historical summary is provided to document the inclusion of the Chupadera Mesa, NM, Site into the Formerly Utilized Sites Remedial Action Program (FUSRAP). Although no remedial action was required, the site met eligibility criterion and was included under FUSRAP, under which the final radiological surveys were performed.

  8. Microsoft Word - S05072_WaterQualityComplStrategy.doc

    Office of Legacy Management (LM)

    Water Quality Compliance Strategy December 2009 LMS/MNT/S05072 This page intentionally left blank LMS/MNT/S05072 Monticello Mill Tailings Site Operable Unit III Water Quality Compliance Strategy December 2009 This page intentionally left blank U.S. Department of Energy MMTS Water Quality Compliance Strategy December 2009 Doc. No. S05072 Page i Contents 1.0 Introduction......................................................................................................................... 1 1.1

  9. Microsoft Word - S05378_2009 GW Rpt.doc

    Office of Legacy Management (LM)

    08 through April 2009 October 2009 LMS/MNT/S05378 This page intentionally left blank LMS/MNT/S05378 Monticello Mill Tailings Site Operable Unit III Annual Groundwater Report May 2008 through April 2009 October 2009 This page intentionally left blank U.S. Department of Energy Monticello Mill Tailings Site OU III Annual Groundwater Report May 2008-April 2009 October 2009 Doc. No. S05378 Page i Contents

  10. Microsoft Word - S05551_1stqtr report.doc

    Office of Legacy Management (LM)

    09 July 2009 LMS/RFS/S05551 This page intentionally left blank LMS/RFS/S05551 U.S. Department of Energy Office of Legacy Management Rocky Flats Site Quarterly Report of Site Surveillance and Maintenance Activities First Quarter Calendar Year 2009 July 2009 This page intentionally left blank U.S. Department of Energy Quarterly Report of Site Surveillance and Maintenance Activities-1st Quarter CY 2009 July 2009 Doc. No. S05551 Page i Contents

  11. Microsoft Word - S05837_FFA 4th qtr 09.doc

    Office of Legacy Management (LM)

    July 1-September 30, 2009 October 2009 Doc. No. S05837 Page 1 Monticello National Priorities List Sites Federal Facilities Agreement (FFA) Quarterly Report: July 1-September 30, 2009 This report summarizes project status and activities implemented July through September 2009, and provides a schedule of near-term activities for the Monticello Mill Tailings Site (MMTS) and the Monticello Vicinity Properties (MVP) sites. This report also includes disposal cell and Pond 4 leachate collection data,

  12. Microsoft Word - S06397_Apr09 thru Mar10.doc

    Office of Legacy Management (LM)

    Groundwater Report April 2009 through March 2010 Tuba City, Arizona, Disposal Site July 2010 LMS/TUB/S06397 This page intentionally left blank LMS/TUB/S06397 Annual Groundwater Report April 2009 through March 2010 Tuba City, Arizona, Disposal Site July 2010 This page intentionally left blank U.S. Department of Energy Tuba City Annual Groundwater Report-April 2009 through March 2010 July 2010 Doc. No. S06397 Page i Contents 1.0 Introduction

  13. Microsoft Word - S06430_JanMar.doc

    Office of Legacy Management (LM)

    31, 2010 April 2010 Doc. No. S06430 Page 1 Monticello, Utah, National Priorities List Sites Federal Facilities Agreement (FFA) Quarterly Report: January 1-March 31, 2010 This report summarizes project status and activities implemented January through March 2010, and provides a schedule of near-term activities for the Monticello Mill Tailings Site (MMTS) and the Monticello Vicinity Properties (MVP) Site. This report also includes disposal cell and Pond 4 leachate collection data, quarterly site

  14. Microsoft Word - S06528_1st qtr 2010.doc

    Office of Legacy Management (LM)

