National Library of Energy BETA

Sample records for doc id stripes

  1. Microsoft Word - DOE-ID-INL-12-015.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    15 SECTION A. Project Title: Materials and Fuels Complex Underground and Aboveground Storage Tank Replacement SECTION B. Project Description: The purpose of this project is to permanently close and remove the Materials and Fuels Complex (MFC) 4,000 gallon bio-diesel underground storage tank (UST) [Site ID# 7230/Facility ID # 6-120614/Tank ID # 99ANL00013] and remove the 1,000 gallon E-85 aboveground storage tank (AST) [Site ID# 7230/Facility ID# 6-120614/Tank ID# 05MFC00035] and replace the two

  2. Microsoft Word - DOE-ID-INL-11-011.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    1 SECTION A. Project Title: MFC-752 Analytical Laboratory Seismic Upgrade SECTION B. Project Description: The Department of Energy, Idaho Operations Office (DOE-ID) conducted a review of the nuclear safety practices on the Materials and Fuels Complex (MFC) documented safety analyses (DSAs) in 2005 during transition of operating contractors. The DOE-ID assessment concluded that the MFC DSAs had potential inadequacies in following the safe harbor methodology of the nuclear safety rule. That review

  3. Microsoft Word - DOE-ID-INL-13-001.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    NEPA-CX DETERMINATION Idaho National Laboratory Page 1 of 1 CX Posting No.: DOE-ID-INL-13-001 SECTION A. Project Title: INL Research (Technical) Library Lease Termination SECTION B. Project Description: The proposed activity will terminate the current lease of the INLTechnical Library (IF-618, University Place) at 1776 Science Center Drive in Idaho Falls, ID on or about February 28, 2013 for cost savings and footprint reduction purposes. A facility walkthrough by BEA personnel will occur on or

  4. Microsoft Word - DOE-ID-INL-13-007.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    8 EC Document No.: DOE-ID-INL-13-007 SECTION A. Project Title: Seismic Monitoring for Seismic Hazards Analyses SECTION B. Project Description: The Idaho National Laboratory (INL) Probabilistic Seismic Hazards Analysis (PSHA) Phase I - Data Collection and Evaluation project is being conducted by Battelle Energy Alliance (BEA) at the request of the U.S. Department of Energy Idaho Operations office (DOE-ID) and INL Management. The project is being conducted from FY-2013 to FY-2017. Earthquake data

  5. Microsoft Word - DOE-ID-INL-12-018.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    8 SECTION A. Project Title: Rexburg Bus Lot (B60-1789-D-NE) Lease Termination SECTION B. Project Description: The proposed activity will terminate the lease of approximately four bus spaces at the Rexburg Parking Lot (B60-1789-D-NE) at South 5 th West in Rexburg, ID on or about July 31, 2012 for cost savings and consolidation to the existing lot at Rigby, ID. A facility walkthrough by BEA personnel will be performed in order to ensure the facility is ready for turnover back to the owner.

  6. Microsoft Word - DOE-ID-10-003.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    3 SECTION A. Project Title: Agreement in Principle, INL Oversight, Idaho DEQ SECTION B. Project Description The state of Idaho receives funding from the Department of Energy to conduct independent oversight and monitoring of DOE-ID operations. Oversight activities and monitoring actions that will be conducted by the state of Idaho include general project management and administrative actions, data management, providing information to the public, emergency response coordination, and environmental

  7. Microsoft Word - DOE-ID-INL-10-020.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    DOE-ID-INL-10-020 SECTION A. Project Title: Idaho National Laboratory (INL) Routine Maintenance Activities (Overarching) SECTION B. Project Description: The purpose of this overarching Environmental Checklist (EC) is to address activities that would meet the intent of the categorical exclusion (CX) B1.3 as described in 10 CFR 1021, Appendix B to Subpart D. These activities would consist of typical and non-typical types of actions, such as routine maintenance, minor modifications, and custodial

  8. Microsoft Word - DOE-ID-INL-11-009.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    CS Posting No.: DOE-ID-INL-11-009 SECTION A. Project Title: International Way Building (IWB) Relocation SECTION B. Project Description: The International Way Building (IWB) is currently leased and near the end of the lease term. Relocating the programs and equipment currently housed in the IWB to underutilized facilties is needed to provide efficient operation of these programs in the National and Homeland Security (N&HS) directorate. Relocating the programs and equipment would also result

  9. Microsoft Word - DOE-ID-INL-12-006.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    6 SECTION A. Project Title: International Way Office Building Lease Termination SECTION B. Project Description: The proposed activity will terminate the current lease of the International Way Office Building (IF-674, IWB) at 1690 International Way in Idaho Falls, ID on or about March 28, 2012 for cost savings and footprint reduction purposes. A facility walkthrough by BEA personnel will occur on or about March 26 to ensure the building is ready for turnover back to the owner. Approximate cost

  10. Microsoft Word - DOE-ID-INL-13-025.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    4 EC Document No.: DOE-ID-INL-13-025 SECTION A. Project Title: Willow Creek Building Pedestrian Bridge Replacement SECTION B. Project Description: The purpose and need for the proposed action is to address safety concerns related to the pedestrian bridge across Willow Creek east of the main entrance to the Willow Creek Building (IF-616). The proposed action would remove the current pedestrian bridge and associated steel railing and would remove the existing concrete approaches on either side of

  11. Microsoft Word - DOE-ID_INL-13-010.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    0 SECTION A. Project Title: North Boulevard Annex Lease Termination SECTION B. Project Description: The proposed activity would terminate the current lease of the North Boulevard Annex (IF-613) at 2095 North Boulevard in Idaho Falls, ID on or about July 31, 2013 for cost savings and footprint reduction purposes. A facility walkthrough by BEA personnel will occur prior to the lease termination to ensure the facility is ready for turnover back to the owner. Approximate cost associated with these

  12. Microsoft Word - DOE-ID-INL-10-017.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    DOE-ID-INL-10-017 SECTION A. Project Title: ATR Complex Dial Room. SECTION B. Project Description: The proposed project is to construct and operate a new dial room at the Advanced Test Reactor Complex (ATR Complex) (formerly known as the Test Reactor Area [TRA]) in order to meet the U.S. Department of Energy Office of Nuclear Energy programmatic needs and to provide ongoing critical support at the Idaho National Laboratory (INL). The existing telecommunication and data systems located at the

  13. Microsoft Word - DOE-ID-INL-12-016.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    No.: DOE-ID-INL-12-016 SECTION A. Project Title: Reverse Osmosis System Removal SECTION B. Project Description: The project will remove a reverse osmosis water treatment system (FU-HA-101) from TAN 681 room 182. The system is out-of-service, with no intent of future use. Work will involve removal of the reverse osmosis system, and associated plumbing/piping and electrical lines and conduit. The project will clear the area of obstacles and tripping hazards associated with unused/unnecessary

  14. Microsoft Word - DOE-ID-INL-12-023.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Page 1 of 1 CX Posting No.: DOE-ID-INL-12-023 SECTION A. Project Title: Idaho Falls Power - Willow Creek Building (WCB) Conduit Installation SECTION B. Project Description: The purpose of this project is to provide the Idaho National Laboratory (INL) a communications pathway from the Willow Creek Building (WCB) northeast parking lot handhole to the handhole north of Research and Education Campus (REC)-617. INL and the City of Idaho Falls have an existing easement agreement that allows INL to

  15. Microsoft Word - DOE-ID-INL-12-024..doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    PostingNo.: DOE-ID-INL-12-024 SECTION A. Project Title: Rigby Bus Lot Northwest Entrance SECTION B. Project Description: The purpose of the proposed action is to provide an additional bus entrance to the Rigby Park and Ride Bus Lot. A portion of chain link fencing (running east to west) on the northwest corner of the Rigby Park and Ride Bus Lot would be relocated to allow an opening off of the City of Rigby dirt access road so that buses may enter the Rigby Park and Ride Lot from the northwest.

  16. Microsoft Word - DOE-ID-INL-13-008.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    DOEID NEPA CX DETERMINATION Idaho National Laboratory Page 1 of 2 EC Document No.: DOE-ID-INL-13-008 SECTION A. Project Title: Materials and Fuels Complex (MFC) Diversion Dam SECTION B. Project Description: There is a flood control dam about 2000 ft south of MFC. The dam is at risk of failure during a large runoff event. This project will reinforce the flood control dam with additional earthen material and a concrete headwall around the culvert inlet. The workscope consists of 1) Removing riprap

  17. Microsoft Word - DOE-ID-INL-13-019.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    9 SECTION A. Project Title: University Boulevard Water Meter Installation SECTION B. Project Description: This project would install water meters for the purpose of measuring water use at each of four University Boulevard (UB) buildings at 535, 655, 625, and 595 University Boulevard (IF-680 (UB1), IF-681 (UB2), IF-682 (UB3), and IF-684 (UB4)) in Idaho Falls, ID during the projected time period of August and September, 2013 at an approximate cost of $20 K - $95 K depending upon whether the work

  18. Microsoft Word - DOE-ID-INL-14-015.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    5 CX Posting No.: DOE-ID-INL-14-015 SECTION A. Project Title: United States Geological Survey (USGS) Geotechnical Drilling for USGS-142 and USGS-143 SECTION B. Project Description: The U.S. Geological Survey (USGS) proposes to continuously core geotechnical boreholes USGS-142 and USGS-143 to a depth of 1,000 and 2,000 ft below land surface, respectively. Boreholes USGS-142 and USGS-143 would be constructed as monitoring wells and used to measure and collect aquifer data. Borehole USGS-142 (see

  19. Header Sheet Doc ID Z OAK RIDGE NATIONAL LABORATORY M. E. Murray

    Office of Legacy Management (LM)

    Dames & Moore Header Sheet Doc ID Z OAK RIDGE NATIONAL LABORATORY M. E. Murray MANAGED BY LOCKHEED MARTIN rNERGY RESEARCH CORPORATION PHONE: (423) 574-5838 FOR THE U.S. DEPARTMENT OF ENERGY FAX: (423) POST OFFICE Box 2 INTERNET: r'0 March 31, 1997 Mr. Andrew Meloy DuPont Environmental Remediation Services DuPont Chambers Works Route 130, Anti-Knocks Building G Deepwater, New Jersey 08023 Dear Mr. Meloy: Radiological Sampling Requirements for the B Ditch Remediation Project, DuPont Chamber

  20. Microsoft Word - cg0915 Alum Carbothermic Tech DE-FC36-00ID139000.doc

    Office of Scientific and Technical Information (OSTI)

    2004 December 31 Cooperative Agreement No. DE-FC36-00ID13900 Aluminum Carbothermic Technology Final Technical Progress Report for the Period 2000 July through 2004 December Submitted to: U. S. Department of Energy Golden Field Office 1617 Cole Boulevard Golden, CO 80401 DOE/ID/13900 Aluminum Carbothermic Technology Submitted to: U. S. Department of Energy Cooperative Agreement Number DE-FC36-00ID13900 Submitted by: M. J. Bruno Alcoa Inc. 100 Technical Drive Alcoa Center, PA 15069-0001 Email:

  1. Microsoft Word - DOE-ID-12-011 RESL XRF EC.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    1 SECTION A. Project Title: DOE-ID/RESL Wavelength-Dispersive X-Ray Spectrometer for Chemistry Research & Development SECTION B. Project Description The DOE-ID Radiological & Environmental Sciences Laboratory (RESL) has a need for a complete state-of-the-art fully automated sequential wavelength-dispersive X-ray fluorescence (WD-XRF) spectrometer system. The WD-XRF spectrometer system will be primarily used for elemental analyses of soil, liquids (waters), air filters, unknown

  2. Microsoft Word - DOE-ID-INL-12-028-1.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    EC Document No.: DOE-ID-INL-12-028 SECTION A. Project Title: National Oceanic and Atmospheric Administration (NOAA) Birch Creek Canyon Wind Study SECTION B. Project Description: The National Oceanic and Atmospheric Administration (NOAA) Birch Creek Valley Wind Study would be conducted under the umbrella of the NOAA/Idaho National Laboratory (INL) Meteorological Research Partnership Memorandum of Agreement between NOAA and the Idaho Office of the U.S. Department of Energy (DOE-ID). The project

  3. Microsoft Word - DOE-ID-13-044 Idaho EC B3-6.doc

    Office of Environmental Management (EM)

    Page 1 of 1 CX Posting No.: DOE-ID-13-044 SECTION A. Project Title: Off-gas Treatment: Evaluation of Nano-structured Sorbents for Selective Removal of Contaminants - University of Idaho SECTION B. Project Description The University of Idaho proposes to evaluate nanostructured sorbent materials for their effectiveness in removing and immobilizing contaminants for the off-gas treatment from the used nuclear fuel recycling operations. Specific objectives of the project are: 1. To synthesize and

  4. AcqGuide4pt1.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    pt1.doc� AcqGuide4pt1.doc� PDF icon AcqGuide4pt1.doc� More Documents & Publications Source Selection Guide Source Selection Guide Policy Flash 2013-46 Awardee in STRIPES

  5. Tamper resistant magnetic stripes

    DOE Patents [OSTI]

    Naylor, Richard Brian (Albuquerque, NM); Sharp, Donald J. (Albuquerque, NM)


    This invention relates to a magnetic stripe comprising a medium in which magnetized particles are suspended and in which the encoded information is recorded by actual physical rotation or alignment of the previously magnetized particles within the flux reversals of the stripe which are opposed in their magnetic polarity. The magnetized particles are suspended in a medium which is solid, or physically rigid, at ambient temperatures but which at moderately elevated temperatures, such as C., is thinable to a viscosity permissive of rotation of the particles therein under applications of moderate external magnetic field strengths within acceptable time limits.

  6. 4-ID beamline layout

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Sector 4 beamline layout Overview Sector 4 uses a canted undulator straight section to operate two beamlines The 4-ID-C beamline operates between 500 and 3000 eV while the 4-ID-D...

  7. Badging, Real ID

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Office » Badging, Real ID Badging, Real ID Effective Nov. 3, 2014, the Lab will implement requirements of the REAL ID Act. Contact Badge Office (505) 667-6901 Email Badge requirements US citizen employees must present a photo ID and proof of US citizenship. See Security Smart on Proof of United States Citizenship for the Badge Office (pdf). Foreign national guests and employees must have an approved visit and present a valid passport and documentation of US legal status and work authorizations.

  8. FAADS/FAADS Plus Screen from STRIPES - dollar amounts

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    FAADS/FAADS Plus Screen from STRIPES - dollar amounts

  9. Beamline 29-ID

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    & Milestones IEX Advisory Committees FDR Beamline Information RSXS ARPES APS Ring Status Current APS Schedule Intermediate Energy X-Rays (29-ID): The Intermediate Energy...

  10. Microsoft Word - DOE-ID-10-004.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    4 SECTION A. Project Title: E-85 Fueling Systems for AMWTP and INTEC SECTION B. Project Description This project consists of installing two E-85 fueling systems (85 % ethanol and 15% petroleum based fuel) for fueling fleet vehicles. One system will be located at the Advanced Mixed Waste Treatment Project and the other at the Idaho Nuclear Technology Center. The two above ground, E85 compatible, double wall carbon steel, skid-mounted tanks have a capacity of 12,000 gallons each. The tanks will be

  11. Microsoft Word - DOE-ID-10-005.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    5 SECTION A. Project Title: CPP-663 HVAC Systems Upgrade SECTION B. Project Description The scope of work will be to repair and/or replace the existing heating, ventilation, and air conditioning system located in building CPP-663 at the Idaho National Engineering Laboratory. The scope will be to repair the existing system or identify an energy efficient replacement to the existing system and place an NFPA 70E code compliant electrical metering system that will monitor building electrical usage.

  12. Microsoft Word - DOE-ID-12-020.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    20 SECTION A. Project Title: ZPPR Surveillance Glovebox SECTION B. Project Description: The purpose of the proposed action is to limit exposure hazards and better contain airborne hazards, beyond current capabilities, associated with performing surveillance, characterization, and repackaging activities for transuranic materials in the Zero Power Physics Reactor (ZPPR) workroom hoods. In order to meet this purpose and need, the Transuranic Surveillance Glovebox (TSG) would be installed. This

  13. Microsoft Word - DOE-ID-INL-10-021.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    21 SECTION A. Project Title: Geotechnical Investigation for INL Remote-Handled Low-Level Waste Disposal SECTION B. Project Description: The proposed action would conduct geotechnical investigations at two 4-6 acre candidate sites for a Remote-Handled Low-Level Waste (RH LLW) Facility at the Idaho National Laboratory (INL). One site is located southwest of the Advanced Test Reactor (ATR)-Complex and the other site is located west of and across Lincoln Blvd. from the Idaho Comprehensive

  14. Microsoft Word - DOE-ID-INL-11-001.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    1 SECTION A. Project Title: Hex Block Shipment Project SECTION B. Project Description. This project involves the shipment of two irradiated stainless steel hex blocks presently located at the Idaho National Laboratory (INL) Materials and Fuels Complex (MFC) to a Westinghouse facility located in Pittsburgh, Pennsylvania to support Research and Development (R&D) activities. This R&D work will be performed by a private contractor and will involve the use of ultrasonic equipment to determine

  15. Microsoft Word - DOE-ID-INL-11-002.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    2 SECTION A. Project Title: Facility Construction and Modification in Support of the Material Security and Consolidation Project. SECTION B. Project Description: Additional onsite storage capabilities that meet anticipated security requirements are needed to support the accelerated processing of Experimental Breeder Reactor-II (EBR-II) spent nuclear fuel (SNF) and the potential growth of research and development activities. DOE is accelerating the processing of the highly enriched EBR-II SNF to

  16. Microsoft Word - DOE-ID-INL-11-003.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    3 SECTION A. Project Title: Specific Manufacturing Capability (SMC) Incinerator and Propane Tank System Removal SECTION B. Project Description The project will dismantle and remove the Specific Manufacturing Capability (SMC) refuse incinerator, the eighteen foot stack, and the associated propane tank system. All propane will be removed from the tank prior to physical removal. The incinerator is located on a cement slab approximately 20 meters northeast of building TAN-681 and is within the

  17. Microsoft Word - DOE-ID-INL-11-004.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    04 SECTION A. Project Title: ATR Canal AFIP-7 Channel Gap Probe Installation Project SECTION B. Project Description: The location for the proposed project is the Advanced Test Reactor (ATR) at the ATR Complex, located at the Idaho National Laboratory (INL). This project involves the following primary efforts: * Installation of the channel gap probe instrument into the East end of the ATR canal o Bolting together two pieces of the assembly o Lifting the channel gap probe into the canal o

  18. Microsoft Word - DOE-ID-INL-11-006.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    6 SECTION A. Project Title: INL - USGS Geotechnical Drilling Program (USGS 131A) SECTION B. Project Description: The U.S. Geological Survey (USGS) proposes to use an existing well pad to construct a replacement well, USGS131A, about 25 ft north of the original well head (USGS 131). USGS 131A will be drilled to about 1,300 ft below surface level (BSL) then instrumented with a multilevel monitoring system in FY 2012. The new well will replace USGS 131, which will be abandoned or used as a water

  19. Microsoft Word - DOE-ID-INL-11-008.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    8 SECTION A. Project Title: Parking area expansion along road to Range #7 SECTION B. Project Description: Additional parking is needed during breacher training and other demonstration activities on range #7 to accommodate access by emergency response vehicles. Historically, participants have parked their vehicles on the gravel road leading to range #7 which restricts access to emergency response vehicles. The proposed action is to "grub" out an area of approximately 0.06 acres (about

  20. Microsoft Word - DOE-ID-INL-11-010.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    1-010 SECTION A. Project Title: Special Manufacturing Complex (SMC) Line 1 Deactivation, Decontamination, and Decommissioning (DD&D) SECTION B. Project Description: This project proposes DD&D of Test Area North (TAN) 629, Line 1 to remove obsolete, out-of-service production equipment. Work will involve the removal of the inspection station, material transporters, laser water chiller, and laser. Associated electrical connections, utility piping, and localized ventilation will also be

  1. Microsoft Word - DOE-ID-INL-11-013.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    3 SECTION A. Project Title: Modifications to Central Facilities Area (CFA)-Live Fire Range and Main Gate Drinking Water SECTION B. Project Description: Modification of the drinking water systems at the CFA Live Fire Range and Main Gate is needed to improve water quality. The drinking water chlorinator at the Live Fire Range does not function properly and cannot be modified or repaired. Personnel at the facility have been using bottled drinking water for several years. There is no disinfection at

  2. Microsoft Word - DOE-ID-INL-11-014.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    4 SECTION A. Project Title: Advanced Test Reactor Core Internals Changeout (CIC) Outage - 2015 SECTION B. Project Description: The proposed action will provide for the sixth core internals changeout (CIC) outage of the Advanced Test Reactor (ATR), which is housed in building Test Reactor Area (TRA)-670, located at the Idaho National Laboratory (INL) ATR Complex. Activities scheduled during the CIC outage include the changeout of components in the high-flux region of the ATR core and support

  3. Microsoft Word - DOE-ID-INL-12-002.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    2 SECTION A. Project Title: Underground Storage Tank (UST) Steel Line Replacements SECTION B. Project Description: The Idaho Department of Environmental Quality (DEQ) performed an inspection of Idaho National Laboratory's (INL's) USTs in September of 2011. Inspection results indicated field violations for failing to install and maintain cathodic protection systems for steel lines associated with seven underground storage tanks. DEQ did not accept the INL's "corrosion expert"

  4. Microsoft Word - DOE-ID-INL-12-004.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    4 SECTION A. Descriptive Information: Materials and Fuels Complex (MFC) Contaminated Equipment Storage Building (CESB) Conversion Scope Change SECTION B. Project Description: MFC-794 CESB is currently being modified for reasons described in Environmental Checklist (EC) Idaho National Laboratory (INL)-10- 074 (OA 12). During construction it was determined that some of the equipment that will be located in the building will need non-contact cooling water in order to operate. This EC addresses the

  5. Microsoft Word - DOE-ID-INL-12-005.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    5 SECTION A. Descriptive Information: Central Facilities Area (CFA) Shoot House Panel Installation SECTION B. Project Description: The existing shoothouse facility (Figure 1) provides little to no wind protection for trainers and observers. Trainers and observers stand in an elevated position that is mostly exposed to blowing winds. This project will install 10 new fiberglass panels (22' to 23' X 4' to 5') on the existing building to inhibit the wind and improve the usability of the facility.

  6. Microsoft Word - DOE-ID-INL-12-010.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    0 SECTION A. Project Title: Information Operations & Research Center (IORC) Room E-6 Air Conditioner Unit Installation SECTION B. Project Description: The proposed project will install an additional air conditioning (A/C) unit in the IORC (IF-608). Universal Power Supply (UPS) and server equipment are being relocated from rooms B-3 and B-6 to room E-6. The current A/C system that cools room E-6 is not adequate to cool the relocated equipment. The 5 ton cooling unit and drycooler will be

  7. Microsoft Word - DOE-ID-INL-12-013.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    3 SECTION A. Project Title: Idaho National Laboratory (INL) Administration Building (IAB) Communication Room Heating, Ventilation, and Air Conditioning (HVAC) Upgrade SECTION B. Project Description: The proposed project would install new server equipment with associated uninterruptible power supplies (UPS's) and an additional air conditioning unit in the data room at the IAB (IF-606). The additional air conditioning (A/C) unit is needed to keep up with the load the new equipment requires.

