Powered by Deep Web Technologies
Note: This page contains sample records for the topic "doc number serial" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


1

Analysis of assembly serial number usage in domestic light-water reactors  

SciTech Connect (OSTI)

Domestic light-water reactor (LWR) fuel assemblies are identified by a serial number that is placed on each assembly. These serial numbers are used as identifiers throughout the life of the fuel. The uniqueness of assembly serial numbers is important in determining their effectiveness as unambiguous identifiers. The purpose of this study is to determine what serial numbering schemes are used, the effectiveness of these schemes, and to quantify how many duplicate serial numbers occur on domestic LWR fuel assemblies. The serial numbering scheme adopted by the American National Standards Institute (ANSI) ensures uniqueness of assembly serial numbers. The latest numbering scheme adopted by General Electric (GE), was also found to be unique. Analysis of 70,971 fuel assembly serial numbers from permanently discharged fuel identified 11,948 serial number duplicates. Three duplicate serial numbers were found when analysis focused on duplication within the individual fuel inventory at each reactor site, but these were traced back to data entry errors and will be corrected by the Energy Information Administration (EIA). There were also three instances where the serial numbers used to identify assemblies used for hot cell studies differed from the serial numbers reported to the EIA. It is recommended that fuel fabricators and utilities adhere to the ANSI serial numbering scheme to ensure serial number uniqueness. In addition, organizations collecting serial number information, should request that all known serial numbers physically attached or associated with each assembly be reported and identified by the corresponding number scheme. 10 refs., 5 tabs.

Reich, W.J. (Oak Ridge National Lab., TN (USA)); Moore, R.S. (Automated Sciences Group, Inc., Oak Ridge, TN (USA))

1991-05-01T23:59:59.000Z

2

Property:NEPA SerialNumber | Open Energy Information  

Open Energy Info (EERE)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data CenterFranconia, Virginia: Energy ResourcesLoadingPenobscot County,ContAddr2 Jump to:ManagingFieldOfficeApplicant MitigationSerialNumber

3

System and method for simultaneously collecting serial number information from numerous identity tags  

DOE Patents [OSTI]

A system and method are disclosed for simultaneously collecting serial number information reports from numerous colliding coded-radio-frequency identity tags. Each tag has a unique multi-digit serial number that is stored in non-volatile RAM. A reader transmits an ASCII coded ``D`` character on a carrier of about 900 MHz and a power illumination field having a frequency of about 1.6 Ghz. A one MHz tone is modulated on the 1.6 Ghz carrier as a timing clock for a microprocessor in each of the identity tags. Over a thousand such tags may be in the vicinity and each is powered-up and clocked by the 1.6 Ghz power illumination field. Each identity tag looks for the ``D`` interrogator modulated on the 900 MHz carrier, and each uses a digit of its serial number to time a response. Clear responses received by the reader are repeated for verification. If no verification or a wrong number is received by any identity tag, it uses a second digital together with the first to time out a more extended period for response. Ultimately, the entire serial number will be used in the worst case collision environments; and since the serial numbers are defined as being unique, the final possibility will be successful because a clear time-slot channel will be available. 5 figs.

Doty, M.A.

1997-01-07T23:59:59.000Z

4

International Journal of Systems Science, 1998, volume 29, number 9, pages 939-951 Performance analysis of serial production lines with quality  

E-Print Network [OSTI]

International Journal of Systems Science, 1998, volume 29, number 9, pages 939-951 Performance analysis of serial production lines with quality inspection machines M.-S. HANt, i.-T. LIMt* and D. The high production rate of machines in isolation and quality inspection machines are the basis of highly

Lim, Jong-Tae

5

Property:NEPA LeadAgencyDocNumber | Open Energy Information  

Open Energy Info (EERE)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data CenterFranconia, Virginia: Energy ResourcesLoadingPenobscot County,ContAddr2 Jump to:ManagingFieldOffice JumpApplicationFundingNumber

6

P:\\Room Numbering Standard\\MSU Room Number Standard 2012.doc 3/12/2012 Page 1 MSU Room Numbering Standard  

E-Print Network [OSTI]

and other spaces in university facilities. Numbering standards ensure continuity within the buildings is a customized standard that: · Accommodates a logical flow and pedestrian movement through buildings Numbering Standard. Minor renovations or additions to an existing building may continue to use existing room

Maxwell, Bruce D.

7

Ref. ESO doc number File name Document title Author MD03 E-PLA-MET-503-0003 e-pla-met-503-0003-future_man_dev_plan.pdf Future Development and Management Plan F. Molster  

E-Print Network [OSTI]

Ref. ESO doc number File name Document title Author MD03 E-PLA-MET-503-0003 e-pla-met-503 S. Hippler MD16 E-PLA-MET-503-0016 e-pla-met-503-0016-ait_plan.pdf AIT Plan F. Molster MD17 E

Siebenmorgen, Ralf

8

Authorized Limits for the Release of a 25 Ton Locomotive, Serial Number 21547, at the Area 25 Engine Maintenance, Assembly, and Disassembly Facility, Nevada Test Site, Nevada  

SciTech Connect (OSTI)

This document contains process knowledge and radiological data and analysis to support approval for release of the 25-ton locomotive, Serial Number 21547, at the Area 25 Engine Maintenance, Assembly, and Disassembly (EMAD) Facility, located on the Nevada Test Site (NTS). The 25-ton locomotive is a small, one-of-a-kind locomotive used to move railcars in support of the Nuclear Engine for Rocket Vehicle Application project. This locomotive was identified as having significant historical value by the Nevada State Railroad Museum in Boulder City, Nevada, where it will be used as a display piece. A substantial effort to characterize the radiological conditions of the locomotive was undertaken by the NTS Management and Operations Contractor, National Security Technologies, LLC (NSTec). During this characterization process, seven small areas on the locomotive had contamination levels that exceeded the NTS release criteria (limits consistent with U.S. Department of Energy [DOE] Order DOE O 5400.5, “Radiation Protection of the Public and the Environment”). The decision was made to perform radiological decontamination of these known accessible impacted areas to further the release process. On February 9, 2010, NSTec personnel completed decontamination of these seven areas to within the NTS release criteria. Although all accessible areas of the locomotive had been successfully decontaminated to within NTS release criteria, it was plausible that inaccessible areas of the locomotive (i.e., those areas on the locomotive where it was not possible to perform radiological surveys) could potentially have contamination above unrestricted release limits. To access the majority of these inaccessible areas, the locomotive would have to be disassembled. A complete disassembly for a full radiological survey could have permanently destroyed parts and would have ruined the historical value of the locomotive. Complete disassembly would also add an unreasonable financial burden for the contractor. A decision was reached between the NTS regulator and NSTec, opting for alternative authorized limits from DOE Headquarters. In doing so, NSTec personnel performed a dose model using the DOE-approved modeling code RESRAD-BUILD v3.5 to evaluate scenarios. The parameters used in the dose model were conservative. NSTec’s Radiological Engineering Calculation, REC-2010-001, “Public Dose Estimate from the EMAD 25 Ton Locomotive,” concluded that the four scenarios evaluated were below the 25-millirem per year limit, the “likely” dose scenarios met the “few millirem in a year” criteria, and that the EMAD 25-ton locomotive met the radiological requirements to be released with residual radioactivity to the public.

Jeremy Gwin and Douglas Frenette

2010-04-08T23:59:59.000Z

9

csms advising worksheet 2008-new numbers.doc (3/25/2009)1 The University of Montana Date  

E-Print Network [OSTI]

of Mathematical Sciences ID 790 - - Name Catalog for Graduation Email Math Advisor CS Advisor Advising Worksheet. Name Credit Term Grade Twelve Credits of M/STAT/MATH Electives* selected from 3- or 4-credit courses numbered above 307 (not including courses numbered 390-399 and 490-499). M/STAT/MATH ( ) M/STAT/MATH ( ) M/STAT

Bardsley, John

10

Policies, Procedures and Guidelines Duplicate and Replacement Parchments Diplomas and Certificates Procedures1.doc.doc  

E-Print Network [OSTI]

Policies, Procedures and Guidelines Duplicate and Replacement Parchments Diplomas and Certificates Procedures1.doc.doc Complete Policy Title: Duplicate and Replacement Parchments, Diplomas and Certificates Procedures Policy Number (if applicable): Approved by: Senate Date of Most Recent Approval: March 14, 2007

Haykin, Simon

11

DOCS SCMP (ANNOTATED OUTLINE)  

Broader source: Energy.gov (indexed) [DOE]

NMMSS PROJECT NMMSS UPGRADE SOFTWARE CONFIGURATION MANAGEMENT PLAN September 2001 Doc No: 135-PL-300A Revision: 1 REVIEWS AND APPROVALS Prepared by: ...

12

Lab 5: Serial Communication This lab introduces serial communication. Students will observe how serial communication  

E-Print Network [OSTI]

will observe how serial communication with the Arduino can help with troubleshooting and reading sensor data. Materials 1) Arduino Uno 2) Makeblock Shield 3) IR Reciever Module 4) IR Remote 5) 1Ã? RJ25 Cable 6) Wires Arduino through the USB cable. First, the serial communication needs to be initialized in the void setup

Wedeward, Kevin

13

Stochastic modeling of a serial killer  

E-Print Network [OSTI]

We analyze the time pattern of the activity of a serial killer, who during twelve years had murdered 53 people. The plot of the cumulative number of murders as a function of time is of "Devil's staircase" type. The distribution of the intervals between murders (step length) follows a power law with the exponent of 1.4. We propose a model according to which the serial killer commits murders when neuronal excitation in his brain exceeds certain threshold. We model this neural activity as a branching process, which in turn is approximated by a random walk. As the distribution of the random walk return times is a power law with the exponent 1.5, the distribution of the inter-murder intervals is thus explained. We confirm analytical results by numerical simulation.

Simkin, M V

2012-01-01T23:59:59.000Z

14

Standards for Serials Metadata and for Terms of Availability 1 Descriptive Standards for Serials Metadata and  

E-Print Network [OSTI]

Standards for Serials Metadata and for Terms of Availability 1 Descriptive Standards for Serials Metadata and Standards for Terms of Availability Metadata Two related eLib Supporting Studies commissioned by UKOLN David Martin Mark Bide Book Industry Communication AUGUST 1997 #12;Standards for Serials Metadata

Carr, Leslie

15

csep_transcript_aspen.doc | Department of Energy  

Broader source: Energy.gov (indexed) [DOE]

& Publications highperformanceleasingstrategiesforstateandlocalgovernments.doc Using Social Media to Engage the Community in Energy Efficiency Projects.doc...

16

Quantum serial turbo-codes  

E-Print Network [OSTI]

We present a theory of quantum serial turbo-codes, describe their iterative decoding algorithm, and study their performances numerically on a depolarization channel. Our construction offers several advantages over quantum LDPC codes. First, the Tanner graph used for decoding is free of 4-cycles that deteriorate the performances of iterative decoding. Secondly, the iterative decoder makes explicit use of the code's degeneracy. Finally, there is complete freedom in the code design in terms of length, rate, memory size, and interleaver choice. We define a quantum analogue of a state diagram that provides an efficient way to verify the properties of a quantum convolutional code, and in particular its recursiveness and the presence of catastrophic error propagation. We prove that all recursive quantum convolutional encoder have catastrophic error propagation. In our constructions, the convolutional codes have thus been chosen to be non-catastrophic and non-recursive. While the resulting families of turbo-codes have bounded minimum distance, from a pragmatic point of view the effective minimum distances of the codes that we have simulated are large enough not to degrade the iterative decoding performance up to reasonable word error rates and block sizes. With well chosen constituent convolutional codes, we observe an important reduction of the word error rate as the code length increases.

David Poulin; Jean-Pierre Tillich; Harold Ollivier

2009-06-10T23:59:59.000Z

17

Design Potential of Metal Foil Substrates for Optimized DOC Performanc...  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

Design Potential of Metal Foil Substrates for Optimized DOC Performance Design Potential of Metal Foil Substrates for Optimized DOC Performance Poster presentation at the 2007...

18

Diversification (PROF DOC) at WVU  

E-Print Network [OSTI]

announces the availability of two-year postdoctoral fellowship opportunities for highly qualified individuals from underrepresented groups with Ph.D.'s in the STEM disciplines. The PROF DOC postdoctoral university, orienting them to the academic profession. These two-year postdoctoral appointments come

Mohaghegh, Shahab

19

Serial Femtosecond Crystallography of G Protein-Coupled Receptors  

DOE Data Explorer [Office of Scientific and Technical Information (OSTI)]

Serial femtosecond crystallography data on microcrystals of 5-HT2B receptor bound to ergotamine grown in lipidic cubic phase.

Liu, Liu

20

PRVS-PLA-00005-0001 Executive Summary.doc PRECISION RADIAL VELOCITY  

E-Print Network [OSTI]

PRVS-PLA-00005-0001 Executive Summary.doc PRECISION RADIAL VELOCITY SPECTROMETER Document Title Executive Summary Document Number PRVS-PLA-00005-0001 Issue 1.0 Date 21st September 2006 Document Prepared and Date Ian Bryson 21st September 2006 #12;Document Number: PRVS-PLA-00005-0001 Issue: 1.0 Category

Crowther, Paul

Note: This page contains sample records for the topic "doc number serial" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


21

Solar Energy Applications Page 1 Rev. September 23, 2009 Field Office Serial  

E-Print Network [OSTI]

Solar Energy Applications Page 1 Rev. September 23, 2009 Field Office Serial Number Project Name) Located in Maricopa Co., north of Mobile AZ. Pending 9. AZA 034187 Sonoran Solar Energy Project Boulevard Co. South of Gila Bend Pending #12;Solar Energy Applications Page 2 Rev. September 23, 2009 Field

Laughlin, Robert B.

22

Minor in Chemistry Handout1.doc (04/30/08) Department of Chemistry  

E-Print Network [OSTI]

Minor in Chemistry Handout1.doc (04/30/08) Department of Chemistry Undergraduate Student Academic.fleming@ucr.edu Minor in Chemistry Procedure: It is assumed that you have completed the requirements listed in section to Declare a Minor to Chemistry. Include the following: full name, student identification number, and email

Reed, Christopher A.

23

Microsoft Word - PART 970.doc  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious Rank EERE:Year in3.pdfEnergy HealthComments MEMA:May1.docEx ParteNationalPolicyAssurances907.rtf

24

Testing Dependence Among Serially Correlated Multi-category Variables  

E-Print Network [OSTI]

Testing Dependence Among Serially Correlated Multi-category Variables M. Hashem Pesaran and Allan Timmermann July 2006 CWPE 0648 Testing Dependence Among Serially Correlated... Multi-category Variables? M. Hashem Pesaran Cambridge University Allan Timmermann University of California, San Diego July 3, 2006 ?We benefitted from the comments of Herman van Dijk and Adrian Pagan and from participants at the Econometric Institute...

Pesaran, M Hashem; Timmermann, Allan

25

CH 6 REFERENCES.DOC 6-1 6 References  

E-Print Network [OSTI]

REFERENCES.DOC Allan, S., A. R. Buckley, and J. E. Meacham. 2001. Atlas of Oregon. Second Edition. William J

26

Switch for serial or parallel communication networks  

DOE Patents [OSTI]

A communication switch apparatus and a method for use in a geographically extensive serial, parallel or hybrid communication network linking a multi-processor or parallel processing system has a very low software processing overhead in order to accommodate random burst of high density data. Associated with each processor is a communication switch. A data source and a data destination, a sensor suite or robot for example, may also be associated with a switch. The configuration of the switches in the network are coordinated through a master processor node and depends on the operational phase of the multi-processor network: data acquisition, data processing, and data exchange. The master processor node passes information on the state to be assumed by each switch to the processor node associated with the switch. The processor node then operates a series of multi-state switches internal to each communication switch. The communication switch does not parse and interpret communication protocol and message routing information. During a data acquisition phase, the communication switch couples sensors producing data to the processor node associated with the switch, to a downlink destination on the communications network, or to both. It also may couple an uplink data source to its processor node. During the data exchange phase, the switch couples its processor node or an uplink data source to a downlink destination (which may include a processor node or a robot), or couples an uplink source to its processor node and its processor node to a downlink destination. 9 figs.

Crosette, D.B.

1994-07-19T23:59:59.000Z

27

Microsoft Word - AL2006-08.doc | Department of Energy  

Energy Savers [EERE]

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Office of Inspector General Office0-72.pdfGeorgeDoesn't32 Master EM ManagementWe2.doc Microsoft3.doc2.doc7.doc8.doc

28

Corporate serial acquisitions: An empirical test of the learning hypothesis  

E-Print Network [OSTI]

2007/23 Corporate serial acquisitions: An empirical test of the learning hypothesis Nihat Aktas: An empirical test of the learning hypothesis Nihat AKTAS1, Eric DE BODT2 and Richard ROLL3 March2007 Abstract

Nesterov, Yurii

29

Microsoft Word - Agenda F&I Update 090804.doc | Department of...  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

Agenda F&I Update 090804.doc Microsoft Word - Agenda F&I Update 090804.doc More Documents & Publications Agenda Slide 1 Microsoft Word - Issue FY2009 Q4 Draft 20090910.doc...

30

Effectiveness of a Diesel Oxidation Catalyst (DOC) to control...  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

Effectiveness of a Diesel Oxidation Catalyst (DOC) to control CO and hydrocarbon emissions from Reactivity Controlled Compression Ignition (RCCI) combustion Effectiveness of a...

31

Microsoft Word - IMBA Gap Analysis Final 20060831.doc  

Broader source: Energy.gov (indexed) [DOE]

Assurance ProcessProcedure (SQAPP) * User Interface Enhancement (UI) * DocumentationMedia (DOC) * Training (TRAIN) * Communications (COM) Table 4.2 Summary of Recommendations...

32

Microsoft Word - AL2006-07.doc | Department of Energy  

Energy Savers [EERE]

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Office of Inspector General Office0-72.pdfGeorgeDoesn't32 Master EM ManagementWe2.doc Microsoft3.doc2.doc7.doc

33

Community Development Finance Institutions-Opportunities for Partnerships with Energy Efficiency Programs Transcript.doc  

Broader source: Energy.gov [DOE]

Community Development Finance Institutions-Opportunities for Partnerships with Energy Efficiency Programs Transcript.doc

34

Energy Savings Performance Contracting-Savings Measurement and Verification Transcript 2-24-2011.doc  

Broader source: Energy.gov [DOE]

Energy Savings Performance Contracting-Savings Measurement and Verification Transcript 2-24-2011.doc

35

Turbo Decoding for PR4: Parallel Versus Serial Concatenation Tom Souvignier  

E-Print Network [OSTI]

Turbo Decoding for PR4: Parallel Versus Serial Concatenation Tom Souvignier , Arnon Friedmann Diego Quantum Corporation Seagate Technology Abstract -- Recent work on the application of turbo results comparing the parallel and serial concatenation systems will be presented. I. INTRODUCTION Turbo

Siegel, Paul H.

36

Haptic Rendering of Topological Constraints to Users Manipulating Serial Virtual Linkages  

E-Print Network [OSTI]

Haptic Rendering of Topological Constraints to Users Manipulating Serial Virtual Linkages Daniela-- This paper presents an approach for haptic rendering of topological constraints to users operating serial rendering. I. INTRODUCTION Haptic interaction with physically-motivated virtual en- vironments provides

Constantinescu, Daniela

37

car_app1.doc STAFF PARKING PERMIT APPLICATION  

E-Print Network [OSTI]

and drop off points Frequency of lifts (days per week) 6. Car Sharing You can share a group permit with upcar_app1.doc STAFF PARKING PERMIT APPLICATION The information supplied on this form will allow (whichever is quicker) from campus to home? (Departing campus at 1700 hours) #12;car_app1.doc 4. Staff

Haase, Markus

38

Microsoft Word - summer.doc  

U.S. Energy Information Administration (EIA) Indexed Site

report indicating an almost 20-percent increase since the end of May in the number of drilling rigs searching for natural gas (380 vs. 450) in the United States. The July contract...

39

954ER4 Specification 4 ports RS-232 PCI-Express Serial cards  

E-Print Network [OSTI]

954ER4 Specification 4 ports RS-232 PCI-Express Serial cards FEATURES 4 independent RS-232 serial ports with communication speeds up to 230 921 ­­­­Kbps Designed to meet PCI-Express Base Specification PC system. Majority of today's motherboard no longer come with serial ports or only have one port

Berns, Hans-Gerd

40

Microsoft Word - S07050_WM.doc  

Office of Legacy Management (LM)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) "ofEarlyEnergyDepartment ofDepartment ofofOxford SiteToledo SiteTonawandaUniversity of Doc. No. S068155-1

Note: This page contains sample records for the topic "doc number serial" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


41

Index2.doc | Department of Energy  

Broader source: Energy.gov (indexed) [DOE]

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) "of EnergyEnergyENERGYWomentheATLANTA,Fermi NationalBusiness PlanPosting of|of Department of EnergyIndex2.doc

42

Microsoft Word - AL2006-10.doc  

Energy Savers [EERE]

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Office of Inspector General Office0-72.pdfGeorgeDoesn't32 Master EM ManagementWe2.docAL-2006-10 Acquisition Regulation

43

AcqGuide41pt1.doc  

Office of Environmental Management (EM)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) "of EnergyEnergy Cooperation |South ValleyASGovLtr.pdfAbout thept1.doc�41 (December 2004) Utilities

44

AcqGuide42pt1.doc  

Office of Environmental Management (EM)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) "of EnergyEnergy Cooperation |South ValleyASGovLtr.pdfAbout thept1.doc�41 (December 2004)October 2010)

45

AcqGuide42pt3.doc  

Office of Environmental Management (EM)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) "of EnergyEnergy Cooperation |South ValleyASGovLtr.pdfAbout thept1.doc�41 (December 2004)October42.3

46

AcqGuide47pt1.doc  

Office of Environmental Management (EM)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) "of EnergyEnergy Cooperation |South ValleyASGovLtr.pdfAbout thept1.doc�41 (December47.1 (June 2004) 1

47

AcqGuide4pt2.doc  

Office of Environmental Management (EM)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) "of EnergyEnergy Cooperation |South ValleyASGovLtr.pdfAbout thept1.doc�41 (December47.1 (June 2004)2

48

AcqGuide70pt28.doc  

Office of Environmental Management (EM)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) "of EnergyEnergy Cooperation |South ValleyASGovLtr.pdfAbout thept1.doc�41 (December47.1 (June70.28

49

AcqGuide70pt31.doc  

Office of Environmental Management (EM)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) "of EnergyEnergy Cooperation |South ValleyASGovLtr.pdfAbout thept1.doc�41 (December47.1

50

AcqGuide70pt3270.doc  

Office of Environmental Management (EM)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) "of EnergyEnergy Cooperation |South ValleyASGovLtr.pdfAbout thept1.doc�4170.3270 (April 2007) 1 Guide

51

AcqGuide70pt4.doc  

Office of Environmental Management (EM)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) "of EnergyEnergy Cooperation |South ValleyASGovLtr.pdfAbout thept1.doc�4170.3270 (April 2007) 1

52

AcqGuide70pt44.doc  

Office of Environmental Management (EM)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) "of EnergyEnergy Cooperation |South ValleyASGovLtr.pdfAbout thept1.doc�4170.3270 (April 2007)

53

AcqGuide70pt5.doc  

Office of Environmental Management (EM)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) "of EnergyEnergy Cooperation |South ValleyASGovLtr.pdfAbout thept1.doc�4170.3270 (April 2007)0.5

54

AcqGuide70pt9.doc  

Office of Environmental Management (EM)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) "of EnergyEnergy Cooperation |South ValleyASGovLtr.pdfAbout thept1.doc�4170.3270 (April-

55

AcqGuide9pt1.doc  

Office of Environmental Management (EM)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) "of EnergyEnergy Cooperation |South ValleyASGovLtr.pdfAbout thept1.doc�4170.3270 (April-.3-OPAM1

56

AcqGuide9pt2.doc  

Office of Environmental Management (EM)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) "of EnergyEnergy Cooperation |South ValleyASGovLtr.pdfAbout thept1.doc�4170.32702 (March 2004)

57

AcqGuide9pt3.doc  

Office of Environmental Management (EM)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) "of EnergyEnergy Cooperation |South ValleyASGovLtr.pdfAbout thept1.doc�4170.32702 (March--------------

58

Microsoft Word - Berger Radiological Conditions.doc  

Office of Legacy Management (LM)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) "ofEarlyEnergyDepartment ofDepartment ofof EnergyYou$0.C. 20545*. . : '*I_1 September2 June 2012 Doc.