    10 July 2010 LMS/RFS/S06528 This page intentionally left blank LMS/RFS/S06528 U.S. Department of Energy Office of Legacy Management Rocky Flats Site Quarterly Report of Site Surveillance and Maintenance Activities First Quarter Calendar Year 2010 July 2010 This page intentionally left blank U.S. Department of Energy Quarterly Report of Site Surveillance and Maintenance Activities-1st Quarter CY 2010 July 2010 Doc. No. S06528 Page i Contents

  15. Microsoft Word - S06584StSoil.doc

    Office of Legacy Management (LM)

    Radiological Assessment of Stained Soils at the Monument Valley Processing Site June 2010 LMS/MON/S06584 This page intentionally left blank LMS/MON/S06584 Radiological Assessment of Stained Soils at the Monument Valley Processing Site June 2010 This page intentionally left blank U.S. Department of Energy Radiological Assessment of Stained Soils at the Monument Valley Processing Site June 2010 Doc. No. S06584 Page i Contents

  16. Microsoft Word - S06770_AprJune.doc

    Office of Legacy Management (LM)

    April 1-June 30, 2010 July 2010 Doc. No. S06770 Page 1 Monticello, Utah, National Priorities List Sites Federal Facilities Agreement (FFA) Quarterly Report: April 1-June 30, 2010 This report summarizes project status and activities implemented April through June 2010, and provides a schedule of near-term activities for the Monticello Mill Tailings Site (MMTS) and the Monticello Vicinity Properties (MVP) Site. This report also includes disposal cell and Pond 4 leachate collection data, quarterly

  17. Microsoft Word - S07079_jul_sep_10.doc

    Office of Legacy Management (LM)

    July 1-September 30, 2010 October 2010 Doc. No. S07079 Page 1 Monticello, Utah, National Priorities List (NPL) Sites Federal Facilities Agreement (FFA) Quarterly Report: July 1-September 30, 2010 This report summarizes project status and activities implemented July through September 2010, and provides a schedule of near-term activities for the Monticello Mill Tailings Site (MMTS) and the Monticello Vicinity Properties (MVP) Site. This report also includes disposal cell and Pond 4 leachate

  18. Microsoft Word - S08999_Apr11-Mar12.doc

    Office of Legacy Management (LM)

    1 Through March 2012 Tuba City, Arizona, Disposal Site July 2012 LMS/TUB/S08999 This page intentionally left blank LMS/TUB/S08999 Annual Groundwater Report April 2011 Through March 2012 Tuba City, Arizona, Disposal Site July 2012 This page intentionally left blank U.S. Department of Energy Tuba City Annual Groundwater Report-April 2011 through March 2012 July 2012 Doc. No. S08999 Page i Contents Abbreviations

  19. Microsoft Word - Appendix B_RiskAssessmenr.doc

    Office of Legacy Management (LM)

    Risk Assessment Information U.S. Department of Energy Weldon Spring Site LTS&M Plan July 2005 Doc. No. S0079000 Page B-3 Summary of Post-Remediation Risk Status at the Weldon Spring Site Baseline risk assessments addressing both human health and ecological risks were performed as part of the remedial investigation phase of the remedial investigation/feasibility study processes conducted. A limited assessment was performed for the Quarry Bulk Waste Operable Unit (OU) consistent with the

  20. Microsoft Word - Appendix E_InstiControls.doc

    Office of Legacy Management (LM)

    Institutional Control Documentation U.S. Department of Energy Weldon Spring Site LTS&M Plan July 2005 Doc. No. S0079000 Page E-iii Appendix E Institutional Control Documentation Notation on Ownership Record for Notification to Potential Owners of Contaminated Groundwater and Applied Restrictions Chemical Plant Site and Quarry Areas (Recorded Book 3754, Pages 419-424, St. Charles County, Missouri)................................E-1 Real Estate License, Groundwater Wells and Sampling on

  1. Microsoft Word - Appendix G_DistributionList.doc

    Office of Legacy Management (LM)