  8. Microsoft Word - DOE-ID-INL-12-017.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    7 SECTION A. Project Title: Engineering Research Office Building (EROB) 1E- Human System Simulation Laboratory Modifications SECTION B. Project Description: The Nuclear Science and Technology (NS&T) customer for Human Simulation Systems Lab (HSSL) has requested additional - computer lab space to support forth coming projects in yearend FY12 and projected into FY13. Project specific is the LWRS-related project for control room upgrades for a commercial client. The project will utilize the

  9. Microsoft Word - DOE-ID-INL-12-019.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    9 SECTION A. Project Title: INL Administration Building (IAB)Telephone Room 112 Heating, Ventilating, and Air Conditioning (HVAC) Upgrade SECTION B. Project Description: The proposed project will install a new air conditioning unit in the INL Administration Building room 112. The new air conditioning system will handle the equipment heat loads within this room. Room 112 is an unclassified telephone room that is not normally occupied. This room has one supply air diffuser and one return air

  10. Microsoft Word - DOE-ID-INL-13-004.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    4 SECTION A. Project Title: High Density Fuel Material for Light Water Reactors (LWRs) SECTION B. Project Description This project proposes to install glove boxes, laboratory equipment and laboratory hoods in the east wing of the Experimental Fuels Facility (EFF), building 794, at the Materials and Fuels Complex (MFC) at the Idaho National Laboratory (INL). The building was previously known as the Contaminated Equipment Storage Building (CESB). The purpose of this project is to support a high

  11. Microsoft Word - DOE-ID-INL-13-014.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    4 SECTION A. Project Title: Iona Relay Station Maintenance SECTION B. Project Description: This project would periodically perform maintenance related activities in and around an approximate 15 acre area at the Iona Hill Relay Station. Activities would include: maintenance/testing of the emergency generator, facility grounds and road surface repair and upkeep (e.g., grading, snow removal, resurfacing, weed control), building and structure maintenance/repair (e.g., painting, insect control,

  12. Microsoft Word - DOE-ID-INL-13-015.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    5 SECTION A. Project Title: Relocation of National and Homeland Security (N&HS) activities from Transient Reactor Experiment and Test Facility (TREAT) to Critical Infrastructure Test Range Complex (CITRC) SECTION B. Project Description: The proposed project will relocate Homeland Security personnel who currently reside at TREAT to CITRC. The scope of this environmental checklist is only for the purchase and installation of three modular trailers. Three modular buildings are to be purchased

  13. Microsoft Word - DOE-ID-INL-13-016.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    6 SECTION A. Project Title: Wildland Fire Chainsaw Training SECTION B. Project Description: The Idaho National Laboratory (INL) fire department is required by the National Wildfire Coordinating Group (NWCG) to have chainsaw packages on each of the Type 4 wildland fire engines. Prior to placing these chainsaws into service, the INL fire department must train firefighters to chainsaw operational and safety protocols, including both classroom and hands-on training in the field. To enable realistic

  14. Microsoft Word - DOE-ID-INL-13-020.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    0 SECTION A. Project Title: Interim Storage Area for Interim Storage Containers (ISCs) at the Radioactive Scrap and Waste Facility (RSWF) SECTION B. Project Description: Currently, dedicated space is unavailable for above-grade storage of Interim Storage Containers (ISCs) containing 55-gal drums of remote handled transuranic waste (RH-TRU). In the past this waste was packaged in specially constructed liners and placed into the RSWF. When ready for transfer this waste would then be removed from

  15. Microsoft Word - DOE-ID-INL-13-021.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    1 SECTION A. Project Description: Decommissioning of Shallow Injection Wells (SIW) (13-Test Reactor Area [TRA], 14-TRA, 21- TRA and 26-TRA) at the Advanced Test Reactor (ATR) Complex SECTION B. Project Description: This project will involve the decommissioning of the following Shallow Injection Wells (SIWs) at the Advanced Test Reactor (ATR) Complex: 13-TRA (Idaho Department of Water Resources [IDWR] Permit Number 34X0001020) located near the northeast corner of building TRA-614, 14-TRA (IDWR

  16. Microsoft Word - DOE-ID-INL-13-023.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    3 SECTION A. Project Title: Test Reactor Area (TRA)-680 Road Widening SECTION B. Project Description: The purpose and need for the proposed action is to widen the gravel interior perimeter road within the Advanced Test Reactor (ATR) Complex at a location near TRA-680 to provide room for vehicles to pass (see Figure 1). The proposed action would widen the road near TRA-680 by placing fill material in an area approximately 16 ft. by 40 ft. Fill material would be obtained from the Monroe Gravel Pit

  17. Microsoft Word - DOE-ID-INL-13-027.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    27 SECTION A. Project Title: Excess Facilities Deactivation and Demolition SECTION B. Project Description: The purpose of the proposed action is to deactivate, decontaminate, and demolish (DD&D) surplus vacant, inactivated, or soon to be inactivated facilities to reduce lifecycle costs associated with surveillance and maintenance. The proposed action would return the location of the facilities to near original condition. There is limited risk to site personnel posed by remaining hazards

  18. Microsoft Word - DOE-ID-INL-14-005.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    4-005 SECTION A. Project Title: MICROGRID DEMONSTRATION PROJECT SECTION B. Project Description: The current state of the United States (U.S.) electric grid is likely incapable of supporting the Department of Energy (DOE) goal of producing 80% of U.S. electricity from clean energy sources by 2035, as stated in the DOE Strategic Plan, May 2011. Supporting such a goal will require increased system flexibility to reliably integrate new, variable, and diverse resources. The energy generation

  19. Microsoft Word - DOE-ID-INL-14-008.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    8 SECTION A. Project Title: Relocation of Environmental Monitoring Services Personnel and Equipment SECTION B. Project Description: The Environmental Monitoring Services organization at Idaho National Laboratory (INL) is currently located at the Materials and Fuels Complex (MFC) in building MFC-721, the original Transient Reactor Test Facility (TREAT) Reactor Control Building. The TREAT reactor has been in stand-by mode since 1995, and MFC-721 was converted in to office space and a sample

  20. Microsoft Word - DOE-ID-INL-14-010.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    10 SECTION A. Project Title: Hot Fuels and Examination Facility (HFEF) Documented Safety Analysis (DSA) Implementation Tasks SECTION B. Project Description: The Hot Fuels Examination Facility (HFEF) (MFC-785) Documented Safety Analysis (DSA) was upgraded in compliance with DOE- STD-3009 to verify that facility operations could be conducted without undue risk to the public or MFC personnel. The full implementation of the DSA requires procedure and software modifications and implementation of the

  1. Microsoft Word - DOE-ID-INL-14-011.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    1 SECTION A. Project Title: Shelley-New Sweden Parking Lot Flood Control SECTION B. Project Description: The Department of Energy-owned Shelley-New Sweden parking lot is currently unable to handle the storm water/snow melt runoff in the spring. The culvert to the north of the parking lot drains storm water/snow melt from the adjacent field under the highway and flows to the parking lot. In the spring, the parking lot pools up with storm water/snow melt causing portions of the lot to be unusable.

  2. Microsoft Word - DOE-ID-INL-14-013.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    3 SECTION A. Project Title: Zero Power Physics Reactor (ZPPR) Documented Safety Analysis (DSA) Implementation Project Tasks SECTION B. Project Description: The Zero Power Physics Reactor (ZPPR) Documented Safety Analysis (DSA) was conducted to verify that facility operations could be conducted without undue risk to the public or Materials and Fuels Complex (MFC) personnel. The DSA identified the need for implementation of the following tasks: 1. Replace 24 high-efficiency particulate air (HEPA)

  3. Microsoft Word - DOE-ID-INL-14-001.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    efficient, water efficient, are bio-based in content, environmentally preferable, non-ozone depleting, have recycled content, or are non-toxic or less-toxic alternatives. SECTION...

  4. Microsoft Word - DOE-ID-11-015.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Description: The purpose of this proposal is to expand the scope of traditional maintenance activities at the Advanced Test Reactor (ATR) to trend the performance of its...

  5. Microsoft Word - DOE-ID-INL-14-006.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    to meet Idaho Administrative Procedures Act (IDAPA) visible emission opacity requirements. Fugitive dust may be generated while constructing the concrete pad...

  6. Microsoft Word - DOE-ID-INL-11-007.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    dust from becoming airborne during construction. The subcontractor will record dust control activities in their daily logs. These records will be used to show compliance to...

  7. Microsoft Word - DOE-ID-INL-14-003.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    of DOE or Executive Orders; 2) require siting and construction or major expansion of waste storage, disposal, recovery, or treatment or facilities; 3) disturb hazardous...

  8. Microsoft Word - DOE-ID-INL-10-018.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    the INLMFC. After the campaign, the equipment will be returned to the participants. The campaign will last for 2 weeks. SECTION C. Environmental Aspects Potential Sources of...

  9. Microsoft Word - DOE-ID-INL-11-005.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    This is in accordance with the methods specified in the Rules for the Control of Air Pollution in Idaho (IDAPA 651). Steps taken to control fugitive dust at the INL ...

  10. Microsoft Word - DOE-ID-INL-10-019.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    ... This is in accordance with the methods specified in the Rules for the Control of Air Pollution in Idaho (IDAPA 651). USGS personnel bringing non-INL owned air ...

  11. Microsoft Word - DOE-ID-INL-12-001.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    This is in accordance with the methods specified in the Rules for the Control of Air Pollution in Idaho (IDAPA Steps taken to control fugitive dust at the INL ...

  12. Microsoft Word - DOE-ID-INL-14-012.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    This is in accordance with the methods specified in the Rules for the Control of Air Pollution in Idaho (Idaho Administrative Procedures Act IDAPA The date, ...

  13. Microsoft Word - DOE-ID-14-007.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Reasonable precautions would be taken to prevent particulate from becoming airborne. This is in accordance with the methods specified in the Rules for the Control of Air Pollution ...

  14. Microsoft Word - DOE-ID-INL-14-014.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    The duration of the outages could range between a few hours and a week. The scope of ... supports, insulation, and valving; electrical power; HVAC controls; earthwork and concrete. ...

  15. Seeing Stripes: Competition and Complexity in High-Temperature...

    Office of Scientific and Technical Information (OSTI)

    Seeing Stripes: Competition and Complexity in High-Temperature Superconductors Citation Details In-Document Search Title: Seeing Stripes: Competition and Complexity in...

  16. Ultrafast charge localization in a stripe-phase nickelate (Journal...

    Office of Scientific and Technical Information (OSTI)

    Journal Article: Ultrafast charge localization in a stripe-phase nickelate Citation Details In-Document Search Title: Ultrafast charge localization in a stripe-phase nickelate ...

  17. Real ID Act in brief

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Visitors » Badging, Badge Office » Real ID Act in brief Real ID Act in brief Effective Nov. 3, 2014, the Lab will implement requirements of the REAL ID Act. Contact Badge Office (505) 667-6901 Email REAL ID Act in brief REAL ID is a coordinated effort by the states and the Federal Government to improve the reliability and accuracy of state-issued identification documents, which should inhibit terrorists' ability to evade detection by using fraudulent identification. REAL ID implements a 9/11

  18. howtodesignandmarketenergyefficiencyprogramstospecificneighborhoods.doc |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy howtodesignandmarketenergyefficiencyprogramstospecificneighborhoods.doc howtodesignandmarketenergyefficiencyprogramstospecificneighborhoods.doc howtodesignandmarketenergyefficiencyprogramstospecificneighborhoods.doc Microsoft Office document icon howtodesignandmarketenergyefficiencyprogramstospecificneighborhoods.doc More Documents & Publications How to Design and Market Energy Efficiency Programs to Specific Neighborhoods Using Social Media to Engage the Community

  19. 4-ID-D optics

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    4-ID-D Beamline Optics A schetch of the major optical components for beam line 4-ID-D are shown above. All these components located in the B-station upstream from the D...

  20. Data ID Service

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    ID Service First DOI for a DOE dataset was minted by OSTI and registered with DataCite on 8/10/2011 from the DOE Atmospheric Radiation Measurement (ARM) Climate Research Facility at Oak Ridge National Laboratory Disseminate Our Results: "Our success should be measured not when a project is completed or an experiment concluded, but when scientifc and technical information is disseminated. Beyond broad availability of technical reports, e-prints and

  1. Blind Modal ID

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Research Projects » Blind Modal ID Blind separation of high-resolution vibration modes High-resolution video camera measurement of the structural vibration (the top video) could be separated into individual, monotone, vibration modes, which enable high-resolution visualization and analysis of structural dynamics. Contact Yongchao Yang (832) 335-3003 Email David Mascarenas (505) 665-0881 Original video = Mode 1 - 6.34 Hz + Mode 2 - 17.96 Hz + Mode 3 - 25.89 Hz (higher

  2. T ID CODE I

    National Nuclear Security Administration (NNSA)

    T ID CODE I DE- , I AC52- AMENDMENT OF SOLICITATION/MODIFICATlON OF CONTRACT I. CONTRAC I 06NA25396 I Los Alamos National Security, LLC 4200 West Jernez Road Suite 400 Los Alamos, NM 87544 PAGE 1 OF 1 PAGES 2. AMENDMENTIMODIFICATION NO. A029 U.S. Department of Energy National Nuclear Security Administration Manager, Los Alamos Site Office 528 3sth Street Los Alamos, NM 87544 I 9B. DATED (SEE ITEM 11) 8. NAME AND ADDRESS OF CONTRACTOR (No., street, county, state, ZIP Code) 10A. MODIFICATION OF

  3. DHSIsotopeID

    Energy Science and Technology Software Center (OSTI)


    DHSIsotopeID is an application designed to read and analyze radiation measurement files taken by radiation measurement files taken by radiation portal monitors, and in particular, by the advanced spectroscopic portals. It requires that the data files be in the N42 file format, compliant with the interface control documents for DNDO radiation measurement files. It carries out an automated analysis to determine which isotopes are present in the spectra, and then presents the results in graphicalmore » form to the user. It also enables further post-processing and analysis, for example by performing further analysis on selected regions of interest of the spectrum, as designated by the user via the graphical interface.« less

  4. finance_programs.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    financeprograms.doc financeprograms.doc financeprograms.doc Microsoft Office document icon financeprograms.doc More Documents & Publications Tools for Designing & Implementing ...

  5. APS Beamline 6-ID-B,C

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    6-ID-B,C Home Recent Publications Beamline Info Optics Instrumentation Software User Info Beamline 6-ID-B,C Beamline 6-ID-B,C is operated by the Magnetic Materials Group in the...

  6. APS Beamline 6-ID-D

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    MM-Group Home MMG Advisory Committees 6-ID-D Home Recent Publications Beamline Info Optics Instrumentation Software User Info Beamline 6-ID-D Beamline 6-ID-D is operated by the...

  7. Microsoft Word - AL-PO-0001-0007.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Authorized List Doc. ID: OP-AL-0001-007.doc Off-Hours Shift Operator Date: 2001/11/20 This policy is effective 11/20/2001 and denotes those individuals who have been authorized for Off-Hours Shift Operation. 1. Alderman, Steven 2. Aigeldinger, Georg 3. Baethke, Niko 4. Bauer, Benjamin 5. Brendebach, Boris 6. Day, Lorraine 7. Desta, Yohannes 8. Doomes, Edward 9. Dust, Reinhard 10. Farquar, George 11. Fluegge, Michael 12. Goettert, Jost 13. Koch, Kevin 14. Kong, Jong Ren 15. Lian, Kun 16. Ling,

  8. Doc...~En.

    Office of Legacy Management (LM)

    ' : ,:#;: .' :.' . ,.:: :,; ..,' ... ..,,..,.... - .~~._ I&i3:scD .::-:, TO-340 .":: ..' . - ' - -. ' . .." ,.. .;.. Very traly yours;, -' .~X :, Doc...~En. ' Br.:Re&ng ';;a' : _, Div. Reading File ., ,, .~, ,.~-

  9. DOEDataID_24X30poster112515

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)


  10. webinar_innovation_financing.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    financing.doc webinarinnovationfinancing.doc webinarinnovationfinancing.doc Microsoft Office document icon webinarinnovationfinancing.doc More Documents & Publications...

  11. webinar_innovation_planning_zoning.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    planningzoning.doc webinarinnovationplanningzoning.doc webinarinnovationplanningzoning.doc Microsoft Office document icon webinarinnovationplanningzoning.doc More...

  12. DOE-ID Twitter Site

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    what's going on at DOE-Idaho? Follow DOE-ID public affairs supervisor Brad Bugger on Twitter at doeidbug. https:twitter.comdoeidbug Editorial Date May 9, 2911 By Brad Bugger...

  13. webinar_innovation_net_metering_interconnection.doc | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    netmeteringinterconnection.doc webinarinnovationnetmeteringinterconnection.doc webinarinnovationnetmeteringinterconnection.doc Microsoft Office document icon...

  14. webinar_innovation_organizing_strategizing.doc | Department of...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    organizingstrategizing.doc webinarinnovationorganizingstrategizing.doc webinarinnovationorganizingstrategizing.doc Microsoft Office document icon webinarinnovationorganizi...

  15. webinar_innovation_permitting_inspections.doc | Department of...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    permittinginspections.doc webinarinnovationpermittinginspections.doc webinarinnovationpermittinginspections.doc Microsoft Office document icon webinarinnovationpermitting...

  16. fed_finance_facilities_ee_upgrades_deployment.doc | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    fedfinancefacilitieseeupgradesdeployment.doc fedfinancefacilitieseeupgradesdeployment.doc fedfinancefacilitieseeupgradesdeployment.doc Microsoft Office document icon ...

  17. DOE-ID Operations Summary

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    June 5, 2013 DOE-ID Operations Summary For the Period May 16, through May 30, 2013 EDITOR'S NOTE: The following is a summary of contractor operations at the Idaho National Laboratory, managed by DOE- Idaho Operations Office. It has been compiled in response to a request from stakeholders for more information on health, safety and environmental incidents at DOE facilities in Idaho. It also includes a brief summary of accomplishments at the Site. POC - Shannon Brennan, DOE-ID, (208) 526-3993.

  18. DOE-ID Operations Summary

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    24, 2013 DOE-ID Operations Summary For the Period May 30, 2013 through June 12, 2013 EDITOR'S NOTE: The following is a summary of contractor operations at the Idaho National Laboratory, managed by DOE- Idaho Operations Office. It has been compiled in response to a request from stakeholders for more information on health, safety and environmental incidents at DOE facilities in Idaho. It also includes a brief summary of accomplishments at the Site. POC - Shannon Brennan, DOE-ID, (208) 526-3993.

  19. interiorlightingefficiencyformunicipalities.doc | Department of Energy

    Broader source: (indexed) [DOE]

    interiorlightingefficiencyformunicipalities.doc Microsoft Office document icon interiorlightingefficiencyformunicipalities.doc More Documents & Publications Interior Lighting Efficiency for Municipalities States & Emerging Energy Technologies stateandemergingtechnologies.doc

  20. Doc.~:Ru.

    Office of Legacy Management (LM)

    .' , .' c,j .c; Distriblition:~ ;. <; ~..,:L.D.i&%.ay,FiN-OR00 Doc.~:Ru. ,.,. 75. ' Br..Reading 'ire' ,lliv. Read&q File ,: '. ~ ,, .-' . ...: - SURNAME..

  1. Rotational Electrophoresis of Striped Metallic Microrods (Journal Article)

    Office of Scientific and Technical Information (OSTI)

    | SciTech Connect Rotational Electrophoresis of Striped Metallic Microrods Citation Details In-Document Search Title: Rotational Electrophoresis of Striped Metallic Microrods Analytical models are developed for the translation and rotation of metallic rods in a uniform electric field. The limits of thin and thick electric double layers are considered. These models include the effect of stripes of different metals along the length of the particle. Modeling results are compared to experimental

  2. Seeing Stripes: Competition and Complexity in High-Temperature...

    Office of Scientific and Technical Information (OSTI)

    electronic structure in solids. Some of the challenges of experimentally 'seeing' both static and fluctuating stripes will be discussed. Authors: Tranquada, John 1 + Show Author...

  3. 2B-05.doc

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ... Final Report UCRL-ID-116964, Vol. 1-4. Lawrence Livermore National Laboratory, Livermore, California. Udell, K.S., N. Sitar, J.R. Hunt, and L.D. Stewart. 1991. Process for In Situ ...

  4. Data ID Service | DOE Data Explorer

    Office of Scientific and Technical Information (OSTI)

    DOE Data ID Service DOE Data ID Service Note 1: This section pertains to datasets, dataset records, and Digital Object Identifiers (DOIs). It is not related to the collection...

  5. APS Beamline 6-ID-B,C

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    B,C Home Recent Publications Beamline Info Optics Instrumentation Software User Info Beamline 6-ID-B,C Beamline 6-ID-B,C is operated by the Magnetic Materials Group in the X-ray...

  6. APS Beamline 6-ID-D

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    D Home Recent Publications Beamline Info Optics Instrumentation Software User Info Beamline 6-ID-D Beamline 6-ID-D is operated by the Magnetic Materials Group in the X-ray Science...

  7. DOE-ID Operations Summary

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    07, 2013 DOE-ID Operations Summary For the Period July 8, 2013 through July 28, 2013 EDITOR'S NOTE: The following is a summary of contractor operations at the Idaho National Laboratory, managed by DOE- Idaho Operations Office. It has been compiled in response to a request from stakeholders for more information on health, safety and environmental incidents at DOE facilities in Idaho. It also includes a brief summary of accomplishments at the Site. POC -Danielle Miller, (208) 526-5709. Advanced

  8. DOE-ID Operations Summary

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    6, 2013 DOE-ID Operations Summary For the Period July 29, 2013 through August 12, 2013 EDITOR'S NOTE: The following is a summary of contractor operations at the Idaho National Laboratory, managed by DOE- Idaho Operations Office. It has been compiled in response to a request from stakeholders for more information on health, safety and environmental incidents at DOE facilities in Idaho. It also includes a brief summary of accomplishments at the Site. POC -Danielle Miller, (208) 526-5709. Advanced

  9. DOE-ID Operations Summary

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    10, 2013 DOE-ID Operations Summary For the Period August 12, 2013 through August 26, 2013 EDITOR'S NOTE: The following is a summary of contractor operations at the Idaho National Laboratory, managed by DOE- Idaho Operations Office. It has been compiled in response to a request from stakeholders for more information on health, safety and environmental incidents at DOE facilities in Idaho. It also includes a brief summary of accomplishments at the Site. POC -Danielle Miller, (208) 526-5709.

  10. DOE-ID Operations Summary

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    8, 2013 DOE-ID Operations Summary For the Period September 30, 2013 through October 31, 2013 EDITOR'S NOTE: The following is a summary of contractor operations at the Idaho National Laboratory, managed by DOE- Idaho Operations Office. It has been compiled in response to a request from stakeholders for more information on health, safety and environmental incidents at DOE facilities in Idaho. It also includes a brief summary of accomplishments at the Site. POC -Danielle Miller, (208) 526-5709.

  11. DOE-ID Operations Summary

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    6, 2014 DOE-ID Operations Summary For the Period November 01, 2013 through November 30, 2013 EDITOR'S NOTE: The following is a summary of contractor operations at the Idaho National Laboratory, managed by DOE- Idaho Operations Office. It has been compiled in response to a request from stakeholders for more information on health, safety and environmental incidents at DOE facilities in Idaho. It also includes a brief summary of accomplishments at the Site. POC -Danielle Miller, (208) 526-5709.