59

Microsoft Word - Pincus-R.doc  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: VegetationEquipment Surfaces andMappingENVIRONMENTALHYDROPOWERFebruarySavebasedSAR.doc MicrosoftUsing

60

Microsoft Word - Poellot-MR.doc  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: VegetationEquipment Surfaces andMappingENVIRONMENTALHYDROPOWERFebruarySavebasedSAR.doc

Note: This page contains sample records for the topic "doc number serial" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


61

Microsoft Word - al93-4.doc  

Energy Savers [EERE]

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Office of Inspector General Office0-72.pdfGeorgeDoesn't32 MasterAcquisiti ---- Contra Seeal2005-06.doc Microsoft 93-4

62

Microsoft Word - al94-19.doc  

Energy Savers [EERE]

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Office of Inspector General Office0-72.pdfGeorgeDoesn't32 MasterAcquisiti ---- Contra Seeal2005-06.doc Microsoft

63

Microsoft Word - fal2004-04.doc  

Energy Savers [EERE]

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious RankCombustion |EnergyonSupport0.pdf5 OPAM SEMIANNUAL REPORTMAMayCross Reference40 USGuideal94-19.doc8

64

Microsoft Word - FAL2004-05.doc  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious Rank EERE:Year in3.pdfEnergy HealthComments MEMA:May1.docEx Parte Memo.docx Microsoft Word - Ex8Federal5

65

Microsoft Word - AL2005-16.doc | Department of Energy  

Energy Savers [EERE]

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Office of Inspector General Office0-72.pdfGeorgeDoesn't32 Master EM ManagementWe2.doc Microsoft3.doc Microsoft6.doc

66

Microsoft Word - AL2006-02.doc | Department of Energy  

Energy Savers [EERE]

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Office of Inspector General Office0-72.pdfGeorgeDoesn't32 Master EM ManagementWe2.doc Microsoft3.doc2.doc Microsoft

67

Microsoft Word - AL2006-03.doc | Department of Energy  

Energy Savers [EERE]

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Office of Inspector General Office0-72.pdfGeorgeDoesn't32 Master EM ManagementWe2.doc Microsoft3.doc2.doc

68

http://www.essex.ac.uk/chimera/ CHIMERA WORKING PAPER NUMBER: 2005-07  

E-Print Network [OSTI]

http://www.essex.ac.uk/chimera/ CHIMERA WORKING PAPER NUMBER: 2005-07 CWP-2005-07-Lesnard-Social-Change-Fin.doc Social Change, Daily Life and the Internet Chimera Working Paper Number: 2005-07 Dr Laurent Lesnard1 Author's current address: laurent.lesnard@sciences-po.fr #12;CHIMERA WORKING PAPER NUMBER: 2005-07 CWP

Paris-Sud XI, Université de

69

NanoSciences Fondation Post-doc Position 2010  

E-Print Network [OSTI]

NanoSciences Fondation Post-doc Position ­ 2010 Postdoctoral position on SQUID microscopy The SuperNanoCharac project of the NanoSciences Fondation (Grenoble, France) seeks outstanding candidates for a postdoctoral

Canet, Léonie

70

T-527: OpenSC Smart Card Serial Number Multiple Buffer Overflow Vulnerabilities  

Broader source: Energy.gov [DOE]

OpenSC is prone to multiple buffer-overflow vulnerabilities because the application fails to perform adequate boundary checks on user-supplied input. Attackers may leverage these issues to execute arbitrary code in the context of the application. Failed attacks will cause denial-of-service conditions.

71

T-527: OpenSC Smart Card Serial Number Multiple Buffer Overflow...  

Broader source: Energy.gov (indexed) [DOE]

Pidgin 'mxitshowmessage()' Function Stack-Based Buffer Overflow Vulnerability U-202: Apple QuickTime Multiple Stack Overflow Vulnerabilities T-543: Wireshark 0.8.20 through...

72

Hi-speed versatile serial crate controller for CAMAC  

SciTech Connect (OSTI)

A serial crate controller, primarily for use in the SLC CAMAC control system, has been designed, and has been in use for about 2 years. The design supports a party line approach, with up to 16 crates on a single twisted pair for data transfers, plus another pair for prompt L response. The bit rate is 5 megabits/s, and complete transaction times of about 10 ..mu..s are achieved for 16-bit data transfers over cables up to 1000 feet long. One of the primary objects of the design was simplicity - there are approximately 60 chips in the two-board unit.

Horelick, D.

1984-10-01T23:59:59.000Z

73

Microsoft Word - FY07AnnualReport.doc | Department of Energy  

Office of Environmental Management (EM)

Microsoft Word - FY07AnnualReport.doc More Documents & Publications Microsoft Word - FY08AnnualReport.doc Audit Report: IG-0857 Attachment 5 Volume II Pricing Matrix.xls&0;...

74

Microsoft Word - July 2008 PMCDP Module CHRIS ESS Tutorial.doc...  

Broader source: Energy.gov (indexed) [DOE]

Microsoft Word - July 2008 PMCDP Module CHRIS ESS Tutorial.doc Microsoft Word - July 2008 PMCDP Module CHRIS ESS Tutorial.doc Microsoft Word - July 2008 PMCDP Module CHRIS ESS...

75

N:\\int\\alle\\BERATUNG\\Sprachtests\\Sprachzeugnis deutsch.doc Sprachzeugnis fr deutsche Bewerber  

E-Print Network [OSTI]

N:\\int\\alle\\BERATUNG\\Sprachtests\\Sprachzeugnis deutsch.doc Sprachzeugnis für deutsche Bewerber Name Internationales Outgoings #12;N:\\int\\alle\\BERATUNG\\Sprachtests\\Sprachzeugnis deutsch.doc Common Reference Levels

Kaus, Boris

76

A computerized serials record system for the Texas A&M University Library  

E-Print Network [OSTI]

Handling Evaluation of Manual System III OTHER AUTOMATED SYSTEMS Operational Systems Proposed Systems ~ 5 13 IV PROPOSED SYSTEM Design Parameters File Organization Input Requirements Proposed Outputs Proposed Data Handling Record Conversion... VI PROPOSED SYSTEM FLOW CHARTS 17 38 53 68 83 107 LIST OF FIGURES 1 Kardex Arrival Card . 2 Kardex Order Card . 3 Order' Subfile Card 4L Serials Holdings Card . 4B Serials Holdings Card ? Back 5 Serials Iacks Card 6A Bindery Card 6B...

Stewart, Bruce Warren

1965-01-01T23:59:59.000Z

77

IRA Pivot Views Appendix.doc; 4/9/2009 GL Transactions: Pivot Table 2  

E-Print Network [OSTI]

IRA Pivot Views Appendix.doc; 4/9/2009 GL Transactions: Pivot Table 2 #12;IRA Pivot Views Appendix.doc; 4/9/2009 GL Transactions by Date Range: Pivot Table 2 #12;IRA Pivot Views Appendix.doc; 4/9/2009 GL Rollup Report: Pivot Table 2 #12;IRA Pivot Views Appendix.doc; 4/9/2009 GL Rollup Operating Report: Pivot

78

The effect of meaningfulness on the shape of the serial position curve  

E-Print Network [OSTI]

to test the hypothesis that the controlling stimulus in serial learning is the position an item occupies in a serial list, and therefore the shape of the serial position curve is invariant. This hypothesis was tested by stratifying meaningfulness... in the tails. List 3, the control list, consisted of a randomly generated sequence of the same words in lists 1 and 2. It was hypothesized that if meaningfulness could affect the shape of the serial position curve, then the learning curve for list 1 would...

Edwards, Mark Lee

1970-01-01T23:59:59.000Z

79

An Econometric Model of Serial Correlation and Illiquidity In Hedge Fund Returns  

E-Print Network [OSTI]

The returns to hedge funds and other alternative investments are often highly serially correlated in sharp contrast to the returns of more traditional investment vehicles such ...

Getmansky, Mila

2003-03-14T23:59:59.000Z

80

Seriality, the Literary and Database in Homestar Runner: Some Old Issues in New Media  

E-Print Network [OSTI]

been reconfigured in digital media. Using Homestar Runner asthe range of what many digital media scholars might strictlyheavily on serial logics. Digital media and specifically, a

Boluk, Stephanie

2009-01-01T23:59:59.000Z

Note: This page contains sample records for the topic "doc number serial" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


81

Learning, hubris and corporate serial acquisitions Nihat Aktas, Eric de Bodt,  

E-Print Network [OSTI]

2007/68 Learning, hubris and corporate serial acquisitions Nihat Aktas, Eric de Bodt, and Richard Roll #12;CORE DISCUSSION PAPER 2007/68 Learning, hubris and corporate serial acquisitions Nihat AKTAS1 empirical hypotheses. 1 CORE & IAG, Université catholique de Louvain, Belgium. E-mail: nihat

Nesterov, Yurii

82

Improved Upper Bounds on the ML Decoding Error Probability of Parallel and Serial Concatenated Turbo  

E-Print Network [OSTI]

Turbo Codes via their Ensemble Distance Spectrum Igal Sason and Shlomo Shamai (Shitz) Department The ensemble performance of parallel and serial concatenated turbo codes is considered, where the ensemble enumeration functions of the ensembles of random parallel and serial concatenated turbo codes,the tangential

Sason, Igal

83

Joint Stiffness Identification of Six-revolute Industrial Serial Robots Claire Dumas  

E-Print Network [OSTI]

Joint Stiffness Identification of Six-revolute Industrial Serial Robots Claire Dumas , St the stiffness of industrial robots from robot manufacturers. As a consequence, this paper introduces a robust and fast procedure that can be used to identify the joint stiffness values of any six-revolute serial robot

Paris-Sud XI, Université de

84

Doc'Up, association des doctorants de Sorbonne Universit Sige social : 15 rue de l'cole de mdecine, 75006 Paris  

E-Print Network [OSTI]

Doc'Up, association des doctorants de Sorbonne Université Siège social : 15 place Jussieu, 75252 Paris cedex 05 Association Doc'Up Site internet : www.doc-up.info Pour nous contacter : contact@doc-up.info Liste Doc'Up pour l'élection des

Arleo, Angelo

85

3D Reconstruction of Intricate Archean Microbial Structures Using Neutron Computed Tomography and Serial SectioningIN43B-0331 Abstract Project Goals  

E-Print Network [OSTI]

Tomography and Serial SectioningIN43B-0331 Abstract Project Goals Background Methods Neutron Computed using both serial sectioning and neutron computed tomography (NCT). Reconstruction techniques vary mechanisms for ancient microbial communities Neutron Computed Tomography Serial Sectioning Samples were

Hamann, Bernd

86

Microsoft Word - FORM46002.doc | Department of Energy  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious RankCombustion | Department ofT ib l L d F S i DOE Tribalthe Native Hawaiian Legal )2010 |Vehicle1.doc2.doc

87

Microsoft Word - AL2004-02.doc | Department of Energy  

Energy Savers [EERE]

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Office of Inspector General Office0-72.pdfGeorgeDoesn't32 Master EM ManagementWe atARRASafetyALREDO32-03.doc4-02.doc

88

Microsoft Word - AL2005-02.doc | Department of Energy  

Energy Savers [EERE]

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Office of Inspector General Office0-72.pdfGeorgeDoesn't32 Master EM ManagementWe2.doc Microsoft Word - AL2005-02.doc

89

Microsoft Word - AL2005-07.doc | Department of Energy  

Energy Savers [EERE]

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Office of Inspector General Office0-72.pdfGeorgeDoesn't32 Master EM ManagementWe2.doc Microsoft Word07.doc Microsoft

90

Microsoft Word - AL2005-10.doc | Department of Energy  

Energy Savers [EERE]

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Office of Inspector General Office0-72.pdfGeorgeDoesn't32 Master EM ManagementWe2.doc Microsoft Word07.doc

91

Microsoft Word - AL2005-11.doc | Department of Energy  

Energy Savers [EERE]

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Office of Inspector General Office0-72.pdfGeorgeDoesn't32 Master EM ManagementWe2.doc Microsoft Word07.docMicrosoft

92

Microsoft Word - AL2005-13.doc | Department of Energy  

Energy Savers [EERE]

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Office of Inspector General Office0-72.pdfGeorgeDoesn't32 Master EM ManagementWe2.doc Microsoft3.doc Microsoft Word -

93

Microsoft Word - AL2005-14.doc | Department of Energy  

Energy Savers [EERE]

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Office of Inspector General Office0-72.pdfGeorgeDoesn't32 Master EM ManagementWe2.doc Microsoft3.doc Microsoft Word

94

Microsoft Word - AL2005-15.doc | Department of Energy  

Energy Savers [EERE]

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Office of Inspector General Office0-72.pdfGeorgeDoesn't32 Master EM ManagementWe2.doc Microsoft3.doc Microsoft

95

Microsoft Word - AL2006-01.doc | Department of Energy  

Energy Savers [EERE]

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Office of Inspector General Office0-72.pdfGeorgeDoesn't32 Master EM ManagementWe2.doc Microsoft3.doc

96

Microsoft Word - AL2008-05.doc | Department of Energy  

Energy Savers [EERE]

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Office of Inspector General Office0-72.pdfGeorgeDoesn't32 Master EM ManagementWe2.docAL-2006-105.doc Microsoft Word -

97

Microsoft Word - AL2008-06.doc | Department of Energy  

Energy Savers [EERE]

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Office of Inspector General Office0-72.pdfGeorgeDoesn't32 Master EM ManagementWe2.docAL-2006-105.doc Microsoft Word

98

Microsoft Word - ARRAAttachment2.doc | Department of Energy  

Energy Savers [EERE]

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Office of Inspector General Office0-72.pdfGeorgeDoesn't32 Master EM ManagementWe2.docAL-2006-105.docARPA-E

99

AcqGuide3pt1.doc | Department of Energy  

Office of Environmental Management (EM)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) "of EnergyEnergy Cooperation |South ValleyASGovLtr.pdfAbout thept1.doc� AcqGuide3pt1.doc�

100

Microsoft Word - al95-06.doc | Department of Energy  

Energy Savers [EERE]

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Office of Inspector General Office0-72.pdfGeorgeDoesn't32 MasterAcquisiti ---- Contra Seeal2005-06.doc Microsoft06.doc

Note: This page contains sample records for the topic "doc number serial" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


101

Microsoft Word - al96-09.doc | Department of Energy  

Energy Savers [EERE]

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Office of Inspector General Office0-72.pdfGeorgeDoesn't32 MasterAcquisiti ---- Contra Seeal2005-06.doc6-09.doc

102

Microsoft Word - canceled -7 Section A April 16 2010.doc  

Office of Environmental Management (EM)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) "of EnergyEnergyENERGY TAXBalanced Scorecard Federal2 to: A Dispersion Modeling4.doc Microsoft6-09.docA p p r

103

Exploiting Points-to Maps for De-/Serialization Code Generation  

SciTech Connect (OSTI)

Serialization code generators for C++ have restrictions on the implementation of dynamic arrays and void/function pointers. If the target program is not implemented with these restrictions, de- velopers have to manually change the source code to facilitate se- rialization code generation. Unfortunately, such changes hamper the benefits of code generation, and they are not localized. This pa- per presents the de-/serialization code generator Ser++ that does not restrict the implementation of these pointer types and, hence, eliminates the need to adapt the source code for serialization code generation. Ser++ can be considered an aspect weaver that i) traces the pointers, ii) identifies the statements in which properties regard- ing the serialization of pointer attributes can be extracted and, finally, iii) weaves the code to store these properties at runtime. It generates the de-/serialization functions in such a way that they serialize the pointer attributes according to the stored values of the properties. We have successfully used Ser++ to generate de- /serialization methods for a computer architecture and a power- flow simulator, without any modifications to the existing source code.

Ciraci, Selim; Villa, Oreste

2013-03-18T23:59:59.000Z

104

TWP93.0100104 DOC#: TWP-DOC-1.4 SCIENCE AND SITING STRATEGY FOR THE  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmosphericNuclear Security AdministrationcontrollerNanocrystallineForeign ObjectOUR TECHNOLOGIESTWP93.0100104 DOC#: TWP-DOC-1.4

105

Microsoft Word - VIPERS instructions.doc  

Office of Environmental Management (EM)

Name Number Recipient Information Number Fill in if applicable and Street and Street City, State Recipient Information City, State and ZIP Code and ZIP Code 11. COMPUTATION OF...

106

Serially connected solid oxide fuel cells having monolithic cores  

DOE Patents [OSTI]

Disclosed is a solid oxide fuel cell for electrochemically combining fuel and oxidant for generating galvanic output. The cell core has an array of cell segments electrically serially connected in the flow direction, each segment consisting of electrolyte walls and interconnect that are substantially devoid of any composite inert materials for support. Instead, the core is monolithic, where each electrolyte wall consists of thin layers of cathode and anode materials sandwiching a thin layer of electrolyte material therebetween. Means direct the fuel to the anode-exposed core passageways and means direct the oxidant to the cathode-exposed core passageways; and means also direct the galvanic output to an exterior circuit. Each layer of the electrolyte composite materials is of the order of 0.002 to 0.01 cm thick; and each layer of the cathode and anode materials is of the order of 0.002 to 0.05 cm thick. Between 2 and 50 cell segments may be connected in series.

Herceg, J.E.

1985-05-20T23:59:59.000Z

107

VISA -Canada.doc March 2012 StudyAbroad@Exeter  

E-Print Network [OSTI]

VISA - Canada.doc March 2012 StudyAbroad@Exeter Visa info Canada IMMIGRATION INFORMATION ­ CANADA are going to study in Canada for more than six months. If you are going to study in Canada for less than six be purchased at most major banks. This draft should be made payable to: THE RECEIVER GENERAL FOR CANADA Please

Mumby, Peter J.

108

________________________________________________________________ F. Ceriotti cv_ceriotti.doc 1/13  

E-Print Network [OSTI]

, upgraded to ISO 9001:2000 in July 2002 and to ISO #12 of Quality Manager for ISO 9000 Certification of the Clinical Laboratory (certification obtained in July 1998_ceriotti.doc 2/13 9001:2008 in October 2008). From November 2002 he has the title of Director for the area

Rodriguez, Carlos

109

VISA -Australia.doc March 2012 StudyAbroad@Exeter  

E-Print Network [OSTI]

VISA - Australia.doc March 2012 StudyAbroad@Exeter Visa info Australia IMMIGRATION INFORMATION ­ AUSTRALIA APPLYING FOR A STUDENT VISA ­ NON-AWARD VISA Who needs one? You will need a student visa if you are going to study in Australia for more than three months. Which visa? You should apply for a Non

Mumby, Peter J.

110

VISA -Mexico.doc March 2012 StudyAbroad@Exeter  

E-Print Network [OSTI]

VISA - Mexico.doc March 2012 StudyAbroad@Exeter Visa info Mexico IMMIGRATION INFORMATION ­ MEXICO anticipated stay in Mexico with photocopy of photo page. Photographs Three passport-sized frontal photos entry into Mexico. · Within 30 days of arrival in Mexico the student must register at the National

Mumby, Peter J.

111

DCLOSSP3.DOC ADAPTATION OF "SPICE3'' TO SIMULATION OF  

E-Print Network [OSTI]

DCLOSSP3.DOC ADAPTATION OF "SPICE3'' TO SIMULATION OF LOSSY MULTIPLE-COUPLED TRANSMISSION LINES simulation of transients in networks that include multiple, coupled lossy transmission lines. Widely used circuit simulator, SPICE, does not have facilities for simulation of multi-conductor transmission lines

Palusinski, Olgierd A.

112

REPORT OF POSSIBLE VIOLATION Campus Community Report 2008.doc  

E-Print Network [OSTI]

REPORT OF POSSIBLE VIOLATION Campus Community Report 2008.doc 1. Student Information Date of report: Student Last Name (if known): Student First Name: Student ID # 2. Reporting Party Information Your Last in which we may be able to respond to anonymous reports. 3. Type of Report: Honor: Lying Cheating Stealing

Swaddle, John

113

CV INA KONING Post-doc researcher at Utrecht University  

E-Print Network [OSTI]

1 CV INA KONING Post-doc researcher at Utrecht University Universiteit Utrecht May 2011 ­ Present (1 year 11 months) PhD student on alcohol prevention among early adolescents Utrecht University March early adolescents and their parents. The project was carried out by the Utrecht University

Oro, Daniel

114

13_030318_CLN_01.doc TO: DISTRIBUTION  

E-Print Network [OSTI]

itself is not accessible. So, the equivalent contact resistance must be backed out of the measurement, the equivalent resistance of the joint is equal to 1/2 of the half flag's contact resistance since in normalNSTX 13_030318_CLN_01.doc TO: DISTRIBUTION FROM: C NEUMEYER SUBJECT: ANALYSIS OF JOINT RESISTANCE

Princeton Plasma Physics Laboratory

115

STBPO-PostDoc:Postdoc Program:Career Fair:2013:2013_LAHotel_Info.doc Hotel Info in Los Alamos  

E-Print Network [OSTI]

Express at Entrada Park 60 Entrada Dr. Los Alamos, NM 87544 505-661-2646 Motel 6 2175 Trinity Dr. LosSTBPO-PostDoc:Postdoc Program:Career Fair:2013:2013_LAHotel_Info.doc Hotel Info in Los Alamos of hotels in Los Alamos: Adobe Pines Bed & Breakfast 2101 Loma Linda Dr. Los Alamos, NM 87544 505

116

A Hardware Implementation of the Soft Output Viterbi Algorithm for Serially Concatenated Convolutional Codes  

E-Print Network [OSTI]

This thesis outlines the hardware design of a soft output Viterbi algorithm decoder for use in a serially concatenated convolutional code system. Convolutional codes and their related structures are described, as well as the algorithms used...

Werling, Brett William

2010-06-28T23:59:59.000Z

117

Department Directory PDF Main Area/Listings Phone Location/AddressSerial #  

E-Print Network [OSTI]

Department Directory PDF Main Area/Listings Phone Location/AddressSerial # Academic Affairs Office 644-4281 103 VP2LI000017 Anthropology Department - Fax 645-0032LI000018 #12;Department Directory

Weston, Ken

118

E-Print Network 3.0 - american serials interest Sample Search...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Medicine 9 DOI: 10.1126science.283.5408.1752 , 1752 (1999);283Science Summary: -Recall Task Motor Cortical Encoding of Serial Order in a www.sciencemag.org (this information is...

119

ON-DEMAND SERIAL DILUTION USING QUANTIZED NANO/PICOLITER-SCALE DROPLETS  

SciTech Connect (OSTI)

This paper describes a fully automated droplet-based microfluidic device for on-demand serial dilution that is capable of achieving a dilution ratio of >6000 (concentration ranges from 1 mM to 160nM) over 35 nanoliter-scale droplets. This serial diluter can be applied to high throughput and label-free kinetic assays by integrating with our previously developed on-demand droplet-based microfluidic with mass spectrometry detection.

Jambovane, Sachin R.; Prost, Spencer A.; Sheen, Allison M.; Magnuson, Jon K.; Kelly, Ryan T.

2014-10-29T23:59:59.000Z

120

Projektarbeit Basisjahr 2010 12. Mrz 2010 Installation von Bluetooth-Dongle und Serial-Port  

E-Print Network [OSTI]

Projektarbeit Basisjahr 2010 12. März 2010 Installation von Bluetooth-Dongle und ­Serial-Port Mini CD · Dongle anbringen Im Geräte Manager überprüfen · BlueSoleil starten Serial Port · Gerät Parani. Benutzt dazu eine Büroklammer und drückt einige Zeit auf auf dem Bluetooth COM- Port. · Merkt

Note: This page contains sample records for the topic "doc number serial" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


121

DocNo.: E-PLA-MET-503-0016 Date: 17-11-2009  

E-Print Network [OSTI]

AIT Plan DocNo.: E-PLA-MET-503-0016 Issue: 1.0 Date: 17-11-2009 Name Date Signature Prepared: F. Molster 17-11-2009 Approved: B. Brandl 17-11-2009 Released: F. Molster 17-11-2009 #12;AIT Plan Doc: E-PLA Reason/Remarks 0.1 06-08-2009 Initial document 1.0 17-11-2009 Final version #12;AIT Plan Doc: E-PLA

Siebenmorgen, Ralf

122

The SPi chip as an integrated power management device for serial powering of future HEP experiments  

SciTech Connect (OSTI)

Serial powering is one viable and very efficient way to distribute power to future high energy physics (HEP) experiments. One promising way to realize serial powering is to have a power management device on the module level that provides the necessary voltage levels and features monitoring functionality. The SPi (Serial Powering Interface) chip is such a power manager and is designed to meet the requirements imposed by current SLHC upgrade plans. It incorporates a programmable shunt regulator, two linear regulators, current mode ADCs to monitor the current distribution on the module, over-current detection, and also provides module power-down capabilities. Compared to serially powered setups that use discrete components, the SPi offers a higher level of functionality in much less real estate and is designed to be radiation tolerant. Bump bonding techniques are used for chip on board assembly providing the most reliable connection at lowest impedance. This paper gives an overview of the SPi and outlines the main building blocks of the chip. First stand alone tests are presented showing that the chip is ready for operation in serially powered setups.