    Distribution List U.S. Department of Energy Weldon Spring Site LTS&M Plan July 2005 Doc. No. S0079000 Page G-3 Except for individual stakeholders, this distribution list is composed of people representing organizations, which have expressed interest in site activities. When individual turnover occurs in these positions, DOE will revise the list to reflect the current holder of these positions. This type of revision is considered minor and not subject to review. All individuals on this list

  2. Microsoft Word - Appendix I-LCRS Operating Plan.doc

    Office of Legacy Management (LM)

    July 2005 Doc. No. S0079000 Page I-3 I1.0 Purpose The purpose of this document is to provide information necessary for the proper operation and maintenance of the Leachate Collection and Removal System (LCRS). Specifically, the subsequent sections will provide the information relating to the management of leachate, maintenance and calibration of liquid level, general equipment maintenance, and reporting requirements. I2.0 Facility Description The LCRS facility is located at the north end of the

  3. Microsoft Word - Final TEC Meeting Summary_September_2004.doc

    Office of Environmental Management (EM)

    TEC Meeting Summary_September_2004.doc 1 U.S. Department of Energy Transportation External Coordination Working Group Meeting Minneapolis, Minnesota September 20-22, 2004 The U.S. Department of Energy (DOE), Transportation External Coordination Working Group (TEC) held its 23 rd meeting on September 20-22, 2004, in Minneapolis, Minnesota. Ninety-six participants, representing national, State, Tribal, and local government; industry; professional organizations; and other interested parties, met to

  4. Microsoft Word - NMMSS News DEC 23 08 Update.doc

    National Nuclear Security Administration (NNSA)

    IS SPONSORED BY DOE AND NRC NMMSS news PUBLISHED PERIODICALLY BY & FOR NMMSS USERS December 23, 2008 SPECIAL EDITION NUREG/BR-0007, Rev.6 Published The NRC wishes to inform industry that it has published its update of NUREG/BR-0007. This NUREG was updated to reflect changes to NMMSS reports that become effective January 1, 2009. Link to the updated NUREG: http://www.nrc.gov/reading-rm/doc-collections/nuregs/brochures/br0007/r6/index.html

  5. Microsoft Word - AMS Report v6.doc

    Office of Scientific and Technical Information (OSTI)

    ADVANCED MICROTURBINE SYSTEMS Final Report for Tasks 1 Through 4 and Task 6 T. Rosfjord, Program Manager W. Tredway, Deputy Program Manager A. Chen, J. Mulugeta, and T. Bhatia United Technologies Research Center East Hartford, CT 06118 March 26, 2007 Prepared for The U.S. Department of Energy, Office of Distributed Energy Award No. DE-FC26-00CH11060 Report Number DOE/CH/11060-1 DISCLAIMER This report was prepared as an account of work sponsored by an agency of the United States Government.

  6. Microsoft Word - FAL2004-01.doc

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Financial Assistance Letters (FALs) that remain in effect are identified below. All other previously issued FALs have been superseded by a formal rulemaking, incorporated into other guidance, and/or canceled. *************** Financial Assistance Letters Remaining in Effect Number Date Subject 96-01 03/08/96 Implementation Guidance on Sections 3001 and 3002 of EPAct 96-02 08/01/96 Implementation Guidance on Section 2306 of EPAct 97-05 12/18/97 Merit Review/Lobbying 2001-02 07/30/01 Preservation

  7. Microsoft Word - MPP_ Application.doc

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    0 of 4 Application Requirements:  Must be a small business;  Must be in business a minimum of two (2) years;  Must already have a Department of Energy (DOE) Mentor and DOE contract number to be used on agreement before submitting for review/approval;  Application must be completed in its entirety;  Must meet all other DOE Mentor-Protégé Program requirements found at www.smallbusiness.energy.gov . DOE Protégé Application Office of Small and Disadvantaged Business Utilization