  12. DOE-ID Operations Summary

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    23, 2015 Updated on April 28, 2015 DOE-ID Operations Summary For the Period September 30, 2014 through November 1, 2014 EDITOR'S NOTE: The following is a summary of contractor operations at the Idaho National Laboratory, managed by DOE- Idaho Operations Office. It has been compiled in response to a request from stakeholders for more information on health, safety and environmental incidents at DOE facilities in Idaho. It also includes a brief summary of accomplishments at the Site. POC -Danielle

  13. DOE-ID Operations Summary

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    7, 2015 DOE-ID Operations Summary For the Period January 1, 2015 - January 31, 2015 EDITOR'S NOTE: The following is a summary of contractor operations at the Idaho National Laboratory Site, managed by the DOE- Idaho Operations Office. It has been compiled in response to a request from stakeholders for more information on health, safety and environmental incidents at DOE facilities in Idaho. It also includes a brief summary of accomplishments at the Site. POC: Danielle Miller, (208) 526-5709.

  14. DOE-ID Operations Summary

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    6, 2015 DOE-ID Operations Summary For the Period February 1, 2015 - February 28, 2015 EDITOR'S NOTE: The following is a summary of contractor operations at the Idaho National Laboratory Site, managed by the DOE- Idaho Operations Office. It has been compiled in response to a request from stakeholders for more information on health, safety and environmental incidents at DOE facilities in Idaho. It also includes a brief summary of accomplishments at the Site. POC: Danielle Miller, (208) 526-5709.

  15. DOE-ID Operations Summary

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    4, 2015 DOE-ID Operations Summary For the Period May 1, 2015 - May 31, 2015 EDITOR'S NOTE: The following is a summary of contractor operations at the Idaho National Laboratory Site, managed by the DOE- Idaho Operations Office. It has been compiled in response to a request from stakeholders for more information on health, safety and environmental incidents at DOE facilities in Idaho. It also includes a brief summary of accomplishments at the Site. POC: Danielle Miller, (208) 526-5709. Advanced

  16. DOE-ID Operations Summary

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    December 2, 2015 DOE-ID Operations Summary For the Period September 1, 2015 - September 30, 2015 EDITOR'S NOTE: The following is a summary of contractor operations at the Idaho National Laboratory Site, managed by the DOE- Idaho Operations Office. It has been compiled in response to a request from stakeholders for more information on health, safety and environmental incidents at DOE facilities in Idaho. It also includes a brief summary of accomplishments at the Site. POC: Danielle Miller, (208)

  17. DOE-ID Operations Summary

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    7, 2015 DOE-ID Operations Summary For the Period August 1, 2015 - August 31, 2015 EDITOR'S NOTE: The following is a summary of contractor operations at the Idaho National Laboratory Site, managed by the DOE- Idaho Operations Office. It has been compiled in response to a request from stakeholders for more information on health, safety and environmental incidents at DOE facilities in Idaho. It also includes a brief summary of accomplishments at the Site. POC: Danielle Miller, (208) 526-5709.

  18. DOE-ID Operations Summary

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    February 11, 2016 DOE-ID Operations Summary For the Period November 1, 2015 - November 30, 2015 EDITOR'S NOTE: The following is a summary of contractor operations at the Idaho National Laboratory Site, managed by the DOE- Idaho Operations Office. It has been compiled in response to a request from stakeholders for more information on health, safety and environmental incidents at DOE facilities in Idaho. It also includes a brief summary of accomplishments at the Site. POC: Danielle Miller, (208)

  19. Document ID Number: RL-721

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    ---------------------------------------------------------- Document ID Number: RL-721 REV 4 NEPA REVIEW SCREENING FORM DOE/CX-00066 I. Project Title: Nesting Bird Deterrent Study at the 241-C Tank Farm CX B3.8, "Outdoor Terrestrial Ecological and Environmental Research" II. Project Description and Location (including Time Period over which proposed action will occur and Project Dimensions - e.g., acres displaced/disturbed, excavation length/depth, area/location/number of buildings,


    National Nuclear Security Administration (NNSA)

    1 II.CONTRACT ID CODE ~AGE 1 of AMENDMENT OF SOLICITATIONIMODIFICATION OF CONTRACT PAGES AC 5. PROJECT NO. (If applicable) 3. EFFECTNE DATE 2. AMENDMENTfMODIFICA TION NO. 4. REQUISITIONIPURCHASE REQ. NO. See Block 16c. NOPR 7. ADMINISTERED BY (If other than Item 6) CODE 05008 6. ISSUED BY CODE 05008 U.S. Department of Energy National Nuclear Security Administration U.S. Department of Energy National Nuclear Security Administration P.O. Box 2050 Oak Ridge, TN 37831 P.O. Box 2050 Oak Ridge, TN

  1. Microsoft Word - ContractManagementPlanningDRIVERS.doc | Department...

    Broader source: (indexed) [DOE]

    ContractManagementPlanningDRIVERS.doc More Documents & Publications Microsoft Word - ARRAAttachment2.doc Microsoft Word - ARRAModelWAS.doc Microsoft Word - ARRAMOModelMod.doc...

  2. transcript_pv_mapper.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    transcriptpvmapper.doc transcriptpvmapper.doc transcriptpvmapper.doc transcriptpvmapper.doc More Documents & Publications PVMapper: A Tool for Energy Siting...

  3. Microsoft Word - S05827_WCR_Final.doc

    Office of Legacy Management (LM)

    HTH-2 Data and 2009 Well Survey Data This page intentionally left blank U.S. Department of Energy Well Completion Report for CAU 443 CNTA December 2009 Doc. No. S05827 Page A-1 Table A-1 Groundwater Quality Data by Location Groundwater Quality Data by Location (USEE100) FOR SITE CNT01, Central Nevada Test Area Site REPORT DATE: 9/11/2009 Location: HTH-2 WELL Parameter Units Sample Date ID Depth Range (Ft BLS) Result Qualifiers Lab Data QA Detection Limit Uncertainty Alkalinity, Total (As CaCO3)

  4. raising_investment_funds_for_clean_energy_programs.doc | Department...

    Broader source: (indexed) [DOE]

    raisinginvestmentfundsforcleanenergyprograms.doc raisinginvestmentfundsforcleanenergyprograms.doc More Documents & Publications Raising Investment Funds for Clean...

  5. spurring_local_economic_development_clean_energy_programs.doc...

    Broader source: (indexed) [DOE]

    spurringlocaleconomicdevelopmentcleanenergyprograms.doc spurringlocaleconomicdevelopmentcleanenergyprograms.doc More Documents & Publications Spurring Local Economic...

  6. Category:NEPA Doc | Open Energy Information

    Open Energy Info (EERE)

    NEPA Doc Jump to: navigation, search GEOTHERMAL ENERGYGeothermal Home Category: NEPA Documents Collections Add.png Add a new NEPA Document Collection Pages in category "NEPA Doc"...

  7. exploringpowerpurchaseagreementsthebasicspart1.doc | Department of Energy

    Broader source: (indexed) [DOE]

    exploringpowerpurchaseagreementsthebasicspart1.doc Microsoft Office document icon exploringpowerpurchaseagreementsthebasicspart1.doc More Documents & Publications Exploring Power Purchase Agreements - The Basics Part 1

  8. Microsoft Word - AL2006-02.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    2.doc Microsoft Word - AL2006-02.doc PDF icon Microsoft Word - AL2006-02.doc More Documents & Publications Microsoft Word - AL2006-03.doc Archived Financial Assistance Letters Microsoft Word - FAL2006-04.doc

  9. Microsoft Word - AL2008-06.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AL2008-06.doc Microsoft Word - AL2008-06.doc PDF icon Microsoft Word - AL2008-06.doc More Documents & Publications Chapter 9 - Contracting Qualifications Microsoft Word - PART 970.doc Microsoft Word - Matrixpart2.doc

  10. Microsoft Word - 98-11.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    8-11.doc Microsoft Word - 98-11.doc PDF icon Microsoft Word - 98-11.doc More Documents & Publications Microsoft Word - AL2006-08.doc Microsoft Word - AL2005-01.doc Microsoft Word -...

  11. IDS Climate Change and Development Centre Resources | Open Energy...

    Open Energy Info (EERE)

    IDS Climate Change and Development Centre Resources Jump to: navigation, search Tool Summary Name: IDS Climate Change and Development Centre Resources AgencyCompany Organization:...

  12. 1-ID Home Page | Advanced Photon Source

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    1-ID Home Infrastructure Techniques Data Analysis Publications X-ray Resources Materials Physics and Engineering Group Useful Links Current APS status ESAF System GUP System X-Ray...

  13. Microsoft Word - Rev5functionalaccountabilityimplementationplan..doc |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy Rev5functionalaccountabilityimplementationplan..doc Microsoft Word - Rev5functionalaccountabilityimplementationplan..doc PDF icon Microsoft Word - Rev5functionalaccountabilityimplementationplan..doc More Documents & Publications Microsoft Word - AL2007-01.doc module 4 Chapter 71 - Review and Approval of Contract and Financial Assistance Actions

  14. deepenergyretrofitsandstateapplications.doc | Department of Energy

    Energy Savers [EERE]

    deepenergyretrofitsandstateapplications.doc deepenergyretrofitsandstateapplications.doc deepenergyretrofitsandstateapplications.doc Microsoft Office document icon deepenergyretrofitsandstateapplications.doc More Documents & Publications Deep Energy Retrofits & State Applications Sustainable Energy Resources for Consumers Webinar on Residential Geothermal Heat Pump Retrofit Transcript Interior Lighting Efficiency for Municipalities

  15. Apparatus And Method For Reconstructing Data Using Cross-Parity Stripes On Storage Media

    DOE Patents [OSTI]

    Hughes, James Prescott (Lino Lakes, MN)


    An apparatus and method for reconstructing missing data using cross-parity stripes on a storage medium is provided. The apparatus and method may operate on data symbols having sizes greater than a data bit. The apparatus and method makes use of a plurality of parity stripes for reconstructing missing data stripes. The parity symbol values in the parity stripes are used as a basis for determining the value of the missing data symbol in a data stripe. A correction matrix is shifted along the data stripes, correcting missing data symbols as it is shifted. The correction is performed from the outside data stripes towards the inner data stripes to thereby use previously reconstructed data symbols to reconstruct other missing data symbols.

  16. Id-1 and Id-2 genes and products as markers of epithelial cancer

    DOE Patents [OSTI]

    Desprez, Pierre-Yves; Campisi, Judith


    A method for detection and prognosis of breast cancer and other types of cancer. The method comprises detecting expression, if any, for both an Id-1 and an Id-2 genes, or the ratio thereof, of gene products in samples of breast tissue obtained from a patient. When expressed, Id-1 gene is a prognostic indicator that breast cancer cells are invasive and metastatic, whereas Id-2 gene is a prognostic indicator that breast cancer cells are localized and noninvasive in the breast tissue.

  17. Id-1 and Id-2 genes and products as markers of epithelial cancer

    DOE Patents [OSTI]

    Desprez, Pierre-Yves; Campisi, Judith


    A method for detection and prognosis of breast cancer and other types of cancer. The method comprises detecting expression, if any, for both an Id-1 and an Id-2 genes, or the ratio thereof, of gene products in samples of breast tissue obtained from a patient. When expressed, Id-1 gene is a prognostic indicator that breast cancer cells are invasive and metastatic, whereas Id-2 gene is a prognostic indicator that breast cancer cells are localized and noninvasive in the breast tissue.

  18. Microsoft Word - SpecialTermsandConditions0506.doc | Department...

    Energy Savers [EERE]

    Microsoft Word - SpecialTermsandConditions0506.doc Microsoft Word - SpecialTermsandConditions0506.doc Microsoft Word - SpecialTermsandConditions0506.doc More Documents &...

  19. Microsoft Word - FY2005finaliparhandbook.doc | Department of...

    Energy Savers [EERE]

    Microsoft Word - FY2005finaliparhandbook.doc Microsoft Word - FY2005finaliparhandbook.doc Microsoft Word - FY2005finaliparhandbook.doc More Documents & Publications...

  20. Microsoft Word - ARRAAttachment2.doc | Department of Energy

    Office of Environmental Management (EM)

    ARRAAttachment2.doc Microsoft Word - ARRAAttachment2.doc More Documents & Publications Microsoft Word - ARRAAttachment12v1.doc Microsoft Word - ARRAAttachment3.rtf Microsoft Word -...

  1. Microsoft Word - ARRAMOModelMod.doc | Department of Energy

    Energy Savers [EERE]

    ARRAMOModelMod.doc Microsoft Word - ARRAMOModelMod.doc More Documents & Publications Microsoft Word - ARRAAttachment2.doc Microsoft Word - ARRAModelWAS...

  2. Microsoft Word - ARRAModelWAS.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ARRAModelWAS.doc Microsoft Word - ARRAModelWAS.doc More Documents & Publications Microsoft Word - ARRAAttachment2.doc Microsoft Word - ARRAMOModelMod...

  3. Microsoft Word - August06.doc | Department of Energy

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    August06.doc Microsoft Word - August06.doc PDF icon Microsoft Word - August06.doc More Documents & Publications Microsoft Word - April

  4. Microsoft Word - DOE-ID-11-002 DOE Direct cooling system [1].doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    2 SECTION A. Project Title: Cooling System for Substation Bldg CPP-613 SECTION B. Project Description The scope of work includes the purchase and installation of an Energy Star compliant 208V three phase staged cooling system capable of maintaining CPP-613 at a temperature below 85 degrees F. The system shall be designed to operate at an elevation of 5000 feet with outside environmental temperatures ranging from -20°F to 100°F. The cooling system shall be pad mounted on the east side of the

  5. Microsoft Word - DOE-ID-11-003 Tennessee EC.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    3 SECTION A. Project Title: Multipurpose Target Chamber for High-Temperature Ion Irradiation - University of Tennessee SECTION B. Project Description This project will build and install a multipurpose target chamber to conduct high-temperature testing of materials under ion-beam irradiation or ion implantation. Such irradiations do not generate any radiation. The target chamber will be operated under high vacuum. Once constructed, it will be connected to one of three beam lines at the ion

  6. Microsoft Word - DOE-ID-11-004 Illinois EC.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    4 SECTION A. Project Title: Nuclear Engineering Teaching and Research Facilities Upgrade at the University of Illinois at Urbana Champaign SECTION B. Project Description The scope of the project includes purchasing equipment that the University of Illinois will use to construct a high pressure materials analysis facility. The facility will provide a compact and efficient mechanism for studying creep-fatigue-rupture in nuclear fuels (cladding) and structural materials under extreme environment

  7. Microsoft Word - DOE-ID-11-006 Clemson EC.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    6 SECTION A. Project Title: Development of New Analytical Capabilities for the Measurement of Fundamental Thermodynamic Parameters Supporting Advanced Fuel Cycle Chemistry - Clemson University SECTION B. Project Description Clemson University will purchase an isothermal titration calorimeter. The calorimeter will primarily be utilized in the determination of aqueous stability constants of actinide-ligand systems to support advanced actinide separations processes and in the determination of

  8. Microsoft Word - DOE-ID-11-007 Colorado Mines EC.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    7 SECTION A. Project Title: Imaging Upgrades for the Colorado School of Mines Nuclear Science and Engineering Program - Colorado School of Mines SECTION B. Project Description This project has three objectives: 1. Upgrade the Transmission Electron Microscope in the Active Materials Characterization Laboratory (ActMCL) with a digital imaging system 2. Upgrade the ActMCL and Nuclear Fuel Development Lab (NFDL) with modern radiation detection and measurement equipment, for both research and

  9. Microsoft Word - DOE-ID-11-009 Utah EC.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    9 SECTION A. Project Title: Development of Nuclear Energy-Related Infrastructure and Capabilities at the Utah Nuclear Engineering Radiation Measurement Laboratory - University of Utah SECTION B. Project Description This project will upgrade the nuclear engineering measurement lab of the Nuclear Engineering Measurement Laboratory at the Utah Nuclear Engineering Program, University of Utah by purchasing two high energy resolution HPGe detector counting systems, a scintillation detector counting

  10. Microsoft Word - DOE-ID-11-010 Wisconsin - Agasie EC.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    0 SECTION A. Project Title: NEUP Infrastructure Program: Minor Reactor Upgrades- University of Wisconsin SECTION B. Project Description This project by the University of Wisconsin will: -Upgrade the reactor pool water system with a reverse osmosis system and a capacitance continuous level measurement probe with an associated digital meter display -Upgrade the reactor instrumentation and control systems with a multi-turn rotary absolute encoder along with associated digital readout devise and

  11. Microsoft Word - DOE-ID-11-015 Nevada EC.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    5 SECTION A. Project Title: General Infrastructure to Enhance Nuclear Materials Research and Education at the University of Nevada, Reno SECTION B. Project Description The University of Nevada, Reno (UNR) will purchase and install a custom designed high-temperature and high-pressure dynamic water loop equipment for mechanical and corrosion testing. UNR will evaluate mechanical performance of various alloys at extreme temperature and pressure conditions using a slow strain rate test equipment;

  12. Microsoft Word - DOE-ID-11-016 Midlands EC.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    6 SECTION A. Project Title: Nuclear Infrastructure Upgrade to Enhance Teaching Capabilities in the Nuclear Systems Technology Program at Midlands Technical College SECTION B. Project Description Midlands Technical College will purchase a metallographic microscope and imaging workstation to allow students to perform structural defect analysis is simulated radiation-damaged, thermal shocked, and stress and corrosion damaged materials, as well as evaluate other surface properties of materials.

  13. Microsoft Word - DOE-ID-11-019 Lakeshore EC.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    9 SECTION A. Project Title: Meeting NUCP Requirements with Equipment Investments - Lakeshore Technical College SECTION B. Project Description Lakeshore Technical College will purchase laboratory equipment including portable radiation survey instruments, radiation detectors, sample holders, an area radiation monitor, air samplers, sealed radioactive sources, contamination control training kits, and a radiation survey simulator necessary to provide student instruction that complies with the

  14. Microsoft Word - DOE-ID-11-020 Ohio State - Blue EC.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    20 SECTION A. Project Title: A NEUP Minor Reactor Upgrade Request for Enhancement of Safety and Operational Monitoring Systems and Research Capabilities of the Ohio State University Nuclear Reactor Laboratory SECTION B. Project Description The object of this project by the University of Wisconsin is to upgrade outdated systems critical to operation of the reactor and laboratory to ensure their long-term viability for serving the education and research missions of both OSU and DOE. Equipment and

  15. Microsoft Word - DOE-ID-11-022 Ohio State - Cao EC.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    2 SECTION A. Project Title: An Integrated Upgrade of Scientific Equipment for Strengthening the Research and Education in Nuclear Energy at the Ohio State University SECTION B. Project Description The overall goal of this project is to acquire equipment/instrumentation that will be integrated into the existing infrastructure at the Nuclear Engineering program at the Ohio State University to help improve capabilities in research and education. To accomplish this, the following equipment will be

  16. Microsoft Word - DOE-ID-12-001 Rensselaer EC.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    1 SECTION A. Project Title: Rensselaer Infrastructure Upgrade to Enhance Research and Education in Nuclear Engineering - Rensselaer Polytechnic Institute SECTION B. Project Description The scope of the project includes purchasing a new Spark Plasma Sintering (SPS) system. The new equipment will be primarily used to advance the cutting edge research in the innovative materials design including fuel, structural, and waste form materials. SECTION C. Environmental Aspects / Potential Sources of

  17. Microsoft Word - DOE-ID-12-005 New Mexico.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    5 SECTION A. Project Title: Equipment Upgrade for the UNM AGN-201M Reactor - University of New Mexico SECTION B. Project Description The University of New Mexico will acquire a computer and associated hardware to measure control rod scram times, a laptop computer and associated electronics such as MCS and MCA systems for operating a High Purity Germanium detector, a Frisker and micro R meter for personnel protection and radiation surveys, a new interface for the data channel, NCRP reports, and

  18. Microsoft Word - DOE-ID-12-006 Utah EC.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    6 SECTION A. Project Title: Acquisition of Specific Equipment to Enhance Performance, Control and Operational Capability of the University of Utah TRIGA Facilities SECTION B. Project Description The objective of this project is to replace the University of Utah TRIGA Reactor heavy water-element handling tool and underwater vacuum cleaner, and to add a portable spectroscopy system and broad energy germanium detector to the facility operational capabilities. SECTION C. Environmental Aspects /

  19. Microsoft Word - DOE-ID-12-007 NC State EC.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    7 SECTION A. Project Title: A High Resolution Digital System in Support of Neutron Imaging at the PULSTAR Reactor - North Carolina State University SECTION B. Project Description The objective of this project is to establish t he capability of high resolution digital neutron imaging at the North Carolina State University (NCSU) PULSTAR reactor. It will be integrated into the existing neutron imaging facility at PULSTAR, and it will be supported by the user facility structure of the Nuclear

  20. Microsoft Word - DOE-ID-12-008 Missouri EC.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    8 SECTION A. Project Title: Nuclear Instrumentation Upgrade for MURR Reactor Power Level Monitoring - University of Missouri SECTION B. Project Description The objective of this project is to replace the Nuclear Instrumentation (NI) and associated components of the University of Missouri Research Reactor (MURR). The NI system monitors and displays neutron flux from subcritical source multiplication range, through intermediate range to full power, while also providing reactor period information.

  1. Microsoft Word - DOE-ID-12-010 VCU EC.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    10 SECTION A. Project Title: Radiation Detection and Nuclear Materials Laboratory Equipment in Support of Student Training and Research by the Department of Mechanical and Nuclear Engineering at Virginia Commonwealth University SECTION B. Project Description This project will support the development of the educational and research infrastructure of the new nuclear engineering program at Virginia Commonwealth University by purchasing a HPGe detector, a gas proportional counter, and a Nal

  2. Microsoft Word - DOE-ID-12-013 Colorado School of Mines.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    3 SECTION A. Project Title: Automated Serial Sectioning and Imaging in Support of Nuclear Materials Analysis - Colorado School of Mines SECTION B. Project Description The Colorado School of Mines will purchase a Robo-Met.3D automated polishing, serial-sectioning, and image acquisition station. The automated serial sectioning and imaging capabilities of the new system will expand the digital microstructure imaging and tomographic capabilities, allowing for the acquisition of micrometer scale 3-D

  3. Microsoft Word - DOE-ID-12-014 Alcorn State.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    4 SECTION A. Project Title: Developing the Currently Existing Nuclear Instrumentation and Radiation Research Laboratories at Alcorn State University SECTION B. Project Description The goal of this Alcorn State University project is to improve the existing basic level nuclear instrumentation laboratory and expand the radiation research laboratory with the ASU Health Physics department for research and training. This will be accomplished by purchasing radiation detectors. SECTION C. Environmental

  4. Microsoft Word - DOE-ID-12-020 Washington State.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    0 SECTION A. Project Title: Upgrading Lanthanide & Actinide Spectroscopy Capabilities at Washington State University SECTION B. Project Description The principle objective of this project is to add new instrumentation to an existing suite of dedicated equipment supporting research on radioactive materials. The research focuses primarily on the chemistry of lanthanide and actinide metal ions, which are of central importance in the development of future fuel cycles that will support actinide

  5. Microsoft Word - DOE-ID-12-022 Colorado State.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    2 SECTION A. Project Title: Revitalizing Health Physics Education for Nuclear Energy Careers - Colorado State University SECTION B. Project Description The objectives of this Colorado State University project are to update instrumentation to reflect current instruments utilized at nuclear power plants and national laboratories, utilize measurement equipment to perform research, and achieve ISO 17025 accreditation. This will be accomplished by purchasing a CZT-based portable detector, alpha

  6. Microsoft Word - DOE-ID-12-026 Illinois Tech.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    6 SECTION A. Project Title: Determination of Microstructure and Chemical State Changes in Ion-Irradiated Fuels and Structural Components with a High Kinetic Energy Electron Detector - Illinois Institute of Technology SECTION B. Project Description The Illinois Institute of Technology will purchase a High Kinetic Energy (HiKE) instrument for measuring the structural and chemical changes in ion-irradiated fuels and structural materials for verification of radiation damage models. SECTION C.