Trimpl, M.; Deptuch, G.; Gingu, C.; Yarema, R.; /Fermilab; Holt, R.; Weber, M.; /Rutherford; Kierstead, J.; Lynn, D.; /Brookhaven

2009-01-01T23:59:59.000Z

123

m:\\disability\\policies\\marking-dyslexia.doc THE UNIVERSITY OF SUSSEX  

E-Print Network [OSTI]

m:\\disability\\policies\\marking-dyslexia.doc THE UNIVERSITY OF SUSSEX Policy and Procedures for a reason relating to his or her disability. 1.2 Dyslexia is a registered disability under the Disability editor could put right. #12;m:\\disability\\policies\\marking-dyslexia.doc 2.3.2 The written work

Sussex, University of

124

-Le_rachat_2005-06-14.doc Le rachat des Corses esclaves Tunis en 1779  

E-Print Network [OSTI]

1 / 19 - Le_rachat_2005-06-14.doc Le rachat des Corses esclaves à Tunis en 1779 L'établissement de), voir la bibliographie halshs-00162606,version1-14Jul2007 #12;2 / 19 - Le_rachat_2005-06-14.doc Esclaves

Paris-Sud XI, Université de

125

4/21/2006 2005-06 RCR Forum SUMMARIES.doc Duke University  

E-Print Network [OSTI]

4/21/2006 2005-06 RCR Forum SUMMARIES.doc Duke University RCR FORUMS GS311 2005-2006 Topic: GS311;4/21/2006 2005-06 RCR Forum SUMMARIES.doc Duke University RCR FORUMS 2005-2006 (cont.) Topic: GS311-02: "From

Ferrari, Silvia

126

Future Development and Management DocNo.: E-PLA-MET-503-0003  

E-Print Network [OSTI]

Future Development and Management Plan DocNo.: E-PLA-MET-503-0003 Issue 1.0 Date: 17-11-2009 Name-11-2009 #12;Future Development and Management Plan Doc: E-PLA-MET-503-0003 Issue: 1.0 Date: 17-11-09 Page: 2

Siebenmorgen, Ralf

127

Using Facebook and Google Docs for Teaching and Sharing Information Kanda Runapongsa Saikaew1  

E-Print Network [OSTI]

1 Using Facebook and Google Docs for Teaching and Sharing Information Kanda Runapongsa, Burapha University, Thailand #12;2 Using Facebook and Google Docs for Teaching and Sharing by doing and exploring. This paper presents the approach and the experience in using Facebook and Google

Runapongsa, Kanda

128

ScopingStudyReport-AppxC-Homework-013105.doc -1 -DEMAND RESPONSE RESEARCH CENTER SCOPING  

E-Print Network [OSTI]

ScopingStudyReport-AppxC-Homework-013105.doc - 1 - DEMAND RESPONSE RESEARCH CENTER SCOPING STUDYStudyReport-AppxC-Homework-013105.doc - 2 - Preparing for the Roundtable Session (HOMEWORK ASSIGNMENT) The PIER Demand Response that advances the near-term adoption of Demand Response technologies, policies, programs, strategies

129

Blandford_2007_MonthlyUpdate_August.doc Data Update for Blandford, MA  

E-Print Network [OSTI]

Update_August.doc Data Summary Statistics A summary of the data during the reporting period are included in the following://www.ceere.org/rerl/rerl_resourcedata.html. Data Recovery All raw wind data are subjected to a series of tests and filters to identify dataBlandford_2007_MonthlyUpdate_August.doc Data Update for Blandford, MA August, 2007 Prepared

Massachusetts at Amherst, University of

130

Blandford_2007_MonthlyUpdate_September.doc Data Update for Blandford, MA  

E-Print Network [OSTI]

Update_September.doc Data Summary Statistics A summary of the data during the reporting period are included in the following://www.ceere.org/rerl/rerl_resourcedata.html. Data Recovery All raw wind data are subjected to a series of tests and filters to identify dataBlandford_2007_MonthlyUpdate_September.doc Data Update for Blandford, MA September, 2007 Prepared

Massachusetts at Amherst, University of

131

Business Expense Guidelines Page 1 CALTECH BUSINESS EXPENSE GUIDELINES rev 09-12-05.doc  

E-Print Network [OSTI]

Business Expense Guidelines Page 1 CALTECH BUSINESS EXPENSE GUIDELINES rev 09-12-05.doc Office of Financial Services March 2003 Revision date: 9/12/05 #12;Business Expense Guidelines Page 2 CALTECH BUSINESS EXPENSE GUIDELINES rev 09-12-05.doc CCoonntteennttss 1. Introduction

Goddard III, William A.

132

NSF TRAINING MATRIX Topic Undergraduates Graduate Students PostDoc Faculty Administrative  

E-Print Network [OSTI]

NSF TRAINING MATRIX 8/31/10 Topic Undergraduates Graduate Students PostDoc Faculty Administrative *Falsification Required/online ApSCI 604*open to Classroom trainingClassroom training all/list of enrollees Video to Corbett Online training required for Graduate students Required for PostDocs. On Being A Scientist

Yu, Gexin

133

A serial-kinematic nanopositioner for high-speed atomic force microscopy  

SciTech Connect (OSTI)

A flexure-guided serial-kinematic XYZ nanopositioner for high-speed Atomic Force Microscopy is presented in this paper. Two aspects influencing the performance of serial-kinematic nanopositioners are studied in this work. First, mass reduction by using tapered flexures is proposed to increased the natural frequency of the nanopositioner. 25% increase in the natural frequency is achieved due to reduced mass with tapered flexures. Second, a study of possible sensor positioning in a serial-kinematic nanopositioner is presented. An arrangement of sensors for exact estimation of cross-coupling is incorporated in the proposed design. A feedforward control strategy based on phaser approach is presented to mitigate the dynamics and nonlinearity in the system. Limitations in design approach and control strategy are discussed in the Conclusion.

Wadikhaye, Sachin P., E-mail: sachin.wadikhaye@uon.edu.au; Yong, Yuen Kuan; Reza Moheimani, S. O. [School of Electrical Engineering and Computer Science, The University of Newcastle, Callaghan, NSW (Australia)

2014-10-15T23:59:59.000Z

134

Relative importance of multiple factors on terrestrial loading of DOC to Arctic river networks  

SciTech Connect (OSTI)

Terrestrial carbon dynamics influence the contribution of dissolved organic carbon (DOC) to river networks in addition to controlling carbon fluxes between the land surface and the atmosphere. In this study, we use a biogeochemical process model to simulate the lateral transfer of DOC from land to the Arctic Ocean via riverine transport. We estimate that the pan-arctic watershed has contributed, on average, 32 Tg C/yr of DOC to the Arctic Ocean over the 20th century with most coming from the extensive area of boreal deciduous needle-leaved forests and forested wetlands in Eurasian watersheds. We also estimate that the rate of terrestrial DOC loading has been increasing by 0.037 Tg C/yr2 over the 20th century primarily as a result of increases in air temperatures and precipitation. These increases have been partially compensated by decreases in terrestrial DOC loading caused by wildfires. Other environmental factors (CO2 fertilization, ozone pollution, atmospheric nitrogen deposition, timber harvest, agriculture) are estimated to have relatively small effects on terrestrial DOC loading to arctic rivers. The effects of the various environmental factors on terrestrial carbon dynamics have both compensated and enhanced concurrent effects on hydrology to influence terrestrial DOC loading. Future increases in riverine DOC concentrations and export may occur from warming-induced increases in terrestrial DOC production associated with enhanced microbial metabolism and the exposure of additional organic matter from permafrost degradation along with decreases in water yield associated with warming-induced increases in evapotranspiration. Improvements in simulating terrestrial DOC loading to pan-arctic rivers in the future will require better information on the spatial distribution of precipitation and its temporal trends, carbon dynamics of larch-dominated ecosystems in eastern Siberia, and the role of industrial organic effluents on carbon budgets of rivers in western Russia.

Kicklighter, David W. [Ecosystem Center, The] [Ecosystem Center, The; Hayes, Daniel J [ORNL] [ORNL; Mcclelland, James W [University of Texas] [University of Texas; Peterson, Bruce [Marine Biological Laboratory] [Marine Biological Laboratory; Mcguire, David [University of Alaska] [University of Alaska; Melillo, Jerry [Marine Biological Laboratory] [Marine Biological Laboratory

2014-01-01T23:59:59.000Z

135

PERFORMANCE ANALYSIS USING SEQUENTIAL DETECTION IN A SERIAL MULTI-HOP WIRELESS SENSOR NETWORK  

E-Print Network [OSTI]

PERFORMANCE ANALYSIS USING SEQUENTIAL DETECTION IN A SERIAL MULTI-HOP WIRELESS SENSOR NETWORK A Thesis by DAE HYUN CHOI Submitted to the O?ce of Graduate Studies of Texas A&M University in partial fulflllment of the requirements for the degree... of MASTER OF SCIENCE August 2008 Major Subject: Electrical Engineering PERFORMANCE ANALYSIS USING SEQUENTIAL DETECTION IN A SERIAL MULTI-HOP WIRELESS SENSOR NETWORK A Thesis by DAE HYUN CHOI Submitted to the O?ce of Graduate Studies of Texas A&M University...

Choi, Dae H.

2010-01-16T23:59:59.000Z

136

Permanent Home Number: Residential Number  

E-Print Network [OSTI]

Permanent Home Number: Residential Number: Mobile: Please update my contact details. Signature nominated correspondence address as indicated below. Permanent Home Adress Residential Address Other Address (Must not be a PO Box) Residential Address (Must not be a PO Box) Other - Postal/Optional Address

Viglas, Anastasios

137

UNIT NUMBER:  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

193 UNIT NUMBER: 197 UNIT NAME: CONCRETE RUBBLE PILE (30) REGULATORY STATUS: AOC LOCATION: Outside plant security fence, north of the plant on Big Bayou Creek on private property....

138

Linking of Serially Ordered Lists by Macaque Monkeys (Macaca mulatta): List Position Influences  

E-Print Network [OSTI]

list positions from initial learning, but continued testing with directional reward yielded gradualLinking of Serially Ordered Lists by Macaque Monkeys (Macaca mulatta): List Position Influences F or not in a counterbalanced, within-subject design. Linking entailed training on the 2 pairs that ordered the 3 5-item lists

Raghanti, Mary Ann

139

Effect of downstream feedback on the achievable performance of feedback control loops for serial processes  

E-Print Network [OSTI]

Effect of downstream feedback on the achievable performance of feedback control loops for serial conditions under which it is advisable to include a control law with downstream feedback besides local Si+1. In reference to that figure, we refer as downstream units (resp. upstream units) as those

Duffy, Ken

140

Evaluating the Capability of Compilers and Tools to Detect Serial and Parallel Run-time Errors  

E-Print Network [OSTI]

, Elizabeth Kleiman, Olga Weiss, Andre Wehe, Melissa Yahya # Iowa State University's High Performance of system software to detect and issue error messages that help programmers quickly fix serial and parallel using the new system software to rted.project@iastate.edu so they can be posted on this web site. II

Luecke, Glenn R.

Note: This page contains sample records for the topic "doc number serial" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


141

A Survey of Systems for Detecting Serial Run-Time Errors  

E-Print Network [OSTI]

Performance Computing Group Glenn R. Luecke, James Coyle, Jim Hoekstra, Marina Kraeva, Ying Li, Olga Taborskaia, and Yanmei Wang {grl, jjc, hoekstra, kraeva, yingli, olga, yanmei}@iastate.edu Revised February-commercial software products to detect serial run-time errors in C and C++ programs, to issue meaningful messages

Luecke, Glenn R.

142

High-Speed Serial AER on FPGA Hans Kristian Otnes Berge, Philipp Hafliger  

E-Print Network [OSTI]

High-Speed Serial AER on FPGA Hans Kristian Otnes Berge, Philipp H¨afliger University of Oslo Address-Event Representation (AER) link with a capacity of 41.66Mevents/sec. The link has been implemented. However, many AER processing systems require an ASIC implementation. We thus propose to implement AER

Häfliger, Philipp

143

Low-Cost Advanced Encryption Standard (AES) VLSI Architecture: A Minimalist Bit-Serial Approach  

E-Print Network [OSTI]

Low-Cost Advanced Encryption Standard (AES) VLSI Architecture: A Minimalist Bit-Serial Approach proposed both in software and hardware. This paper presents a low cost and low power hardware architecture. A focus on low power and cost allows for scaling of the architecture towards vulnerable portable

Hernandez, Orlando

144

Property:NEPA FundingAgencyDocNumber | Open Energy Information  

Open Energy Info (EERE)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data CenterFranconia, Virginia: Energy ResourcesLoadingPenobscot County,ContAddr2 Jump to:ManagingFieldOffice JumpApplication

145

Microsoft Word - S07012_RFL_2010_VMR_LEC.doc  

Office of Legacy Management (LM)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) "ofEarlyEnergyDepartment ofDepartment ofofOxford SiteToledo SiteTonawandaUniversity of Doc. No. S068155-1 Old

146

Microsoft Word - S07033_2nd qtr 2010.doc  

Office of Legacy Management (LM)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) "ofEarlyEnergyDepartment ofDepartment ofofOxford SiteToledo SiteTonawandaUniversity of Doc. No. S068155-1 Old

147

Microsoft Word - S08266_App_A-2.doc  

Office of Legacy Management (LM)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) "ofEarlyEnergyDepartment ofDepartment ofofOxford SiteToledo SiteTonawandaUniversity of Doc.1 1.0Second42 2011

148

Microsoft Word - S08266_App_A-3.doc  

Office of Legacy Management (LM)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) "ofEarlyEnergyDepartment ofDepartment ofofOxford SiteToledo SiteTonawandaUniversity of Doc.1 1.0Second42

149

Microsoft Word - 4March08_SCADA_Procurement.doc  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious RankCombustion | Department ofT ib l L d F S i DOE Tribal Leader ForumStatus4008D7DF19-707E-28B27A.docINL is

150

Microsoft Word - FCL Testing Report Final.doc  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious RankCombustion | Department ofT ib l L d F S i DOE Tribal LeaderDE-OE0000660Mr.Ms.1.doc MicrosoftReport ofAn

151

Microsoft Word - FEMP-State MOU pdf version.doc  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious RankCombustion | Department ofT ib l L d F S i DOE Tribal LeaderDE-OE0000660Mr.Ms.1.docDecember

152

Microsoft Word - FFATA Memo 30 March 2007.doc  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious RankCombustion | Department ofT ib l L d F S i DOE Tribal LeaderDE-OE0000660Mr.Ms.1.docDecemberEMPLOYEE March

153

Flash2006-23Attachment.doc | Department of Energy  

Office of Environmental Management (EM)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) "of Energy Power.pdf Flash2006-14.pdf Flash2006-14.pdf More Documents &17.pdfAttachment.doc�

154

Flash2006-38Attachment.doc | Department of Energy  

Office of Environmental Management (EM)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) "of Energy Power.pdf Flash2006-14.pdf Flash2006-14.pdf More DocumentsAttachment.doc�

155

Flash2006-42Attachment2.doc | Department of Energy  

Office of Environmental Management (EM)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) "of Energy Power.pdf Flash2006-14.pdf Flash2006-14.pdf MoreAttachment2.doc�

156

Flash2006-45Attachment.doc | Department of Energy  

Office of Environmental Management (EM)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) "of Energy Power.pdf Flash2006-14.pdf Flash2006-14.pdf MoreAttachment2.doc�3.pdf

157

al99-06.doc | Department of Energy  

Office of Environmental Management (EM)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) "of EnergyEnergyENERGYWomen Owned SmallOf TheViolations |JoinZero-Energy Home Tour: Coming.doc�

158

Microsoft Word - 98-11.doc | Department of Energy  

Energy Savers [EERE]

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Office of Inspector General Office0-72.pdfGeorgeDoesn't32 Master EM ManagementWe at NAPAWM2012WATER ANDWaste8-11.doc

159

Microsoft Word - AL2000-05.doc | Department of Energy  

Energy Savers [EERE]

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Office of Inspector General Office0-72.pdfGeorgeDoesn't32 Master EM ManagementWe atARRASafetyALREDO3 Microsoft.doc

160

Microsoft Word - AL2002-03.doc | Department of Energy  

Energy Savers [EERE]

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Office of Inspector General Office0-72.pdfGeorgeDoesn't32 Master EM ManagementWe atARRASafetyALREDO32-03.doc Microsoft

Note: This page contains sample records for the topic "doc number serial" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


161

Microsoft Word - AL2003-04.doc | Department of Energy  

Energy Savers [EERE]

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Office of Inspector General Office0-72.pdfGeorgeDoesn't32 Master EM ManagementWe atARRASafetyALREDO32-03.doc

162

Microsoft Word - AL2005-03.doc | Department of Energy  

Energy Savers [EERE]

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Office of Inspector General Office0-72.pdfGeorgeDoesn't32 Master EM ManagementWe2.doc Microsoft Word -

163

Microsoft Word - AL2005-12.doc | Department of Energy  

Energy Savers [EERE]

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Office of Inspector General Office0-72.pdfGeorgeDoesn't32 Master EM ManagementWe2.doc Microsoft

164

Microsoft Word - AL2006-09.doc | Department of Energy  

Energy Savers [EERE]

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Office of Inspector General Office0-72.pdfGeorgeDoesn't32 Master EM ManagementWe2.doc

165

Microsoft Word - AL2006-11.doc | Department of Energy  

Energy Savers [EERE]

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Office of Inspector General Office0-72.pdfGeorgeDoesn't32 Master EM ManagementWe2.docAL-2006-10 Acquisition

166

Microsoft Word - AL2007-01.doc | Department of Energy  

Energy Savers [EERE]

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Office of Inspector General Office0-72.pdfGeorgeDoesn't32 Master EM ManagementWe2.docAL-2006-10

167

Microsoft Word - FAL2004-01.doc | Department of Energy  

Energy Savers [EERE]

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Office of Inspector General Office0-72.pdfGeorgeDoesn't32 Master EMAZINFO PEWTRUSTS.ORGMicrosoftFAL2004-01.doc

168

Microsoft Word - FAL2004-02.doc | Department of Energy  

Energy Savers [EERE]

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Office of Inspector General Office0-72.pdfGeorgeDoesn't32 Master EMAZINFO PEWTRUSTS.ORGMicrosoftFAL2004-01.docMicrosoft

169

Microsoft Word - National Report 05-02-03.doc  

Office of Environmental Management (EM)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) " ,"ClickPipelinesProvedDecemberInitiatives InitiativesShippingHow EMGJPPGPracticesDraft.docManagement May

170

AcqGuide41pt1.doc | Department of Energy  

Office of Environmental Management (EM)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) "of EnergyEnergy Cooperation |South ValleyASGovLtr.pdfAbout thept1.doc�41 (December 2004)

171

AcqGuide42pt1.doc | Department of Energy  

Office of Environmental Management (EM)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) "of EnergyEnergy Cooperation |South ValleyASGovLtr.pdfAbout thept1.doc�41 (December 2004)October

172

AcqGuide42pt3.doc | Department of Energy  

Office of Environmental Management (EM)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) "of EnergyEnergy Cooperation |South ValleyASGovLtr.pdfAbout thept1.doc�41 (December

173

AcqGuide47pt1.doc | Department of Energy  

Office of Environmental Management (EM)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) "of EnergyEnergy Cooperation |South ValleyASGovLtr.pdfAbout thept1.doc�41 (December47.1 (June 2004)

174

AcqGuide70pt31.doc | Department of Energy  

Office of Environmental Management (EM)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) "of EnergyEnergy Cooperation |South ValleyASGovLtr.pdfAbout thept1.doc�41

175

AcqGuide70pt4.doc | Department of Energy  

Office of Environmental Management (EM)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) "of EnergyEnergy Cooperation |South ValleyASGovLtr.pdfAbout thept1.doc�4170.3270 (April 2007)

176

AcqGuide70pt5.doc | Department of Energy  

Office of Environmental Management (EM)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) "of EnergyEnergy Cooperation |South ValleyASGovLtr.pdfAbout thept1.doc�4170.3270 (April

177

AcqGuide9pt1.doc | Department of Energy  

Office of Environmental Management (EM)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) "of EnergyEnergy Cooperation |South ValleyASGovLtr.pdfAbout thept1.doc�4170.3270

178

AcqGuide9pt2.doc | Department of Energy  

Office of Environmental Management (EM)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) "of EnergyEnergy Cooperation |South ValleyASGovLtr.pdfAbout thept1.doc�4170.32702 (March

179

AcqGuideChapter39pt2.doc  

Office of Environmental Management (EM)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) "of EnergyEnergy Cooperation |South ValleyASGovLtr.pdfAbout thept1.doc�4170.32702

180

Microsoft Word - April06.doc | Department of Energy  

Broader source: Energy.gov (indexed) [DOE]

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) "of EnergyEnergyENERGYWomen OwnedofDepartment ofJared Temanson -ofMarcFinalModule5.pptApril06.doc More

Note: This page contains sample records for the topic "doc number serial" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


181

Microsoft Word - August06.doc | Department of Energy  

Broader source: Energy.gov (indexed) [DOE]

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) "of EnergyEnergyENERGYWomen OwnedofDepartment ofJared Temanson -ofMarcFinalModule5.pptApril06.doc

182

Microsoft Word - CERFDOE Final Report - 071204.doc | Department of Energy  

Broader source: Energy.gov (indexed) [DOE]

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) "of EnergyEnergyENERGYWomen OwnedofDepartment ofJared Temanson -ofMarcFinalModule5.pptApril06.docCERFDOE

183

Microsoft Word - FAL2006-03.doc | Department of Energy  

Broader source: Energy.gov (indexed) [DOE]

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) "of EnergyEnergyENERGYWomen OwnedofDepartment ofJared TemansonEnergy FINAL1.DOC More Documentsof 8

184

Microsoft Word - GJPPGPracticesDraft.doc | Department of Energy  

Broader source: Energy.gov (indexed) [DOE]

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) "of EnergyEnergyENERGYWomen OwnedofDepartment ofJared TemansonEnergy FINAL1.DOCPropertyBSCFed.doc

185

Microsoft Word - No Fear Stats FY02.doc  

Broader source: Energy.gov (indexed) [DOE]

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) "of EnergyEnergyENERGYWomen OwnedofDepartment ofJared TemansonEnergy FINAL1.DOCPropertyBSCFed.docIQA2 EEO

186

Microsoft Word - No Fear Stats FY03.doc  

Broader source: Energy.gov (indexed) [DOE]

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) "of EnergyEnergyENERGYWomen OwnedofDepartment ofJared TemansonEnergy FINAL1.DOCPropertyBSCFed.docIQA2

187

Microsoft Word - No Fear Stats FY04.doc  

Broader source: Energy.gov (indexed) [DOE]

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) "of EnergyEnergyENERGYWomen OwnedofDepartment ofJared TemansonEnergy FINAL1.DOCPropertyBSCFed.docIQA2 No

188

Microsoft Word - No Fear Stats FY06.doc  

Broader source: Energy.gov (indexed) [DOE]

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) "of EnergyEnergyENERGYWomen OwnedofDepartment ofJared TemansonEnergy FINAL1.DOCPropertyBSCFed.docIQA2 No6

189

Microsoft Word - PeerReview_SAR.doc | Department of Energy  

Broader source: Energy.gov (indexed) [DOE]

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) "of EnergyEnergyENERGYWomen OwnedofDepartment ofJared TemansonEnergySAR.doc More Documents &

190

Microsoft Word - Using Green Button Download.doc  

Broader source: Energy.gov (indexed) [DOE]

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) "of EnergyEnergyENERGYWomen OwnedofDepartment ofJared TemansonEnergySAR.doc More Documents &U.S. -a