  8. NDRPProtocolTechBasisCompiled020705.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Basis Document for the Neutron Dose Reconstruction Project NEUTRON DOSE RECONSTRUCTION PROTOCOL Roger B. Falk, Joe M. Aldrich, Jerry Follmer, Nancy M. Daugherty, and Dr. Duane E. Hilmas Oak Ridge Institute of Science and Education and Dr. Phillip L. Chapman Department of Statistics, Colorado State University February 7, 2005 ORISE 05-0199 This document was produced under contract number DE-AC05-00OR22750 between the U.S. Department of Energy and Oak Ridge Associated Universities The authors of

  9. Microsoft Word - AL2005-01.doc

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Acquisition Letters (AL) that remain in effect are identified below. All other previously issued ALs have been superseded by a formal rule-making, incorporated into other guidance, and/or canceled. * * * * * * * * * * * * * * * ACQUISITION LETTERS REMAINING IN EFFECT NUMBER DATE SUBJECT 93-4 04/07/93 Displaced Workers Benefits Program 94-19 12/09/94 Basic Labor Policies Fringe Benefits 95-06 06/28/95 Personal Property Letter System 95-14 11/17/95 Subcontracts under the New Independent States -

  10. Microsoft Word - AL2006-08.doc

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Acquisition Letters (AL) that remain in effect are identified below. All other previously issued ALs have been superseded by a formal rule-making, incorporated into other guidance, and/or canceled. * * * * * * * * * * * * * * * ACQUISITION LETTERS REMAINING IN EFFECT NUMBER DATE SUBJECT 93-4 04/07/93 Displaced Workers Benefits Program 94-19 12/09/94 Basic Labor Policies Fringe Benefits 95-06 06/28/95 Personal Property Letter System 95-14 11/17/95 Subcontracts under the New Independent States -

  11. Microsoft Word - Hurricane Analysis v11.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Impact of Tropical Cyclones on Gulf of Mexico Crude Oil and Natural Gas Production Table of Contents 1. Summary 2. Tropical Cyclones in the Gulf of Mexico 3. Tropical Cyclone Impacts on Gulf of Mexico Oil and Natural Gas Production and Refinery Operations 4. Forecasting Shut-In Production A. Model 1: Using the NOAA Forecast of the Atlantic ACE Index to Estimate Shut- In Production B. Model 2: Using the NOAA Forecast of the Number of Atlantic Tropical Cyclones to Estimate Shut-In Production 5.

  12. Microsoft Word - PHMC_CoC.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    CERTIFICATE OF CONFORMANCE (CHPRC) Container Identification Number:_________________________________________________ Section 1. Vent The vent has been installed on this waste container and the waste packaging meets the requirements of HNF-EP-0063, Section 2.11.4. The vent is an approved vent listed in Appendix H of HNF-EP-0063 or has been approved for use. The vent on this container has been procured as a safety significant item. ~ N/A - Vent Not Required Per HNF-EP-0063 ~ N/A - Vent Procured

  13. Microsoft Word - RNA_folding_Herschlag.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    March 2003 Exploring the Folding Landscape of a Structured RNA by SAXS Rick Russell, Ian S. Millett, Sebastian Doniach and Daniel Herschlag Stanford University One goal of genome projects is to systematically identify genes (1,2). The best current knowledge indicates that humans carry approximately 35000 genes. This number is an estimate that varies from expert to expert and range up to 100,000 (3-5). To anyone who has taken an elementary biology class, this ambiguity must seem strange. How hard

  14. Microsoft Word - vision-spd.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Plan Vision Care for Life EVIDENCE OF COVERAGE Provided by: VISION SERVICE PLAN INSURANCE COMPANY 3333 Quality Drive, Rancho Cordova, CA 95670 (916) 851-5000 (800) 877-7195 Group Name: LOS ALAMOS NATIONAL SECURITY, LLC. Group Number: 12284390 Effective Date: JANUARY 1, 2016 EOC NM 03/02 09/10/15 Mzp To be filled in by employer in the event this document is used to develop a Summary Plan Description: NAME OF EMPLOYER: NAME OF PLAN: PRINCIPAL ADDRESS: EMPLOYER I.D.#: GROUP #: PLAN ADMINISTRATOR:

  15. Microsoft Word - EA March 05.doc

    Office of Legacy Management (LM)

    DOE/EA-1313 Rev. 0 Environmental Assessment of Ground Water Compliance at the Monument Valley, Arizona, Uranium Mill Tailings Site Final March 2005 Prepared by U.S. Department of Energy Office of Legacy Management Grand Junction, Colorado Work Performed Under DOE Contract No. DE-AC01-02GJ79491 for the U.S. Department of Energy Document Number U0069700 This Page Intentionally Blank DOE Office of Legacy Management EA of Ground Water Compliance at the Monument Valley Site March 2005 Final Page iii

  16. Microsoft Word - Q0032900-Aug-2004.doc

    Office of Legacy Management (LM)

    Q0032900 DOE-LM/GJ684-2004 Monticello Mill Tailings Site Operable Unit III Post-Record of Decision Monitoring Plan Draft Final August 2004 Work Performed by S.M. Stoller Corporation under DOE Contract No. DE-AC01-02GJ79491 for the U.S. Department of Energy Office of Legacy Management, Grand Junction, Colorado Document Number Q0032900 Contents U.S. Department of Energy MMTS OU III Post-ROD Monitoring Plan August 2004 Draft Final Page iii Contents Page

  17. Microsoft Word - S06010_Ltr.doc

    Office of Legacy Management (LM)

    6010 Task Order LM00-502 Control Number 10-0184 January 21, 2010 U.S. Department of Energy Office of Legacy Management ATTN: Jack Craig Site Manager 3600 Collins Ferry Road Morgantown, WV 26505 SUBJECT: Rulison Long-Term Hydrologic Monitoring Program Sampling and Analysis Results for 2009 Dear Mr. Craig: The U.S. Department of Energy (DOE) Office of Legacy Management conducted annual sampling at the Rulison, Colorado, Site for the Long-Term Hydrologic Monitoring Program (LTHMP) on May 11 and 12,

  18. Microsoft Word - U0184800-September 2003.doc

    Office of Legacy Management (LM)

    4800 GJO-2003-483-TAC GJO-GWTUB 30.13.2 UMTRA Ground Water Project Tuba City, Arizona, UMTRA Project Site Semi-Annual Performance Evaluation September 2002 through February 2003 September 2003 Prepared by U.S. Department of Energy Grand Junction Office Grand Junction, Colorado Work Performed Under DOE Contract No. DE-AC13-02GJ79491 This page intentionally left blank Document Number U0184800 Contents DOE/Grand Junction Office Tuba City UMTRA Project Site Semi-Annual Performance Evaluation

  19. Microsoft Word - U0192600_January 2004.doc

    Office of Legacy Management (LM)

    92600 GJO-2004-550-TAC Tuba City, Arizona, Land Management Project Site Semi-Annual Performance Evaluation March 2003 through August 2003 January 2004 Work Performed by S.M. Stoller Corporation under DOE Contract No. DE-AC01-02GJ79491 for the U.S. Department of Energy, Grand Junction, Colorado This page intentionally left blank Document Number U0192600 Contents DOE/Office of Legacy Management Tuba City Semi-Annual Performance Evaluation January 2004 Page iii Contents 1.0 Introduction

  20. Microsoft Word - U0199700_August 2004.doc

    Office of Legacy Management (LM)

    9700 DOE-EM/GJ708-2004 Tuba City, Arizona, Land Management Project Site Semi-Annual Performance Evaluation September 2003 through February 2004 August 2004 Work Performed by S.M. Stoller Corporation under DOE Contract No. DE-AC01-02GJ79491 for the U.S. Department of Energy, Grand Junction, Colorado This page intentionally left blank Document Number U0199700 Contents U.S. Department of Energy Tuba City Semi-Annual Performance Evaluation August 2004 Page iii Contents 1.0 Introduction

  1. Microsoft Word - u01493_July2002.doc

    Office of Legacy Management (LM)