  7. Microsoft Word - DOE-ID-12-027 Oregon State.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    7 SECTION A. Project Title: Building calorimetric and thermogravimetric analytical instrumentation capability at Oregon State University SECTION B. Project Description The objective of this project is to further the radiochemistry and nuclear material research at Oregon State University by building a calorimetric and thermogravimetric capability in the Laboratory of Transuranic Elements. This will be accomplished by acquiring a nano isothermal titration calorimeter and thermogravimetric

  8. Microsoft Word - DOE-ID-12-029 Missouri ST.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    9 SECTION A. Project Title: Infrastructure Upgrade of Radiation Measurement and Spectroscopy Laboratory at Missouri S&T SECTION B. Project Description The infrastructure upgrade at Missouri S& T includes three identical workstations for radiation detection and measurement systems for alpha particle, beta particle, and gamma ray; one workstation for neutron measurement; and one for x-ray measurement. The workstations will include radiation sources, detectors, oscilloscopes, computers, and

  9. Microsoft Word - DOE-ID-12-030 Wisconsin-Madison.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    30 SECTION A. Project Title: Infrastructure for Advanced Reactor Materials Center SECTION B. Project Description SECTION C. Environmental Aspects / Potential Sources of Impact The action consists of funding the modification of existing facilities purchase of equipment, and move equipment to a new existing location. The action would not create additional environmental impacts above those already occurring at the university. SECTION D. Determine the Level of Environmental Review (or Documentation)

  10. Microsoft Word - DOE-ID-12-041 INL EC B3-6.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    1 SECTION A. Project Title: Monitoring and Control of the Hybrid Laser-Gas Metal Arc Welding Process - Idaho National Laboratory SECTION B. Project Description This project will investigate a promising welding process that combines gas metal-arc welding and laser beam welding into Hybrid Las - Gas Metal-Arc Welding. The objectives of this project are to:  Develop and demonstrate a prototype system base on a number of sensing and diagnostic tools to monitor and provide real- time weld process

  11. Microsoft Word - DOE-ID-13-004 Westinghouse EC B3-6.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    4 SECTION A. Project Title: Modeling and Validation of Sodium Plugging for Heat Exchangers in Sodium-cooled Fast Reactor Systems - Westinghouse Electric Company LLC SECTION B. Project Description Westinghouse proposes to perform development and testing of new experimental techniques for detecting the presence of Na 2 O, as well as to measure the thickness of the corresponding deposits on channel walls. These tasks will be accomplished using the Sodium Plugging Phenomena Loop (SPPL) available at

  12. Microsoft Word - DOE-ID-13-005 GE Hitachi EC B3-6.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    5 SECTION A. Project Title: Next Generation Electromagnetic Pump: Analysis Tools and Insulation Materials Development - GE Hitachi Nuclear Energy Americas LLC SECTION B. Project Description GE Hitachi, teaming with Argonne National Laboratory, proposes to improve electromagnetic (EM) pump analysis model and EM design and analysis tools for next-generation EM pumps. Additionally, GE Hitachi proposes to develop, produce, and evaluate samples of new pump insulation materials. SECTION C.

  13. Microsoft Word - DOE-ID-13-008 MIT EC B2-5.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    8 SECTION A. Project Title: Infrastructure Upgrade (Minor) to the MITR Research Reactor in Support of Operational Safety - Massachusetts Institute of Technology - Nuclear Reactor Lab SECTION B. Project Description The objective of this proposal is to improve the MIT Research Reactor safety by (1) procuring and installing a gaseous tritium detector that will monitor for airborne releases from both the reactor's heavy water reflector and from in-core experiments involving potential salt reactor

  14. Microsoft Word - DOE-ID-13-011 Clemson EC B3-6.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    1 SECTION A. Project Title: Development of New Analytical Capabilities for the Characterization and Measurement of Solid Actinide-Containing Materials Supporting Fuel Cycle Research and Development at Clemson University SECTION B. Project Description Clemson University will purchase a powder X-ray diffractometer (XRD) to add capabilities to the Nuclear Environmental and Science program. The XRD will primarily be used for research focusing on 1) the determination of corrosion mechanisms of

  15. Microsoft Word - DOE-ID-13-012 Aiken B1-31.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    2 SECTION A. Project Title: Expansion of Nuclear Industry Programs at Aiken Technical College SECTION B. Project Description Aiken Technical College will acquire a custom-designed and constructed Flow Loop Trainer, a specialized orbital welder, and a supporting beveling device to be used to educate and train students in the Nuclear Quality Systems program and Nuclear Welding Certification Program. SECTION C. Environmental Aspects / Potential Sources of Impact The action consists of purchasing

  16. Microsoft Word - DOE-ID-13-013 Utah State B1-31.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    3 SECTION A. Project Title: High Temperature Thermal Properties - Utah State University SECTION B. Project Description Utah State University proposes to purchase a Laser Flash Analysis (LFA) system for high temperature thermophysical properties analysis of nuclear materials. The LFA system combined with existing equipment will expand the ability to analyze and characterize thermophysical properties such as thermal diffusivity, thermal conductivity, specific heat capacity, thermal expansion

  17. Microsoft Word - DOE-ID-13-015 Tennessee EC B3-6.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    5 SECTION A. Project Title: Multipurpose High-Resolution X-Ray Diffractometer for Nuclear Energy Research and Education - University of Tennessee SECTION B. Project Description The University of Tennessee will purchase an advanced X-ray diffractometer (XRD) system to add capabilities allow researchers to examine and quantify materials behavior upon exposure to extreme conditions such as radiation, corrosion, and mechanical deformation. SECTION C. Environmental Aspects / Potential Sources of

  18. Microsoft Word - DOE-ID-13-016 Texas B1-31.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    6 SECTION A. Project Title: In-core Neutron Detectors for The University of Texas at Austin TRIGA Reactor SECTION B. Project Description The University of Texas (UT) proposes to upgrade the in-core neutron detector instrumentation within the 1.1MW TRIGA reactor at the Nuclear Engineering Laboratory. To accomplish this, UT will purchase a wide range neutron flux channel, a series of self- powered neutron detectors for monitoring the flux in experimental locations, and associated electronics.

  19. Microsoft Word - DOE-ID-13-018 Florida EC B3-6.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    8 SECTION A. Project Title: Innovative Coating of Nanostructured Vanadium Carbide on the F/M Cladding Tube Inner Surface for Mitigating the Fuel Cladding Chemical Interactions - University of Florida SECTION B. Project Description The University of Florida proposes to conduct applied and fundamental research towards the development of diffusion barrier coatings on the inner surface of ferritic/martensitic fuel cladding tubes. SECTION C. Environmental Aspects / Potential Sources of Impact

  20. Microsoft Word - DOE-ID-13-019 Florida EC B3-6.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    9 SECTION A. Project Title: Bil 3 Gamma-Ray Spectrometers for Reliable Room-Temperature Nuclear Materials Safeguarding - University of Florida SECTION B. Project Description The University of Florida will develop and manufacture Bil 3 detector devices, perform characterization tests using calibration sources to determine detector response and energy-dependent efficiency, and demonstrate their use in reliable spent fuel monitoring within the fuel cycle for safeguarding applications, including

  1. Microsoft Word - DOE-ID-13-020 Purdue EC B3-6.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    0 SECTION A. Project Title: Correlating Thermal, Mechanical, and Electrical Coupling Based Multi-Physics Behavior of Nuclear Materials through in-situ Measurement - Purdue University SECTION B. Project Description Purdue University proposes to evaluate the effects of irradiation on thermomechanical coupling for Zircaloy as function of temperature and environment change using complementary in-situ experiments. The focus is on establishing an elaborate in-situ experimental setup that can not only

  2. Microsoft Word - DOE-ID-13-023 Vanderbilt EC B3-15.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    3 SECTION A. Project Title: Development of a Nano-modified Concrete for Next Generation of Storage Systems - Vanderbilt University SECTION B. Project Description The goal of Vanderbilt University is to develop superior concrete for the long-term storage of used nuclear fuel by engineering concrete at the nanoscale through the incorporation of nano-sized and nano-structured particles based on enhanced reactivity. Tasks will include sample preparation, gamma irradiation at the ATR NSUF, exposure

  3. Microsoft Word - DOE-ID-13-027 Utah EC B3-6.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    7 SECTION A. Project Title: Risk Assessment of Structural Integrity of Transportation Casks - University of Utah SECTION B. Project Description The University of Utah proposes to assess the risk of loss of structural integrity of transportation casks and fuel cladding after extended storage. The project will include subjecting canisters to impact loads and puncture tests. Casks will be subjected to accelerated degradation due to chloride attacks to simulate the effects of exposure to

  4. Microsoft Word - DOE-ID-13-031 Idaho EC B3-6.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    31 SECTION A. Project Title: Doubling The Life of Concrete Structures - University of Idaho SECTION B. Project Description The University of Idaho proposes to study the transport properties of concrete. Objectives include developing methods for doubling the service life of concrete structures through the use of nano-SiO2, studying the effect of temperature load and temperature cycling on conductive pathways by electrochemical methods, studying the combined effect of temperature, moisture, and

  5. Microsoft Word - DOE-ID-13-032 Illinois B1-31.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    2 SECTION A. Project Title: Nuclear Engineering Teaching and Research Facilities Upgrade at the University of Illinois at Urbana-Champaign SECTION B. Project Description The University of Illinois proposes to purchase equipment to upgrade the Nuclear Fuel Cladding and Structural Analysis Laboratory. The equipment includes an electrolytical polisher for bulk materials, an electrolytical polisher for transmission electron microscope specimens, a perchloric acid laboratory hood, and a nuclear glove

  6. Microsoft Word - DOE-ID-13-034 NC State B1-31.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    4 SECTION A. Project Title: A Positron Microprobe Spectrometer for Defects and Nano-Vacancy Characterization in Materials - North Carolina State University SECTION B. Project Description North Carolina State University proposes to install a positron (electron antiparticle) microprobe spectrometer for nanophase positron annihilation spectrometry at the North Carolina State University (NCSU) Positron Beam Laboratory, which is located at the NCSU PULSTAR reactor.

  7. Microsoft Word - DOE-ID-13-036 New Mexico EC B3-6.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    6 SECTION A. Project Title: Improving the Understanding of the Coupled Thermal-Mechanical-Hydrologic Behavior of Consolidating Granular Salt - University of New Mexico SECTION B. Project Description The University of New Mexico proposes to improve the understanding of key aspects of the coupled thermal-mechanical-hydrologic response of granular salt used as a seal material for shafts, drifts, and boreholes in mined repositories in salt. Specific objectives of the project are: 1. Measure the

  8. Microsoft Word - DOE-ID-13-037 Washington State B1-31.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    7 SECTION A. Project Title: Spectroscopy System for Teaching and Research- Washington State University SECTION B. Project Description Washington State University proposes to purchase and setup the equipment necessary for a new up-to-date  spectroscopy system for research and development work and laboratory instruction. SECTION C. Environmental Aspects / Potential Sources of Impact The action consists of purchasing equipment to be used in research and teaching. The action would not create

  9. Microsoft Word - DOE-ID-13-038 UC-Berkeley B1-31.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    8 SECTION A. Project Title: Research and Teaching Equipment for Nuclear Materials Characterization - U.C.-Berkeley SECTION B. Project Description The University of California-Berkeley proposes to purchase a retractable annular STEM detector, 6-channel detector amplifier, atomic force microscope, high temperature chamber for a tensile tester, and an in-situ micromechanical testing device. SECTION C. Environmental Aspects / Potential Sources of Impact Radioactive Material Use/Radioactive Waste

  10. Microsoft Word - DOE-ID-13-044 Idaho EC B3-6.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    4 SECTION A. Project Title: Off-gas Treatment: Evaluation of Nano-structured Sorbents for Selective Removal of Contaminants - University of Idaho SECTION B. Project Description The University of Idaho proposes to evaluate nanostructured sorbent materials for their effectiveness in removing and immobilizing contaminants for the off-gas treatment from the used nuclear fuel recycling operations. Specific objectives of the project are: 1. To synthesize and characterize various nanosorbents for the

  11. Microsoft Word - DOE-ID-13-047 Arizona State EC B3-6.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    7 SECTION A. Project Title: Radiation Hardened Electronics Destined for Severe Nuclear Reactor Environments - Arizona State University SECTION B. Project Description Arizona State University proposes to develop both board and application-specific integrated circuits (ASIC) level (radiation hardening by design) RHBD techniques for circuits destined for severe nuclear environments, specifically those that are vital to robotic circuits. The project will focus on using redundancy to achieve total

  12. Microsoft Word - DOE-ID-13-048 Alabama EC B3-6.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    8 SECTION A. Project Title: Using Ionic Liquids for the Development of Renewable Biopolymer-Based Adsorbents for the Extraction of Uranium from Seawater and Testing Under Marine Conditions - University of Alabama SECTION B. Project Description The University of Alabama proposes to study the fundamental engineering parameters for a renewable high-performance adsorbent for the extraction of uranium from seawater based on a proven ionic liquid-chitin platform. Objectives include: 1) Understand how

  13. Microsoft Word - DOE-ID-13-050 Northwestern EC B3-6.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    0 SECTION A. Project Title: Predictive Characterization of Aging and Degradation of Reactor Materials in Extreme Environments - Northwestern University SECTION B. Project Description Northwestern University proposes to understand and predict long-term effects or irradiation, temperature, and stress on material microstructures and their macroscopic behavior through a suite of unique experimental techniques, augmented by a mesoscale computational framework. Work will include in situ transmission

  14. Microsoft Word - DOE-ID-13-056 Arizona State EC B3-6.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    6 SECTION A. Project Title: Multi-Resolution In Situ Testing and Multiscale Simulation for Creep Fatigue Damage Analysis of Alloy 617 - Arizona State University SECTION B. Project Description Arizona State University proposes to develop novel testing and experimentally validated prediction methodologies for creep- dominated creep fatigue response of structural materials (nickel-based Inconel 617) for advanced reactor systems. Objectives include: 1. Perform multi-resolution in-situ and ex-situ

  15. Microsoft Word - DOE-ID-13-059 UC Irvine EC B3-15.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    59 SECTION A. Project Title: Multiphase Nanocrystalline Ceramic Concept for Nuclear Fuel- University of California, Irvine SECTION B. Project Description The University of California, Irvine, in collaboration with the University of California, San Diego, University of Tennessee, and Los Alamos National Laboratory, proposes to explore the use of nanoparticles and nanostructured materials to create improved materials that can extend the service life for nuclear fuel. Work at UC-Irvine will include

  16. Microsoft Word - DOE-ID-13-060 George Washington EC B3-6.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    60 SECTION A. Project Title: Validation Data for Depressurized and Pressurized Conduction Cooldown - George Washington University SECTION B. Project Description George Washington University proposes to study the behavior of a Very High Temperature Gas Reactor during a Depressurized Conduction Cooldown (DCC) event and during a Pressurized Conduction Cooldown (PCC) event during normal operations. Both of these phenomena will be studied by a combination of in-situe velocity field, pressure, and

  17. Microsoft Word - DOE-ID-13-061 South Carolina EC B3-6.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    1 SECTION A. Project Title: Structural Health Monitoring of Nuclear Spent Fuel Storage Facilities - University of South Carolina SECTION B. Project Description The University of South Carolina, in collaboration with Savannah River National Laboratory, proposes to develop a state-of-the-art nuclear structural health monitoring (N-SHM) system based on in-situ sensing technologies that monitors material degradation and aging for nuclear spent fuel dry cask storage system (DCSS) and similar

  18. Microsoft Word - DOE-ID-13-063 Houston EC B3-6.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    3 SECTION A. Project Title: NEET-1: Ultra-High Performance Concrete and Advanced Manufacturing Methods for Modular Construction - University of Houston SECTION B. Project Description The University of Houston proposes to develop cost-effective ultra-high performance concrete (UHPC) products with 150 MPa (22ksi) concrete compressive strength without special temperature and pressure treatment, high durability, large-scale process-ability with controlled quality, which can be rapidly prefabricated

  19. Microsoft Word - DOE-ID-13-065 UC Berkeley EC B3-6.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    5 SECTION A. Project Title: Structural Health Monitoring of Nuclear Spent Fuel Storage Facilities - University of California, Berkeley SECTION B. Project Description The University of California-Berkeley, in collaboration with Argonne National Laboratory, proposes to demonstrate that the recoil-ion approach to -delayed neutron spectroscopy can be an innovative method to collect high-quality measurements of neutron emission branching ratio and energy spectrum that are needed for nuclear-energy

  20. Microsoft Word - DOE-ID-13-066 Wisconsin EC B3-6.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    6 SECTION A. Project Title: Validation Corrosion of Structural Materials for Advanced Supercritical Carbon-Dioxide Brayton Cycle - University of Wisconsin SECTION B. Project Description The University of Wisconsin proposes to study the supercritical carbon-dioxide (SC-CO 2 ) Brayton cycle to address key materials corrosion and related challenges, identify appropriate materials, and advance the body of scientific knowledge in the area of high temperature SC-CO 2 corrosion. SECTION C.

  1. Microsoft Word - DOE-ID-13-067 Wisconsin EC B3-6.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    7 SECTION A. Project Title: Component and Technology Development for Advanced Liquid Metal Reactors - University of Wisconsin SECTION B. Project Description The University of Wisconsin proposes to study corrosion resistance in advanced materials, testing of new diffusion bonded heat exchanger technologies, development of O 2 detector, and fiber optic temperature measurements to help improve safety margins and design flexibility critical to improving the performance and economics of liquid metal

  2. Microsoft Word - DOE-ID-13-073 South Carolina EC B3-6.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    3 SECTION A. Project Title: U 3 Si 2 Fabrication and Testing for Implementation into the BISON Fuel Performance Code - University of South Carolina SECTION B. Project Description The University of South Carolina proposes to fabricate, test, and model a high uranium density, advanced nuclear fuel (U 3 Si 2 ). Tasks include fabrications of samples, characterizing to understand their microstructure, creep testing, and design, fabrication, and usage of four-point bend testing fixture and high

  3. Microsoft Word - DOE-ID-13-074 Colorado EC B3-6.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    4 SECTION A. Project Title: Microwave Readout Techniques for Very Large Arrays of Nuclear Sensors - University of Colorado SECTION B. Project Description The University of Colorado, in collaboration with the National Institute for Standards & Technology (NIST), proposes to develop an inexpensive yet powerful readout technique based on microwave transmission and reflection that will enable very large arrays of diverse sensor types for nuclear materials quantification and tracking.

  4. Microsoft Word - DOE-ID-13-075 Ohio State EC B3-6.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    5 SECTION A. Project Title: Compact Heat Exchanger Design and Testing for Advanced Nuclear Reactors and Advanced Power Cycles - The Ohio State University SECTION B. Project Description The Ohio State University proposes to investigate optimal heat exchanger designs as intermediate heat exchangers (IHXs)/recuperators for small modular reactors and other advanced reactors that use the s-CO 2 Brayton power cycle. Objectives include: 1. Engineer optimized printed-circuit heat exchanger (PCHE) for

  5. Microsoft Word - DOE-ID-13-076 Utah State EC B3-6.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    6 SECTION A. Project Title: Optical Fiber Based Laser System for Thermophysical Properties at Very High Temperatures - Utah State University SECTION B. Project Description Utah State University proposes to develop a robust technique using lasers for the measurement of multiple thermophysical properties, such as thermal diffusivity, thermal conductivity, heat capacity, and melting point, at very high temperatures. Objectives include: 1. Design, build, and tune the measurement technique; 2.

  6. Microsoft Word - DOE-ID-13-077 Clemson EC B3-6.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    7 SECTION A. Project Title: Lower Length Scale Characterization and Validation of Formation and Stability of Helium Bubbles in Nano-structured Ferritic Alloys under Irradiation - Clemson University SECTION B. Project Description Clemson University, in collaboration with Oak Ridge National Laboratory and Argonne National Laboratory, proposes to characterize helium bubbles within 14YWT alloys with both theoretical understanding and experimental observation. Tasks include: 1. Conduct a thoroughly

  7. Microsoft Word - DOE-ID-13-078 Ohio State EC B3-6.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    8 SECTION A. Project Title: Tritium Migration/Control for Advanced Reactor Systems - The Ohio State University SECTION B. Project Description The Ohio State University proposes to study the mitigation of tritium permeation in the coolant loops of a fluoride salt-cooled High- temperature Reactor (FHR) by proposing a two-loop FHR to eliminate the intermediate third loop. Objectives include: 1. To estimate tritium permeation behavior in FHRs; 2. To design a tritium removal system for FHR system; 3.

  8. Microsoft Word - DOE-ID-13-080 Penn State EC B3-6.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    0 SECTION A. Project Title: Glass Composition and Solution Effects on Stage III Dissolution - Pennsylvania State University SECTION B. Project Description Pennsylvania State University proposes to investigate the chemical and structural triggers of Stage III corrosion of waste glass through a series of studies covering a range of glass compositional space based primarily on two waste glass compositions which have been observed to exhibit very different behavior with respect to Stage III

  9. Microsoft Word - DOE-ID-13-081 Idaho EC B3-6.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    1 SECTION A. Project Title: Innovative Elution Processes for Recovering Uranium and Transition Metals from Amidoxime- based Sorbents - University of Idaho SECTION B. Project Description The University of Idaho, in collaboration with Oak Ridge National Laboratory, proposes to develop an efficient, economic, and environmentally sustainable technique for sequestering uranium from seawater. Objectives include: 1. Study durability of the amidoxime-based sorbent during carbonate-H 2 O 2 elution of

  10. Microsoft Word - DOE-ID-13-082 Missouri EC B3-6.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    2 SECTION A. Project Title: Long-Term Prediction of Emissivity of Structural Material for High Temperature Reactor Systems - University of Missouri SECTION B. Project Description The University of Missouri, in collaboration with the University of Wisconsin, proposes to study long-term predictions of emissivity of steels and alloys. Objectives include: 1. Defining materials for long-term emissivity in cross-cutting reactor applications - procurement, preparation, and analyses of materials. 2.

  11. Microsoft Word - DOE-ID-13-084 Maryland EC B3-6.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    4 SECTION A. Project Title: Enhancement of the Extraction of Uranium from Seawater - University of Maryland SECTION B. Project Description The University of Maryland, in collaboration with Catholic University, proposes to develop novel technologies in the form of adsorbent fabrics for the extraction of uranium from seawater. Objectives include: 1. Enhancing the loading capacity of uranium on the adsorbent fabric. 2. Acceleration of kinetics of uptake of uranium on the adsorbent fabric. 3.