191

Microsoft Word - Chap - 5-15-05.doc  

Office of Legacy Management (LM)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) "ofEarlyEnergyDepartment ofDepartment ofof EnergyYou$0.C. 20545*. . : '*I_1 September2 June 2012 Doc.May

192

Microsoft Word - Pergam Final Report formatted.doc  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: VegetationEquipment Surfaces andMappingENVIRONMENTALHYDROPOWERFebruarySavebasedSAR.doc Microsoft Word

193

AcqGuide38pt1.doc | Department of Energy  

Energy Savers [EERE]

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious RankCombustion |Energyon ArmedWaste andAccess to OUO Access to OUO DOE M 471.3-1, AcqGuide38pt1.doc�

194

Microsoft Word - al2004-03.doc | Department of Energy  

Energy Savers [EERE]

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Office of Inspector General Office0-72.pdfGeorgeDoesn't32 MasterAcquisiti ---- Contra See AcquFOR007Byal2004-03.doc

195

Microsoft Word - al2005-06.doc | Department of Energy  

Energy Savers [EERE]

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Office of Inspector General Office0-72.pdfGeorgeDoesn't32 MasterAcquisiti ---- Contra Seeal2005-06.doc Microsoft Word -

196

Microsoft Word - al2006-12.doc | Department of Energy  

Energy Savers [EERE]

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Office of Inspector General Office0-72.pdfGeorgeDoesn't32 MasterAcquisiti ---- Contra Seeal2005-06.doc Microsoft Word

197

Microsoft Word - al2007-11.doc | Department of Energy  

Energy Savers [EERE]

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Office of Inspector General Office0-72.pdfGeorgeDoesn't32 MasterAcquisiti ---- Contra Seeal2005-06.doc Microsoft

198

Microsoft Word - al95-14.doc | Department of Energy  

Energy Savers [EERE]

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Office of Inspector General Office0-72.pdfGeorgeDoesn't32 MasterAcquisiti ---- Contra Seeal2005-06.doc

199

Microsoft Word - Final MR AL.doc | Department of Energy  

Energy Savers [EERE]

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious RankCombustion |EnergyonSupport0.pdf5 OPAM SEMIANNUAL REPORTMAMayCross Reference4 DepartmentFinal MR AL.doc

200

Microsoft Word - al94-19.doc | Department of Energy  

Energy Savers [EERE]

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious RankCombustion |EnergyonSupport0.pdf5 OPAM SEMIANNUAL REPORTMAMayCross Reference40 USGuideal94-19.doc

Note: This page contains sample records for the topic "doc number serial" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


201

Microsoft Word - Cleanline final report Rev 3.doc  

Broader source: Energy.gov (indexed) [DOE]

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) "ofEarly Careerlumens_placard-green.eps More DocumentsCMPTemplate031307.doc MoreChapter 10_2006_Jun More7, 2015S

202

Microsoft Word - ITR SRS Rpt FINAL.doc  

Office of Environmental Management (EM)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) "of Energy Power.pdf11-161-LNG | DepartmentEnergyMagna:MasterOffice0 1 2 - 2 09Attachment.doc0-1May

203

Microsoft Word - tribal issues group call 7-25.doc  

Office of Environmental Management (EM)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) "of EnergyEnergyENERGY TAXBalanced Scorecard Federal2 to: A Dispersion Modeling4.doc20 th8Record

204

Coupled Serial and Parallel Non-uniform SQUIDs  

SciTech Connect (OSTI)

In this work we numerical model series and parallel non-uniform superconducting quantum interference device (SQUID) array. Previous work has shown that series SQUID array constructed with a random distribution of loop sizes, (i.e. different areas for each SQUID loop) there exists a unique 'anti-peak' at the zero magnetic field for the voltage versus applied magnetic field (V-B). Similar results extend to a parallel SQUID array where the difference lies in the arrangement of the Josephson junctions. Other system parameter such as bias current, the number of loops, and mutual inductances are varied to demonstrate the change in dynamic range and linearity of the V-B response. Application of the SQUID array as a low noise amplifier (LNA) would increase link margins and affect the entire communication system. For unmanned aerial vehicles (UAVs), size, weight and power are limited, the SQUID array would allow use of practical 'electrically small' antennas that provide acceptable gain.

Longhini, Patrick; In, Visarath [Space and Naval Warfare Systems Center, 53560 Hull Street, San Diego, CA 92152-5001 (United States); Berggren, Susan; Palacios, Antonio [Nonlinear Dynamics Group Department of Mathematics and Statistics San Diego State University, San Diego, CA 92182 (United States); Leese de Escobar, Anna

2011-04-19T23:59:59.000Z

205

Microsoft Word - 20050821_Appendix_A.doc  

Gasoline and Diesel Fuel Update (EIA)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) " ,"ClickPipelines About U.S.30Natural Gas Glossary529 6330 04 19 15 15 15 3YearDecade7. U.S. Number of

206

Microsoft Word - 20050821_Appendix_A.doc  

Gasoline and Diesel Fuel Update (EIA)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) " ,"ClickPipelines About U.S.30Natural Gas Glossary529 6330 04 19 15 15 15 3YearDecade7. U.S. Number of8.

207

Microsoft Word - 20050821_Appendix_A.doc  

Gasoline and Diesel Fuel Update (EIA)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) " ,"ClickPipelines About U.S.30Natural Gas Glossary529 6330 04 19 15 15 15 3YearDecade7. U.S. Number of8.9.

208

Microsoft Word - 20050821_Appendix_A.doc  

Gasoline and Diesel Fuel Update (EIA)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) " ,"ClickPipelines About U.S.30Natural Gas Glossary529 6330 04 19 15 15 15 3YearDecade7. U.S. Number

209

Microsoft Word - GNEP Website Glossary 2006-02-03_no_links.doc...  

Broader source: Energy.gov (indexed) [DOE]

Glossary 2006-02-03nolinks.doc More Documents & Publications GNEP Glossary Lesson 5 - Fission and Chain Reactions Generation-IV Roadmap Report of the Fuel Cycle Crosscut Group...

210

Microsoft Word - NGNP-CTF MTECH-TDRM-017_Rev0.doc  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

TECH-TDRM-017Rev0.doc 10272008 7 of 89 Acronym Definition KTA German nuclear technical committee LANL Los Alamos National Laboratory LEU Low Enriched Uranium LOFC Loss of Forced...

211

Application to Export Electric Energy OE Doc No. EA-339-A Shell...  

Broader source: Energy.gov (indexed) [DOE]

: Federal Register Notice, Volume 78, No. 45 - March 7, 2013 Application to Export Electric Energy OE Doc No. EA-339-A Shell Energy North America (US), L.P.: Federal Register...

212

2005-06 Annual Budget Instructions FY6/AppendixC.doc -1 -02-01-05  

E-Print Network [OSTI]

2005-06 Annual Budget Instructions FY6/AppendixC.doc - 1 - 02-01-05 A P P E N D I X C NUMERIC FUND;Office of Budget, Planning & Analysis FY6/AppendixC.doc - 2 - 02-01-05 NUMERIC CODE SOURCE DESCRIPTION; Principal Repayment, Interest, and Rebates #12;2005-06 Annual Budget Instructions FY6/AppendixC.doc - 3 - 02

Sheridan, Jennifer

213

Parallel processing data network of master and slave transputers controlled by a serial control network  

DOE Patents [OSTI]

The present device provides for a dynamically configurable communication network having a multi-processor parallel processing system having a serial communication network and a high speed parallel communication network. The serial communication network is used to disseminate commands from a master processor (100) to a plurality of slave processors (200) to effect communication protocol, to control transmission of high density data among nodes and to monitor each slave processor's status. The high speed parallel processing network is used to effect the transmission of high density data among nodes in the parallel processing system. Each node comprises a transputer (104), a digital signal processor (114), a parallel transfer controller (106), and two three-port memory devices. A communication switch (108) within each node (100) connects it to a fast parallel hardware channel (70) through which all high density data arrives or leaves the node.

Crosetto, Dario B. (DeSoto, TX)

1996-01-01T23:59:59.000Z

214

Parallel processing data network of master and slave transputers controlled by a serial control network  

DOE Patents [OSTI]

The present device provides for a dynamically configurable communication network having a multi-processor parallel processing system having a serial communication network and a high speed parallel communication network. The serial communication network is used to disseminate commands from a master processor to a plurality of slave processors to effect communication protocol, to control transmission of high density data among nodes and to monitor each slave processor`s status. The high speed parallel processing network is used to effect the transmission of high density data among nodes in the parallel processing system. Each node comprises a transputer, a digital signal processor, a parallel transfer controller, and two three-port memory devices. A communication switch within each node connects it to a fast parallel hardware channel through which all high density data arrives or leaves the node. 6 figs.

Crosetto, D.B.

1996-12-31T23:59:59.000Z

215

Serial Intraoperative MR Imaging of Brain Shift Arya Nabavi, M.D.1  

E-Print Network [OSTI]

Serial Intraoperative MR Imaging of Brain Shift Arya Nabavi, M.D.1 , Peter McL. Black, M.D. Ph.D.1 , David T. Gering, M.S.4 , Carl-Fredrik Westin, Ph.D3 , Vivek Mehta, M.D.1 , Richard S. Pergolizzi Jr., M, M.D., Ph.D.2 , William M. Wells III, Ph.D4 ., Ron Kikinis, M.D.3 , Ferenc A. Jolesz, M.D.3 1

216

Characterization of Brain Distribution of Sunitinib in a Murine Serial Sacrifice Design Using A Population-Based Approach  

E-Print Network [OSTI]

Characterization of Brain Distribution of Sunitinib in a Murine Serial Sacrifice Design Using A Population-Based Approach Rajneet Oberoi Department sample per subject, resulting in a study design wherein a small group

Thomas, David D.

217

Doc'Up, association des doctorants de Sorbonne Universits Sige social: 15 rue de l'cole de mdecine, 75006 Paris  

E-Print Network [OSTI]

Doc'Up, association des doctorants de Sorbonne Universités Siège social: 15 rue de l'école de.docup.info Pour nous contacter : contact@docup.info Liste soutenue par Doc'Up pour l'élection des représentants des doctorants à la Commission de la Recherche de l'UPMC. Qu'est ce que Doc' Up ? Doc'Up, créée à l

Arleo, Angelo

218

g:\\fpdc\\contracts unit\\consultant selection and agreement forms\\consultant agreements\\owner consultant agreement final pdc.doc Page 1 of 24  

E-Print Network [OSTI]

\\owner consultant agreement final pdc.doc Page 1 of 24 MONTANA STATE UNIVERSITY PLANNING, DESIGN & CONSTRUCTION 6TH forms\\consultant agreements\\owner consultant agreement final pdc.doc Page 2 of 24 TABLE OF CONTENTS PART\\consultant selection and agreement forms\\consultant agreements\\owner consultant agreement final pdc.doc Page 3 of 24 1

Dyer, Bill

219

!Y-Y-2000062! J:\\Registration,Readmits,Spec. programs\\Data (Forms, Reports, Etc.)\\Registrar Forms and Petitions\\Word Docs\\Partial Fee Reduction_Barcoded.doc  

E-Print Network [OSTI]

and Petitions\\Word Docs\\Partial Fee Reduction_Barcoded.doc Revised 5/26/2011 SS REQUEST FOR PARTIAL FEE Educational Fee and must be submitted to the Office of the Registrar. A petition for a deficit load should to a complete withdraw from the University. 2. Approval for partial fee reduction is not automatic. To qualify

California at Santa Barbara, University of

220

Serial Queue  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsrucLas ConchasPassiveSubmitted forHighlightsSeminars Seminars at theSequestration of

Note: This page contains sample records for the topic "doc number serial" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


221

Pappas Consulting Group Inc. PCG/FLBOG/FBOG Report.doc/ATP.SP.4/CC.6/16January07  

E-Print Network [OSTI]

Pappas Consulting Group Inc. PCG/FLBOG/FBOG Report.doc/ATP.SP.4/CC.6/16January07 January 15, 2007 Consulting Group Inc. PCG/FLBOG/FBOG Report.doc/ATP.SP.4/CC.6/16January07 Mr. John Dasburg Chair, Academic

Pilyugin, Sergei S.

222

Analysis 6127Performance071230.doc 1 of 5 1/21/2008 Steve Kliewer Analysis of 6127Performance071230.txt  

E-Print Network [OSTI]

Analysis 6127Performance071230.doc 1 of 5 1/21/2008 Steve Kliewer Analysis of 6127Performance071230.txt Analysis of Data using QDAQ.exe This page represents the statistical analysis of this file done 7 #12;Analysis 6127Performance071230.doc 2 of 5 1/21/2008 Steve Kliewer Invalid GPS Status: Data

California at Santa Cruz, University of

223

FM032_r1_0_Incident Report.doc 03/04/09 CNS Incident Report Form  

E-Print Network [OSTI]

FM032_r1_0_Incident Report.doc 03/04/09 CNS Incident Report Form Incident Information Date and Time Instructions on reverse #12;FM032_r1_0_Incident Report.doc 03/04/09 FM032 Instructions 1. This form. This form is not a substitute for other reporting obligations including University Injury reports. #12;

224

The optimal selection of inspection modes in a serial production process  

E-Print Network [OSTI]

. and Hassan, M. Z. , "On the Cummulative Distribution of Outgoing Duality: A New Criterion for Sampling Plans, " Technometrics 23, 4, 395-400 (November 1981) Juran, J. M. and Gryna, F. M. , ualit Plannin and Anal sis ~ McGraw- Hill Book Company, New York...THE OPTIMAL SELECTION OF INSPECTION MODES IN A SERIAL PRODUCTION PROCESS A Thesis by JESSE BRADLEY BRIDGES Submitted to the Graduate College of Texas A&M University in partial fulfillment of the requirements for the degree of MASTER...

Bridges, Jesse Bradley

1982-01-01T23:59:59.000Z

225

Serial time-resolved crystallography of photosystem II using a femtosecond  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformation Desert Southwest RegionatSearchScheduled System OutagesNewsMaterialsX-ray laser Serial

226

cDNA Microarray Analysis of Serially Sampled Cervical Cancer Specimens From Patients Treated With Thermochemoradiotherapy  

SciTech Connect (OSTI)

Purpose: To elucidate changes in gene expression after treatment with regional thermochemoradiotherapy in locally advanced squamous cell cervical cancer. Methods and Materials: Tru-Cut biopsy specimens were serially collected from 16 patients. Microarray gene expression levels before and 24 h after the first and second trimodality treatment sessions were compared. Pathway and network analyses were conducted by use of Ingenuity Pathways Analysis (IPA; Ingenuity Systems, Redwood City, CA). Single gene expressions were analyzed by quantitative real-time reverse transcription-polymerase chain reaction. Results: We detected 53 annotated genes that were differentially expressed after trimodality treatment. Central in the three top networks detected by IPA were interferon alfa, interferon beta, and interferon gamma receptor; nuclear factor kappaB; and tumor necrosis factor, respectively. These genes encode proteins that are important in regulation cell signaling, proliferation, gene expression, and immune stimulation. Biological processes over-represented among the 53 genes were fibrosis, tumorigenesis, and immune response. Conclusions: Microarrays showed minor changes in gene expression after thermochemoradiotherapy in locally advanced cervical cancer. We detected 53 differentially expressed genes, mainly involved in fibrosis, tumorigenesis, and immune response. A limitation with the use of serial biopsy specimens was low quality of ribonucleic acid from tumors that respond to highly effective therapy. Another 'key limitation' is timing of the post-treatment biopsy, because 24 h may be too late to adequately assess the impact of hyperthermia on gene expression.

Borkamo, Erling Dahl, E-mail: borkamo@gmail.co [Section of Oncology, Institute of Medicine, University of Bergen, Bergen (Norway); Center for Medical Genetics and Molecular Medicine, Haukeland University Hospital, Bergen (Norway); Schem, Baard-Christian [Department of Oncology and Medical Physics, Haukeland University Hospital, Bergen (Norway); Fluge, Oystein; Bruland, Ove [Center for Medical Genetics and Molecular Medicine, Haukeland University Hospital, Bergen (Norway); Department of Oncology and Medical Physics, Haukeland University Hospital, Bergen (Norway); Dahl, Olav; Mella, Olav [Section of Oncology, Institute of Medicine, University of Bergen, Bergen (Norway); Department of Oncology and Medical Physics, Haukeland University Hospital, Bergen (Norway)

2009-12-01T23:59:59.000Z

227

Serial Section Registration of Axonal Confocal Microscopy Datasets for Long-Range Neural Circuit Reconstruction  

SciTech Connect (OSTI)

In the context of long-range digital neural circuit reconstruction, this paper investigates an approach for registering axons across histological serial sections. Tracing distinctly labeled axons over large distances allows neuroscientists to study very explicit relationships between the brain's complex interconnects and, for example, diseases or aberrant development. Large scale histological analysis requires, however, that the tissue be cut into sections. In immunohistochemical studies thin sections are easily distorted due to the cutting, preparation, and slide mounting processes. In this work we target the registration of thin serial sections containing axons. Sections are first traced to extract axon centerlines, and these traces are used to define registration landmarks where they intersect section boundaries. The trace data also provides distinguishing information regarding an axon's size and orientation within a section. We propose the use of these features when pairing axons across sections in addition to utilizing the spatial relationships amongst the landmarks. The global rotation and translation of an unregistered section are accounted for using a random sample consensus (RANSAC) based technique. An iterative nonrigid refinement process using B-spline warping is then used to reconnect axons and produce the sought after connectivity information.

Hogrebe, Luke; Paiva, Antonio R.; Jurrus, Elizabeth R.; Christensen, Cameron; Bridge, Michael; Dai, Li; Pfeiffer, Rebecca; Hof, Patrick; Roysam, Badrinath; Korenberg, Julie; Tasdizen, Tolga

2012-06-15T23:59:59.000Z

228

Microsoft Word - AL2009DWMBPRewrite2GenaCleared.doc | Department of Energy  

Energy Savers [EERE]

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Office of Inspector General Office0-72.pdfGeorgeDoesn't32 Master EM ManagementWe2.docAL-2006-105.doc Microsoft

229

Microsoft Word - ALonEO13423Last.doc | Department of Energy  

Energy Savers [EERE]

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Office of Inspector General Office0-72.pdfGeorgeDoesn't32 Master EM ManagementWe2.docAL-2006-105.doc

230

P:\\Policy & Procedures\\PP\\PP#10-Ext Lighting Maint..doc Physical Plant  

E-Print Network [OSTI]

P:\\Policy & Procedures\\PP\\PP#10-Ext Lighting Maint..doc Physical Plant Policy & Procedure #10 TITLE: EXTERIOR LIGHTING MAINTENANCE OBJECTIVE AND PURPOSE: To assure existing exterior lighting is maintained: ACTION MAINTENANCE DEPARTMENT (MERIDIAN) Conduct Monthly Lighting Tour (visual inspection) of all

Fernandez, Eduardo

231

Post-doc GIPSA-Lab / LGIT : Ocean Acoustic Tomography in shallow water and Signal Processing  

E-Print Network [OSTI]

Post-doc GIPSA-Lab / LGIT : Ocean Acoustic Tomography in shallow water and Signal Processing influence and pollution in coastal areas. Consequently, they need the precise knowledge of the spatial and to estimate the sur- face height is also very interesting as these problems have many applications (acoustic

van Tiggelen, Bart

232

Post-doc position : Nanostructured materials for the realization of enhanced micro-supercapacitors  

E-Print Network [OSTI]

Post-doc position : Nanostructured materials for the realization of enhanced micro-supercapacitors and temperature range. The integration of low-profile, miniaturized supercapacitors could, CDC, CNT, RuO2...) for the development of micro-supercapacitors. An attractive

Ingrand, François

233

Revised on 2/6/2014 Application.doc College of the Environment  

E-Print Network [OSTI]

Revised on 2/6/2014 Application.doc College of the Environment 2014 Internship Application Form The College of the Environment is pleased to announce the 2014 Internship Program at Wesleyan University by Monday, February 24, 2014 in the College of the Environment Office, located at 284 High Street

Royer, Dana

234

Accelerated_Program_Application_10_31.doc | Revised: 11/4/13 Accelerated Program Application  

E-Print Network [OSTI]

Accelerated_Program_Application_10_31.doc | Revised: 11/4/13 Accelerated Program Application OFFICE://www.grad.usf.edu/ STUDENT AGREEMENT Please initial, indicating agreement: I have reviewed the Accelerated Program Requirements and information (http://www.grad.usf.edu/accelerated.php) I have met with my undergraduate

Meyers, Steven D.

235

FACTSHEET WORKFLOW PhD Candidate / Promotor / Dean / TGS / Doctorate Board / ProDoc Code /  

E-Print Network [OSTI]

GRADUATION FACTSHEET WORKFLOW PhD Candidate / Promotor / Dean / TGS / Doctorate Board / ProDoc Code: Graduation. The PhD1 will receive an e-mail with an invitation to submit the manuscript (33. Invitation not approved it could lead to a discontinuation of the PhD project. Termination of the employment contract

Twente, Universiteit

236

C:\\Users\\mrognlie.MSU\\Desktop\\Acronyms.doc State and Federal Agricultural Acronyms  

E-Print Network [OSTI]

C:\\Users\\mrognlie.MSU\\Desktop\\Acronyms.doc State and Federal Agricultural Acronyms Miscellaneous Center #12;State and Federal Agricultural Acronyms Printed 12/23/2009 Page 2 EFAC ­ Equipment Fee LN ­ Linfield Hall LRBP ­ Long Range Building Program LRCDP ­ Long Range Campus Development Plan (or

Maxwell, Bruce D.

237

CNS-ProjectManagement-Guidelines-200010.doc 1 / 3 CNS Project Management Procedures and Guidelines  

E-Print Network [OSTI]

CNS-ProjectManagement-Guidelines-200010.doc 1 / 3 CNS Project Management Procedures and Guidelines (Rev. October 2000) Staffing and Project Management This section is intended to provide business an application. Following an analysis phase, which may be performed by CNS in collaboration with the project

Shihadeh, Alan

238

FBE-IIPrequirements.doc 1 To: PIER Students and Steering Committee  

E-Print Network [OSTI]

FBE-IIPrequirements.doc 1 To: PIER Students and Steering Committee From: David Klahr and Sharon-Based Experience (FBE) and Integrative Interdisciplinary Project (IIP), yet clear flexibility to tailor the experiences to the unique profiles of our diverse student population. The FBE and IIP are two

239

Dear Exchange Student, Welcome to Dartmouth! You are invited to attend Dartmouth Outing Club (DOC)  

E-Print Network [OSTI]

need to arrive in Hanover on September 5th or 6th . If you fly in to Logan International Airport in Boston, you will be met by the International Students Office. If you have questions about this please://www.dartmouth.edu/~doc/firstyeartrips/. Note: If you are an International exchange student, you should select sections F or G which means you

Lotko, William

240

G:\\library-management\\Policies\\Coll_Man_PolicySept08.doc 1 University of Sussex Library  

E-Print Network [OSTI]

G:\\library-management\\Policies\\Coll_Man_PolicySept08.doc 1 University of Sussex Library Collection Management Policy 1. Introduction The University of Sussex Library contains 800,000 books, to which about 15,000 new items are added each year. The Library also provides access to over 20,000 print and online

Sussex, University of

Note: This page contains sample records for the topic "doc number serial" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


241

P:\\Policy & Procedures\\OSUA\\OSUA #2-purchasing.doc Office of Space Utilization & Analysis  

E-Print Network [OSTI]

P:\\Policy & Procedures\\OSUA\\OSUA #2-purchasing.doc Office of Space Utilization & Analysis Policy & Procedure #2 TITLE: PURCHASING OF COMPUTERS, COMPUTER EQUIPMENT OR SOFTWARE FOR DEPARTMENTAL USE. OBJECTIVE AND PURPOSE: To establish a standard procedure for purchasing computers and computer related equipment

Fernandez, Eduardo

242

TELECOM incubator summer internship description.doc TELECOM & Management SudParis Pamplin Summer Internships  

E-Print Network [OSTI]

at Management Sud Paris. They will work for a start-up company in the business incubator at Management Sud ParisTELECOM incubator summer internship description.doc TELECOM & Management SudParis ­ Pamplin Summer Internships Introduction Virginia Tech has had an exchange agreement for many years with TELECOM &Management

Virginia Tech

243

CH 5 MANAGEMENT PLAN.DOC 5-1 5 Management Plan  

E-Print Network [OSTI]

CH 5 MANAGEMENT PLAN.DOC 5-1 5 Management Plan 5.1 Vision The Willamette Subbasin Plan Oversight drafted the following vision: Willamette Basin citizens from all walks of life prize and enjoy a quilt-work of natural areas, working landscapes, and distinctive communities, from the crest of the Coast Range

244

Draft 14a CMOT.doc Proofs 05/14/04  

E-Print Network [OSTI]

Draft 14a CMOT.doc Proofs 05/14/04 Networks, Fields and Organizations: Micro-Dynamics, Scale us to identify a set of important new micro-macro linkages between local behavior in networks networks, organizational fields, scaling and at- tachment, micro-macro linkages. #12;1. Introduction

White, Douglas R.