    97-TAR MAC-GWSHP1.9 Final Ground Water Compliance Action Plan for Remediation at the Shiprock, New Mexico, UMTRA Site July 2002 U0149300 GJO-2001-297-TAR GWSHP1.9 Final Ground Water Compliance Action Plan for Remediation at the Shiprock, New Mexico, UMTRA Site July 2002 Prepared by U.S. Department of Energy Grand Junction Office Grand Junction, Colorado Work Performed under DOE Contract No. DE-AC13-96GJ87335 This page intentionally left blank Document Number U0149300 Contents DOE/Grand Junction

  2. Microsoft Word - UPDATE 2 - Unit 1.doc

    Office of Environmental Management (EM)

    2 to: A Dispersion Modeling Analysis of Downwash from Mirant's Potomac River Power Plant Modeling Unit 1 Emissions at Maximum and Minimum Loads ENSR Corporation December 20, 2005 Document Number 10350-002-410 (Update 2) December, 2005 1-1 1.0 INTRODUCTION This report describes AERMOD modeling results performed for Unit 1 at Mirant's Potomac River Generating Station. The purpose of these runs was to demonstrate that operation of Unit 1 for 24 hours a day at loads from 35 MW to 88 MW with the use

  3. Microsoft Word - ICMP2005Rev2.doc

    National Nuclear Security Administration (NNSA)

    49-REV2 INTEGRATED CLOSURE AND MONITORING PLAN for the Area 3 and Area 5 Radioactive Waste Management Sites at the Nevada Test Site Prepared for U.S. Department of Energy National Nuclear Security Administration Nevada Site Office under Contract Number DE-AC08-96NV11718 June 2005 DISCLAIMER NOTICE This report was prepared as an account of work sponsored by an agency of the U.S. Government. Neither the U.S. Government nor any agency thereof, nor any of their employees, nor any of their

  4. NSR Key Number Retrieval

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    NSR Key Number Retrieval Pease enter key in the box Submit

  5. Microsoft Word - Citrix_2FA_Authentication_12_3_2009.doc | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Citrix_2FA_Authentication_12_3_2009.doc Microsoft Word - Citrix_2FA_Authentication_12_3_2009.doc PDF icon Microsoft Word - Citrix_2FA_Authentication_12_3_2009.doc More Documents & Publications Citrix_2FA_Authentication_09.09 Using Two-Factor RSA Token with WebVPN User guide for remote access to VDI and Workplace using RSA token

  6. Microsoft Word - PressRelease_Siting_2-8-06_Final.doc | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy PressRelease_Siting_2-8-06_Final.doc Microsoft Word - PressRelease_Siting_2-8-06_Final.doc PDF icon Microsoft Word - PressRelease_Siting_2-8-06_Final.doc More Documents & Publications EIS-0394: Advance Notice of Intent to Prepare an Environmental Impact Statement EIS-0394: Notice of Intent to Prepare an Environmental Impact Statement EIS-0394: Draft Environmental Impact Statement

  7. Microsoft Word - SMail_Secure_Web-Based_Email_v3 _2_.doc | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy SMail_Secure_Web-Based_Email_v3 _2_.doc Microsoft Word - SMail_Secure_Web-Based_Email_v3 _2_.doc PDF icon Instructions for Using Secure Email via Outlook Web Access More Documents & Publications Using Two-Factor RSA Token with WebVPN Citrix_2FA_Authentication_09.09 Microsoft Word - Citrix_2FA_Authentication_12_3_2009.doc

  8. Microsoft Word - NSRC precompetitive User Agreement amended 1-18-07.doc |

    Office of Environmental Management (EM)

    Department of Energy NSRC precompetitive User Agreement amended 1-18-07.doc Microsoft Word - NSRC precompetitive User Agreement amended 1-18-07.doc PDF icon Microsoft Word - NSRC precompetitive User Agreement amended 1-18-07.doc More Documents & Publications EXHIBIT A: CRADA, WFO, PUA and NPUA Comparison Table, with suggested changes Class_Waiver_NPUA-2.pdf ClassWaiver-PUA.pdf