  12. Microsoft Word - DOE-ID-13-085 Oregon State EC B3-6.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    5 SECTION A. Project Title: Organic Speciation and Interactions in ALSEP - One Step Partitioning Process of Minor Actinides, Lanthanides, and Fission Products - Oregon State University SECTION B. Project Description Oregon State University, in collaboration with Argonne National Laboratory, proposes to investigate the nature of organic phase on the extraction side of the Actinide-Lanthanide Separation (ALSEP) process. The primary objective will be to document the naturally occurring

  13. Microsoft Word - DOE-ID-14-002 Georgia Tech EC B3-6.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    2 SECTION A. Project Title: Self-Consolidating Concrete Construction for Modular Units - Georgia Institute of Technology SECTION B. Project Description The Georgia Institute of Technology proposes to develop self-consolidating concrete (SCC) mixtures so that concrete placement can be made into steel plate composite modular structures without the need for continuous concrete placement. SCC mixtures will be developed and their use validated to ensure sufficient shear capacity across cold-joints,

  14. Microsoft Word - DOE-ID-14-004 Virginia Tech EC B3-6.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    4 SECTION A. Project Title: Enhanced Shielding Performance of HLW Storage Packages via Multi-Component Coatings - Virginia Polytechnic Institute and State University SECTION B. Project Description Virginia Polytechnic Institute and State University, in collaboration with North Carolina State University, proposes to develop an outer shield material for use in packaging that is not only resistant to the corrosion, radiation, diffusion, and thermal cycling processes that affect fuel packages during

  15. Microsoft Word - DOE-ID-14-009 Alfred EC B3-6.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    09 SECTION A. Project Title: Gyrotron for Rapid Extreme Thermal Processing of Materials for Nuclear Energy- Alfred University SECTION B. Project Description Alfred University proposes to purchase and install a 94 GHz, 10 kW CW gyrotron with a liquid cryogen-free superconducting magnet along with appropriate power source and auxiliary systems to establish an extreme thermal processing capability. SECTION C. Environmental Aspects / Potential Sources of Impact The research would generate small

  16. Microsoft Word - DOE-ID-14-010 Nevada Reno B1-31.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    10 SECTION A. Project Title: X-Ray Diffraction System to Enhance the Nuclear Materials Research and Education - University of Nevada Reno SECTION B. Project Description The University of Nevada, Reno proposes to purchase and install an x-ray diffractometer to further enhance the research capabilities at the university by allowing x-ray diffraction characterization of thick oxide films formed on the surfaces of samples for research and laboratory instruction. SECTION C. Environmental Aspects /

  17. Microsoft Word - DOE-ID-14-014 Utah B1-31.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    4 SECTION A. Project Title: Development of Capabilities to Study the Thermodynamics of Nuclear Energy Related Infrastructure at the Utah Nuclear Engineering Program - University of Utah SECTION B. Project Description The University of Utah proposes to acquire an isothermal titration calorimeter (ITC) for the measurement of thermodynamic properties of actinide complexes, and the enhancement of coursework and research efforts

  18. Microsoft Word - DOE-ID-14-015 Idaho State B1-31.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    5 SECTION A. Project Title: Idaho State University Reactor Laboratory Modernization SECTION B. Project Description Idaho State University proposes to modernize radiation detectors and associated instruments used to perform laboratory experiments and research in the Idaho State University Reactor Laboratory. ISU will upgrade radiation detectors, the sub-critical assembly grid plates, tank filling and draining equipment, and handrails

  19. Microsoft Word - DOE-ID-14-016 Arizona State EC B3-6.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    6 SECTION A. Project Title: Serial Sectioning Equipment for 3-D Characterization of Microstructure and Composition Effects on Mechanical Behavior of Enhanced Uranium Oxide Fuels - Arizona State University SECTION B. Project Description Arizona State University proposes to purchase and operate an ion polishing system to expand existing capabilities for 3-D microstructure characterization via serial sectioning with mechanical polishing to use ion beam polishing over large areas of oxide fuel

  20. Microsoft Word - DOE-ID-14-017 Wisconsin B1-31.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    7 SECTION A. Project Title: General Scientific Infrastructure Support for University of Wisconsin SECTION B. Project Description The University of Wisconsin proposes to purchase a custom-designed cylindrical chamber for ion implantation and/or ion beam analysis, a sample stage, vacuum components for the PIXE detector, a turbopump for the new implantation chamber, a controlled motor for remote steering of the double slits, a turbopump for a high-current TORVIS source, a helium leak detector, and

  1. Microsoft Word - DOE-ID-14-022 Illinois B1-31.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    2 SECTION A. Project Title: Nuclear Engineering Teaching and Research Facilities Upgrade at the University of Illinois at Urbana-Champaign Education SECTION B. Project Description The University of Illinois proposes to purchase and install a steam generator to observe the response of Zr-based LWR cladding to steam at temperature associated with design-based accident scenarios and temperatures associated with beyond designed based accident scenarios. The university also proposes to purchase and

  2. Microsoft Word - DOE-ID-14-025 Ohio State B1-31.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    5 SECTION A. Project Title: Inductively Coupled Plasma Optical Emission Spectrometer for Nuclear Energy-Related Teaching and Research - Ohio State University SECTION B. Project Description Ohio State University proposes to purchase and install a high purity glove box system for studying advanced instrumentation and control and instruments, such as high-temperature flow meters and intermediate heat exchangers, for the High Temperature Fluoride Salt Direct Reactor Auxiliary Cooling System (DRACS)

  3. Microsoft Word - DOE-ID-14-027 Washington State B1-31.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    7 SECTION A. Project Title: Inductively Coupled Plasma Optical Emission Spectrometer for Nuclear Energy-Related Teaching and Research - Washington State University SECTION B. Project Description Washington State University proposes to purchase and install an inductively coupled-plasma optical emission spectrometer (ICP-OES) for quantification of stable elements at trace levels for teaching and research. SECTION C. Environmental Aspects / Potential Sources of Impact The action consists of

  4. Microsoft Word - DOE-ID-14-030 Purdue EC B3-6.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    0 SECTION A. Project Title: An Investigation To Establish Multiphysical Property Dataset of Nuclear Materials Based on In- Situ Observations and Measurements, NEAMS: Nuclear Energy Advanced Modeling and Simulation - Purdue University SECTION B. Project Description Purdue University proposes to investigate the prediction of microstructure feature change as a function of irradiation energy using in- situ observation through in-situ ion irradiation transmission electron microscope experiments,

  5. Microsoft Word - DOE-ID-14-032 Purdue EC B3-6.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    2 SECTION A. Project Title: Improvement of Design Codes to Account for Accident Thermal Effects on Seismic Performance - Purdue University SECTION B. Project Description Purdue University proposes to develop knowledge-based design guidelines for safety-related nuclear facilities subjected to combined accident thermal conditions and seismic loading. This will be accomplished by experimentally investigating the seismic performance of structural walls subjected to accident thermal loading,

  6. Microsoft Word - DOE-ID-14-033 Tennessee EC B3-6.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    3 SECTION A. Project Title: Integrated Computational and Experimental Study of Radiation Damage Effects in Grade 92 Steel and Alloy 709 - University of Tennessee SECTION B. Project Description The University of Tennessee proposes to study the relationship between ion irradiation and neutron irradiation in regards to equivalence in radiation damage in two materials and how ion irradiation data can be used to guide future neutron irradiation experiments, to determine the mechanical property

  7. Microsoft Word - DOE-ID-14-047 Rutgers EC B3-6.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    7 SECTION A. Project Title: Multi-Sensor Inspection and Robotic Systems for Dry Storage Casks - Pennsylvania State University SECTION B. Project Description The objective of Pennsylvania State University's research is to develop sensors, monitoring methodologies, and a delivery system to ensure safe dry storage of used nuclear fuel. SECTION C. Environmental Aspects / Potential Sources of Impact The action will use existing facilities and will not create additional environmental impacts above

  8. Microsoft Word - DOE-ID-14-048 Clemson University EC B3-6.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    8 SECTION A. Project Title: A New Paradigm for Understanding Multi-phase Ceramic Waste Form Performance - Clemson University SECTION B. Project Description Clemson University will fabricate model multiphase ceramic waste forms with processing-controlled microstructures followed by advanced characterization with synchrotron and electron microscopy-based 3D tomography to provide elemental and chemical state specific information resulting in compositional phase maps of ceramic composites. SECTION

  9. Microsoft Word - DOE-ID-14-054 Lehigh University EC B3-6.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    4 SECTION A. Project Title: Development of Novel Functional Graded Transition Joints for Improving the Creep Strength of Dissimilar Metal Welds in Nuclear Applications - Lehigh University SECTION B. Project Description The objectives of Lehigh University research is to: 1) Develop design and processing methods for fabricating novel Graded Transition Joints (GTJs) that eliminate failures that occur due to enhanced carbon diffusion and high thermal stresses, 2) Establish a database of creep life

  10. Microsoft Word - DOE-ID-14-058 Notre Dame EC B3-6.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    8 SECTION A. Project Title: Assessment of Corrosion Resistance of Promising Accident Tolerant Fuel Cladding Under Reactor Conditions - Notre Dame University SECTION B. Project Description Notre Dame University assess the corrosion behavior of accident tolerant fuel candidate iron-based alloys under normal Light water reactor operating conditions consisting of high temperature, relevant water chemistry and irradiation. SECTION C. Environmental Aspects / Potential Sources of Impact The action will

  11. Microsoft Word - DOE-ID-14-059 MIT EC B3-6.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    59 SECTION A. Project Title: Integrated FHR Technology Development : Tritium Management, Materials Testing, Materials Testing, Salt Chemistry Control, Thermal-Hydraulics and Neutronics with Associated Benchmarking - Massachusetts Institute of Technology SECTION B. Project Description Massachusetts Institute of Technology will conduct research is to address major challenges in the development of commercial Fluoride-salt-cooled High-temperature Reactor (FHR) technology: tritium control;

  12. Microsoft Word - DOE-ID-14-064 Illinois EC B3-6.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    4 SECTION A. Project Title: Fundamental Studies of Irradiation-Induced Modification in Microstructural Evolution and Mechanical Properties of Advanced Alloys - University of Illinois SECTION B. Project Description The University of Illinois will conduct research that will: (1) establish ion-to-neutron irradiation correlations between available neutron-irradiated reference alloys (Grade 91, Grade 92 and NF709) and the ion irradiations on these materials, and (2) to use these correlations to

  13. Microsoft Word - DOE-ID-14-069 Houston B1-31.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    9 SECTION A. Project Title: Upgrade of Universal Element Tester for Nuclear Energy Infrastructure Research- University of Houston SECTION B. Project Description The University of Houston proposes to purchase and install a computer control system and tele-participation computer system to upgrade the universal element tester that is used to perform biaxial or triaxial tests on full-size concrete elements with load-control and strain-control loading modes. The upgrade will allow further studies of

  14. Microsoft Word - DOE-ID-14-070 Wisconsin EC B3-6.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    0 SECTION A. Project Title: Advanced Instrumentation for Transient Reactor Testing - University of Wisconsin SECTION B. Project Description The University of Wisconsin proposes to focus on five distinct task areas for advanced instrumentation for transient reactor testing: 1. Development of innovations for real-time, 'line-of-sight' imaging for a transient test using the current hodoscope concept with advancements in detection and image resolution; 2. Development of novel sensors to measure

  15. Microsoft Word - DOE-ID-14-071 IDEQ EC B3-1.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    1 SECTION A. Project Title: Federal Facility Agreement and Consent Order (FFA/CO) - Idaho Department of Environmental Quality SECTION B. Project Description In order for the Idaho Department of Environmental Quality (IDEQ) to ensure Department of Energy (DOE) compliance with the terms and conditions of the Federal Facility Agreement and Consent Order (Agreement), IDEQ oversight activities will include the following: 1. Technical review, verification and validation, comments and recommendations

  16. Microsoft Word - DOE-ID-14-075 Utah EC B3-6.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    5 SECTION A. Project Title: - Development and Optimization of Voltammetric Methods for Real Time Analysis of Electrorefiner Salt with High Concentrations of Actinides and Fission Products - University of Utah SECTION B. Project Description The University of Utah proposes to develop a robust, accurate method for measuring key component concentrations in molten LiCl- KCl that can readily be implemented into real-time process monitoring systems. This will be accomplished by utilizing fundamental

  17. Microsoft Word - DOE-ID-14-076 Penn State EC B3-6.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    6 SECTION A. Project Title: Novel Dissimilar Joints Between Alloy 800H and 2.25%Cr and 1%Mo Steel - The Pennsylvania State University SECTION B. Project Description The Pennsylvania State University proposes to undertake an integrated experimental and theoretical research program to develop, fabricate, and test highly engineered dissimilar metal weld joints between 2.25Cr-1 Mo ferritic steels and an 800-H nickel base alloys. The projects will also generate, evaluate, and document data on welding

  18. Microsoft Word - DOE-ID-14-079 Nevada Reno EC B3-6.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    79 SECTION A. Project Title: Effects of Metallic Li on the Behavior of Metals and Alloys in Molten Salts - The University of Nevada Reno SECTION B. Project Description The University of Nevada Reno proposes to understand how the presence of Li -0 in molten LiCl-Li 2 O affects the degradation of two classes of alloys by correlating their accelerated and long-term electrochemical behavior to the surface chemistry of the alloys and the chemistry of the electrolyte. Electrochemical studies,

  19. Microsoft Word - DOE-ID-14-083 Michigan EC B3-6.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    3 SECTION A. Project Title: High-Resolution Time-Resolved Experiments on Mixing and Entrainment of Buoyant Jets in Stratified Environments - University of Michigan SECTION B. Project Description The University of Michigan proposes to measure the effect of stratification on turbulence redistribution and mixing with different high-resolution diagnostics using coordinated experiments and simulations. SECTION C. Environmental Aspects / Potential Sources of Impact The research would involve

  20. Microsoft Word - DOE-ID-14-084 Virginia Tech EC B3-15.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    4 SECTION A. Project Title: SiC-ODS Alloy Gradient Nanocomposites as Novel Cladding Materials - Virginia Polytechnic Institute and State University SECTION B. Project Description Virginia Tech proposes to design and study gradient nanocomposites that are composed of nanostructured SiC and oxide dispersion strengthened (ODS) steel (9Cr nanostructured ferritic alloy (NFA)) as the most advanced nuclear cladding materials, conduct material testing that most closely resembles nuclear reactor

  1. Microsoft Word - DOE-ID-14-086 Virginia Tech EC B3-6.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    6 SECTION A. Project Title: Thermal Conductivity of Metallic Fuels - Virginia Polytechnic Institute and State University SECTION B. Project Description Virginia Tech, in collaboration with Idaho National Laboratory and Oak Ridge National Laboratory, proposes to determine the electronic structure and phonon spectrum of U-Zr and Np-Zr alloys with and without the presence of noble gases. U-Zr and Np-Zr alloys will be fabricated for a composition range from 0 to 20% Zr. The thermal conductivity of

  2. Microsoft Word - DOE-ID-14-088 General Atomics EC B3-6.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    8 SECTION A. Project Title: Modularization Fabrication and Characterization of Complex Silicon Carbide Composite Structures - General Atomics SECTION B. Project Description General Atomics will The proposed project will explore innovative methods for fabricating and testing complex Silicon carbide (SiC) and SiC fiber-reinforced composite structures pertinent to advanced reactor concepts. The project will use existing facilities to conduct the research. SECTION C. Environmental Aspects /

  3. Microsoft Word - DOE-ID-15-020 Nevada Reno B2-2.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    0 SECTION A. Project Title: In situ Raman Spectroscopy to Enhance Nuclear Materials Research and Education - University of Nevada Reno SECTION B. Project Description The University of Nevada Reno proposes to install a Raman Spectrometer on the existing water loop for in situ analysis of oxide films forming on sample surfaces. SECTION C. Environmental Aspects / Potential Sources of Impact The action consists of funding the purchase of analytical equipment. The action would not create additional

  4. Microsoft Word - DOE-ID-15-023 Illinois EC B3-6.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    3 SECTION A. Project Title: Multi-scale Experimental Study of Creep-Fatigue Failure Initiation in a 709 Stainless Steel Alloy Using High Resolution Digital Image Correlation - The Board of Trustees of the University of Illinois SECTION B. Project Description The University of Illinois proposes to understand the multi-scale (micro-, meso-, and macro-scale) development of damage in creep- fatigue of Stainless Steel 709 at high temperatures so fatigue life modeling predictivity will be feasible.

  5. Microsoft Word - DOE-ID-15-024 UNLV EC B3-6.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    4 SECTION A. Project Title: Purification of Zirconium Cladding Using a Chloride Volatility Process - University of Nevada, Las Vegas SECTION B. Project Description The University of Nevada, Las Vegas proposes to 1) investigate, by theoretical methods, the chemical form and thermochemical behavior of the chloride species produced after chlorination of Zr; 2) perform experimental characterization of the chloride species obtained after chlorination of Zr cladding; 3) investigate, under various

  6. Microsoft Word - DOE-ID-15-028 New Mexico EC B3-6.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    8 SECTION A. Project Title: Experimental Validation of a Compact Double-Walled Twisted-Tube Heat Exchanger Concept - University of New Mexico SECTION B. Project Description The University of New Mexico proposes to investigate a new compact double-walled heat exchanger concept for fluoride salt-cooled high-temperature reactors (FHRs) that utilize an outer twisted tube configuration in order to enhance shell-side heat transfer and make the overall bundle more compact while utilizing a traditional

  7. Microsoft Word - DOE-ID-15-029 Washington State EC B3-6.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    9 SECTION A. Project Title: Understanding Influence of Thermal History and Glass Chemistry on Kinetics of Phase Separation and Crystallization in Borosilicate Glass-Ceramic Waste Forms for Aqueous Reprocessed High Level Waste - Washington State University SECTION B. Project Description Washington State University, in collaboration with Rutgers University, proposes to develop a fundamental understanding of the phase transitions and crystallization mechanisms in complex glass-ceramic high level

  8. Microsoft Word - DOE-ID-15-030 City College EC B3-6.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    0 SECTION A. Project Title: Experimental Investigation of Forced Convection and Natural Circulation Cooling of a VHTR Core under Normal Operation and Accident Scenarios - City College of New York SECTION B. Project Description City College of New York proposes to experimentally investigate the coolant flow and heat transfer behavior in a prismatic core of a Very High Temperature Gas-Cooled Reactor (VHTR) under accident conditions. The objectives of this proposal are to perform the following

  9. Microsoft Word - DOE-ID-15-033 Arizona State EC B3-6.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    3 SECTION A. Project Title: Automatic Imagery Data Analysis for Proactive Computer-Based Workflow Management during Nuclear Power Plant Outages - Arizona State University SECTION B. Project Description Arizona State University proposes to test the hypothesis that real-time imagery-based object tracking and spatial analysis, as well as human behavior modeling of outage participants, will significantly improve efficiency of outage control while lowering the rates of accidents and incidents.

  10. Microsoft Word - DOE-ID-15-041 Wisconsin EC B3-6.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    1 SECTION A. Project Title: Radiation-induced Swelling and Microcracking in SiC Cladding for LWRs - University of Wisconsin SECTION B. Project Description The University of Wisconsin proposes to provide a fundamental basis for continuum models of swelling by measuring the distribution of defect clusters of all sizes and modeling their contribution to swelling and to combine the model of swelling with simulations of microstructural evolution to predict the effect of swelling on microcracking in

  11. Microsoft Word - DOE-ID-15-042 Notre Dame EC B3-6.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    2 SECTION A. Project Title: Prefabricated High-Strength Rebar Systems with High-Performance Concrete for Accelerated Construction of Nuclear Concrete Structures - University of Notre Dame SECTION B. Project Description The University of Notre Dame proposes to reduce the field construction times of fabrication costs of reinforced concrete nuclear structures through: 1) high-strength steel deformed reinforcing bars (rebar); 2) prefabricated rebar assemblies with headed anchorages; and 3)

  12. Microsoft Word - DOE-ID-15-043 Florida EC B3-6.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    3 SECTION A. Project Title: Used Fuel Storage Monitoring Using Novel 4 He Scintillation Fast Neutron Detectors and Neutron Energy Discrimination Analysis - University of Florida SECTION B. Project Description The University of Florida proposes to build and demonstrate a prototype detector device capable of unambiguously verifying the declared contents of dry storage casks in a non-intrusive manner for the safeguarding and monitoring of used fuel storage installations. This will be achieved

  13. Microsoft Word - DOE-ID-15-046 UCLA EC B3-6.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    6 SECTION A. Project Title: The Influences of Neutron Irradiation on Aggregate Induced Degradation of Concrete - University of California, Los Angeles SECTION B. Project Description The University of California, Los Angeles, in collaboration with a National Lab, proposes to examine evolutions/manifestations of irradiation assisted aggregate (and concrete) degradation caused by neutron exposure. Objectives of this research include 1) to quantify the impacts of damage cascades, caused by heavy ion

  14. Microsoft Word - DOE-ID-15-047 Mississippi EC B3-6.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    7 SECTION A. Project Title: Multimodal Nondestructive Dry Cask Basket Structure and Spent Fuel Evaluation - The University of Mississippi SECTION B. Project Description The University of Mississippi proposes to perform non-destructive evaluations of a spent fuel cask. Methods used include 1) emission source tomography, 2) linear and nonlinear active acoustics methods, 3) acousto-ultrasonic techniques, and 4)Muon imaging. The casks will contain no radioactive material. SECTION C. Environmental

  15. Microsoft Word - DOE-ID-15-052 Houston EC B3-6.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    2 SECTION A. Project Title: Multiple Degradation Mechanisms in Reinforced Concrete Structures, Modeling and Risk Analysis - The University of Houston SECTION B. Project Description The University of Houston proposes to complement ongoing Light Water Reactor Sustainability (LWRS)-funded Grizzly (component aging code) efforts by providing improved multi-physics models that will be incorporated into Grizzly's framework. These new developments include 1) coupling between mechanical damage and

  16. Microsoft Word - DOE-ID-15-057 Oregon State EC B3-6.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    7 SECTION A. Project Title: Modeling and Validation of Irradiation Damage in Ni-based Alloys for Long-Term LWR Applications - Oregon State University SECTION B. Project Description Oregon State University proposes to address thermal and irradiation-induced transformations mechanisms of Alloys 690 and 625 to extend the Grizzly code to include capabilities for modeling Ni-based alloys. The proposed program combines thermal and irradiation experiments, mechanical testing, microstructural

  17. Microsoft Word - DOE-ID-15-058 Oregon State EC B3-6.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    8 SECTION A. Project Title: Advancement of Supercritical Carbon Dioxide Technology through Round Robin Testing and Fundamental Modeling - Oregon State University SECTION B. Project Description Oregon State University proposes to establish a round robin test plan for supercritical carbon dioxide (S-CO 2 ) corrosion testing and the organization of an S-CO 2 Materials Group to guide future materials testing directions. This proposal relates S-CO 2 corrosion data to existing industrial supercritical

  18. Microsoft Word - DOE-ID-15-059 Penn State EC B3-6.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    9 SECTION A. Project Title: Fundamental Electrochemical Properties of Liquid Metals in LiCl-KCl for Separation of Alkali/Alkaline-Earths (Cs, Sr, and Ba) - The Pennsylvania State University SECTION B. Project Description The Pennsylvania State University proposes to investigate and develop selective liquid metal electrodes for the electrochemical separation of the alkali/alkaline-earth elements of Cs, Sr, and Ba from molten salt electrolyte. SECTION C. Environmental Aspects / Potential Sources

  19. Microsoft Word - DOE-ID-15-061 Alabama EC B3-6.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    61 SECTION A. Project Title: Understanding the Interactions of Seawater Ions with Amidoxime through X-Ray Crystallography - The University of Alabama SECTION B. Project Description The University of Alabama (UA) proposes to understand how metal ions from seawater bind to uranium-selective amidoxime functionalized sorbents by experimentally determining the structures of metal complexes with molecules simulating the possible binding sites and characterizing these binding sites spectroscopically to

  20. Microsoft Word - DOE-ID-15-062 EPRI EC B3-6.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    2 SECTION A. Project Title: Nuclear Qualification Demonstration of a Cost Effective Common Cause Failure Mitigation in Embedded Digital Devices - EPRI SECTION B. Project Description The Electric Power Research Institute (EPRI) proposes to investigate the use of embedded digital components for safety-related I &C systems that can be demonstrated to contain no additional capabilities or characteristics other than that specially required for the functional objectives. These inflexible devices