245

Blandford_2008_MonthlyUpdate_May.doc Data Update for Blandford, MA  

E-Print Network [OSTI]

at http://www.ceere.org/rerl/rerl_resourcedata.html. #12;Data Summary Statistics A summary of the data://www.ceere.org/rerl/rerl_resourcedata.html. Data Recovery All raw wind data are subjected to a series of tests and filters to identify dataBlandford_2008_MonthlyUpdate_May.doc Data Update for Blandford, MA May, 2008 Prepared

Massachusetts at Amherst, University of

246

Blandford_2007_MonthlyUpdate_May.doc Data Update for Blandford, MA  

E-Print Network [OSTI]

://www.ceere.org/rerl/rerl_resourcedata.html. #12;Blandford_2007_MonthlyUpdate_May.doc Data Summary Statistics A summary of the data during at the Renewable Energy Research Laboratory web site: http://www.ceere.org/rerl/rerl_resourcedata.html. Data Recovery All raw wind data are subjected to a series of tests and filters to identify data that are faulty

Massachusetts at Amherst, University of

247

Blandford_2008_MonthlyUpdate_April.doc Data Update for Blandford, MA  

E-Print Network [OSTI]

at http://www.ceere.org/rerl/rerl_resourcedata.html. #12;Data Summary Statistics A summary of the data://www.ceere.org/rerl/rerl_resourcedata.html. Data Recovery All raw wind data are subjected to a series of tests and filters to identify dataBlandford_2008_MonthlyUpdate_April.doc Data Update for Blandford, MA April, 2008 Prepared

Massachusetts at Amherst, University of

248

Blandford_2008_MonthlyUpdate_July.doc Data Update for Blandford, MA  

E-Print Network [OSTI]

at http://www.ceere.org/rerl/rerl_resourcedata.html. #12;Data Summary Statistics A summary of the data://www.ceere.org/rerl/rerl_resourcedata.html. Data Recovery All raw wind data are subjected to a series of tests and filters to identify dataBlandford_2008_MonthlyUpdate_July.doc Data Update for Blandford, MA July, 2008 Prepared

Massachusetts at Amherst, University of

249

Blandford_2007_MonthlyUpdate_July.doc Data Update for Blandford, MA  

E-Print Network [OSTI]

Summary Statistics A summary of the data during the reporting period are included in the following table://www.ceere.org/rerl/rerl_resourcedata.html. Data Recovery All raw wind data are subjected to a series of tests and filters to identify dataBlandford_2007_MonthlyUpdate_July.doc Data Update for Blandford, MA July, 2007 Prepared

Massachusetts at Amherst, University of

250

Blandford_2008_MonthlyUpdate_June.doc Data Update for Blandford, MA  

E-Print Network [OSTI]

at http://www.ceere.org/rerl/rerl_resourcedata.html. #12;Data Summary Statistics A summary of the data://www.ceere.org/rerl/rerl_resourcedata.html. Data Recovery All raw wind data are subjected to a series of tests and filters to identify dataBlandford_2008_MonthlyUpdate_June.doc Data Update for Blandford, MA June, 2008 Prepared

Massachusetts at Amherst, University of

251

Blandford_2007_MonthlyUpdate_June.doc Data Update for Blandford, MA  

E-Print Network [OSTI]

://www.ceere.org/rerl/rerl_resourcedata.html. #12;Blandford_2007_MonthlyUpdate_June.doc Data Summary Statistics A summary of the data during at the Renewable Energy Research Laboratory web site: http://www.ceere.org/rerl/rerl_resourcedata.html. Data Recovery All raw wind data are subjected to a series of tests and filters to identify data that are faulty

Massachusetts at Amherst, University of

252

RMP Mercury Strategy 06-03-09.doc Page 1 of 5 RMP MERCURY STRATEGY  

E-Print Network [OSTI]

RMP Mercury Strategy 06-03-09.doc Page 1 of 5 RMP MERCURY STRATEGY Mercury is a pollutant of high the information most urgently needed by managers to find remedies to the Bay's mercury problem. The focus of total mercury in the Bay are expected to slowly decline over coming decades. The premise

253

CH 4 INVENTORY.DOC 4-1 4 Inventory and Assessment of Conservation Efforts  

E-Print Network [OSTI]

CH 4 INVENTORY.DOC 4-1 4 Inventory and Assessment of Conservation Efforts 4.1 Background According and imminent protections, and 3) current strategies implemented through specific projects. The inventory residents makes an inventory and assessment of this nature very difficult. It may therefore be helpful

254

Colorado State University Veterinary Teaching Hospital Post Doc Fellow: Emergency & Critical Care Clinician  

E-Print Network [OSTI]

Colorado State University Veterinary Teaching Hospital Post Doc Fellow: Emergency & Critical Care Clinician Internal Search Only The Veterinary Teaching Hospital at Colorado State University is offering and critical care in a veterinary hospital setting. Applicant must be a current employee of Colorado State

Rutledge, Steven

255

jdb_1700.doc 4/15/091 Energy and the Environment, Spring 2009, Class Schedule  

E-Print Network [OSTI]

jdb_1700.doc 4/15/091 Energy and the Environment, Spring 2009, Class Schedule Date Home- work Class-class Test #1, Chapters 1-11 Feb. 26 13 Fossil Fuel Resources Chapter 12 Mar. 3 Mar. 5 Environmental Impacts Mar. 26 16 Nuclear Reactions, Nuclear Energy Production Basics Chapters 18-19 Mar. 31 17 Nuclear

Bowen, James D.

256

NO NAME:Accident reporting and Auto Insurance.doc July 15, 2014  

E-Print Network [OSTI]

NO NAME:Accident reporting and Auto Insurance.doc July 15, 2014 STATEMENT OF RESOURCES TO ADDRESS CLAIMS ARISING FROM ACCIDENTS INVOLVING VEHICLES OPERATED ON UNIVERSITY BUSINESS This statement contains a general description of resources available in connection with claims arising from accidents involving

Kelly, Scott David

257

2570 IEEE TRANSACTIONS ON INFORMATION THEORY, VOL. 58, NO. 5, MAY 2012 The Performance of Serial Turbo Codes  

E-Print Network [OSTI]

Turbo Codes Does Not Concentrate Federica Garin, Giacomo Como, and Fabio Fagnani Abstract--Minimum distances and maximum likelihood error probabilities of serial turbo codes with uniform interleaver are an, the minimum distance of se- rial turbo codes grows as a positive power of their block-length, while

Como, Giacomo

258

NCMIR METHODS FOR 3D EM: A NEW PROTOCOL FOR PREPARATION OF BIOLOGICAL SPECIMENS FOR SERIAL BLOCK  

E-Print Network [OSTI]

NCMIR METHODS FOR 3D EM: A NEW PROTOCOL FOR PREPARATION OF BIOLOGICAL SPECIMENS FOR SERIAL BLOCK, University of California, San Diego, La Jolla, CA, USA Note: This protocol was designed to enhance signal followed by 0.15M cacodylate buffer (Ted Pella Inc., Redding, CA) pH 7.4 containing 2.5% glutaraldehyde

Gleeson, Joseph G.

259

A deterministic, gigabit serial timing, synchronization and data link for the RHIC LLRF  

SciTech Connect (OSTI)

A critical capability of the new RHIC low level rf (LLRF) system is the ability to synchronize signals across multiple locations. The 'Update Link' provides this functionality. The 'Update Link' is a deterministic serial data link based on the Xilinx RocketIO protocol that is broadcast over fiber optic cable at 1 gigabit per second (Gbps). The link provides timing events and data packets as well as time stamp information for synchronizing diagnostic data from multiple sources. The new RHIC LLRF was designed to be a flexible, modular system. The system is constructed of numerous independent RF Controller chassis. To provide synchronization among all of these chassis, the Update Link system was designed. The Update Link system provides a low latency, deterministic data path to broadcast information to all receivers in the system. The Update Link system is based on a central hub, the Update Link Master (ULM), which generates the data stream that is distributed via fiber optic links. Downstream chassis have non-deterministic connections back to the ULM that allow any chassis to provide data that is broadcast globally.

Hayes, T.; Smith, K.S.; Severino, F.

2011-03-28T23:59:59.000Z

260

think forward OrderNumberDOC-P80-EXS026V12007BrukerAXSGmbH.PrintedinGermany.  

E-Print Network [OSTI]

AXSGmbH.PrintedinGermany. Proportional and Scintillation Counter Proportional counter for light elements Scintillation counter for heavyYour Command Wavelength dispersive X-ray fluorescence spectrometry offers: Multi element analysis from Be to U

Wells, Mathew G. - Department of Physical and Environmental Sciences, University of Toronto

Note: This page contains sample records for the topic "doc number serial" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


261

CH 3 ASSESSMENT.DOC 3-1 3 Subbasin Assessment  

E-Print Network [OSTI]

.1% Washington 469,001 413,944 88.3% 5.6% Yamhill 459,391 422,481 92.0% 5.8% Source: Adapted from Pacific.DOC 3-3 Figure 3-2: The Willamette Basin Source: Uhrich and Wentz, 1999: 3.1.1.3 Geology The Willamette; Thieman, 2000) A variety of rock types are present in the Willamette Basin. The Coast Range consists

262

REFERENCE SHEET FOR SELECTED FIELDS OF ACQUISITIONS ORDER AND ITEM RECORDS BIBLIOGRAPHER LIST: http://ucblibraries.colorado.edu/services/bibliographers.htm  

E-Print Network [OSTI]

://ucblibraries.colorado.edu/services/bibliographers.htm CALL NUMBER/LOCATION CHART: http://ucblibraries.colorado.edu/about/classification.htm FIELD 01 ACQ TYPE materials h shared purchase scimo sci TS ENG g gov docs m spec membership spcmo spc TT ART j serials o s

Stowell, Michael

263

O:\\CSUE\\Horticulture\\Native Plant Masters\\2013\\2013 NPM Application.doc4/3/2013 Colorado State University Extension 2009  

E-Print Network [OSTI]

O:\\CSUE\\Horticulture\\Native Plant Masters\\2013\\2013 NPM Application.doc4/3/2013 © Colorado State: ___________________________ The following items are very important for communication with your trainer and NPM staff: Your Mailing Address\\2013\\2013 NPM Application.doc4/3/2013 © Colorado State University Extension 2009 2 SECTION B: (All

Stephens, Graeme L.

264

\\\\Ce_equine3\\public\\Cheryl\\WebDocuments\\OnLine\\CCYouthNomForm.doc NEW HAMPSHIRE 4-H CURRICULUM COMMITTEE  

E-Print Network [OSTI]

\\\\Ce_equine3\\public\\Cheryl\\WebDocuments\\OnLine\\CCYouthNomForm.doc NEW HAMPSHIRE 4-H CURRICULUM, including this year? #12;\\\\Ce_equine3\\public\\Cheryl\\WebDocuments\\OnLine\\CCYouthNomForm.doc 2. List and structure of 4-H (service, training, background, etc.) 4. What special attributes does this youth have

New Hampshire, University of

265

Hyper Space Complex Number  

E-Print Network [OSTI]

A new kind of numbers called Hyper Space Complex Numbers and its algebras are defined and proved. It is with good properties as the classic Complex Numbers, such as expressed in coordinates, triangular and exponent forms and following the associative and commutative laws of addition and multiplication. So the classic Complex Number is developed from in complex plane with two dimensions to in complex space with N dimensions and the number system is enlarged also.

Shanguang Tan

2007-04-23T23:59:59.000Z

266

Microsoft Word - External 2nd PP Elections Summary_10242011.doc  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Percent of Load Served 1 Number of Customers Estimated Average Percent of Load Served 1 Load Growth Rate (LGR) 41 (1 partial LGR) 2% 54 (1 partial LGR) 8% Short-Term Rate (STR)...

267

Elements of number theory  

E-Print Network [OSTI]

The dissertation argues for the necessity of a morphosemantic theory of number, that is, a theory of number serviceable both to semantics and morphology. The basis for this position, and the empirical core of the dissertation, ...

Harbour, Daniel, 1975-

2003-01-01T23:59:59.000Z

268

Table D.2 List of equiement used in Griffin Experiment. Manufacturer, serial number, and comment/description are given in adjacent columns.  

E-Print Network [OSTI]

600 Proven engineering Solar Panels Power generation Six, 75 Watt panels. Pairs of panels were battery bank. BP 275 BP solar Generator Power generation 1.2 kW generator converted to run on propane anemometer electronics, mass flow controller, battery, IRGA calibration solenoids, tube heating electronics

269

Sen. Doc. No. 05-046 SPECIAL REPORT  

E-Print Network [OSTI]

for assault was the residence halls. Although 70 reports may seems like a high number of assaults, the FBI-33. 2 FBI Uniform Crime Reports, http://www.fbi.gov/ucr/cius_03/pdf/03sec2.pdf 3 Fisher, B.S., Cullen, F

Massachusetts at Amherst, University of

270

MATLAB, vning SBN 1999-01-16 matlab_ovn.doc 1(5)  

E-Print Network [OSTI]

¢¡¤£¦¥¤§¨¡¤©¤©©© MATLAB, övning SBN 1999-01-16 matlab_ovn.doc 1(5) !#"%$¨"'&%(0)2143654798A@CBD8 programsystemet MATLAB så att du kan använda det i andra kurser. Det blir således inga matematiska djupdykningar definiera en matris i MATLAB kan man skriva på flera olika sätt. a) Mata in matrisen A : b) Genom att

Duckett, Tom

271

Microsoft Word - S07693_5-yr review rpt.doc  

Office of Legacy Management (LM)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) "ofEarlyEnergyDepartment ofDepartment ofofOxford SiteToledo SiteTonawandaUniversity of Doc. No.256

272

Microsoft Word - S09330_2ndQtr2012.doc  

Office of Legacy Management (LM)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) "ofEarlyEnergyDepartment ofDepartment ofofOxford SiteToledo SiteTonawandaUniversity of Doc.1128

273

Microsoft Word - AL2005-05Revised.doc | Department of Energy  

Energy Savers [EERE]

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Office of Inspector General Office0-72.pdfGeorgeDoesn't32 Master EM ManagementWe2.doc Microsoft Word

274

Microsoft Word - DP_cover_and_front matter_FINAL1.DOC | Department of  

Broader source: Energy.gov (indexed) [DOE]

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) "of EnergyEnergyENERGYWomen OwnedofDepartment ofJared TemansonEnergy FINAL1.DOC More Documents &

275

Microsoft Word - DP_cover_and_front matter_R1_Draft_3.DOC | Department of  

Broader source: Energy.gov (indexed) [DOE]

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) "of EnergyEnergyENERGYWomen OwnedofDepartment ofJared TemansonEnergy FINAL1.DOC More Documents

276

Microsoft Word - FY09PropertyBSCContractor.doc | Department of Energy  

Broader source: Energy.gov (indexed) [DOE]

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) "of EnergyEnergyENERGYWomen OwnedofDepartment ofJared TemansonEnergy FINAL1.DOC More Documentsof

277

Microsoft Word - FY09PropertyBSCFed.doc | Department of Energy  

Broader source: Energy.gov (indexed) [DOE]

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) "of EnergyEnergyENERGYWomen OwnedofDepartment ofJared TemansonEnergy FINAL1.DOC More

278

Microsoft Word - FY10PropertyBSCContractor.doc | Department of Energy  

Broader source: Energy.gov (indexed) [DOE]

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) "of EnergyEnergyENERGYWomen OwnedofDepartment ofJared TemansonEnergy FINAL1.DOC

279

Microsoft Word - FY10PropertyBSCFed.doc | Department of Energy  

Broader source: Energy.gov (indexed) [DOE]

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) "of EnergyEnergyENERGYWomen OwnedofDepartment ofJared TemansonEnergy FINAL1.DOCPropertyBSCFed.doc More

280

Microsoft Word - US_Japan_REE_agenda_ver7.doc | Department of Energy  

Broader source: Energy.gov (indexed) [DOE]

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) "of EnergyEnergyENERGYWomen OwnedofDepartment ofJared TemansonEnergySAR.doc More Documents &U.S. -

Note: This page contains sample records for the topic "doc number serial" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


281

Microsoft Word - g413.3-10Final5-6-08.doc | Department of Energy  

Broader source: Energy.gov (indexed) [DOE]

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) "of EnergyEnergyENERGYWomen OwnedofDepartment ofJared TemansonEnergySAR.doc More Documents &U.S.

282

Microsoft Word - Apr-June 2012 Monticello Quarterly_S09178_FFA -final.doc  

Office of Legacy Management (LM)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) "ofEarlyEnergyDepartment ofDepartment ofof EnergyYou$0.C. 20545*. . : '*I_1 September2 June 2012 Doc. No.

283

Microsoft Word - July-Sept 2012 FFA Monticello Quarterly Report.doc  

Office of Legacy Management (LM)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) "ofEarlyEnergyDepartment ofDepartment ofof EnergyYou$0.C. 20545*. . : '*I_1Shiprock,2 October 2012 Doc.

284

Microsoft Word - PhycalAlgaePilotProject_NEPAFinalEA_October2011.doc  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: VegetationEquipment Surfaces andMappingENVIRONMENTALHYDROPOWERFebruarySavebasedSAR.doc Microsoft

285

Microsoft Word - Port Townsend Amendment DRAFT 5.2.12.doc  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: VegetationEquipment Surfaces andMappingENVIRONMENTALHYDROPOWERFebruarySavebasedSAR.docVERA

286

Microsoft Word - PortTownsend IP Contract 10_08_09.doc  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: VegetationEquipment Surfaces andMappingENVIRONMENTALHYDROPOWERFebruarySavebasedSAR.docVERA4

287

Microsoft Word - Posted DSI Amendment of Alcoa Block Power Sales Agreement 12-29-08.doc  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: VegetationEquipment Surfaces andMappingENVIRONMENTALHYDROPOWERFebruarySavebasedSAR.docVERA4September

288

flash2007-33ConformedBPAPublic.doc | Department of Energy  

Office of Environmental Management (EM)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) "of EnergyEnergy Cooperation | Departmentflash2007-33ConformedBPAPublic.doc�

289

Microsoft Word - Groundwater_Booklet-2008-v5 final.doc  

Office of Environmental Management (EM)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) "of Energy Power.pdf11-161-LNG | DepartmentEnergyMagna:MasterOffice0 1 2 - 2 09Attachment.doc Acronyms

290

Microsoft Word - INCOMING.EM SSAB Chairs Recommendation 2010-1.RFP Option Periods.012110.doc  

Office of Environmental Management (EM)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) "of Energy Power.pdf11-161-LNG | DepartmentEnergyMagna:MasterOffice0 1 2 - 2 09Attachment.doc0-1

291

Microsoft Word - INCOMING.EM SSAB Chairs to NewEM-1.052109.doc  

Office of Environmental Management (EM)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) "of Energy Power.pdf11-161-LNG | DepartmentEnergyMagna:MasterOffice0 1 2 - 2 09Attachment.doc0-1May 21,

292

Microsoft Word - Policy Flash 2008-04.doc | Department of Energy  

Office of Environmental Management (EM)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) "of EnergyEnergyENERGY TAXBalanced Scorecard Federal ComplianceFOR IMMEDIATEEM-NonDefense30,4.doc Microsoft

293

Microsoft Word - Policy_Flash_ 09_01_L1_Safety_course.doc | Department of  

Office of Environmental Management (EM)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) "of EnergyEnergyENERGY TAXBalanced Scorecard Federal ComplianceFORCONFLICTS OF INTEREST1 NewFINAL.doc

294

Microsoft Word - 2012.04.9_RFHP_FINAL_SEA.doc  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious Rank EERE:Year in3.pdfEnergy HealthComments MEMA:May 14,1_2011_CEG_Update_v2.doc Microsoft Word -5

295

Implementation of data acquisition interface using on-board field-programmable gate array (FPGA) universal serial bus (USB) link  

SciTech Connect (OSTI)

Typically a system consists of hardware as the controller and software which is installed in the personal computer (PC). In the effective nuclear detection, the hardware involves the detection setup and the electronics used, with the software consisting of analysis tools and graphical display on PC. A data acquisition interface is necessary to enable the communication between the controller hardware and PC. Nowadays, Universal Serial Bus (USB) has become a standard connection method for computer peripherals and has replaced many varieties of serial and parallel ports. However the implementation of USB is complex. This paper describes the implementation of data acquisition interface between a field-programmable gate array (FPGA) board and a PC by exploiting the USB link of the FPGA board. The USB link is based on an FTDI chip which allows direct access of input and output to the Joint Test Action Group (JTAG) signals from a USB host and a complex programmable logic device (CPLD) with a 24 MHz clock input to the USB link. The implementation and results of using the USB link of FPGA board as the data interfacing are discussed.

Yussup, N.; Ibrahim, M. M.; Lombigit, L.; Rahman, N. A. A.; Zin, M. R. M. [Malaysian Nuclear Agency (Nuclear Malaysia), Bangi, 43000 KAJANG (Malaysia)

2014-02-12T23:59:59.000Z

296

N:\\redesign\\indexes\\Armour Engineer Index.doc 1 Combined Index of Armour Engineer* and Illinois Tech Engineer*  

E-Print Network [OSTI]

Occupations­Diseases, hygiene Industrial heating SEE Electric heating, Industrial Industrial hygiene SEE, Industrial SEE Psychology, Applied Radiant heating SEE Heating ­ Panel system Radio stations SEE Radio:\\redesign\\indexes\\Armour Engineer Index.doc 2 Airships SEE SEE Air-ships Alternating currents SEE Electrical currents, Alternating

Heller, Barbara

297

\\\\due.uci.edu\\due\\Files\\SAC\\CIE\\STAFF\\Duties\\REGIONS.DOC ` 09/06/13 Staff Advisor Regions  

E-Print Network [OSTI]

\\\\due.uci.edu\\due\\Files\\SAC\\CIE\\STAFF\\Duties\\REGIONS.DOC ` 09/06/13 Staff Advisor Regions UCI Study.studyabroad.uci.edu Advisor Countries/Regions (EAP & IOP) EAP Countries Chrystal Fairbanks cfairban@uci.edu (949) 824

Barrett, Jeffrey A.

298

GAL.BLAYDES-FIRESTONE.DOC 11/19/2008 2:01 PM WIND POWER, WILDLIFE, AND THE MIGRATORY BIRD  

E-Print Network [OSTI]

GAL.BLAYDES-FIRESTONE.DOC 11/19/2008 2:01 PM [1167] WIND POWER, WILDLIFE, AND THE MIGRATORY BIRD by discussing the rapid domestic growth of wind power and the implications for turbine-related avian and bat impacts, and then examine other anthropogenic sources of avian mortality. Next, we provide a broad

Firestone, Jeremy

299

ulvacsim.paper.doc 08/20/99 p. 1 of 23 Dynamic Simulation of a Multichamber CVD Cluster Tool  

E-Print Network [OSTI]

ulvacsim.paper.doc 08/20/99 p. 1 of 23 Dynamic Simulation of a Multichamber CVD Cluster Tool N-level dynamic simulator for an 8" CVD cluster tool (ULVAC-ERA1000). The simulator incorporates models, and volumes to reflect actual behavior, validated against experiments on the Ulvac tool. The process simulator

Rubloff, Gary W.

300

Dissolved organic carbon (DOC) plays a central role in many aquatic ecosystem processes [e.g. (Williamson et al.,  

E-Print Network [OSTI]

. A study in North American lakes showed that photochemical degradation of DOC caused a decrease in UV radiation, especially UV radiation (UVR = 280­400 nm) (Scully and Lean, 1994; Morris et al., 1995). UVR can absorbance. Effects of photochemical degradation differed between lakes and were related to differences

Williamson, Craig E.