  9. Ex Parte Memo - 09 02 Mtg-09.09.10.doc | Department of Energy

    Office of Environmental Management (EM)

    Parte Memo - 09 02 Mtg-09.09.10.doc Ex Parte Memo - 09 02 Mtg-09.09.10.doc Summary of ex parte meeting on energy efficiency standards PDF icon Ex Parte Memo - 09 02 Mtg-09.09.10.doc More Documents & Publications Microsoft Word - Agenda for 9-2-10 DOE Mtg re EE of Fed Bldgs.doc Earthjustice, Appliance Standards Awareness Project, Natural Resources Defense Council - Comments in response to DOE solicitation of views on the implementation of test procedure waivers for large capacity clothes

  10. Microsoft Word - DP_cover_and_front matter_R1_Draft_3.DOC | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy R1_Draft_3.DOC Microsoft Word - DP_cover_and_front matter_R1_Draft_3.DOC PDF icon Microsoft Word - DP_cover_and_front matter_R1_Draft_3.DOC More Documents & Publications Microsoft Word - DP_cover_and_front matter_FINAL1.DOC WVDP Waste Incidental to Reprocessing Evaluation for the Concentrator Feed Makeup Tank and the Melter Feed Hold Tank Waste-Incidental-to-Reprocessing Evaluation for the West Valley Demonstration Project Vitrification Melter

  11. Microsoft Word - 25 May Vienna GTR Fact Sheet_FINAL 1 .doc |...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    1 .doc More Documents & Publications Global Threat Reduction Initiative U.S. Global Threat Reduction InitiativeU.S.-Origin Nuclear Fuel Removals Global Threat Reduction Initiative...

  12. Microsoft Word - DOE-ID-12-013 Colorado School of Mines.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    3 SECTION A. Project Title: Automated Serial Sectioning and Imaging in Support of Nuclear Materials Analysis - Colorado School of Mines SECTION B. Project Description The Colorado School of Mines will purchase a Robo-Met.3D automated polishing, serial-sectioning, and image acquisition station. The automated serial sectioning and imaging capabilities of the new system will expand the digital microstructure imaging and tomographic capabilities, allowing for the acquisition of micrometer scale 3-D

  13. Parallel processing data network of master and slave transputers controlled by a serial control network

    DOE Patents [OSTI]

    Crosetto, D.B.

    1996-12-31

    The present device provides for a dynamically configurable communication network having a multi-processor parallel processing system having a serial communication network and a high speed parallel communication network. The serial communication network is used to disseminate commands from a master processor to a plurality of slave processors to effect communication protocol, to control transmission of high density data among nodes and to monitor each slave processor`s status. The high speed parallel processing network is used to effect the transmission of high density data among nodes in the parallel processing system. Each node comprises a transputer, a digital signal processor, a parallel transfer controller, and two three-port memory devices. A communication switch within each node connects it to a fast parallel hardware channel through which all high density data arrives or leaves the node. 6 figs.

  14. Parallel processing data network of master and slave transputers controlled by a serial control network

    DOE Patents [OSTI]

    Crosetto, Dario B. (DeSoto, TX)

    1996-01-01

    The present device provides for a dynamically configurable communication network having a multi-processor parallel processing system having a serial communication network and a high speed parallel communication network. The serial communication network is used to disseminate commands from a master processor (100) to a plurality of slave processors (200) to effect communication protocol, to control transmission of high density data among nodes and to monitor each slave processor's status. The high speed parallel processing network is used to effect the transmission of high density data among nodes in the parallel processing system. Each node comprises a transputer (104), a digital signal processor (114), a parallel transfer controller (106), and two three-port memory devices. A communication switch (108) within each node (100) connects it to a fast parallel hardware channel (70) through which all high density data arrives or leaves the node.