  1. Microsoft Word - DOE-ID-15-063 Idaho EC B3-6.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    3 SECTION A. Project Title: Characterization of Creep-Fatigue Crack Growth in Alloy 709 and Prediction of Service Lives in Nuclear Reactor Components - University of Idaho SECTION B. Project Description The University of Idaho proposes 1) to measure and report the creep-fatigue crack growth rates in Alloy 709 under various creep- fatigue loading in accelerated test conditions and to use this knowledge to predict the extended service life of structural components, 2) to measure and report the

  2. Microsoft Word - DOE-ID-15-072 Kansas State EC B3-6.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    2 SECTION A. Project Title: A Transient Reactor Physics Experiment with High-Fidelity, 3-D Flux Measurements for Validation and Verification - Kansas State University SECTION B. Project Description Kansas State University, in collaboration with the University of Wisconsin, proposes to instrument a research reactor with novel micro-pocket fission detectors (MPFDs) for measuring three-dimensional flux distributions. The measured data will be compared to simulation using the PROTEUS tool from the

  3. Microsoft Word - DOE-ID-15-074 UC Berkeley EC B3-6.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    4 SECTION A. Project Title: Developing a Macro-scale SiC-cladding Behavior Model Based on Localized Mechanical and Thermal Property Evaluation on Pre-and Post-irradiation SiC-SiC Composites - University of California- Berkeley SECTION B. Project Description The University of California-Berkeley, in collaboration with Oak Ridge National Laboratory (ORNL), proposes to develop a fundamental understanding of the macroscopic behavior of SiC-SiC composite structures based on the microscopic properties

  4. Microsoft Word - DOE-ID-15-079 Long Beach B3-6.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    79 SECTION A. Project Title: Elucidation of the Kinetics of Advanced Separation Systems - California State University at Long Beach SECTION B. Project Description California State University at Long Beach, in collaboration with Idaho National Laboratory (INL), proposes to quantitatively measure absolute ligand complexation kinetics behind a variety of suggested separations systems for both lanthanides and actinides in the organic and aqueous phases. The research will include experiments on

  5. Microsoft Word - DOE-ID-15-081 Oregon State B3-6.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    1 SECTION A. Project Title: Computational and Experimental Benchmarking for Transient Fuel Testing - Oregon State University SECTION B. Project Description Oregon State University, in collaboration with two universities, three national laboratories, and two industry partners, proposes to develop a comprehensive evaluation of existing Transient Reactor Test (TREAT) Facility neutronics data using the next generation reactor core neutronics codes, perform a complete thermal hydraulic

  6. Microsoft Word - DOE-ID-15-082 ESER B1-20.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    2 SECTION A. Project Title: Sagebrush Seedling Planting - ESER SECTION B. Project Description The purpose and need for the project is to restore habitat for Greater sage-grouse as a conservation measure in the Candidate Conservation Agreement. We propose to plant 5000 seedlings of big sagebrush (Artemisia tridentate) on approximately 50 acres in the Sage Grouse Conservation Area on the INL Site. Specifically, the proposed planting site for 2014 will be in the area burned by the Tin Cup Fire west

  7. Microsoft Word - DOE-ID-INL-09-001redo.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    09-001 SECTION A. Project Title: SMC Dial Room SECTION B. Project Description The purpose of this project is to design and construct a new "Specific Manufacturing Capability (SMC) Dial Room" (and to procure/install communications equipment) inside the SMC security controlled area. The project will replace an existing dial room in Test Area North (TAN)-601, which is located at the Test Support Facility (TSF) area of TAN and outside SMC control. Because of the requirement for constant

  8. Microsoft Word - DOE-ID-INL-12-008 _INL-12-032_.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    8 SECTION A. Project Title: Test Reactor Area (TRA)-1710 Radioactive Materials Storage Area SECTION B. Project Description: Provide a brief but thorough description of the project or action, including the type of action (for example, new activity or facility, construction, process or facility modification, maintenance, research and development, work for others), description of activities, work phases, location of work activity (include a map or diagram, if appropriate), purpose and need (what is

  9. Microsoft Word - DOE-ID-INL-12-009 _INL-12-028_.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    09 SECTION A. Project Title: Idaho National Laboratory (INL) Closed Circuit Television (CCTV) Replacement Project SECTION B. Project Description: The Idaho National Laboratory (INL) closed circuit television (CCTV) provides video surveillance for use by protective forces in the protection of Department of Energy (DOE) security assets at the INL. The INL consists of a number of facilities spread out over an 890 square mile area and with facilities located in Idaho Falls. The CCTV system is

  10. Microsoft Word - DOE-ID-INL-12-025-1.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    5 SECTION A. Project Title: Central Facilities Area (CFA)-696 Gasoline Tank Installation SECTION B. Project Description: The two above ground gasoline tanks (04CFA00001, 10CFA00001) located on the east side of CFA-696 do not meet National Fire Protection Association (NFPA) requirements for separation distances (50 ft.) between the tanks and the dispenser. Two options are being considered to resolve the situation: 1. Battelle Energy Alliance, LLC (BEA) would take ownership of an existing 12,000

  11. Microsoft Word - DOE-ID-INL-12-027 _INL-12-105_.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    7 SECTION A. Project Title: Advanced Test Reactor (ATR) Transition to Commercial Power SECTION B. Project Description: In order to improve reliability and availability of the Advanced Test Reactor (ATR), to exempt ATR from compliance with 40 CFR, Subpart ZZZZ emission standards, and to reduce the carbon footprint at the Idaho National Laboratory (INL) and reduce the amount of diesel consumed at ATR Complex in support of INL sustainability goals, the INL proposes to transition the ATR to 100%

  12. Microsoft Word - DOE-ID-INL-13-004 R1.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    04 R1 SECTION A. Project Description: High Density Fuel Material for Light Water Reactors (LWRs) SECTION B. Project Description: This project proposes to install glove boxes, laboratory equipment and laboratory hoods in the east wing of the Experimental Fuels Facility (EFF), building 794, at the Materials and Fuels Complex (MFC) at the Idaho National Laboratory (INL). The building was previously known as the Contaminated Equipment Storage Building (CESB). The purpose of this project is to

  13. Microsoft Word - DOE-ID-11-013 Rhode Island EC.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    the Area Radiation Monitoring System and Confinement Air Handling System I&C with Opto-22 systems, add a Reactor Power Level Trend display that shows power trend data from...

  14. Microsoft Word - DOE-ID-15-050 Tennessee EC B3-6.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    with Oak Ridge National Laboratory (ORNL), proposes to examine three main scientific feasibility issues associated with high conductivity composite fuels. The first task is to...

  15. Microsoft Word - DOE-ID-12-034 EPRI EC B3-6.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    in a commercial BWR nuclear reactor. Specific objectives include conducting a feasibility evaluation, fabricating SiC-SiC composite test particles, conducting impact tests,...

  16. Microsoft Word - DOE-ID-13-079 UC Berkeley EC B3-6.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    B. Project Description The University of California, Berkeley proposes to assess the feasibility of designing a sodium-cooled breed-and-burn (B&B) fast reactor that will be able to...

  17. Microsoft Word - DOE-ID-13-051 Oregon St EC B3-6.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    a robust, multi-scale, mechanism-based model that quantitatively preducts creep-fatigue crack growth and failure in nickel-based nuclear reactor alloys. A model will be developed...

  18. Microsoft Word - DOE-ID-13-054 Maryland EC B3-6.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Impact Chemical UseStorage - It is expected that nitric acid, sulfuric acid, etc. for etching of steel speciments will be used. Less than 1 liter of each will be needed. Chemical...

  19. Microsoft Word - DOE-ID-13-057 Arizona State EC B3-6.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    a few milliliters for each use. Small amounts of inorganic acids will be stored for etching and other procedures needed. The ASU Offices of Risk Management and of Environmental...

  20. Microsoft Word - DOE-ID-15-032 Ohio State EC B3-6.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    of actinide isotopes in the salt of an electrorefiner or drawdown system. A novel sensor will be developed that uses electrochemical reduction to pre-concentrate the actinides...

  1. Microsoft Word - DOE-ID-13-021 Stony Brook EC B3-6.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    1 SECTION A. Project Title: Self-powered Wireless Dual-mode Langasite Sensor for PressureTemperature Monitoring of Nuclear Reactors - The Research Foundation of State University...

  2. Microsoft Word - DOE-ID-14-072 Pittsburgh EC B3-6.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    2 SECTION A. Project Title: - High Spatial Resolution Distributed Fiber-Optic Sensor Network for Reactors and Fuel Cycle Systems - University of Pittsburgh SECTION B. Project...

  3. Microsoft Word - DOE-ID-11-021 - North Wind EC.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Laboratory (INL) facilities. SECTION C. Environmental Aspects Potential Sources of Impact Air Emissions - The proposed scope of work (SOW) requires the use of heavy...

  4. Microsoft Word - DOE-ID-15-027 Maryland EC B3-6.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    7 SECTION A. Project Title: Enhancement of the Extraction of Uranium from Seawater - University of Maryland SECTION B. Project Description The University of Maryland proposes to...

  5. Microsoft Word - DOE-ID-13-052 Chicago EC B3-6.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    2 SECTION A. Project Title: Development of Novel Porous Sorbents for Extraction of Uranium from Seawater - The University of Chicago SECTION B. Project Description The University...

  6. Microsoft Word - DOE-ID-12-017 Pittsburgh.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Safety Office. Many of the sources are of sufficiently low activity to be exempt from NRC license requirements. Sources that are not exempt are authorized under the terms of the...

  7. Microsoft Word - DOE-ID-12-016 Kansas State.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    uses for an existing program. The work related to the reactor core is covered by KSU's NRC license. SECTION D. Determine the Level of Environmental Review (or Documentation) and...

  8. Microsoft Word - DOE-ID-12-018 Texas.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Samples which are considered radioactive will be handled as required by the facility NRC andor Texas Department of State Health Services licenses. Radioactive Waste Generation...

  9. Microsoft Word - DOE-ID-12-023 Rensselaer - Ji.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    ready uses for an existing program. The work related to the reactor is covered by RPI's NRC license. SECTION D. Determine the Level of Environmental Review (or Documentation) and...

  10. Microsoft Word - DOE-ID-13-071 Hunter College EC B3-6.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    1 SECTION A. Project Title: Recovery of Uranium from Seawater: Polymer-Supported Aminophosphinates as Selective - Hunter College of the City University of New York SECTION B....

  11. Microsoft Word - DOE-ID-15-044 Wisconsin EC B3-6.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    of Wisconsin proposes to use an inherent feature of salt- and gas-cooled reactors towards the capture and removal of tritium from the primary coolant system: the presence...

  12. Microsoft Word - DOE-ID-14-080 South Florida EC B3-6.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    uranium "nano-traps" as well as the investigation of their performance on UO 2 2+ adsorption in the lab scale. Collaborators will engage in ambient seawater uranium adsorption...

  13. Microsoft Word - DOE-ID-14-052 Syracuse University EC B3-6.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    SECTION B. Project Description Syracuse University will perform R&D related to adsorption modeling for the separation and recovery of radioisotopic gases in the off-gas...

  14. Microsoft Word - DOE-ID-13-053 Woods Hole EC B3-16.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Uranium from Seawater: Studies under Real Ocean Conditions - Woods Hole Oceanographic ... and the best platform to expose, in high current regimes, these new fibers to the optimal ...

  15. Microsoft Word - DOE-ID-12-021 Virginia Tech.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    simulation, and visualization. This will be accomplished by acquiring a basic set of radiation detection instruments and sources along with a computer cluster and displays to...

  16. Microsoft Word - DOE-ID-13-086 New Mexico EC B3-6.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    The work is done with approval of the University Department of Safety and Risk Services, radiation safety office. The use of the detectors involves experiments at LANL using an...

  17. Microsoft Word - DOE-ID-13-064 Ohio State EC B3-6.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Material Use - Depleted uranium chloride up to 80 g will be utilized under the radiation safety protocol. This will be operated under the state license with an...

  18. Microsoft Word - DOE-ID-12-025 Ohio State.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    5 SECTION A. Project Title: Enhancement of Radiation Safety and Radiological Monitoring Systems for the Ohio State University Nuclear Reactor SECTION B. Project Description The...

  19. Microsoft Word - DOE-ID-11-008 Wisconsin - Allen EC.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Radioactive Material Use - All sample transfer and analysis is coordinated through the UW Radiation Safety Office through pre- approved protocols under the UW Radioactive Material...

  20. Microsoft Word - DOE-ID-14-029 VCU B1-31.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    but the X-ray machine is not designated a radioactive material. VCU's EH&S division's Radiation Safety Office will oversee installation and regulation of the device. The action...

  1. Microsoft Word - DOE-ID-12-028 Georgia Tech.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    glove box system, and activities can be expected to average a microcurie or lower. The Radiation Safety Office supports all laboratory operations. Waste management handles...

  2. Microsoft Word - DOE-ID-14-074 Arkansas EC B3-6.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    - All radioactive waste will be disposed according to procedures through the TAMU radiation safety office in the Environmental Health and Safety Division (EHSD). Mixed...

  3. Microsoft Word - DOE-ID-13-010 Kansas State B2-2.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    upgrades include: a new water radiation monitor to help detect failed fuel, a new primary water pump to replace the existing pump, and a new secondary water tank to replace the...

  4. Microsoft Word - DOE-ID-15-054 Pittsburgh EC B3-6.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Validation Data and Computational Models for Turbulent Mixing of Bypass and Coolant Jet flows in Gas-Cooled Reactors - University of Pittsburgh SECTION B. Project Description...

  5. Microsoft Word - DOE-ID-13-068 Washington State EC B3-6.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Description Washington State University, in collaboration with Idaho National Laboratory and CEA-Marcoule in France, proposes to develop improved approaches to...

  6. Microsoft Word - DOE-ID-13-025 Ohio State EC B3-6.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Chemical UseStorage - Chemical etchants will be used for routine sample preparations for metallographic analysis. Safety procedures for handling these chemicals and their storage...

  7. Microsoft Word - DOE-ID-11-001 John Hopkins EC.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    requirements of DOE orders; 2) require siting and construction or major expansion of waste storage, disposal, recovery, or treatment facilities; 3) disturb hazardous...

  8. Microsoft Word - DOE-ID-14-089 Westinghouse EC B3-6.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    9 SECTION A. Project Title: Development of Thermo-Acoustic Sensors for Sodium-cooled Fast Reactors - Westinghouse Electric Company LLC SECTION B. Project Description Westinghouse ...

  9. Microsoft Word - DOE-ID-13-042 Michigan EC B3-6.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Use - Two water tanks of 1.5m 3 each will be filled and used to conduct the experimental campaign. The water in the two tanks will be recirculated in the experimental loop. One...

  10. Microsoft Word - DOE-ID-12-040 ORNL EC B3-6.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    a novel in situ method established at ORNL to demonstrate materials with increased resistance to radiation and thermal degradation. In order to complete the project objectives,...

  11. Microsoft Word - DOE-ID-11-011 Michigan EC.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    1 SECTION A. Project Title: Acquisition of a 3 MV Tandem Accelerator for Research and Teaching in Nuclear Science and Engineering - University of Michigan SECTION B. Project...

  12. Microsoft Word - DOE-ID-13-070 Missouri EC B3-6.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    circulation. This will be accomplished by implementing in a novel way sophisticated measurement techniques that will measure simultaneously heat transfer coefficient from the...

  13. Microsoft Word - DOE-ID-INL-12-007_INL-12-033_.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    ... This is in accordance with the methods specified in the Rules for the Control of Air Pollution in Idaho (IDAPA Steps taken to control fugitive dust at the INL ...

  14. Microsoft Word - DOE-ID-13-033 NC State B1-31.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    3 SECTION A. Project Title: A Positron Generator System in Support of High Brightness Materials Characterization at the Pulstar Reactor - North Carolina State University SECTION B....

  15. Microsoft Word - DOE-ID-11-014 Missouri ST EC.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    4 SECTION A. Project Title: Upgrade of Missouri S&T Reactor for Distance Learning - Missouri University of Science and Technology SECTION B. Project Description Missouri S&T will...

  16. Microsoft Word - DOE-ID-13-001 General Atomics EC B3-6.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    1 SECTION A. Project Title: Development of ASTM Standard for SiC-SiC Joint Testing - General Atomics SECTION B. Project Description General Atomics (GA) proposes to develop an...

  17. Microsoft Word - DOE-ID-13-035 Penn State EC B3-6.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    or CERCLA-excluded petroleum and natural gas products that pre-exist in the environment such that there would be uncontrolled or unpermitted releases; 4) adversely affect...

  18. Microsoft Word - DOE-ID-15-080 Long Beach B3-6.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    the reaction kinetics for organic-phase radicals and the physiochemical properties of extraction ligands determined by their structural features. The proposed kinetic studies...

  19. Microsoft Word - DOE-ID-12-009 Colorado School of Mines.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    09 SECTION A. Project Title: Upgrades to the Colorado School of Mines Neutron Imaging Beam-Line SECTION B. Project Description The Colorado School Mines project has three...

  20. Microsoft Word - DOE-ID-13-049 Iowa State EC B3-6.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    inspection capabilities. To assess the effects of varying levels of conductivity in a fluid on the performance of both ultrasound and eddy-current transducers, a test cell will...

  1. 2011 Annual Planning Summary for Idaho Operations Office (ID) | Department

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    of Energy Idaho Operations Office (ID) 2011 Annual Planning Summary for Idaho Operations Office (ID) The ongoing and projected Environmental Assessments and Environmental Impact Statements for 2011 and 2012 within the Idaho Operations Office (ID) (See Environmental Management). PDF icon 2011 Annual Planning Summary for Idaho Operations Office (ID) More Documents & Publications 2010 Annual Planning Summary for Idaho Operations Office (ID) 2012 Annual Planning Summary for SLAC Site Office

  2. Microsoft Word - Flash2007-43.doc | Department of Energy

    Office of Environmental Management (EM)

    43.doc Microsoft Word - Flash2007-43.doc Microsoft Word - Flash2007-43.doc More Documents & Publications Microsoft Word - Policy Flash 2008-07.doc Microsoft Word - Policy Flash...

  3. Microsoft Word - AL2006-01.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    1.doc Microsoft Word - AL2006-01.doc PDF icon Microsoft Word - AL2006-01.doc More Documents & Publications Microsoft Word - al2005-06.doc Chapter 19 - Small Business Programs OPAM Policy Acquisition Guides

  4. Microsoft Word - AL2005-10.doc | Department of Energy

    Office of Environmental Management (EM)

    10.doc Microsoft Word - AL2005-10.doc PDF icon Microsoft Word - AL2005-10.doc More Documents & Publications Microsoft Word - AL2005-16.doc Audit Report: IG-0860 Microsoft Word - AL2006-08

  5. Requesting a Digital ID | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    a Digital ID Requesting a Digital ID S puzzle1.jpg tep One - Registering with the DOE's Management Information System (MIS) Before you request a DOE Digital Identity, you must register in DOE's Management Information System (MIS). Please note that DOE Federal employees are already registered and do not need to complete this step. The may skip to step two. During the registration process, you will be required to select a DOE sponsor. Your sponsor is the DOE employee who certifies that you have a

  6. Microsoft Word - Matrixpart1.doc | Department of Energy

    Broader source: (indexed) [DOE]

    Matrixpart1.doc More Documents & Publications Part 1, Clauses Prescribed in FAR Part 52 Microsoft Word - Matrixpart2.doc...

  7. csep_transcript_arlington.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Office document icon cseptranscriptarlington.doc More Documents & Publications Tools for Designing & Implementing Better Finance Programs financeprograms.doc financeprograms

  8. Microsoft Word - AL2002-03.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    2-03.doc Microsoft Word - AL2002-03.doc PDF icon Microsoft Word - AL2002-03.doc More Documents & Publications Microsoft Word - AL2005-01.doc Microsoft Word - FAL2004-01.doc Microsoft Word - ARRAAttachment12v1.doc

  9. Microsoft Word - AL2005-14.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    4.doc Microsoft Word - AL2005-14.doc PDF icon Microsoft Word - AL2005-14.doc More Documents & Publications Microsoft Word - AL-Omnibus FY 2009 Apr 22 2009 all sections.doc Microsoft Word - AL-Consolidated Approps FY 2008 as of feb 21 2008 final.doc Microsoft Word - AL2006-08.doc

  10. Microsoft Word - AL2007-01.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AL2007-01.doc Microsoft Word - AL2007-01.doc PDF icon Microsoft Word - AL2007-01.doc More Documents & Publications Microsoft Word - Rev5functionalaccountabilityimplementationplan..doc Microsoft Word - Corp Impl Microsoft Word - AL2006-11.doc

  11. csep_transcript_aspen.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    aspen.doc csep_transcript_aspen.doc csep_transcript_aspen.doc Microsoft Office document icon csep_transcript_aspen.doc More Documents & Publications highperformanceleasingstrategiesforstateandlocalgovernments.doc Using Social Media to Engage the Community in Energy Efficiency Projects.doc webinar_innovation_permitting_inspections

  12. csep_transcript_minneapolis.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    minneapolis.doc csep_transcript_minneapolis.doc csep_transcript_minneapolis.doc Microsoft Office document icon csep_transcript_minneapolis.doc More Documents & Publications newguideforcommunityenergystrategicplanning.doc csep_transcript_aspen.doc Marketing & Driving Demand: Social Media Tools & Strategies - January 16, 2011 (Text Version)

  13. Microsoft Word - FWP- Fact Sheet.doc | Department of Energy

    Office of Environmental Management (EM)

    FWP- Fact Sheet.doc Microsoft Word - FWP- Fact Sheet.doc PDF icon Microsoft Word - FWP- Fact Sheet.doc More Documents & Publications Microsoft Word - FOA cover sheet.doc Microsoft Word - Fact Sheet Energy Speech 082508 FINAL.doc Microsoft Word - ARRAAttachment12v1.doc

  14. Microsoft Word - ITSI award doc 06-D0008 conformed to P00001.doc |

    Office of Environmental Management (EM)

    Department of Energy ITSI award doc 06-D0008 conformed to P00001.doc Microsoft Word - ITSI award doc 06-D0008 conformed to P00001.doc More Documents & Publications Policy Flash 2015-02 Acquisition Letter No. AL 2015-01R - 06/01/2015 FOA 148 Amendment

  15. I.D I VI Figure

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    ~press - ,~,.--;~ 3.1 ,,~-.::;:.--- ~ ( 3.1 ( ;-; t\ I.D I VI Figure 9-1. Location of the original Cypress Grove Set-Aside and the Stave Island and Georgia Power replacement Areas. Set-Aside 9: Cypress Grove, Stave Island, and Georgia Power

  16. Ammendment 2.doc | Department of Energy

    Broader source: (indexed) [DOE]

    Ammendment 2.doc More Documents & Publications Attachment 6 Volume V Pricing Matrix for Optional Enhancements.xls&0; RFQ DE-RQ01-04ME90001.doc&0; Attachment 3-Past Performance...