Note: This page contains sample records for the topic "doc number serial" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


301

Department Human Resources Bulletin, #027, FY06, dated August 1,2006 DOC Demonstration Project Operating Procedures  

E-Print Network [OSTI]

Project Operating Procedures Purpose This issuance provides NOAA managers with pay setting flexibilitywhen Demonstration Project OperatingProcedures. . . . , . . Background On August 1,2006, the Department issued Human setting pay for Presidential Management Fellows (PMF) who are covered by the DOC Demonstration Project

302

FACULTY/POST-DOC POSITION OPENING AT NANJING UNIVERSITY The College of Environmental Science and Engineering at the Nanjing University  

E-Print Network [OSTI]

FACULTY/POST-DOC POSITION OPENING AT NANJING UNIVERSITY The College of Environmental Science.nju.edu.cn). The State Key Laboratory of Pollution Control and Resource Reuse is equipped with state-of-the-art equipments. The brand new building in Xianlin campus (see right) provides over 30,000 m2 lab

Ma, Lena

303

postdoc:Postdoc Program:Career Fair:2013:2013_LAHotel_Info.doc Hotel Info in Los Alamos  

E-Print Network [OSTI]

-672-3838 Holiday Inn Express at Entrada Park 60 Entrada Dr. Los Alamos, NM 87544 505-661-2646 Motel 6 2175 Trinitypostdoc:Postdoc Program:Career Fair:2013:2013_LAHotel_Info.doc Hotel Info in Los Alamos of hotels in Los Alamos: Adobe Pines Bed & Breakfast 2101 Loma Linda Dr. Los Alamos, NM 87544 505

304

W:\\Clinical Affairs\\Marshall\\HOTLINES\\HOTLINES-Revised-1-31-2013.doc Internal Medicine Residency Hotlines!  

E-Print Network [OSTI]

W:\\Clinical Affairs\\Marshall\\HOTLINES\\HOTLINES-Revised-1-31-2013.doc Internal Medicine Residency after hours and leave Ron a voice mail message. 2. To talk personally to William Marshall, Chair. To talk personally to Debbie McCall, Executive Assistant Dean for Administration about pay, benefits

Gilbert, Matthew

305

doc. RNDr. Vladislav Rosa, PhD., Department of fundamentals of mathematics and didactic of mathematics FMFI UK  

E-Print Network [OSTI]

doc. RNDr. Vladislav Rosa, PhD., Department of fundamentals of mathematics and didactic. The 2nd chapter ­ the shortest ­ contains description of key words of actual didactic of mathematics (didactical contract, visions, models, conflicts, incorrect opinions, obstacles). This chapter describes

Spagnolo, Filippo

306

doc. RNDr. Vladislav Rosa, PhD., Department of Algebra, Geometry and Didactics of Mathematics, FMFI UK Bratislava  

E-Print Network [OSTI]

1 doc. RNDr. Vladislav Rosa, PhD., Department of Algebra, Geometry and Didactics of Mathematics a didactical background; · extension of the tools to creation of a-didactic situation and deeper understanding proper didactic experiment carried out on sample of 11-12 and 14-15 years old pupils. This experiment

Spagnolo, Filippo

307

Web Security Standards and Practices Page 1 of 13 Web Security Standard Operating Environment (SOE) V1.doc  

E-Print Network [OSTI]

Web Security Standards and Practices Page 1 of 13 Web Security Standard Operating Environment (SOE) V1.doc Columbia University Web Security Standards and Practices Objective and Scope Effective Date: January 2011 This Web Security Standards and Practices document establishes a baseline of security related

Qian, Ning

308

PDX\\APP L_STATE FED INVENTORY.DOC 1 Inventory of State and Federal Fish and Wildlife  

E-Print Network [OSTI]

PDX\\APP L_STATE FED INVENTORY.DOC 1 APPENDIX L Inventory of State and Federal Fish and Wildlife Plans and Programs This inventory was conducted in the spring of 2003 by the Oregon Department of Fish and Wildlife under contract to WRI. The following pages are printed from the spreadsheet used in the inventory

309

C:\\Documents and Settings\\kkn\\Desktop\\JAM\\EXEMPTION LETTERS\\Freshman Residential Requirement.doc Freshman Residential Requirement  

E-Print Network [OSTI]

C:\\Documents and Settings\\kkn\\Desktop\\JAM\\EXEMPTION LETTERS\\Freshman Residential Requirement.doc Freshman Residential Requirement POLICY AND EXEMPTION PROCEDURES Division of Student Affairs-campus residential experience. The University considered and accepted the findings that living on-campus positively

Ida, Nathan

310

Exhibit 7 Filing of Patent Applications Classified Subject Matter UT-B Contracts Div ex7-july10.doc  

E-Print Network [OSTI]

Exhibit 7 ­ Filing of Patent Applications ­ Classified Subject Matter UT-B Contracts Div July 2010 Page 1 of ex7-july10.doc Exhibit 7 Ref: FAR 52.227-10 (Dec 2007) FILING OF PATENT APPLICATIONS - CLASSIFIED SUBJECT MATTER (July 2010) (a) Before filing or causing to be filed a patent application

Pennycook, Steve

311

C:\\Documents and Settings\\rpriesmeyer\\My Documents\\Word\\FAMIS Purchasing Guidelines.doc FAMIS Purchasing Guidelines  

E-Print Network [OSTI]

C:\\Documents and Settings\\rpriesmeyer\\My Documents\\Word\\FAMIS Purchasing Guidelines.doc FAMIS Purchasing Guidelines We are now utilizing the FAMIS (Financial Accounting Information Systems) State of measure & unit price of each item) · Indicate if there is a separate charge for shipping and handling

Behmer, Spencer T.

312

N:\\redesign\\guides\\Food Technology-Food Engineering.doc 1 A Beginning Finding Aid to Materials  

E-Print Network [OSTI]

, J. Henry Oxygen by the ton Oxygen ­ Manufacture 12:22 March 1947 Parker, Milton E. Food technologyN:\\redesign\\guides\\Food Technology-Food Engineering.doc 1 A Beginning Finding Aid to Materials in the IIT Archives Related to Food Technology Index of IIT Archives Acc. No. 1998.149/News (Press) Releases

Heller, Barbara

313

Acceptable Use of IT Resources Policy appendix B -revised 04-11.doc Page 1 of 2  

E-Print Network [OSTI]

not intended for you. Computing University computing resources include but are not limited to desktops, serversAcceptable Use of IT Resources Policy appendix B - revised 04-11.doc Page 1 of 2 Acceptable Use of IT Resources (Network and Computing) Policy Appendix B Examples of the Acceptable Use of IT Resources

Qian, Ning

314

Revised paper Leak NED 1997.doc 8:53 25.10.2002 1 Submitted to Nuclear Engineering and Design  

E-Print Network [OSTI]

Revised paper Leak NED 1997.doc 8:53 25.10.2002 1 Submitted to Nuclear Engineering and Design in nuclear power plants with pressurized water reactors comprise most of the reactor coolant pressure wall thickness were allowed (The American Society of Mechanical Engineers, 1986). Therefore, all tubes

Cizelj, Leon

315

risk_policies_accident_std_vist.doc/ac 1 Revised 07.26.13 STUDENT AND VISITOR ACCIDENT  

E-Print Network [OSTI]

risk_policies_accident_std_vist.doc/ac 1 Revised 07.26.13 STUDENT AND VISITOR ACCIDENT REPORTING: 408-924-1892 Student and Visitor Accident Reporting Guidelines These guidelines provide instructions for reporting and handling accidents or incidents that happen to students and visitors while on the San José

Su, Xiao

316

Definitions Numbered Space  

E-Print Network [OSTI]

Definitions · Numbered Space ­ a single space marked with a number and reserved for a single permit 24/7 · Unnumbered Space ­ a space which can be used by any customer allowed to park in that lot. High Low Average Question 4: If I buy a staff permit for an UNNUMBERED* space in a non-gated surface

Behmer, Spencer T.

317

Impact of Biodiesel Impurities on the Performance and Durability of DOC, DPF and SCR Technologies: Preprint  

SciTech Connect (OSTI)

An accelerated durability test method determined the potential impact of biodiesel ash impurities, including engine testing with multiple diesel particulate filter substrate types, as well as diesel oxidation catalyst and selective catalyst reduction catalysts. The results showed no significant degradation in the thermo-mechanical properties of a DPF after exposure to 150,000-mile equivalent biodiesel ash and thermal aging. However, exposure to 435,000-mile equivalent aging resulted in a 69% decrease in thermal shock resistance. A decrease in DOC activity was seen after exposure to 150,000-mile equivalent aging, resulting in higher hydrocarbon slip and a reduction in NO2 formation. The SCR catalyst experienced a slight loss in activity after exposure to 435,000-mile equivalent aging. The SCR catalyst, placed downstream of the DPF and exposed to B20 exhaust suffered a 5% reduction in overall NOx conversion activity over the HDDT test cycle. It is estimated that the additional ash from 150,000 miles of biodiesel use would also result in a moderate increases in exhaust backpressure for a DPF. The results of this study suggest that long-term operation with B20 at the current specification limits for alkali and alkaline earth metal impurities will adversely impact the performance of DOC, DPF and SCR systems.

Williams, A.; McCormick, R.; Luecke, J.; Brezny, R.; Geisselmann, A.; Voss, K.; Hallstrom, K.; Leustek, M.; Parsons, J.; Abi-Akar, H.

2011-04-01T23:59:59.000Z

318

The Fermat and Mersenne Numbers  

E-Print Network [OSTI]

MERSENNE EMBERS 1. ~lnt Rd doc~ton. The nunbers F of the fora 2 + 1 (n=0, 1, 2, . ~ ~ ) 2 are ccunonly hnown as the Feraat nunbers~ those nunbers M of the fora p 2P - 1, where p is a positive, pries integer, are couaonly hnown as the Mersenne nuubers.... Since n is not gwine, xx=ab, where neither a nor b is a unit. Let E=2 . Then I~X-1&X -1, and a b ~2- X -1 b-1 b-2 I + I + "~+I+I, 2 -I X 1 an integer. Hence 2 ? 1 ~ M& and thus N is not pxime. Theorem 3. If p is an odd prime, then 2p ~ M -1. P...

Nowlin, W. D.

1960-01-01T23:59:59.000Z

319

Comment on Thompson's "Complexity, Diminishing Marginal Returns and Serial Mesopotamian Fragmentation."  

E-Print Network [OSTI]

Peace, Trade (Low water levels?) Population Growth, Regime Stability Prosperity (Economic Expansion these variables. #12;Imperial Size Declining Urban Population Rising Temperature Larger City Size Trade Collapse a cycle having an odd number of negative correlations among prosperity/depression, urbanization

White, Douglas R.

320

DOE/ID-Number  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

performance and PSC in NPPs and the latest information on mobile devices and software technology in order to explore a number of usage scenarios. In their research, the team...

Note: This page contains sample records for the topic "doc number serial" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


321

ch2-1GovEqs.docCreated on 8/20/06 12:37 PM 1 Chapter 2. The continuous equations  

E-Print Network [OSTI]

Relative (rotating) coordinates va = v + ! " r #12;ch2-1GovEqs.docCreated on 8/20/06 12:37 PM 4 Newton , rotation with !, r is the position vector of the parcel: va = v + ! " r (1.2) More generally: the total dt + ! ! va (1.4) #12;ch2-1GovEqs.docCreated on 8/20/06 12:37 PM 5 Substitute va = v + ! " r into da

Kalnay, Eugenia

322

IJPSS Volume 3, Issue 11 ISSN: 2249-5894 A Monthly Double-Blind Peer Reviewed Refereed Open Access International e-Journal -Included in the International Serial Directories  

E-Print Network [OSTI]

in the International Serial Directories Indexed & Listed at: Ulrich's Periodicals Directory ©, U.S.A., Open J-Gage, India as well as in Cabell's Directories of Publishing Opportunities, U.S.A. International Journal Reviewed Refereed Open Access International e-Journal - Included in the International Serial Directories

Kumar, C.P.

323

Report number codes  

SciTech Connect (OSTI)

This publication lists all report number codes processed by the Office of Scientific and Technical Information. The report codes are substantially based on the American National Standards Institute, Standard Technical Report Number (STRN)-Format and Creation Z39.23-1983. The Standard Technical Report Number (STRN) provides one of the primary methods of identifying a specific technical report. The STRN consists of two parts: The report code and the sequential number. The report code identifies the issuing organization, a specific program, or a type of document. The sequential number, which is assigned in sequence by each report issuing entity, is not included in this publication. Part I of this compilation is alphabetized by report codes followed by issuing installations. Part II lists the issuing organization followed by the assigned report code(s). In both Parts I and II, the names of issuing organizations appear for the most part in the form used at the time the reports were issued. However, for some of the more prolific installations which have had name changes, all entries have been merged under the current name.

Nelson, R.N. (ed.)

1985-05-01T23:59:59.000Z

324

ALARA notes, Number 8  

SciTech Connect (OSTI)

This document contains information dealing with the lessons learned from the experience of nuclear plants. In this issue the authors tried to avoid the `tyranny` of numbers and concentrated on the main lessons learned. Topics include: filtration devices for air pollution abatement, crack repair and inspection, and remote handling equipment.

Khan, T.A.; Baum, J.W.; Beckman, M.C. [eds.] [eds.

1993-10-01T23:59:59.000Z

325

CHEMICAL SAFETY Emergency Numbers  

E-Print Network [OSTI]

- 1 - CHEMICAL SAFETY MANUAL 2010 #12;- 2 - Emergency Numbers UNBC Prince George Campus Security Prince George Campus Chemstores 6472 Chemical Safety 6472 Radiation Safety 5530 Biological Safety 5530 use, storage, handling, waste and emergency management of chemicals on the University of Northern

Bolch, Tobias

326

A number of organizations,  

E-Print Network [OSTI]

installed solar electric systems on a number of the city's buildings, including the Chicago Center for Green Technology shown here. CityofChicago Aggregated Purchasing--A Clean Energy Strategy SOLAR TODAY Aggregated Purchasing--A Clean Energy Strategy by Lori A. Bird and Edward A. Holt #12;November/December 2002 35 Power

327

Impact of Biodiesel Impurities on the Performance and Durability of DOC, DPF and SCR Technologies  

SciTech Connect (OSTI)

It is estimated that operating continuously on a B20 fuel containing the current allowable ASTM specification limits for metal impurities in biodiesel could result in a doubling of ash exposure relative to lube-oil derived ash. The purpose of this study was to determine if a fuel containing metals at the ASTM limits could cause adverse impacts on the performance and durability of diesel emission control systems. An accelerated durability test method was developed to determine the potential impact of these biodiesel impurities. The test program included engine testing with multiple DPF substrate types as well as DOC and SCR catalysts. The results showed no significant degradation in the thermo-mechanical properties of cordierite, aluminum titanate, or silicon carbide DPFs after exposure to 150,000 mile equivalent biodiesel ash and thermal aging. However, exposure of a cordierite DPF to 435,000 mile equivalent aging resulted in a 69% decrease in the thermal shock resistance parameter. It is estimated that the additional ash from 150,000 miles of biodiesel use would also result in a moderate increases in exhaust backpressure for a DPF. A decrease in DOC activity was seen after exposure to 150,000 mile equivalent aging, resulting in higher HC slip and a reduction in NO{sub 2} formation. The metal-zeolite SCR catalyst experienced a slight loss in activity after exposure to 435,000 mile equivalent aging. This catalyst, placed downstream of the DPF, showed a 5% reduction in overall NOx conversion activity over the HDDT test cycle.

Williams, A.; McCormick, R.; Luecke, J.; Brezny, R.; Geisselmann, A.; Voss, K.; Hallstrom, K.; Leustek, M.; Parsons, J.; Abi-Akar, H.

2011-06-01T23:59:59.000Z

328

ACCOUNTS PAYABLE VENDOR NUMBER GUIDE  

E-Print Network [OSTI]

ACCOUNTS PAYABLE VENDOR NUMBER GUIDE FOR DEPARTMENTS W-9 AND W-8BEN FORMS TAXPAYER ID NUMBER (TIN), FEDERAL EMPLOYER ID NUMBER (FEIN), AND EMPLOYER'S ID NUMBER (EIN) HOW TO FIND A VENDOR'S ID NUMBER IN BANNER HOW TO DETERMINE IF A VENDOR IS IN BANNER UPDATED MAY 2013 #12;Vendor Number Guide

329

PQLA_perm_new.doc Site Name : Quella permanent station Author : C. Vigny, A. Socquet, A. Pavez  

E-Print Network [OSTI]

the peak, a gate opens the access to a dirt road that brings to the the house of the landlords (or his : Topcon PGAI : PN O1-840201-06 SN 308-5828 Battery Lucas Supreme SMFNX110-SL 70Ah sealed Antenna cable 3m Contact David Lizana Coordinates of his house: S36.08367° W72.13291° #12;PQLA_perm_new.doc QLAP 2 ACCESS

Vigny, Christophe

330

HP Laboratories 4/28/02 Tofari:Users:berettag:Research:Conferences:EI 98:ontologyOHP.doc  

E-Print Network [OSTI]

HP Laboratories 4/28/02 Tofari:Users:berettag:Research:Conferences:EI 98:ontologyOHP.doc 0Structure-Packard Company. All rights reserved. #12;HP Laboratories 4/28/02 Tofari:Users:berettag:Research:Conferences:EI 98 radioactive · use a real big magnet · store needles separately from hay #12;HP Laboratories 4/28/02 Tofari:Users:berettag:Research:Conferences:EI

Beretta, Giordano

331

NAME: STUDENT NUMBER (PID): CITY, STATE ZIP: DAYTIME PHONE NUMBER  

E-Print Network [OSTI]

NAME: STUDENT NUMBER (PID): ADDRESS: CITY, STATE ZIP: DAYTIME PHONE NUMBER: CELL PHONE NUMBER of financial institution. 14 Cell Phone Expenses 15 Other ordinary and necessary living expenses. 16 TOTAL (add

332

Number | Open Energy Information  

Open Energy Info (EERE)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home5b9fcbce19 No revision hasInformation Earth's HeatMexico:CommunityNorthwest Basin andNsbowde's blog HomeNumber"

333

Grant Application Package CFDA Number  

E-Print Network [OSTI]

Grant Application Package CFDA Number: Opportunity Title: Offering Agency: Agency Contact: Opportunity Open Date: Opportunity Close Date: CFDA Description: Opportunity Number: Competition ID

Talley, Lynne D.

334
335

The concrete theory of numbers: initial numbers and wonderful properties of numbers repunit  

E-Print Network [OSTI]

In this work initial numbers and repunit numbers have been studied. All numbers have been considered in a decimal notation. The problem of simplicity of initial numbers has been studied. Interesting properties of numbers repunit are proved: $gcd(R_a, R_b) = R_{gcd(a,b)}$; $R_{ab}/(R_aR_b)$ is an integer only if $gcd(a,b) = 1$, where $a\\geq1$, $b\\geq1$ are integers. Dividers of numbers repunit, are researched by a degree of prime number.

Boris V. Tarasov

2007-04-07T23:59:59.000Z

336

Serial Verbs in Ibibio  

E-Print Network [OSTI]

as DPs, independent pronouns, and argument markers. All three options are demonstrated in (2) below: (2) Ekpe á-mà á-?-má (míén) Ekpe 3SG.SUBJ-PST 3SG-1SG.OBJ-like 1SG.OBJ ‘Ekpe liked me.’ The proper name Ekpe is the subject..., which is also encoded by the marker á- that precedes the tense marker (and on the verb in other cases). The 1SG object is encoded by both the full object pronoun mien and the 1SG object marker m-. The markers are sometimes variable depending...

Major, Travis

2015-03-04T23:59:59.000Z

337

Data Compression with Prime Numbers  

E-Print Network [OSTI]

A compression algorithm is presented that uses the set of prime numbers. Sequences of numbers are correlated with the prime numbers, and labeled with the integers. The algorithm can be iterated on data sets, generating factors of doubles on the compression.

Gordon Chalmers

2005-11-16T23:59:59.000Z

338

Instructions for Humanities AI/TF Doc Inventory & GSI Appointment Request Using the CEP supplemental form, please determine if the file will require CEP approval,  

E-Print Network [OSTI]

Instructions for Humanities AI/TF Doc Inventory & GSI Appointment Request Form Using the CEP document inventory for Associate In or Teaching Fellow appointments and the CEP GSI Appointment Request, please complete the Humanities GSI Appointment Request Form and the Humanities Document Inventory

California at Santa Cruz, University of

339

1 Intevep/2002/papers/FoamyOil-Pt2/nucleation_5-03.doc Modeling Foamy Oil Flow in Porous Media II  

E-Print Network [OSTI]

in a depletion experiment in which oil is pulled out of a closed sand pack at a constant rate reservoirs of heavy foamy oil under solution gas drive. All of the background motivation, the arguments1 · Intevep/2002/papers/FoamyOil-Pt2/nucleation_5-03.doc Modeling Foamy Oil Flow in Porous Media II

Joseph, Daniel D.

340

Advisor change form.doc; 8/10/2004 Whetten Graduate Center 438 Whitney Road Extension, Unit 1006 Storrs, Connecticut 06269-1006  

E-Print Network [OSTI]

Advisor change form.doc; 8/10/2004 Whetten Graduate Center 438 Whitney Road Extension, Unit 1006 Storrs, Connecticut 06269-1006 CHANGE OF MAJOR ADVISOR FORM Submit this form, when completed and signed are sent to the new major advisor, the former major advisor, and the student. The Graduate School retains

Kim, Duck O.

Note: This page contains sample records for the topic "doc number serial" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


341

C:\\Documents and Settings\\lm.SU-4155CABB2178\\Desktop\\LabSafety\\SA04002 Evaluation.DOC Date: November 9, 2004  

E-Print Network [OSTI]

C:\\Documents and Settings\\lm.SU-4155CABB2178\\Desktop\\LabSafety\\SA04002 Evaluation.DOC Date cultures capable of producing Alpha-Hemolysin Toxin be possessed by Dr. #12;C:\\Documents and Settings\\lm

Movileanu, Liviu

342

singapore_composites5.doc submitted to World Scientific 22/10/2003 -14:46 1/1 DIAMOND-FIBRE REINFORCED PLASTIC COMPOSITES  

E-Print Network [OSTI]

thin films of polycrystalline diamond on different substrates has enabled scientists and engineerssingapore_composites5.doc submitted to World Scientific 22/10/2003 - 14:46 1/1 DIAMOND of Bristol, Bristol BS8 1TR, UK Email: David.Smith@bris.ac.uk Diamond fibre reinforced poly

Bristol, University of

343

H:\\INST\\AUXBGT\\FY13UWM\\Kickoff Info\\Kickoff Packet\\1213 Aux Kickoff Agenda.doc University of Wisconsin Milwaukee  

E-Print Network [OSTI]

June 2013 June 2014 June 2015 June 2016 H:\\INST\\AUXBGT\\FY13UWM\\Internal Aux Financing\\Fund 128 ProjH:\\INST\\AUXBGT\\FY13UWM\\Kickoff Info\\Kickoff Packet\\1213 Aux Kickoff Agenda.doc University of Wisconsin ­ Milwaukee 201213 Auxiliary Budget Kickoff Meeting October 12, 2011 10:00 ­ 11:30 Regents

Saldin, Dilano

344

Page 1 of 21 G:\\ASU G DRIVE\\CASQE Website -LIVE\\casqe\\experience\\voice\\docs\\student_voice_project.docx  

E-Print Network [OSTI]

Page 1 of 21 G:\\ASU G DRIVE\\CASQE Website - LIVE\\casqe\\experience\\voice\\docs\\student_voice_project: 17 June 2009 Report title: Student Voice Project Author/to be presented by: Project Manager examiners; policies and procedures for assessment and examination of the academic performance of students

345

Above- and below-ground Litter Manipulation: Effect on Retention and Release of DOC, DON and DIN in the Sikfokut Forest, Hungary  

E-Print Network [OSTI]

on the retention and release of dissolved organic carbon (DOC), dissolved organic nitrogen (DON), nitrate and ammonium in the soil profile at 0-5 and 5-15 cm depths. The soils were obtained from a Long Term Ecological Research site in the Sikfokut Forest in Hungary...

Evetts, Elizabeth A.; Peterson, Jacqueline A.

2009-09-30T23:59:59.000Z

346

Commitment to Civil Rights and Affirmative Action 2009 I:\\Extension\\Civil Rights\\Commitment to Civil Rights and Affirmative Action.doc  

E-Print Network [OSTI]

Commitment to Civil Rights and Affirmative Action 2009 I:\\Extension\\Civil Rights\\Commitment to Civil Rights and Affirmative Action.doc COMMITMENT TO CIVIL RIGHTS AND AFFIRMATIVE ACTION government, another person, and private groups. The United States Constitution, state constitutions and many

Collins, Gary S.