  15. Application of three-dimensional digital image processing for reconstruction of microstructural volume from serial sections

    SciTech Connect (OSTI)

    Tewari, A.; Gokhale, A.M.

    2000-03-01

    Three-dimensional digital image processing is useful for reconstruction of microstructural volume from a stack of serial sections. Application of this technique is demonstrated via reconstruction of a volume segment of the liquid-phase sintered microstructure of a tungsten heavy alloy processed in the microgravity environment of NASA's space shuttle, Columbia. Ninety serial sections (approximately one micrometer apart) were used for reconstruction of the three-dimensional microstructure. The three-dimensional microstructural reconstruction clearly revealed that the tungsten grains are almost completely connected in three-dimensional space. Both the matrix and the grains are topologically co-continuous, although the alloy was liquid-phase sintered in microgravity. Therefore, absence of gravity did not produced a microstructure consisting of discrete isolated W grains uniformly dispersed in the liquid Ni-Fe alloy matrix at the sintering temperature.

  16. Serial time-resolved crystallography of photosystem II using a femtosecond

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    X-ray laser Serial time-resolved crystallography of photosystem II using a femtosecond X-ray laser Authors: Kupitz, Christopher; Basu, Shibom; Grotjohann, Ingo; Fromme, Raimund; Zatsepin, Nadia A.; Rendek, Kimberly N.; Hunter, Mark; Shoeman, Robert L.; White, Thomas A.; Wang, Dingjie; James, Daniel; Yang, Jay-How; Cobb, Danielle E.; Brenda, Reeder; Raymond, G. Sierra; Liu, Haiguang; Barty, Anton; Aquila, Andrew L.; Deponte, Daniel; Kirian, Richard A.; Bari, Sadia; Bergkamp, Jesse J.;

  17. PIC DOC 01/08/11 … SOS

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    PIC DOC 01/08/11 - SOS Content Outline 1) Usable Quotes We shouldn't equate public involvement with meetings. Maynard Plahuta [Meetings, of many kinds, are probably the most utilized of all the public involvement activities. Meetings are attempts at direct democracy, but often provide only limited opportunities for members of the public to engage with issues and decision makers. In many cases, this engagement is brief and comes only after the issues have been framed and a narrow menu of choices

  18. Microsoft Word - ex15-ITER-sept10.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    5 - Rights in Data-Special Works - ITER UT-B Contracts Div Sept 2010 Page 1 of 1 ex15-ITER-sept10.doc Exhibit 15-ITER Ref: FAR 52.227-17 RIGHTS IN DATA í SPECIAL WORKS í ITER (Sept 2010) (a) Definitions. (1) "Data", as used in this clause, means recorded information, regardless of form or the media on which it may be recorded. The term includes technical data and computer software. The term does not include information incidental to contract administration, such as financial,

  19. Microsoft Word - ex1b-ITER-mar07.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    B - Patent Rights - Acquisition by the Government - ITER UT-B Contracts Div March 2007 Page 1 of 6 ex1b-ITER-mar07.doc Exhibit 1B ITER Ref: DEAR 952.227-13 PATENT RIGHTS - ACQUISITION BY THE GOVERNMENT - ITER (Mar 2007) (a) Definitions. (1) "Invention", as used in this clause, means any invention or discovery which is or may be patentable or otherwise protectable under title 35 of the United States Code or any novel variety of plant that is or may be protectable under the Plant Variety

  20. Microsoft Word - ex9-ITER-june11.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    - Technical Data - ITER UT-B Contracts Div June 2011 Page 1 of 5 ex9-ITER-june11.doc Exhibit 9 ITER Ref: DEAR 927.409; FAR 52.227-14, 52.227-14 Alt.V, 52.227-16 TECHNICAL DATA - ITER (June 2011) 1. RIGHTS IN DATA - GENERAL (a) Definitions. (1) "Computer data bases," as used in this clause, means a collection of data in a form capable of, and for the purpose of, being stored in, processed, and operated on by a computer. The term does not include computer software. (2) "Computer