  17. Microsoft Word - S06401_IC.doc

    Office of Legacy Management (LM)

    0 Doc. No. S06401 Page B-1 Annual Assessment of the Effectiveness of Site-Wide Institutional Controls U.S. Department of Energy Doc. No. S06401 June 2010 Page B-2 U.S. Department of Energy Annual Assessment of the Effectiveness of Site-Wide Institutional Controls June 2010 Doc. No. S06401 Page B-3 Annual Assessment of the Effectiveness of Site-Wide Institutional Controls U.S. Department of Energy Doc. No. S06401 June 2010

  18. Department of Energy Idaho - Inside DOE-ID

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Inside ID Inside Idaho Operations Office (DOE-ID) DOE-ID Mission and Vision Brief History of the Idaho National Laboratory (INL) DOE-ID Agreement in Principle Organization Chart Employment Opportunities New Employee Orientation EOD Checklist - 68 KB EOD Forms - 261 KB DOE/Tribal Agreement in Principle Strategic Partnership Projects (formerly WFO) Idaho Site Contractor Timeline - 3.7 MB ID@Work Introduces some of the DOE-ID employees and the jobs they perform. Last Updated: 05/21/2015

  19. Index2.doc | Department of Energy

    Energy Savers [EERE]

    Index2.doc Index2.doc PDF icon Index2.doc More Documents & Publications Sylvania Corporation, Hicksville, NY and Bayside, NY - Addendum to July 8, 2004 O:\HOMEPAGE\FOIA\report99.PDF&#0; U.S. Department of Energy 2004 Annual Report

  20. SubcontractingGuidelines.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    SubcontractingGuidelines.doc&#0; SubcontractingGuidelines.doc&#0; PDF icon SubcontractingGuidelines.doc&#0; More Documents & Publications Guidance of the Department of Energy Subcontracting Program Chapter 19 - Small Business Programs Business Opportunity Session Materials - December 14, 2011, Chicago

  1. AcqGuide39pt1.doc

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ... See their Home Page for more information or call them at (703) 306-6140. 13291 Security and Privacy The ...

  2. Policy Flash 2013-46 Awardee in STRIPES | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    6 Awardee in STRIPES Policy Flash 2013-46 Awardee in STRIPES Attached is Policy Flash 2013-46 Awardee in STRIPES This Flash will be available online at the following website: Questions concerning this policy flash should be directed to Ellen Colligan at (202) 287-1776 or of the Contract and Financial Assistance Policy Division, Office of Policy, Office of

  3. Facility Representative Program Outstanding at ID

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    June 19, 2007 Facility Representative Program Outstanding at ID Idaho's three DOE Complex-wide Facility Representative of the Year (FROTY) recipients at this year's conference pose for a photo shoot with Elvis. L to R: Dary Newbry 2005 FROTY, Bob Seal 2006 FROTY, Bob Knighten 2004 FROTY Facility representatives (FRs) are the eyes and ears of the federal government at the Idaho National Laboratory. They oversee the people, processes, facilities and systems that ensure safety at INL facilities.

  4. Microsoft Word - Mustering card.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Idaho Operations Office Employee Mustering The email based check in system should only be used by DOE ID Employees. (Use in descending order until successful) Call: 1-208-526-COOP (2667) 1-800-DOE-DOE1 Ext. 382 (1-800-363-3631 Ext. 382) Email:

  5. Facility Representative Program ID Selects FR of the Year

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Facility Representative Program ID Selects FR of the Year John Martin DOE-ID Facility Representative John Martin DOE-ID Facility Representative of the Year. John Martin was selected as DOE-ID's Facility Representative of the Year and the office's nominee for the 2007 DOE Facility Representative of the Year Award. John was selected from an exceptional field of candidates to represent DOE-ID at the Facility Representative Annual Workshop in Las Vegas this May. Each year the Department of Energy


    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    CHANGE IN ACCEPTABLE ID DOCUMENTS FOR JLAB ACCESS: The REAL ID Act (Public Law 109-13) now determines which state driver's license can be presented and accepted as a valid ID document for access to Jefferson Lab. The following states/US territories have been determined by the U.S. Department of Homeland Security to have failed to comply with the REAL ID Act: American Samoa, Illinois, Minnesota, Missouri, and Washington. As of March 2, 2015, Jefferson Lab will begin using the REAL ID Act

  7. Propagation of nonlinearly generated harmonic spin waves in microscopic stripes

    SciTech Connect (OSTI)

    Rousseau, O.; Yamada, M.; Miura, K.; Ogawa, S.; Otani, Y.


    We report on the experimental study of the propagation of nonlinearly generated harmonic spin waves in microscopic CoFeB stripes. Using an all electrical technique with coplanar waveguides, we find that two kinds of spin waves can be generated by nonlinear frequency multiplication. One has a non-uniform spatial geometry and thus requires appropriate detector geometry to be identified. The other corresponds to the resonant fundamental propagative spin waves and can be efficiently excited by double- or triple-frequency harmonics with any geometry. Nonlinear excited spin waves are particularly efficient in providing an electrical signal arising from spin wave propagation.

  8. AcqGuide38pt1.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    8pt1.doc&#0; AcqGuide38pt1.doc&#0; PDF icon AcqGuide38pt1.doc&#0; More Documents & Publications Microsoft Word - AcqGuide38pt Nov 2010 Microsoft Word - AL2005-05Revised.doc AL2007-03.doc&#0;

  9. AcqGuide41pt1.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    1pt1.doc&#0; AcqGuide41pt1.doc&#0; PDF icon AcqGuide41pt1.doc&#0; More Documents & Publications Chapter 41 - Acquisition of Utility Services AcqGuide70pt28.doc&#0; AcqGuide9pt1.doc&#0;

  10. Microsoft Word - AL2000-05.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    .doc Microsoft Word - AL2000-05.doc PDF icon Microsoft Word - AL2000-05.doc More Documents & Publications al99-06.doc&#0; Microsoft Word - AL2000-05Attachment.doc AL2004-01r2.pdf

  11. Microsoft Word - AL2004-02.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    4-02.doc Microsoft Word - AL2004-02.doc PDF icon Microsoft Word - AL2004-02.doc More Documents & Publications Microsoft Word - AL2005-02.doc Microsoft Word - al2005-04.doc Microsoft Word - AL-Omnibus FY 2009 Apr 22 2009 all sections

  12. Microsoft Word - AL2005-02.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    5-02.doc Microsoft Word - AL2005-02.doc PDF icon Microsoft Word - AL2005-02.doc More Documents & Publications Microsoft Word - AL-Omnibus FY 2009 Apr 22 2009 all sections.doc Microsoft Word - AL2004-02.doc Microsoft Word - AL-Consolidated Approps FY 2008 as of feb 21 2008 final

  13. Microsoft Word - AL2005-03.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    3.doc Microsoft Word - AL2005-03.doc PDF icon Microsoft Word - AL2005-03.doc More Documents & Publications Microsoft Word - AL2005-01.doc Microsoft Word - AL2006-08.doc Microsoft Word - Chapter 10_2006_Jun

  14. Microsoft Word - FAL2004-01.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    1.doc Microsoft Word - FAL2004-01.doc PDF icon Microsoft Word - FAL2004-01.doc More Documents & Publications Microsoft Word - FAL2004-03.doc Microsoft Word - FAL2004-02.doc Microsoft Word - FAL2003-03R

  15. csep_transcript_transportation.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    transportation.doc csep_transcript_transportation.doc csep_transcript_transportation.doc Microsoft Office document icon csep_transcript_transportation.doc More Documents & Publications csep_transcript_minneapolis.doc Marketing & Driving Demand: Social Media Tools & Strategies - January 16, 2011 (Text Version) Transcript: Biomass Clean Cities Webinar - Workforce Development

  16. Engaging Financial Institution Partners Transcript.doc | Department of

    Office of Environmental Management (EM)

    Energy Engaging Financial Institution Partners Transcript.doc Engaging Financial Institution Partners Transcript.doc Engaging Financial Institution Partners Transcript.doc Microsoft Office document icon Engaging Financial Institution Partners Transcript.doc More Documents & Publications Engaging Financial Institution Partners Transcript.doc Engaging Financial Institution Partners Case Studies-Financing Energy Improvements on Utility Bills

  17. Microsoft Word - PeerReview_SAR.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    SAR.doc Microsoft Word - PeerReview_SAR.doc PDF icon Microsoft Word - PeerReview_SAR.doc More Documents & Publications Microsoft Word - PeerReview_CCSP.doc Microsoft Word - Cross Reference Matrix Introduction.doc Assessment of the Effects of Climate Change on Federal Hydropower

  18. AL2007-05.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    7-05.doc&#0; AL2007-05.doc&#0; PDF icon AL2007-05.doc&#0; More Documents & Publications Microsoft Word - AL2006-08.doc Department of Energy Microsoft Word - AL2006-10.doc

  19. Microsoft Word - AL2005-01.doc | Department of Energy

    Office of Environmental Management (EM)

    1.doc Microsoft Word - AL2005-01.doc PDF icon Microsoft Word - AL2005-01.doc More Documents & Publications Microsoft Word - AL2006-08.doc Acquisition Letter Archive listing AL2007-05.doc&#0;

  20. Microsoft Word - AL2006-08.doc | Department of Energy

    Office of Environmental Management (EM)

    6-08.doc Microsoft Word - AL2006-08.doc PDF icon Microsoft Word - AL2006-08.doc More Documents & Publications AL2007-05.doc&#0; Microsoft Word - AL2005-14.doc Microsoft Word - AL2006-03

  1. Microsoft Word - FAL2004-03.doc | Department of Energy

    Office of Environmental Management (EM)

    FAL2004-03.doc Microsoft Word - FAL2004-03.doc PDF icon Microsoft Word - FAL2004-03.doc More Documents & Publications Microsoft Word - FAL2004-01.doc Financial Assistance Letters No. FAL 2006-04 Microsoft Word - FAL2006-04.doc

  2. Microsoft Word - toc.doc

    Office of Legacy Management (LM)

    I Ground Water Management Policy for the MMTS and Adjacent Areas U n c o n t r o l l e d c o p y U.S. Department of Energy Long-Term Surveillance and Maintenance Plan for the Monticello NPL Sites Rev. 0 Doc. No. S0038700 Rev. Date: June 25, 2007 Page I-3 U n c o n t r o l l e d c o p y Long-Term Surveillance and Maintenance Plan for the Monticello NPL Sites U.S. Department of Energy Doc. No. S0038700 Rev. 0 Page I-4 Rev. Date: June 25, 2007 U n c o n t r o l l e d c o p y U.S. Department of

  3. Microsoft Word - toc.doc

    Office of Legacy Management (LM)

    J Ground Water Remedy Performance Evaluation Plan U n c o n t r o l l e d c o p y U.S. Department of Energy Long-Term Surveillance and Maintenance Plan for Monticello NPL Sites Rev. 0 Doc. No. S0038700 Rev. Date: June 25, 2007 Page iii Contents Page J1.0 Plan Objective..................................................................................................................J-1 J2.0 Monitored Natural Attenuation Performance Evaluation Method...................................J-1 J2.1

  4. Mo Year Report Period: EIA ID NUMBER:

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mo Year Report Period: EIA ID NUMBER: Mailing Address: Secure File Transfer option available at: (e.g., PO Box, RR) Electronic Transmission: The PC Electronic Zip Code - Data Reporting Option (PEDRO) is available. If interested in software, call (202) 586-9659. Email form to: - - - - Fax form to: (202) 586-9772 Mail form to: Oil & Gas Survey Email address: U.S.

  5. SLAC Dosimeter / ID Request Form A

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Feb 2009 (updated 13 May 2010) SLAC-I-760-0A07J-006-R010 1 of 2 SLAC Dosimeter / ID Request Form A (For applicants who have completed SLAC Environment, Safety, and Health Training) Sections 1-5 completed by applicant. Section 1: Contact Information Last name: First name: MI: Male Female Birth year (yyyy): Job title: Contact information/mailing address: City: State: Zip code: Country: Dept/Group: Phone number: Mail stop: Users or non-SLAC employees only: List employer, company, or university :

  6. Airless drying -- Developments since IDS'94

    SciTech Connect (OSTI)

    Stubbing, T.J.


    Since its introduction to IDS'94 delegates, significant progress has been made with the development of airless drying technology. The ceramic industry internationally is beginning to benefit from both the energy use and drying time reductions it achieves, while on the basis of further theoretical work carried out since 1993 other industries, including the bioenergy sector, should also soon begin to exploit its advantages. As global warming becomes a reality and oil reserves decline, superheated steam drying and gasification of biomass will contribute to the mitigation of those problems.

  7. Edwin Parks (Doc) | Department of Energy

    Energy Savers [EERE]

    Edwin Parks (Doc) About Us Edwin Parks (Doc) Team Leader, Archives and Information Management Team Dr. Ed "Doc" Parks joined the Office of Legacy Management in September 2010, as a Program Analyst in the Records Management program. He provided ongoing analytical support for records and information programs, policies, procedures, plans, cost, and operational analyses. He now serves as LM's Program Records Official, the Authorizing Official and federal official accountable for the risk

  8. Associate Research Physicist (Post Doc, Experimental Research...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Post Doc, Experimental Research, NSTX-U, Radio Frequency Waves) Department: Research Staff: RM1 Requisition Number: 1500421 The Princeton Plasma Physics Laboratory (PPPL) seeks to...

  9. Microsoft Word - EODchecklist1.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    New Employee Orientation FORMS CHECKLIST EOD Date: Employee Name: Organization: HR Specialist: Phone Number: Admin Contact: Phone Number: New Employee Orientation Forms to be issued and collected by HR Orientation Team: FORM COMPLETE & SIGNED FORM NAME AND NUMBER Yes No Comments 1. Photo ID 2. Passport, Birth Certificate, or U.S. Citizenship Documents Bring on 1 st Day 3. Employment & Benefits forms listed below 1. Employee Information Form 2. Statement of Prior Federal Service - SF-144

  10. Property:NEPA TieredDoc | Open Energy Information

    Open Energy Info (EERE)

    TieredDoc Jump to: navigation, search Property Name NEPA TieredDoc Property Type Page This is a property of type Page. Pages using the property "NEPA TieredDoc" Showing 25 pages...

  11. Microsoft Word - AL2005-08.doc | Department of Energy

    Office of Environmental Management (EM)

    8.doc Microsoft Word - AL2005-08.doc Microsoft Word - AL2005-08.doc More Documents & Publications OPAM Policy Acquisition Guides Attachment FY2011-28 OPAM Microsoft Word -...

  12. Microsoft Word - FAC2005-19.doc | Department of Energy

    Office of Environmental Management (EM)

    FAC2005-19.doc Microsoft Word - FAC2005-19.doc Microsoft Word - FAC2005-19.doc More Documents & Publications Acquisitlon Letter No. AL 2008-06 AL2008-06.pdf fac2001-27.pdf...

  13. Microsoft Word - FAL2004-05.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Microsoft Word - FAL2004-05.doc Microsoft Word - FAL2004-05.doc Microsoft Word - FAL2004-05.doc More Documents & Publications Archived Financial Assistance Letters Microsoft Word -...

  14. Microsoft Word - FORM46002.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    2.doc Microsoft Word - FORM46002.doc Microsoft Word - FORM46002.doc More Documents & Publications DOE F 4600.2 ATTACHMENT FLASH 2011-46(6) Attachment FY2011-63 OPAM...

  15. Microsoft Word - AL2008-05.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Microsoft Word - AL2008-05.doc Microsoft Word - AL2008-05.doc Microsoft Word - AL2008-05.doc More Documents & Publications Microsoft Word - AL 2010-07 Acquistion Letters Remaining...

  16. Microsoft Word - AL2006-07.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    7.doc Microsoft Word - AL2006-07.doc PDF icon Microsoft Word - AL2006-07.doc More Documents & Publications OPAM Policy Acquisition Guides Personal Property Management Certification Brochure Microsoft Word - AL2005-07

  17. Microsoft Word - AL2008-05.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    8-05.doc Microsoft Word - AL2008-05.doc PDF icon Microsoft Word - AL2008-05.doc More Documents & Publications Department of Energy OPAM Policy Acquisition Guides Microsoft PowerPoint - Executive Order13423rbl

  18. Microsoft Word - May2009.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    May2009.doc Microsoft Word - May2009.doc PDF icon Microsoft Word - May2009.doc More Documents & Publications Special Resource Study/Environmental Assessment for Manhattan Project Sites, DOE/EA-1868 (September 2010) Microsoft Word - April06

  19. DOC-DOE Joint China Mission Statement | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Joint China Mission Statement DOC-DOE Joint China Mission Statement DOC-DOE Joint China Mission Statement PDF icon DOC-DOE Joint China Mission Statement More Documents &...

  20. Microsoft Word - al2006-12.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    al2006-12.doc Microsoft Word - al2006-12.doc PDF icon Microsoft Word - al2006-12.doc More Documents & Publications Department of Energy Special Report: DOE/IG-0934

  1. Microsoft Word - al95-06.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    06.doc Microsoft Word - al95-06.doc PDF icon Microsoft Word - al95-06.doc More Documents & Publications ppl970-1.pdf Audit Report: IG-0589 Inspection Report: INS-O-02-01

  2. Microsoft Word - CMPTemplate031307.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    CMPTemplate031307.doc Microsoft Word - CMPTemplate031307.doc PDF icon Microsoft Word - CMPTemplate031307.doc More Documents & Publications Chapter 42 - Contract Administration Chapter 71 - Review and Approval of Contract and Financial Assistance Actions Chapter 43 - Contract Modifications

  3. Operating Guidelines Appendix C D.DOC | Department of Energy

    Energy Savers [EERE]

    Operating Guidelines Appendix C D.DOC&0; Operating Guidelines Appendix C D.DOC&0; PDF icon Operating Guidelines Appendix C D.DOC&0; More Documents & Publications Operating...

  4. Microsoft Word - April06.doc | Department of Energy

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    April06.doc Microsoft Word - April06.doc PDF icon Microsoft Word - April06.doc More Documents & Publications Secretary Directs FPO to Prepare Strategic Plan Microsoft Word - August

  5. Microsoft Word - AL2006-11.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AL2006-11.doc Microsoft Word - AL2006-11.doc PDF icon Microsoft Word - AL2006-11.doc More Documents & Publications Subject: Cost and Price Analysis Subject: Cost and Price Analysis...

  6. Microsoft Word - GJPPGPracticesDraft.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    GJPPGPracticesDraft.doc Microsoft Word - GJPPGPracticesDraft.doc PDF icon Microsoft Word - GJPPGPracticesDraft.doc More Documents & Publications 1 DOE Purchase Card Policy Natural Oils - The Next Generation of Diesel Engine Lubricants?

  7. al99-06.doc | Department of Energy

    Broader source: (indexed) [DOE]

    .doc&#0; More Documents & Publications Microsoft Word - AL2000-05.doc AL2007-05.doc&#0; AL2004-01r2.pdf

  8. Microsoft Word - competitionincontractingguidev2.doc | Department of Energy

    Office of Environmental Management (EM)

    competitionincontractingguidev2.doc Microsoft Word - competitionincontractingguidev2.doc PDF icon Microsoft Word - competitionincontractingguidev2.doc More Documents & Publications AcqGuide 5.2-OPAM Microsoft Word - AG Chapter 6 1 Nov 2010 Competition Requirements

  9. Microsoft Word - ACQUISITION LETTER.doc | Department of Energy

    Office of Environmental Management (EM)

    ACQUISITION LETTER.doc Microsoft Word - ACQUISITION LETTER.doc PDF icon Microsoft Word - ACQUISITION LETTER.doc More Documents & Publications ACQUISITION LETTER DEAR Part 933 OPAM Policy Acquisition Guides Chapter 33 - Protests, Disputes and Appeals

  10. Microsoft Word - ARRAAttachment12v1.doc | Department of Energy

    Office of Environmental Management (EM)

    ARRAAttachment12v1.doc Microsoft Word - ARRAAttachment12v1.doc More Documents & Publications Microsoft Word - DRAFT CRB Interview Guidance.doc Microsoft Word - ARRAGuideAttachment10v1

  11. Microsoft Word - FORM46001.doc | Department of Energy

    Office of Environmental Management (EM)

    FORM46001.doc Microsoft Word - FORM46001.doc PDF icon Microsoft Word - FORM46001.doc More Documents & Publications DOE F 4600.1 Archived Financial Assistance Letters American Recovery and Reinvestment Act, Financial Assistance Award: 212 Degrees Consulting, LLC

  12. Operating Guidelines Appendix A B.DOC | Department of Energy

    Energy Savers [EERE]

    Operating Guidelines Appendix A B.DOC&#0; Operating Guidelines Appendix A B.DOC&#0; PDF icon Operating Guidelines Appendix A B.DOC&#0; More Documents & Publications Operating Guidelines Appendix C D.DOC&#0; 2 Jun 03 Roles and Responsibilities _CSO Highlighted_.doc&#0; DOE HR Guidebook 12_15_05.DOC&#0;

  13. Microsoft Word - PeerReview_SAR.doc | Department of Energy

    Energy Savers [EERE]

    & Publications Microsoft Word - PeerReviewCCSP.doc Microsoft Word - Cross Reference Matrix Introduction.doc Assessment of the Effects of Climate Change on Federal Hydropower...

  14. Microsoft Word - FOA cover sheet.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Microsoft Word - FOA cover sheet.doc Recovery Act, Office of the Biomass Program,Funding Opportunity Announcements Special Notice Microsoft Word - FOA cover sheet.doc...

  15. Experimental Evaluation of DOC Performance Using Secondary Fuel...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Evaluation of DOC Performance Using Secondary Fuel Injection Experimental Evaluation of DOC Performance Using Secondary Fuel Injection Poster presentation at the 2007 Diesel ...

  16. DOE EIR FM.doc | Department of Energy

    Office of Environmental Management (EM)

    EIR FM.doc PDF icon DOE EIR FM.doc More Documents & Publications Contractor Statement of Work (SOW) Template (for EIR) External Independent Review (EIR) Standard Operating...

  17. Design Potential of Metal Foil Substrates for Optimized DOC Performanc...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Potential of Metal Foil Substrates for Optimized DOC Performance Design Potential of Metal Foil Substrates for Optimized DOC Performance Poster presentation at the 2007 Diesel...

  18. RetTrendReport1205.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    PDF icon RetTrendReport1205.doc&0; More Documents & Publications Pension Plans for Contractor Workers April 1-10 comments.doc&0; POLICY GUIDANCE MEMORANDUM...

  19. Carry Emergency Contact Card with your Lab ID | Jefferson Lab

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Carry Emergency Contact Card with your Lab ID Jefferson Lab Emergency Manager, Tina Menefee, encourages all members of the Jefferson Lab community to carry their JLab emergency notification and reminder card with their lab ID. Put it on your ID lanyard or carry it in your wallet. The card (front and back pictured below) lists the primary numbers where emergencies, injuries, or any abnormal situation should be reported. The other side of the card provides guidance on reporting emergencies and

  20. RAPID/Roadmap/12-ID-a | Open Energy Information

    Open Energy Info (EERE)

    Contact Us State Biological Resource Considerations (12-ID-a) The Idaho Department of Fish & Game preserves wildlife against any direct take, including wild animals, birds, and...

  1. RAPID/Roadmap/8-ID-e | Open Energy Information

    Open Energy Info (EERE)

    ID-e < RAPID | Roadmap Jump to: navigation, search RAPID Regulatory and Permitting Information Desktop Toolkit BETA About Bulk Transmission Geothermal Hydropower Solar Tools...

  2. RAPID/Roadmap/3-ID-e | Open Energy Information

    Open Energy Info (EERE)

    ID-e < RAPID | Roadmap Jump to: navigation, search RAPID Regulatory and Permitting Information Desktop Toolkit BETA About Bulk Transmission Geothermal Hydropower Solar Tools...

  3. RAPID/Roadmap/14-ID-b | Open Energy Information

    Open Energy Info (EERE)

    RAPIDRoadmap14-ID-b < RAPID | Roadmap Jump to: navigation, search RAPID Regulatory and Permitting Information Desktop Toolkit BETA About Bulk Transmission Geothermal...