347

C:\\Public\\CECarter\\Horse\\AdvCouncil\\2009\\11Minutes.doc 4-H Horse Advisory Council 4 November 2009  

E-Print Network [OSTI]

C:\\Public\\CECarter\\Horse\\AdvCouncil\\2009\\11Minutes.doc 4-H Horse Advisory Council 4 November 2009, and of course is not something we can solve if N.H. is not hosting the Regional meet. Judging: Kids were be an issue; some horses are possibly just not ready for show like State (multi-day, of this size, full

New Hampshire, University of

348

C:\\Users\\jorgan\\Documents\\Web Edits\\Vacancies\\Pastry Chef\\Template -Application for Permanent Employment (3).doc BRASENOSE COLLEGE  

E-Print Network [OSTI]

C:\\Users\\jorgan\\Documents\\Web Edits\\Vacancies\\Pastry Chef\\Template - Application for Permanent: #12;C:\\Users\\jorgan\\Documents\\Web Edits\\Vacancies\\Pastry Chef\\Template - Application for Permanent:\\Users\\jorgan\\Documents\\Web Edits\\Vacancies\\Pastry Chef\\Template - Application for Permanent Employment (3).doc Employment History

Oxford, University of

349

H:\\Internship Program\\Employer Packets and Marketing\\Internship Handbook for Employers 8-07.doc Tips for creating and maintaining successful internships  

E-Print Network [OSTI]

H:\\Internship Program\\Employer Packets and Marketing\\Internship Handbook for Employers 8-07.doc Tips for creating and maintaining successful internships Internship Handbook for Employers: Michelin://career.clemson.edu recruit_L@clemson.edu #12;2 CONTENTS Internship overview

Duchowski, Andrew T.

350

Business Expense Guidelines Page 1 Revision date: 12-06-12 Caltech Business Expense Guidelines Rev 01-04-13.doc  

E-Print Network [OSTI]

Business Expense Guidelines Page 1 Revision date: 12-06-12 Caltech Business Expense Guidelines Rev 01-04-13.doc California Institute of Technology BUSINESS EXPENSE GUIDELINES Office of Financial Services March 2003 Revised January, 2013 #12;Business Expense Guidelines Page 2 Caltech Business Expense

Bruck, Jehoshua (Shuki)

351

Version: AuthorAgreementFormAC2.doc, 2013-11-04 Academic Commons is Columbia University's online research repository, which is managed by the  

E-Print Network [OSTI]

Version: AuthorAgreementFormAC2.doc, 2013-11-04 Academic Commons is Columbia University's online of Columbia University Libraries/Information Services. http://academiccommons.columbia.edu Author Rights understand that by acceptance of this agreement I have granted Columbia University the non-exclusive right

Salzman, Daniel

352

679.26 Prohibited Species Donation Program 50 CFR 679b26.doc 679.26 Prohibited Species Donation Program Page 1 of 3  

E-Print Network [OSTI]

manager of the processor. (xii) A signed statement from the applicant and from all persons who are listed for personal injury, death, sickness, damage to property directly or indirectly due to activities conducted§ 679.26 Prohibited Species Donation Program 50 CFR 679b26.doc § 679.26 Prohibited Species Donation

353

Compendium of Experimental Cetane Numbers  

SciTech Connect (OSTI)

This report is an updated version of the 2004 Compendium of Experimental Cetane Number Data and presents a compilation of measured cetane numbers for pure chemical compounds. It includes all available single compound cetane number data found in the scientific literature up until March 2014 as well as a number of unpublished values, most measured over the past decade at the National Renewable Energy Laboratory. This Compendium contains cetane values for 389 pure compounds, including 189 hydrocarbons and 201 oxygenates. More than 250 individual measurements are new to this version of the Compendium. For many compounds, numerous measurements are included, often collected by different researchers using different methods. Cetane number is a relative ranking of a fuel's autoignition characteristics for use in compression ignition engines; it is based on the amount of time between fuel injection and ignition, also known as ignition delay. The cetane number is typically measured either in a single-cylinder engine or a constant volume combustion chamber. Values in the previous Compendium derived from octane numbers have been removed, and replaced with a brief analysis of the correlation between cetane numbers and octane numbers. The discussion on the accuracy and precision of the most commonly used methods for measuring cetane has been expanded and the data has been annotated extensively to provide additional information that will help the reader judge the relative reliability of individual results.

Yanowitz, J.; Ratcliff, M. A.; McCormick, R. L.; Taylor, J. D.; Murphy, M. J.

2014-08-01T23:59:59.000Z

354

Number  

Office of Legacy Management (LM)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) "ofEarlyEnergyDepartment ofDepartment ofof EnergyYou$0.C. 20545*.MSE Cores" _ ,' ,:.'' , /v-i 2 -i 3

355

C:\\Documents and Settings\\Serena Borsini\\Desktop\\AMS -Electronics\\Test 2008\\UG crate QM\\UG CRATE ESS\\ENVRPT26_S3013R-UG crate QM_ESS-29FEB2K8.doc Laboratorio per lo Studio degli  

E-Print Network [OSTI]

ESS\\ENVRPT26_S3013R-UG crate QM_ESS-29FEB2K8.doc SERMS Laboratorio per lo Studio degli Effetti delle.0744.49.29.13 ENVIRONMENTAL TEST REPORT doc: UG crate QM - ESS date: 29/02/08 rev: A01 pag: 1 /11 file: ENVRPT26_S3013R- UG crate QM_ESS- 29FEB2K8.doc INFN - Roma ENVIRONMENTAL TEST REPORT ­ UG crate QM - ESS ENVRPT26_S3013R

Roma "La Sapienza", Università di

356

RNG: A Practitioner's Overview Random Number Generation  

E-Print Network [OSTI]

RNG: A Practitioner's Overview Random Number Generation A Practitioner's Overview Prof. Michael and Monte Carlo Methods Pseudorandom number generation Types of pseudorandom numbers Properties of these pseudorandom numbers Parallelization of pseudorandom number generators New directions for SPRNG Quasirandom

Mascagni, Michael

357

1254 IEEE TRANSACTIONS ON NUCLEAR SCIENCE, VOL. 48, NO. 4, AUGUST 2001 Implementation of a Serial Protocol for the Liquid  

E-Print Network [OSTI]

, in a radiation-free environment. It is connected through four unidirectional optical links (the number of fibers of the liquid argon calorimeters, located in an irradiated environment. After a technical description are located in an irradiated environment (20 Gray/year and neutrons/cm /year) [3]. The information is intended

358

Motion at low Reynolds number  

E-Print Network [OSTI]

The work described in this thesis centers on inertialess motion at low Reynolds numbers at the crossroad between biofluids and microfluids. Here we address questions regarding locomotion of micro-swimmers, transport of ...

Tam, Daniel See Wai, 1980-

2008-01-01T23:59:59.000Z

359

Departmental Business Instrument Numbering System  

Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

To prescribe procedures for assigning identifying numbers to all Department of Energy (DOE), including the National Nuclear Security Administration, business instruments. Cancels DOE 1331.2B. Canceled by DOE O 540.1A.

2000-12-05T23:59:59.000Z

360

Departmental Business Instrument Numbering System  

Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

The Order prescribes the procedures for assigning identifying numbers to all Department of Energy (DOE) and National Nuclear Security Administration (NNSA) business instruments. Cancels DOE O 540.1. Canceled by DOE O 540.1B.

2005-01-27T23:59:59.000Z

Note: This page contains sample records for the topic "doc number serial" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


361

Microsoft Word - CTF WBS&PEDS_white paper_v1.doc  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

WHITE PAPER Work Breakdown Structure and PlantEquipment Designation System Numbering Scheme for the High Temperature Gas- Cooled Reactor (HTGR) Component Test Capability (CTC)...

362

Mac mini: How to Reset the PMU http://docs.info.apple.com/article.html?artnum=300574 1 of 2 7/23/2007 2:06 PM  

E-Print Network [OSTI]

Mac mini: How to Reset the PMU http://docs.info.apple.com/article.html?artnum=300574 1 of 2 7 the PMU on a Mac mini and it still isn't displaying video or turning on, contact Apple technical support (1-800-APL-CARE in the U.S.) or take your computer to your local Apple Retail Store or Apple

California at Santa Barbara, University of

363

On rings of structural numbers  

E-Print Network [OSTI]

structural numbers over the set X, and let B(X) have the operations defined above with equality also as before. Theorem I. l. If X is any set, then B(X) is a commutative ring with identity. Proof. The structural number 0 is the additive identity element... with identity g. Definition I. 7. If A, B e S(X) then A'B = (P U q ( p e A, q e B, p Il q = &f and p U q can be formed in an odd number of ways). ~E1 t. 4. L t A = (( . b), (bj. 7 )) 4 B = ((b, c), (b), (a)) be in S(X) for some X. Then AD B = {{b, a), {a...

Powell, Wayne Bruce

2012-06-07T23:59:59.000Z

364

Revised 10/3/13 h:\\dept\\forms\\propinf.doc  

E-Print Network [OSTI]

.Y. State DOH Animal Care & Use Certificate # A-050 NYS Vendor ID number 1000007489 U of R Dun & Bradstreet Administration 518 Hylan Building, RC Box 270140 Rochester, NY 14627 585 275-4031 FAX: 585 275-9492 #12;

Mahon, Bradford Z.

365

Arkansas Natural Gas Number of Industrial Consumers (Number of Elements)  

Annual Energy Outlook 2013 [U.S. Energy Information Administration (EIA)]

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) " ,"ClickPipelinesProved Reserves (Billion CubicCubic Feet)YearIndustrial Consumers (Number of Elements)

366

Kentucky Natural Gas Number of Industrial Consumers (Number of Elements)  

Gasoline and Diesel Fuel Update (EIA)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) " ,"ClickPipelines About U.S.30Natural Gas Glossary529 6330 0 14 15Industrial Consumers (Number of Elements)

367

Connecticut Natural Gas Number of Commercial Consumers (Number of Elements)  

Gasoline and Diesel Fuel Update (EIA)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) " ,"ClickPipelines About U.S.30Natural Gas Glossary529 633 622 56623 4623 42 180NumberDecadeCommercial

368

2001Notes2Providers.doc -1-Notes to Retail Providers  

E-Print Network [OSTI]

Report Filing Pursuant to Section 398.5 of the Public Utilities Code and Section 1394 of Title 20 of quarterly labels or an Annual Report, please call us at one of the numbers provided below. The Annual Report must contain the following information: 1) The registered electric service provider Identification

369

SARDINIA2003_2_Infrastructure.doc 1 Waste Treatment Infrastructure in North Rhine-Westphalia,  

E-Print Network [OSTI]

% of German hazardous waste. These conditions led to an extreme variety of disposal and recycling activities management boards. This waste disposal and recycling register has been existing and growing in number 3090 recycling and disposal plants in operation (Appendix 1, status June 2000). The disposal

Columbia University

370

Ref:Ref:159235Outline08.doc 1 Format for Paper Outlines -2008  

E-Print Network [OSTI]

to design and implement programs for simple 2d and 3d graphics models. The exam tests understanding OF SCIENCES Paper Number & Title: 159.235 Graphical Programming Credits Value: 15 Semester: S2 Campus: Albany Telephone: 9414 0800 (9532 internal) Office: QA 2.53 Email: K.A.Hawick@massey.ac.nz Other Contributing Staff

Hawick, Ken

371

Device Independent Random Number Generation  

E-Print Network [OSTI]

Randomness is an invaluable resource in today's life with a broad use reaching from numerical simulations through randomized algorithms to cryptography. However, on the classical level no true randomness is available and even the use of simple quantum devices in a prepare-measure setting suffers from lack of stability and controllability. This gave rise to a group of quantum protocols that provide randomness certified by classical statistical tests -- Device Independent Quantum Random Number Generators. In this paper we review the most relevant results in this field, which allow the production of almost perfect randomness with help of quantum devices, supplemented with an arbitrary weak source of additional randomness. This is in fact the best one could hope for to achieve, as with no starting randomness (corresponding to no free will in a different concept) even a quantum world would have a fully deterministic description.

Mataj Pivoluska; Martin Plesch

2015-02-23T23:59:59.000Z

372

Particle Number & Particulate Mass Emissions Measurements on...  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

Number & Particulate Mass Emissions Measurements on a 'Euro VI' Heavy-duty Engine using the PMP Methodologies Particle Number & Particulate Mass Emissions Measurements on a 'Euro...

373

Verification Challenges at Low Numbers  

SciTech Connect (OSTI)

Many papers have dealt with the political difficulties and ramifications of deep nuclear arms reductions, and the issues of “Going to Zero”. Political issues include extended deterrence, conventional weapons, ballistic missile defense, and regional and geo-political security issues. At each step on the road to low numbers, the verification required to ensure compliance of all parties will increase significantly. Looking post New START, the next step will likely include warhead limits in the neighborhood of 1000 . Further reductions will include stepping stones at1000 warheads, 100’s of warheads, and then 10’s of warheads before final elimination could be considered of the last few remaining warheads and weapons. This paper will focus on these three threshold reduction levels, 1000, 100’s, 10’s. For each, the issues and challenges will be discussed, potential solutions will be identified, and the verification technologies and chain of custody measures that address these solutions will be surveyed. It is important to note that many of the issues that need to be addressed have no current solution. In these cases, the paper will explore new or novel technologies that could be applied. These technologies will draw from the research and development that is ongoing throughout the national laboratory complex, and will look at technologies utilized in other areas of industry for their application to arms control verification.

Benz, Jacob M.; Booker, Paul M.; McDonald, Benjamin S.

2013-06-01T23:59:59.000Z

374

Latin American Theatre Review, Volume 11, Number 1: Book Reviews  

E-Print Network [OSTI]

"Conclusiones," diciendo que "aun el techo" se utilizaba como entrada para las mujeres del pueblo (p. 249). Tan peregrina afirmación se basa en "un documento de 1678 [que] habla de la reparación del 'tejado donde cobran a las mujeres' (Doc. 15 de 1678)," y en... amanecer (1955) by Agustín Cuzzani (Argentina); El robo del cochino (1961) by Abelardo Estorino (Cuba); La muerte no entrará en palacio (1957) by Rene Marqués (Puerto Rico); La pasión según Antígona Pérez (1970) by Luis Rafael Sánchez (Puerto Rico...

Editors

1977-10-01T23:59:59.000Z

375

C:\\Users\\rcberkel\\AppData\\Local\\Microsoft\\Windows\\Temporary Internet Files\\Content.Outlook\\LR8SNPQ6\\CIP Faculty Director Job Description.doc 6/5/14  

E-Print Network [OSTI]

\\CIP Faculty Director Job Description.doc 6/5/14 Title: Faculty Director, Capital Internship for the position of Faculty Director of the Capital Internship Programs (CIP) in Washington, D.C. (UCDC) and Sacramento (UCCS), which is housed within the Division of Undergraduate Education. The mission of CIP

Rose, Michael R.

376

T:\\013.ffentlichkeitsarbeit\\05.Vortrge\\32.NAWTEC 11 Florida 2003\\A_Ways to Improve the Efficiency of Waste to Energy Plants.doc Ways to Improve the Efficiency of Waste to Energy Plants  

E-Print Network [OSTI]

of Waste to Energy Plants.doc Ways to Improve the Efficiency of Waste to Energy Plants for the Production@mvr-hh.de Abstract Up to now the emissions of waste-to-energy plants have been of major concern for the operators about CO2 reductions the efficiency of today's Waste to Energy (WTE) plants should be improved, even

Columbia University

377

This directory lists main and branch libraries providing direct library service. Use the Public Library Headquarters file (http://www.library.ca.gov/lds/docs/CaliforniaPublicLibraryHeadquartersDirectory.pdf) for more extensive  

E-Print Network [OSTI]

This directory lists main and branch libraries providing direct library service. Use the Public Library Headquarters file (http://www.library.ca.gov/lds/docs/CaliforniaPublicLibraryHeadquartersDirectory, CA 94536-3493 Page 1 of 143Published by the Califorinia State Library. 6/6/2014 rptDirectory

378

Inter/Intra-Vehicle Wireless Communication file:///X:/www-docs/cse574-06/ftp/vehicular_wireless/index.html 1 of 16 5/9/2006 7:32 PM  

E-Print Network [OSTI]

Inter/Intra-Vehicle Wireless Communication file:///X:/www-docs/cse574-06/ftp/vehicular_wireless/index.html 1 of 16 5/9/2006 7:32 PM Inter/Intra-Vehicle Wireless Communication Gregory S. Bickel greg vehicles, as well as between vehicles. Different concepts associated with radio frequency bands and wave

Jain, Raj

379

Prime number generation and factor elimination  

E-Print Network [OSTI]

We have presented a multivariate polynomial function termed as factor elimination function,by which, we can generate prime numbers. This function's mapping behavior can explain the irregularities in the occurrence of prime numbers on the number line. Generally the different categories of prime numbers found till date, satisfy the form of this function. We present some absolute and probabilistic conditions for the primality of the number generated by this method. This function is capable of leading to highly efficient algorithms for generating prime numbers.

Vineet Kumar

2014-10-06T23:59:59.000Z

380

Grant Title: INNOVATIVE TECHNOLOGY EXPERIENCES FOR STUDENTS AND TEACHERS (ITEST) Funding Opportunity Number: NSF 12-597. CFDA Number(s): 47.076.  

E-Print Network [OSTI]

Opportunity Number: NSF 12-597. CFDA Number(s): 47.076. Agency/Department: National Science Foundation

Farritor, Shane

Note: This page contains sample records for the topic "doc number serial" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


381

Grant Title: RESEARCH EXPERIENCES FOR TEACHERS (RET) IN ENGINEERING AND COMPUTER Funding Opportunity Number: NSF 11-509. CFDA Number(s): 47.041.  

E-Print Network [OSTI]

Opportunity Number: NSF 11-509. CFDA Number(s): 47.041. Agency/Department: National Science Foundation

Farritor, Shane

382

"V Doc with logo.doc"  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

notice may share health information with each other to carry out treatment, payment, or health care operations. These Plans are collectively referred to as the Plan in this...

383

Microsoft Word - 07121310 DocProd.doc  

Office of Legacy Management (LM)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) "ofEarlyEnergyDepartment ofDepartment ofof EnergyYou$0.C. 20545*. . : '*I_ - A research projectI4the

384

Microsoft Word - 08021395 DocProd.doc  

Office of Legacy Management (LM)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) "ofEarlyEnergyDepartment ofDepartment ofof EnergyYou$0.C. 20545*. . : '*I_ - A research

385

Microsoft Word - 08071744_DocProd.doc  

Office of Legacy Management (LM)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) "ofEarlyEnergyDepartment ofDepartment ofof EnergyYou$0.C. 20545*. . : '*I_ - A researchShirley Basin

386

Microsoft Word - 08101898_DocProd.doc  

Office of Legacy Management (LM)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) "ofEarlyEnergyDepartment ofDepartment ofof EnergyYou$0.C. 20545*. . : '*I_ - A researchShirleySampling

387

Microsoft Word - 08031475_DocProd.doc  

Office of Legacy Management (LM)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) "ofEarlyEnergyDepartment ofDepartment ofof EnergyYou$ EGcG

388

Microsoft Word - 08071744_DocProd.doc  

Office of Legacy Management (LM)

...21 Attachment 1-Assessment of Anomalous Data Potential Outliers Report Attachment 2-Data Presentation Groundwater Quality Data Static...

389

Turing's normal numbers: towards randomness Veronica Becher  

E-Print Network [OSTI]

presumably in 1938 Alan Turing gave an algorithm that produces real numbers normal to every integer base- putable normal numbers, and this result should be attributed to Alan Turing. His manuscript entitled "A

390

High speed optical quantum random number generation  

E-Print Network [OSTI]

.3351 (2009). 6. I. Reidler, Y. Aviad, M. Rosenbluh, and I. Kanter, "Ultrahigh-speed random number generation

Weinfurter, Harald

391

Harmonic resolution as a holographic quantum number  

E-Print Network [OSTI]

LBNL- 57239 Harmonic resolution as a holographic quantumhep-th/0310223 UCB-PTH-03/26 Harmonic resolution as aquantum number, the harmonic resolution K. The Bekenstein

Bousso, Raphael

2009-01-01T23:59:59.000Z

392

Protocol Number: (IBC office use only)  

E-Print Network [OSTI]

Protocol Number: (IBC office use only) 1 UNF Registration of Biosafety Level 2 (BSL-2) A-2 Form", describe the methods of inactivation. #12;Protocol Number: (IBC office use only) 2 10. Describe the mechanism for decontaminating lab waste prior to disposal. Yes No If "Yes", describe the methods

Asaithambi, Asai

393

enter part number BNC / RP-BNC  

E-Print Network [OSTI]

enter part number Products 7/16 1.0/2.3 1.6/5.6 AFI AMC BNC / RP-BNC C FAKRA SMB FME HN MCX Mini ------- Product Search ------- Inventory Search Search Results for: 31-10152-RFX Results: 1 - 1 of 1 Part Number. All rights reserved. Copyright | Terms & Conditions | RF E-Mail Client | Contact Us | Amphenol

Berns, Hans-Gerd

394

GENERAL CHEMISTRY TEXTBOOK LIST ISBN Number  

E-Print Network [OSTI]

FALL 2013 GENERAL CHEMISTRY TEXTBOOK LIST Course Number ISBN Number Title of Text and/or Material Edition Author Publishers 11100 978-1-2591-9687-4 Introduction to Chemistry, 3rd ed. (packaged w 978-1-2591-6192-6 Chemistry, The Molecular Nature of Matter and Change, 6e (packaged w

Jiang, Wen

395

Company number 5857955 Wellcome Trust Finance plc  

E-Print Network [OSTI]

Company number 5857955 Wellcome Trust Finance plc Annual Report and Financial Statements Year ended 30 September 2013 #12;Company number 5857955 Wellcome Trust Finance plc Contents Page Directors Trust Finance plc Directors' Report For the year ended 30 September 2013 Report of the Directors

Rambaut, Andrew

396

Company number 5857955 Wellcome Trust Finance plc  

E-Print Network [OSTI]

Company number 5857955 Wellcome Trust Finance plc Annual Report and Financial Statements Year ended 30 September 2012 #12;Company number 5857955 Wellcome Trust Finance plc Contents Page Directors Trust Finance plc Directors' Report for the year ended 30 September 2012 Report of the Directors

Rambaut, Andrew

397

Compendium of Experimental Cetane Number Data  

SciTech Connect (OSTI)

In this report, we present a compilation of reported cetane numbers for pure chemical compounds. The compiled database contains cetane values for 299 pure compounds, including 156 hydrocarbons and 143 oxygenates. Cetane number is a relative ranking of fuels based on the amount of time between fuel injection and ignition. The cetane number is typically measured either in a combustion bomb or in a single-cylinder research engine. This report includes cetane values from several different measurement techniques - each of which has associated uncertainties. Additionally, many of the reported values are determined by measuring blending cetane numbers, which introduces significant error. In many cases, the measurement technique is not reported nor is there any discussion about the purity of the compounds. Nonetheless, the data in this report represent the best pure compound cetane number values available from the literature as of August 2004.

Murphy, M. J.; Taylor, J. D.; McCormick, R. L.

2004-09-01T23:59:59.000Z

398

Grant Title: NIDCD PHASE I/II PRELIMINARY CLINICAL TRIALS IN COMMUNICATION DISORDERS Funding Opportunity Number: PAR-12-123. CFDA Number(s): 93.173.  

E-Print Network [OSTI]

Opportunity Number: PAR-12-123. CFDA Number(s): 93.173. Agency/Department: National Institutes of Health (NIH

Farritor, Shane

399

Grant Title: AHRQ HEALTH SERVICES RESEARCH DEMONSTRATION AND DISSEMINATION GRANTS Funding Opportunity Number: PA-13-046. CFDA Number(s): 93.226.  

E-Print Network [OSTI]

Opportunity Number: PA-13-046. CFDA Number(s): 93.226. Agency/Department: Department of Health and Human

Farritor, Shane

400

Grant Title: INTELLECTUAL AND DEVELOPMENTAL DISABILITIES RESEARCH CENTERS (P30) Funding Opportunity Number: RFA-HD-13-002. CFDA Number(s): 93.865.  

E-Print Network [OSTI]

Number: RFA-HD-13-002. CFDA Number(s): 93.865. Agency/Department: Department of Health and Human Services

Farritor, Shane

Note: This page contains sample records for the topic "doc number serial" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


401

Grant Title: RESEARCH ON PSYCHOPATHOLOGY IN INTELLECTUAL DISABILITIES (R01) Funding Opportunity Number: PA-12-219. CFDA Number(s): 93.242.  

E-Print Network [OSTI]

Number: PA-12-219. CFDA Number(s): 93.242. Agency/Department: Department of Health and Human Services

Farritor, Shane

402

Grant Title: MENTAL HEALTH RESEARCH DISSERTATION GRANT TO INCREASE DIVERSITY (R36) Funding Opportunity Number: PAR-12-103. CFDA Number(s): 93.242.  

E-Print Network [OSTI]

Opportunity Number: PAR-12-103. CFDA Number(s): 93.242. Agency/Department: Department of Health and Human

Farritor, Shane

403

Grant Title: RESEARCH GRANTS FOR PREVENTING VIOLENCE AND VIOLENCE-RELATED INJURY Funding Opportunity Number: RFA-CE-14-006. CFDA Number(s): 93.136.  

E-Print Network [OSTI]

Opportunity Number: RFA-CE-14-006. CFDA Number(s): 93.136. Agency/Department: Centers for Disease Control

Farritor, Shane

404

Grant Title: BEHAVIORAL SCIENCE TRACK AWARD FOR RAPID TRANSITION (B/START) (R03) Funding Opportunity Number: PAR-12-251. CFDA Number(s): 93.279.  

E-Print Network [OSTI]

Opportunity Number: PAR-12-251. CFDA Number(s): 93.279. Agency/Department: Department of Health and Human

Farritor, Shane

405

Grant Title: ARTS IN EDUCATION MODEL DEVELOPMENT AND DISSEMINATION PROGRAM Funding Opportunity Number: ED-GRANTS-022013-001. CFDA Number(s): 84.351D.  

E-Print Network [OSTI]

Number: ED-GRANTS-022013-001. CFDA Number(s): 84.351D. Agency/Department: Department of Education, Office

Farritor, Shane

406

personal_data_form.doc 2011-07-27 T H E U N I V E R S I T Y O F B R I T I S H C O L U M B I A  

E-Print Network [OSTI]

personal_data_form.doc 2011-07-27 T H E U N I V E R S I T Y O F B R I T I S H C O L U M B I A - PERSONAL DATA FORM - IDENTIFICATION ­ Provide all information in this section EMPLOYEE ID PREFIX FIRST NAME CURRENT HOME ADDRESS CITY PROV/ST POSTAL/ZIP COUNTRY SIGNATURES SIGNATURE DATE (yyyy-mm-dd) * Personal

Michelson, David G.

407

Intel-based iMac, Intel-based Mac mini: How to reset the System Mana... http://docs.info.apple.com/article.html?artnum=303446 1 of 1 7/23/2007 2:16 PM  

E-Print Network [OSTI]

Intel-based iMac, Intel-based Mac mini: How to reset the System Mana... http://docs.info.apple.com/article.html?artnum=303446 1 of 1 7/23/2007 2:16 PM Visit the Apple Store online (1-800-MY-APPLE), visit a retail location on an iMac (Early 2006), iMac (Mid 2006), iMac (Late 2006), or Mac mini (Early 2006): From the Apple menu

California at Santa Barbara, University of

408

Grant Title: DECISION, RISK AND MANAGEMENT SCIENCES (DRMS) Funding Opportunity Number: PD-98-1321. CFDA Number(s): 47.075.  

E-Print Network [OSTI]

-1321. CFDA Number(s): 47.075. Agency/Department: National Science Foundation. Area of Research: Research

Farritor, Shane

409

Grant Title: NIH DIRECTOR'S EARLY INDEPENDENCE AWARDS (DP5) Funding Opportunity Number: RFA-RM-12-018. CFDA Number(s): 93.310.  

E-Print Network [OSTI]

-018. CFDA Number(s): 93.310. Agency/Department: Department of Health and Human Services, Office of Strategic

Farritor, Shane

410

Grant Title: NIDCD CLINICAL RESEARCH CENTER GRANT (P50) Funding Opportunity Number: PAR-13-277. CFDA Number(s): 93.173.  

E-Print Network [OSTI]

-277. CFDA Number(s): 93.173. Agency/Department: National Institutes of Health (NIH), National Institute

Farritor, Shane

411

Grant Title: ACADEMIC-COMMUNITY PARTNERSHIP CONFERENCE SERIES (R13) Funding Opportunity Number: PAR-12-102. CFDA Number(s): 93.865.  

E-Print Network [OSTI]

-12-102. CFDA Number(s): 93.865. Agency/Department: Department of Health and Human Services, National

Farritor, Shane

412

Grant Title: ALCOHOL RESEARCH EDUCATION PROJECT GRANTS (R25) Funding Opportunity Number: PAR -11-205. CFDA Number(s) 93.273.  

E-Print Network [OSTI]

-205. CFDA Number(s) 93.273. Agency/Department: Department of Health and Human Services (HHS), National

Farritor, Shane

413

Grant Title: NIDA CORE CENTER OF EXCELLENCE GRANT PROGRAM (P30) Funding Opportunity Number: PAR-10-220. CFDA Number(s): 93.279.  

E-Print Network [OSTI]

-220. CFDA Number(s): 93.279. Agency/Department: Department of Health and Human Services, National Institutes

Farritor, Shane

414

Grant Title: INITIATIVE FOR MAXIMIZING STUDENT DEVELOPMENT (IMSD) (R25) Funding Opportunity Number: PAR-13-082. CFDA Number(s): 93.859.  

E-Print Network [OSTI]

: PAR-13-082. CFDA Number(s): 93.859. Agency/Department: National Institutes of Health (NIH), National

Farritor, Shane

415

Contributions to Metric Number Technical Report  

E-Print Network [OSTI]

Contributions to Metric Number Theory Paul Rowe Technical Report RHUL­MA­2002­2 5 December 2002, Professor Glyn Harman, for sug- gestions of problems to attempt, helpful advice on methods and help

Dent, Alexander W.

416

Estimating visitor and visit numbers to  

E-Print Network [OSTI]

............................................ 24 4.5 Monitoring and Evaluating Quality of Life for CRS'07 .......................................25 4.6 Quality of experience visitor, visit and total numbers of visits to woodlands. This document builds on guidance on visitor

417

Dynamical real numbers and living systems  

E-Print Network [OSTI]

Recently uncovered second derivative discontinuous solutions of the simplest linear ordinary differential equation define not only an nonstandard extension of the framework of the ordinary calculus, but also provide a dynamical representation of the ordinary real number system. Every real number can be visualized as a living cell -like structure, endowed with a definite evolutionary arrow. We discuss the relevance of this extended calculus in the study of living systems. We also present an intelligent version of the Newton's first law of motion.

Dhurjati Prasad Datta

2010-01-11T23:59:59.000Z

418

Chemical kinetics of cetane number improving agents  

SciTech Connect (OSTI)

The increasing demand for diesel fuels has resulted in the use of greater percentage of cracked distillates having poor ignition properties. The ignition properties of diesel fuels can be rated in terms of their cetane number and diesel fuels having low cetane number may have poor ignition properties such as diesel knock, difficulties to start engines in the cold weather and so on. Such diesel fuels need cetane number improving agents. In the 1940s and 1950s alkyl nitrates, alkyl nitrites and organic peroxides were found to be effective cetane number improving additives. Our recent study suggests that free radicals produced from thermal decomposition just before ignition should have an important role to improve their ignition properties. However no studies on the reaction mechanism for improving effect of these additives have been attempted because of complex nature of spontaneous ignition reaction of hydrocarbons. In order to clarify the reaction mechanism for improving effects of cetane number improving agents. We here have attempted to simulate the spontaneous ignition of n-butane as a model compound in the presence of alkyl nitrites as cetane number improving agents.

Hashimoto, K.; Akutsu, Y.; Arai, M.; Tamura, M. [Univ. of Tokyo (Japan)

1996-12-31T23:59:59.000Z

419

The concrete theory of numbers : Problem of simplicity of Fermat number-twins  

E-Print Network [OSTI]

The problem of simplicity of Fermat number-twins $f_{n}^{\\pm}=2^{2^n}\\pm3$ is studied. The question for what $n$ numbers $f_{n}^{\\pm}$ are composite is investigated. The factor-identities for numbers of a kind $x^2 \\pm k $ are found.

Boris V. Tarasov

2007-07-06T23:59:59.000Z

420

Microsoft Word - 4136036.doc  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

generator in the primary loop. It is included here because of the attractiveness of this combined-cycle option for an electricity producing plant. Next Generation Nuclear Plant...

Note: This page contains sample records for the topic "doc number serial" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


421

matlab.doc  

E-Print Network [OSTI]

Department of Computer Science. University of New Mexico ...... If all goes according to plan, this will read the matrix A from the file A,. invert it, store the inverse ...

422

Microsoft Word - ??????.doc  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Several workmen were active in the room. The workmen were not wearing helmets or work boots but they were clearly part of a technical construction team. The machine was in...

423

Microsoft Word - ~6521732.doc  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Next Generation Nuclear Plant Project Kevan D. Weaver Date Engineering Technical Advisor Next Generation Nuclear Plant Project David A. Petti Date R&D Director Next...

424

Lesson20.doc  

E-Print Network [OSTI]

On most one-liner scientific calculators, the power key looks like .... The formula used to find the amount of radioactive material present at time t, where A0 is the ...

425

zg_lwlvl.doc  

E-Print Network [OSTI]

modular; in spite of IBM's recent move toward building video. hardware into the computer's motherboard, most vendors have. maintained the ability to install ...

426

Microsoft Word - ~6521732.doc  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

during Workshop ... 166 Appendix C: Differential Nuclear Data Measurements at the ANL Intense Pulsed Neutron Source... 171 Appendix D:...

427

0028.TBU.doc  

Broader source: Energy.gov (indexed) [DOE]

biased." These allegations clearly raise an issue with regard to at least "gross waste of funds," the revelation of which is specifically protected under Part 708....

428

Lesson30.doc  

E-Print Network [OSTI]

The time in minutes required to charge a battery depends on how close it is to being fully charged. If M is the theoretical maximum charge, k is a positive constant ...

429

Lesson21.doc  

E-Print Network [OSTI]

The time in minutes required to charge a battery depends on how close it is to being fully charged. If M is the theoretical maximum charge, k is a positive constant ...

430

1146627_7.DOC  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

PacifiCorp; NextEra Energy Resources, LLC; Invenergy Wind North America LLC; and Horizon Wind Energy LLC Complainants, v. Bonneville Power Administration Respondent. ) ) ) ) ) ) )...

431

0113.tbu.doc  

Broader source: Energy.gov (indexed) [DOE]

to Part 708 or the DOE's notification provisions for employee concerns under DOE Order 442.1A. The complainant contends that SupraMagnetics was a DOE subcontractor, because...

432

OCI.doc  

E-Print Network [OSTI]

Virtually all physical production activities — from conceptual product design, supply ... while OR facilitates data mining, exploration of larger scenario spaces, and ... The time scales of the decision-making in this management process range

433

Microsoft Word - 10063154.doc  

Office of Legacy Management (LM)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) "ofEarlyEnergyDepartment ofDepartment ofofOxford SiteToledo SiteTonawanda North - t ' v I2Grandand09Old and

434

SEC A.doc  

National Nuclear Security Administration (NNSA)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) "ofEarlyEnergyDepartmentNationalRestart of the Review ofElectronicNORTH LASSOLICITATION, OFFER AND AWARD 1.

435

SWPPPMH1.doc  

National Nuclear Security Administration (NNSA)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) "ofEarlyEnergyDepartmentNationalRestart of the Reviewwill help prepare local students forStorm Water

436

Index2.doc  

Broader source: Energy.gov (indexed) [DOE]

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) "of EnergyEnergyENERGYWomentheATLANTA,Fermi NationalBusiness PlanPosting of|of Department of Energy

437

weatherwksht.doc  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmosphericNuclear SecurityTensile Strain Switched5 Industrial Carbon CaptureFY08Intermittent MagneticVehicle3Deducing the

438

Nov08.doc  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmosphericNuclear Security Administration the Contributions andDataNationalNewportBig Eddyof H-2 andNot519hep-ph/0511180 v1 1515 W8

439

Chakrapani-V.doc  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation Proposed New Substation SitesStanding FriedelIron-Sulfur Protein DomainSSRLChainRemarks

440

doeadm-17.doc  

Office of Environmental Management (EM)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) "of EnergyEnergyENERGYWomen Owned SmallOf TheViolations |JoinZero-Energy Home Tour:a

Note: This page contains sample records for the topic "doc number serial" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


441

Report2003.doc  

Office of Environmental Management (EM)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) "of Energy Power.pdf11-161-LNG |September 15,2015Department of Energy on Separate DisposalDepartment2003

442

Microsoft Word - 13045.doc  

Energy Savers [EERE]

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Office of Inspector General Office0-72.pdfGeorgeDoesn't32 Master EM ManagementWe at NAPAWM2012 Conference,

443

titlepg.doc  

Annual Energy Outlook 2013 [U.S. Energy Information Administration (EIA)]

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) " ,"ClickPipelines AboutDecemberSteam Coal Import CostsLiquids Reserve Class3a.86, 19988,5a.8,7 (Released

444

win0203.doc  

Annual Energy Outlook 2013 [U.S. Energy Information Administration (EIA)]

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) " ,"ClickPipelines AboutDecemberSteam Coal Import CostsLiquids Reserve Class3a.86,77,1996 N| Winter Fuels

445

SPDWRAP#1.doc  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmosphericNuclear Security Administration the1 -the Mid-Infrared0 ResourceAwards SAGE Awards ,#2446Smalln n u a l r eSOWFA235May

446

SPDWRAP#1.doc  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmosphericNuclear Security Administration the1 -the Mid-Infrared0 ResourceAwards SAGE Awards ,#2446Smalln n u a l r

447

Highlights.doc  

Annual Energy Outlook 2013 [U.S. Energy Information Administration (EIA)]

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) " ,"ClickPipelines AboutDecember 2005 (Thousand9,0, 1997Environment >7,992000 Short-Term Energy Outlook

448

Highlights.doc  

Annual Energy Outlook 2013 [U.S. Energy Information Administration (EIA)]

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) " ,"ClickPipelines AboutDecember 2005 (Thousand9,0, 1997Environment >7,992000 Short-Term Energy Outlook2

449

Highlights.doc  

Annual Energy Outlook 2013 [U.S. Energy Information Administration (EIA)]

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) " ,"ClickPipelines AboutDecember 2005 (Thousand9,0, 1997Environment >7,992000 Short-Term Energy Outlook2

450

Highlights.doc  

Annual Energy Outlook 2013 [U.S. Energy Information Administration (EIA)]

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) " ,"ClickPipelines AboutDecember 2005 (Thousand9,0, 1997Environment >7,992000 Short-Term Energy

451

Highlights.doc  

Annual Energy Outlook 2013 [U.S. Energy Information Administration (EIA)]

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) " ,"ClickPipelines AboutDecember 2005 (Thousand9,0, 1997Environment >7,992000 Short-Term EnergyJuly 2003

452

Highlights.doc  

Annual Energy Outlook 2013 [U.S. Energy Information Administration (EIA)]

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) " ,"ClickPipelines AboutDecember 2005 (Thousand9,0, 1997Environment >7,992000 Short-Term EnergyJuly

453

Highlights.doc  

Annual Energy Outlook 2013 [U.S. Energy Information Administration (EIA)]

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) " ,"ClickPipelines AboutDecember 2005 (Thousand9,0, 1997Environment >7,992000 Short-Term EnergyJulyMarch

454

Highlights.doc  

Annual Energy Outlook 2013 [U.S. Energy Information Administration (EIA)]

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) " ,"ClickPipelines AboutDecember 2005 (Thousand9,0, 1997Environment >7,992000 Short-Term

455

Highlights.doc  

Annual Energy Outlook 2013 [U.S. Energy Information Administration (EIA)]

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) " ,"ClickPipelines AboutDecember 2005 (Thousand9,0, 1997Environment >7,992000 Short-TermSeptember 2002 1

456

DOC182.PDF  

Broader source: Energy.gov (indexed) [DOE]

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) "ofEarly Career Scientists'Montana. DOCUMENTS AVAILABLEReport 2009SiteMajor Maintenance at Philpott LakeThis

457

Microsoft Word - 45196.doc  

Office of Legacy Management (LM)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) "ofEarlyEnergyDepartment ofDepartment ofof EnergyYou$0.C. 20545*. . : '*I_1 September 2011 Purpose:24

458

U0004500.DOC  

Office of Legacy Management (LM)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) "ofEarlyEnergyDepartment ofDepartment ofof EnergyYou$0.C.Green River,The Secretaryat Grand Junctionla)155

459

U0083900.doc  

Office of Legacy Management (LM)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) "ofEarlyEnergyDepartment ofDepartment ofof EnergyYou$0.C.Green River,The Secretaryat Grand

460

U0174100.doc  

Office of Legacy Management (LM)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) "ofEarlyEnergyDepartment ofDepartment ofof EnergyYou$0.C.Green River,The Secretaryat Grand4100

Note: This page contains sample records for the topic "doc number serial" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


461

shprkEA.doc  

Office of Legacy Management (LM)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) "ofEarlyEnergyDepartment ofDepartment ofof EnergyYou$0.C.Greentnv~ronmenrar ivronrrorrngAC T S3

462

Microsoft Word - ~7664231.doc  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

and heat for the production of hydrogen andor oil retrieval from oil sands and oil shale to help in our national pursuit of energy independence. For nuclear process heat to...

463

1B-03.doc  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious Rank EERE:YearRound-Up from theDepartment( Sample of Shipment Notice)1021STATE ENERGY Report1B-03, in: A.R.

464

2B-01.doc  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious Rank EERE:YearRound-Up from theDepartment(October-December 2013Lamps;5 FederalEfficiency Experts1, in: A.R.

465

2B-05.doc  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious Rank EERE:YearRound-Up from theDepartment(October-December 2013Lamps;5 FederalEfficiency Experts1, in: A.R.5,

466

Dec08.doc  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation Proposed Newcatalyst phasesData Files Data Files 1 EIADeadline for2 December 20098

467

LLNLKEYSFINAL.doc  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious Rank EERE:YearRound-UpHeatMulti-Dimensionalthe10 DOEWashington, DCKickoffLDV5-CE-14022) LG: Proposed

468

Feb09.doc  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation ProposedUsing ZirconiaPolicyFeasibility of SF 6 Gas-InsulatedEnergy OSTI

469

DOEF46001705.doc  

Office of Environmental Management (EM)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) "of EnergyEnergy CooperationRequirements Matrix DOE-STD-3009-2014of EnergyMay 17, 2012Energy14313μmF

470

Environmental Records.doc  

Broader source: Energy.gov (indexed) [DOE]

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) "ofEarly Career Scientists'Montana.Program -DepartmentNovember 1, 2010December 1, 1996GuidanceDepartmentLIST OF

471

1146627_7.DOC  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsrucLasDelivered‰PNGExperience hands-on halloweenReliable solar:210th LANSCE SchoolI (8/06) Page

472

Fonsi.Leo.DOC  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation ProposedUsing ZirconiaPolicyFeasibilityFieldMinds" |beamthe Light Justreduction

473

makingiteasiertocompletecleanenergyprojectswithqualifiedenergyconservationbonds_qecbs.doc  

Broader source: Energy.gov (indexed) [DOE]

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) "ofEarlyEnergyDepartment ofDepartment of EnergyofDepartmentDEPARTMENT OFthis8-03SUBCOMMITTEE ON NATIONAL|

474

sr0801.doc  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsrucLasDelivered energy consumption byAbout SRNLBuildingsScattering at JLab andDecay

475

sr0905.doc  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsrucLasDelivered energy consumption byAbout SRNLBuildingsScattering at JLab andDecayMedia Contact:

476

sr0930.doc  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsrucLasDelivered energy consumption byAbout SRNLBuildingsScattering at JLab8, 200915, 2009CONTACTS

477

sr0934.doc  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsrucLasDelivered energy consumption byAbout SRNLBuildingsScattering at JLab8, 200915,Nettamo,

478

Oct08.doc  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmosphericNuclear Security Administration the ContributionsArmsSpeedingSpeedingUnderOccupational HealthOceanInstitute | Jefferson8

479

Doc...~En.  

Office of Legacy Management (LM)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) "ofEarlyEnergyDepartment ofDepartment ofof EnergyYou areDowntownRockyDeparttient,of Energy-' : ,:#;: .'

480

Doc.~:Ru.  

Office of Legacy Management (LM)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) "ofEarlyEnergyDepartment ofDepartment ofof EnergyYou areDowntownRockyDeparttient,of Energy-' : ,:#;: .'.'

Note: This page contains sample records for the topic "doc number serial" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


481

N0057000.doc  

Office of Legacy Management (LM)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) "ofEarlyEnergyDepartment ofDepartment ofof EnergyYou$0.C. 20545 OCT 28 1% - : Mr.~ofad. 3 0000 GJO-

482

HABAdv#167.doc  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation ProposedUsingFun with Big Sky LearningGetGraphene'sEMSLonly)EnergyP.Oc t o7 Subject: Stop

483

HABAdv#1671.doc  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation ProposedUsingFun with Big Sky LearningGetGraphene'sEMSLonly)EnergyP.Oc t o7 Subject: Stop6

484

HABadv-117.doc  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation ProposedUsingFun with Big Sky LearningGetGraphene'sEMSLonly)EnergyP.Oc t o7 Subject:

485

HABadv-118.doc  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation ProposedUsingFun with Big Sky LearningGetGraphene'sEMSLonly)EnergyP.Oc t o7 Subject:8

486

HABadv-121.doc  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation ProposedUsingFun with Big Sky LearningGetGraphene'sEMSLonly)EnergyP.Oc t o7 Subject:81

487

Habadv-115.doc  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation ProposedUsingFun with Big Sky9, 2010 The meeting wasEngineering andHQHSIHYBRID UNDULATORS

488

Habadv-119.doc  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation ProposedUsingFun with Big Sky9, 2010 The meeting wasEngineering andHQHSIHYBRID UNDULATORS9

489

Habadv-120.doc  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation ProposedUsingFun with Big Sky9, 2010 The meeting wasEngineering andHQHSIHYBRID UNDULATORS920

490

Aug08.doc  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth (AOD)ProductssondeadjustsondeadjustAboutScience Program Cumulus Humilis Aerosol596 Audit2-05 Audit62Audits88

491

Microsoft Word - 20.doc  

Office of Scientific and Technical Information (OSTI)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinan antagonist Journal Article: Crystal structureComposite--FORRemarksHEATINGI _Final ReportEFFECT OF

492

Microsoft Word - ~2432658.doc  

Office of Scientific and Technical Information (OSTI)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinan antagonist Journal Article: CrystalFG36-08GO18149 Revision: - Date: 06/15/10 ABENGOA SOLAR Advanced

493

howtodesignandmarketenergyefficiencyprogramstospecificneighborhoods.doc |  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious RankCombustion |Energy Usage »of| Department ofDepartmentLieve

494

May08.doc  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: VegetationEquipment Surfaces andMapping the Nanoscale LandscapeImportsBG4, 2012 1:00 - 2:00

495

Microsoft Word - 1938.doc  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: VegetationEquipment Surfaces andMapping RichlandScatteringWater308:UFC 2300.00 Department of 1Figure

496

Microsoft Word - 64490001.doc  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: VegetationEquipment Surfaces andMappingENVIRONMENTAL IMPACT STATEMENTbelow). U.S.Western

497

craig_IAEA.doc  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmosphericNuclear SecurityTensile Strain Switched5 Industrial Carbon Capture and Storageconvert program | NationalcostGlobal

498

Microsoft Word - 58285.doc  

Office of Scientific and Technical Information (OSTI)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) "ofEarlyEnergyDepartmentNationalRestart ofMeasuringInformation 9StructureContact

499

Microsoft Word - 1897.doc  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsrucLas Conchas recovery challenge fundProject QuarterlyDepartmentConducting1, 2014 DOE-ID:97

500

fftf ea 05292001.doc  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmosphericNuclear SecurityTensile Strain Switched5 Industrial Carbon Capture andDeepwater Methane Hydrate MaximizeOctober HomeCARTEA -