  4. RAPID/Roadmap/8-ID-a | Open Energy Information

    Open Energy Info (EERE)

    RAPIDRoadmap8-ID-a < RAPID | Roadmap Jump to: navigation, search RAPID Regulatory and Permitting Information Desktop Toolkit BETA About Bulk Transmission Geothermal Hydropower...

  5. RAPID/Roadmap/6-ID-b | Open Energy Information

    Open Energy Info (EERE)

    RAPIDRoadmap6-ID-b < RAPID | Roadmap Jump to: navigation, search RAPID Regulatory and Permitting Information Desktop Toolkit BETA About Bulk Transmission Geothermal Hydropower...

  6. RAPID/Roadmap/17-ID-a | Open Energy Information

    Open Energy Info (EERE)

    Contact Us Aesthetic Resource Assessment (17-ID-a) 17IDAAestheticResourceAssessment.pdf Error creating thumbnail: Page number not in range. Error creating thumbnail: Page number...

  7. RAPID/Roadmap/9-ID-a | Open Energy Information

    Open Energy Info (EERE)

    Environmental Review Process (9-ID-a) Add overview. 09IDAStateEnvironmentalProcess.pdf Error creating thumbnail: Page number not in range. Error creating thumbnail: Page number...

  8. RAPID/Roadmap/14-ID-c | Open Energy Information

    Open Energy Info (EERE)

    Geothermal Hydropower Solar Tools Contribute Contact Us Underground Injection Control Permit (14-ID-c) Rule 40 of the Idaho Department of Water Resources' Drilling for...

  9. RAPID/Roadmap/14-ID-d | Open Energy Information

    Open Energy Info (EERE)

    Permitting Information Desktop Toolkit BETA About Bulk Transmission Geothermal Hydropower Solar Tools Contribute Contact Us 401 Water Quality Certification (14-ID-d) IDEQ is...

  10. RAPID/Roadmap/3-ID-b | Open Energy Information

    Open Energy Info (EERE)

    Permitting Information Desktop Toolkit BETA About Bulk Transmission Geothermal Hydropower Solar Tools Contribute Contact Us State Land Access Overview (3-ID-b) If a project is...

  11. RAPID/Roadmap/14-ID-f | Open Energy Information

    Open Energy Info (EERE)

    Permitting Information Desktop Toolkit BETA About Bulk Transmission Geothermal Hydropower Solar Tools Contribute Contact Us 401 NPDES Water Quality Certification (14-ID-f) Idaho...

  12. RAPID/Roadmap/4-ID-a | Open Energy Information

    Open Energy Info (EERE)

    Permitting Information Desktop Toolkit BETA About Bulk Transmission Geothermal Hydropower Solar Tools Contribute Contact Us State Exploration Process (4-ID-a) 04IDAStateExploration...

  13. RAPID/Roadmap/11-ID-a | Open Energy Information

    Open Energy Info (EERE)

    Toolkit BETA About Bulk Transmission Geothermal Hydropower Solar Tools Contribute Contact Us State Cultural Considerations (11-ID-a) Idaho has a statute that provides state...

  14. RAPID/Roadmap/15-ID-b | Open Energy Information

    Open Energy Info (EERE)

    BETA About Bulk Transmission Geothermal Hydropower Solar Tools Contribute Contact Us Air Quality Permit - Tier II Operating Permit (15-ID-b) Tier II Operating Permits are...

  15. RAPID/Roadmap/15-ID-a | Open Energy Information

    Open Energy Info (EERE)

    BETA About Bulk Transmission Geothermal Hydropower Solar Tools Contribute Contact Us Air Quality Permit - Permit to Construct (15-ID-a) The Idaho Department of Environmental...

  16. RAPID/Roadmap/5-ID-a | Open Energy Information

    Open Energy Info (EERE)

    Geothermal Hydropower Solar Tools Contribute Contact Us Drilling and Well Development (5-ID-a) 05IDADrillingWellDevelopment.pdf Error creating thumbnail: Page number not in...

  17. DOE-ID FOIA Electronic Reading Room Documents

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Electronic Reading Room Documents Electronic Reading Room Documents The information contained here represents DOE-ID's responses to FOIA requests that have been or are likely to be...

  18. Temporary EPA ID Number Request | Open Energy Information

    Open Energy Info (EERE)

    Temporary EPA ID Number RequestLegal Abstract A developer that may "generate hazardous waste only from an episodic event" may instead apply for a temporary hazardous waste...

  19. Microsoft Word - toc.doc

    Office of Legacy Management (LM)

    Appendix A Monticello LTS&M Project Organization and Key Personnel U n c o n t r o l l e d c o p y U.S. Department of Energy Long-Term Surveillance and Maintenance Plan for the Monticello NPL Sites Rev. 0 Doc. No. S0038700 Rev. Date: June 25, 2007 Page A-3 Utah Department of Transportation City of Monticello Monticello LM Representativ e Contractor General Manager Monticello LM Task Order Manager DOE Office of Legacy Managem ent Director U.S. EPA Region VIII Utah Departm ent of Environm

  20. Microsoft Word - toc.doc

    Office of Legacy Management (LM)

    B Document Control and Records Management Procedures U n c o n t r o l l e d c o p y U.S. Department of Energy Long-Term Surveillance and Maintenance Plan for the Monticello NPL Sites Rev. 0 Doc. No. S0038700 Rev. Date: June 25, 2007 Page B-3 B1.0 Document Control and Records Management Procedures Administrative procedures have been developed to define responsibilities, establish documentation and change control requirements, and employ standard work processes in implementing the monitoring,

  1. Microsoft Word - toc.doc

    Office of Legacy Management (LM)

    F Radiological Survey Procedures U n c o n t r o l l e d c o p y U.S. Department of Energy Long-Term Surveillance and Maintenance Plan for the Monticello NPL Sites Rev. 0 Doc. No. S0038700 Rev. Date: June 25, 2007 Page F-3 F.1 Radiological Survey Procedures This section describes the actions and method used by the Monticello Legacy Management (LM) Representative when conducting radiological surveys for the purpose of identifying radiologically contaminated material and determining the Radium-226

  2. Microsoft Word - toc.doc

    Office of Legacy Management (LM)

    G Uranium Scanning Procedure U n c o n t r o l l e d c o p y U.S. Department of Energy Long-Term Surveillance and Maintenance Plan for the Monticello NPL Sites Rev. 0 Doc. No. S0038700 Rev. Date: June 25, 2007 Page G-3 Uranium Scanning Procedure for Property MP-00211 1. Select a Ludlum Model 12 ratemeter with a 44-9 pancake Geiger-Mueller beta-gamma detector or equivalent instrument capable of meeting detection limit criteria. 2. Check that the ratemeter and the detector have calibration

  3. Microsoft Word - toc.doc

    Office of Legacy Management (LM)

    Appendix H Procedures for the Transportation of Radioactive Materials U n c o n t r o l l e d c o p y U.S. Department of Energy Long-Term Surveillance and Maintenance Plan for the Monticello NPL Sites Rev. 0 Doc. No. S0038700 Rev. Date: June 25, 2007 Page H-3 H1.0 Purpose The purpose of this procedure is to ensure that radioactive material is transported (1) using best management practices, (2) in compliance with U.S. Department of Transportation (DOT) requirements, and (3) with minimal risk to

  4. Microsoft Word - Appendix N_Historical.doc

    Office of Legacy Management (LM)

    N Example Historical Marker and Plaque U.S. Department of Energy Weldon Spring Site LTS&M Plan July 2005 Doc. No. S0079000 Page N-3 Weldon Spring Site LTS&M Plan U.S. Department of Energy Doc. No. S0079000 July 2005 Page N-4

  5. Microsoft Word - toc.doc

    Office of Legacy Management (LM)

    K MMTS and MVP Site Inspection Checklists U n c o n t r o l l e d c o p y MMTS Annual Inspection Checklist U n c o n t r o l l e d c o p y MMTS Annual Inspection Checklist Page 1 of 38 I. MMTS Site Information Site name: Monticello Mill Tailings (USDOE) Site; Operable Units I, II, and III Date of inspection: Site Location: Monticello, Utah: EPA Region 8 EPA ID: UT 3890090035 Lead Agency: U.S. Department of Energy Office of Legacy Management (DOE-LM) PCOR Date: September 2004 Operational and

  6. Microsoft Word - CXPosticp10001.doc

    Office of Environmental Management (EM)

    IDAHO NATIONAL LABORATORY Page 1 of 2 CX Posting No.: DOE-ID-ICP-10-001 SECTION A. Project Title: MFC - EBR-II Sodium Removal/RCRA Closure Activities SECTION B. Project Description The proposed action will remove the sodium from the Experimental Breeder Reactor (EBR)-II piping system and tanks to achieve clean-closure for eventual decommissioning, deactivation and demolition (DD&D). The clean-closure will be completed in compliance with the EBR-II Hazardous Waste Management Act/Resource

  7. Striped Bass Spawning in Non-Estuarine Portions of the Savannah River

    SciTech Connect (OSTI)

    Martin, D.; Paller, M.


    Historically, the estuarine portions of the Savannah River have been considered to be the only portion of the river in which significant amounts of striped bass (Morone saxatilis) spawning normally occur. A reexamination of data from 1983 through 1985 shows a region between River Kilometers 144 and 253 where significant numbers of striped bass eggs and larvae occur with estimated total egg production near that currently produced in the estuarine reaches. It appears possible that there are two separate spawning populations of striped bass in the Savannah River.

  8. DOE - Office of Legacy Management -- Lowman Mill Site - ID 01

    Office of Legacy Management (LM)

    Lowman Mill Site - ID 01 FUSRAP Considered Sites Site: Lowman Mill Site (ID.01) Designated Name: Alternate Name: Location: Evaluation Year: Site Operations: Site Disposition: Radioactive Materials Handled: Primary Radioactive Materials Handled: Radiological Survey(s): Site Status: Also see Lowman, Idaho, Disposal Site Documents Related to Lowman Mill Site

  9. Microsoft Word - Append E waterlevels.doc

    Office of Legacy Management (LM)

    Groundwater Level Data Since 2000 This page intentionally left blank Groundwater Levels a ______________________________________________________________________________________________________ a Numbers in parentheses indicate elevation of bottom of well for dry measurements. ______________________________________________________________________________________________________ Well Id Collect Depth to Water Well Id Collect Depth to Water Date Water Elevation Date Water Elevation

  10. Microsoft Word - AL2000-01.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AL2000-01.doc Microsoft Word - AL2000-01.doc PDF icon Microsoft Word - AL2000-01.doc More Documents & Publications AL/FAL 99-01 Department of Energy No Microsoft Word - al2005-04.doc

  11. Microsoft Word - AL2005-11.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    11.doc Microsoft Word - AL2005-11.doc PDF icon Microsoft Word - AL2005-11.doc More Documents & Publications Audit Report: OAS-L-13-08 Microsoft Word - AL2005-12.doc CHAPTER 7 FINANCIAL MANAGEMENT

  12. AcqGuide42pt3.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    2pt3.doc&#0; AcqGuide42pt3.doc&#0; PDF icon AcqGuide42pt3.doc&#0; More Documents & Publications Chapter 42 - Contract Administration AcqGuide9pt2.doc&#0; Chapter 9 - Contracting Qualifications

  13. AcqGuide47pt1.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    7pt1.doc&#0; AcqGuide47pt1.doc&#0; PDF icon AcqGuide47pt1.doc&#0; More Documents & Publications Chapter 47 - Transportation TEC Working Group Topic Groups Manual Review Key Documents AcqGuide3pt1.doc&#0;

  14. AcqGuide9pt1.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    pt1.doc&#0; AcqGuide9pt1.doc&#0; PDF icon AcqGuide9pt1.doc&#0; More Documents & Publications Chapter 9 - Contracting Qualifications AcqGuide3pt1.doc&#0; OPAM Policy Acquisition Guides

  15. AcqGuide9pt2.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    pt2.doc&#0; AcqGuide9pt2.doc&#0; PDF icon AcqGuide9pt2.doc&#0; More Documents & Publications Chapter 9 - Contracting Qualifications Audit Report: IG-0432 AcqGuide42pt3.doc&#0;

  16. Microsoft Word - al2005-04.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    al2005-04.doc Microsoft Word - al2005-04.doc PDF icon Microsoft Word - al2005-04.doc More Documents & Publications AL2005-04ClassDeviation.pdf Microsoft Word - Matrixpart2.doc 2014-02 Acquistion Letter 2014-01: Management and Operating Contractors' Audit Coverage of Cost-Reimbursement Subcontracts

  17. Microsoft Word - al2005-06.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    al2005-06.doc Microsoft Word - al2005-06.doc PDF icon Microsoft Word - al2005-06.doc More Documents & Publications Microsoft Word - AL2006-01.doc OPAM Policy Acquisition Guides Acquisition Letter: AL2005-08

  18. Microsoft Word - 99-04.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    9-04.doc Microsoft Word - 99-04.doc PDF icon Microsoft Word - 99-04.doc More Documents & Publications Policy Flash 2014-18 Complex-Wide Strategic Sourcing Microsoft Word - AL2000-01.doc Microsoft Word - AL2005-1

  19. Microsoft Word - AL2005-16.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    6.doc Microsoft Word - AL2005-16.doc PDF icon Microsoft Word - AL2005-16.doc More Documents & Publications Microsoft Word - AL2005-10.doc Policy Flash 2013-33 Department of Energy Order 206.2 Identity, Credential and Access Managment (ICAM) Audit Report: IG-0860

  20. Microsoft Word - AL2006-03.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    3.doc Microsoft Word - AL2006-03.doc PDF icon Microsoft Word - AL2006-03.doc More Documents & Publications Microsoft Word - AL2006-02.doc Archived Financial Assistance Letters Financial Assistance Letters No. FAL 2006-04

  1. Microsoft Word - AL2006-09.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    9.doc Microsoft Word - AL2006-09.doc PDF icon Microsoft Word - AL2006-09.doc More Documents & Publications Microsoft PowerPoint - Executive Order13423rbl Sample Contract Language for Construction Using Energy-Efficient Products AL2007-05.doc&#0;

  2. AcqGuide39pt1.doc | Department of Energy

    Energy Savers [EERE]

    9pt1.doc&#0; AcqGuide39pt1.doc&#0; PDF icon AcqGuide39pt1.doc&#0; More Documents & Publications Chapter 39 - Acquisition of Information Technology AcqGuide38pt1.doc&#0; Microsoft Word - AcqGuide16pt1 Nov 2010

  3. Microsoft Word - AL2005-12.doc | Department of Energy

    Energy Savers [EERE]

    2.doc Microsoft Word - AL2005-12.doc PDF icon Microsoft Word - AL2005-12.doc More Documents & Publications Acquisition Letter No. AL 2012-05 Microsoft Word - AL2005-11.doc OPAM Policy Acquisition Guides

  4. Microsoft Word - FAL2006-03.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    FAL2006-03.doc Microsoft Word - FAL2006-03.doc PDF icon Microsoft Word - FAL2006-03.doc More Documents & Publications Financial Assistance Letter No. FAL 2006-03 Microsoft Word - FAL2006-03.doc For-Profit Audit Guidance (FY 2010)

  5. Microsoft Word - PART 970.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    PART 970.doc Microsoft Word - PART 970.doc PDF icon Microsoft Word - PART 970.doc More Documents & Publications Searchable Electronic Department of Energy Acquisition Regulation Microsoft Word - Matrixpart2.doc AcqGuide70.52Matrixpart2Redo-OPAM

  6. Microsoft Word - PeerReview_CCSP.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    CCSP.doc Microsoft Word - PeerReview_CCSP.doc PDF icon Microsoft Word - PeerReview_CCSP.doc More Documents & Publications Microsoft Word - PeerReview_SAR.doc EIS-0402: Advance Notice of Intent to Prepare an Environmental Impact Statement URTAC Meeting - January 2008

  7. Microsoft Word - al2007-11.doc | Department of Energy

    Office of Environmental Management (EM)

    al2007-11.doc Microsoft Word - al2007-11.doc PDF icon Microsoft Word - al2007-11.doc More Documents & Publications Acquisition Letter: AL2005-08 Microsoft Word - al2004-03.doc OPAM Policy Acquisition Guides

  8. Microsoft Word - AL2003-04.doc | Department of Energy

    Office of Environmental Management (EM)

    3-04.doc Microsoft Word - AL2003-04.doc PDF icon Microsoft Word - AL2003-04.doc More Documents & Publications Microsoft Word - AL2006-08.doc AL2004-01r2.pdf City of Tulare Renewable Biogas Fuel Cell Project

  9. Microsoft Word - AL2005-07.doc | Department of Energy

    Office of Environmental Management (EM)

    07.doc Microsoft Word - AL2005-07.doc PDF icon Microsoft Word - AL2005-07.doc More Documents & Publications Microsoft Word - AL2006-07.doc OPAM Policy Acquisition Guides Microsoft Word - 1_2011_CEG_Update_v2

  10. Microsoft Word - CERFDOE Final Report - 071204.doc | Department of Energy

    Office of Environmental Management (EM)

    CERFDOE Final Report - 071204.doc Microsoft Word - CERFDOE Final Report - 071204.doc PDF icon Microsoft Word - CERFDOE Final Report - 071204.doc More Documents & Publications Integrated Project Team RM DOE EIR FM.doc Independent Oversight Activity Report, Hanford Sludge Treatment Project - September 2013

  11. Microsoft Word - DOETTQuestions.doc | Department of Energy

    Office of Environmental Management (EM)

    DOETTQuestions.doc Microsoft Word - DOETTQuestions.doc PDF icon Microsoft Word - DOETTQuestions.doc More Documents & Publications Microsoft Word - 73FR72036_UC signed 1&#0; Microsoft Word - SRNL Fed Register Response.doc Subcontractor Rights Under CRADAs and WFO Agreements

  12. Microsoft Word - FAL2006-04.doc | Department of Energy

    Office of Environmental Management (EM)

    FAL2006-04.doc Microsoft Word - FAL2006-04.doc PDF icon Microsoft Word - FAL2006-04.doc More Documents & Publications Financial Assistance Letters No. FAL 2006-04 Microsoft Word - AL2006-03.doc Microsoft Word - FAL2004-01

  13. Microsoft Word - Federal Register Response _Jan09_.doc | Department of

    Office of Environmental Management (EM)

    Energy Federal Register Response _Jan09_.doc Microsoft Word - Federal Register Response _Jan09_.doc PDF icon Microsoft Word - Federal Register Response _Jan09_.doc More Documents & Publications Microsoft Word - Document2 Microsoft Word - Intellectual Property Provisions _NRD-1003_.doc Microsoft Word - SRNL Fed Register Response

  14. Microsoft Word - Final Sample Participant Profile November 2008.doc |

    Office of Environmental Management (EM)

    Department of Energy Final Sample Participant Profile November 2008.doc Microsoft Word - Final Sample Participant Profile November 2008.doc More Documents & Publications Microsoft Word - ARRAAttachment12v1.doc Microsoft Word - Fact Sheet Energy Speech 082508 FINAL.doc Microsoft Word - DRAFT CRB Interview Guidance

  15. Microsoft Word - MitigationsForVulnerabilitiesInCSNetworks.doc

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Idaho National Laboratory Idaho Falls, ID 83415 Idaho Falls, ID 83415 Kathy Lee ... vulnerabilities include balancing the risk of system compromise by an intruder with ...

  16. Magnetic properties on the surface of FeAl stripes induced by nanosecond pulsed laser irradiation

    SciTech Connect (OSTI)

    Kaiju, H. Kondo, K.; Ishibashi, A.; Yoshida, Y.; Watanabe, S.; Yoshimi, K.


    We demonstrate the formation of magnetic nanostripes on the surface of Fe{sub 52}Al{sub 48} induced by nanosecond pulsed laser irradiation and investigate their magnetic properties. The magnetic stripe consists of a disordered A2 phase of Fe-Al alloys with Al-oxide along the [110] direction on the (111)-oriented plane. According to the focused magneto-optical Kerr effect measurement, the coercive force of the magnetic stripe obeys the 1/cos?? law, where ? is the field rotation angle estimated from the stripe direction. Also, the jump field can be observed in the magnetic hysteresis loop. These results indicate that the magnetization reversal in the magnetic stripe originates from the domain pinning, showing that the magnetization rotates incoherently.

  17. The Role of Stripes in Superconducting Behavior | U.S. DOE Office of

    Office of Science (SC) Website

    Science (SC) The Role of Stripes in Superconducting Behavior Basic Energy Sciences (BES) BES Home About Research Facilities Science Highlights Benefits of BES Funding Opportunities Basic Energy Sciences Advisory Committee (BESAC) Community Resources Contact Information Basic Energy Sciences U.S. Department of Energy SC-22/Germantown Building 1000 Independence Ave., SW Washington, DC 20585 P: (301) 903-3081 F: (301) 903-6594 E: Email Us More Information » 09.01.13 The Role of Stripes in

  18. Id-1 and Id-2 genes and products as therapeutic targets for treatment of breast cancer and other types of carcinoma

    DOE Patents [OSTI]

    Desprez, Pierre-Yves; Campisi, Judith


    A method for treatment and amelioration of breast, cervical, ovarian, endometrial, squamous cells, prostate cancer and melanoma in a patient comprising targeting Id-1 or Id-2 gene expression with a delivery vehicle comprising a product which modulates Id-1 or Id-2 expression.

  19. AcqGuide70pt31.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    pt31.doc&#0; AcqGuide70pt31.doc&#0; PDF icon AcqGuide70pt31.doc&#0; More Documents & Publications Microsoft Word - AcqGuide70pt31A.doc Policy Flash 2014-26 Acquisition Guide Chapter 70.31A - Costs Associated with Whistleblower Actions Microsoft Word - AcqGuide70pt31B.doc

  20. leveraging_partnerships_with_faith-based_organizations.doc | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy leveraging_partnerships_with_faith-based_organizations.doc leveraging_partnerships_with_faith-based_organizations.doc leveraging_partnerships_with_faith-based_organizations.doc Microsoft Office document icon leveraging_partnerships_with_faith-based_organizations.doc More Documents & Publications Leveraging Partnerships with Faith-Based Organizations Outreach to Faith--Based Organizations Using Social Media to Engage the Community in Energy Efficiency Projects.doc

  1. Microsoft Word - Clay Memo PMC Coburn Obama 11_9_06.doc | Department...

    Office of Environmental Management (EM)

    Clay Memo PMC Coburn Obama 11906.doc Microsoft Word - Clay Memo PMC Coburn Obama 11906.doc Microsoft Word - Clay Memo PMC Coburn Obama 11906.doc More Documents & Publications...

  2. Microsoft Word - TSLCC 2007_5_05_08 rev 1.doc | Department of...

    Office of Environmental Management (EM)

    TSLCC 200750508 rev 1.doc Microsoft Word - TSLCC 200750508 rev 1.doc Microsoft Word - TSLCC 200750508 rev 1.doc More Documents & Publications FY 2007 Total System Life...

  3. Form:NEPA Doc | Open Energy Information

    Open Energy Info (EERE)

    NEPA Doc Jump to: navigation, search Input the name of a NEPA Document below. If the document already exists, you will be able to edit its information. AddEdit a NEPA Document...

  4. JLab Registration/International Services - Researcher/Visitor ID

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Requirements Researcher/Visitor ID Requirements CHANGE IN ACCEPTABLE ID DOCUMENTS FOR JLAB ACCESS U.S. Citizens must bring a valid Government issued ID card that contains a photo such as a passport or valid driver's license. Non-driver photo identification cards issued by the Department of Motor Vehicles can be used as proof of identification. Lawful Permanent Resident of the United States must bring their Green Card or passport with valid I-551 stamp AND a valid government issued

  5. Poster - DOE Data ID Service | OSTI, US Dept of Energy, Office...

    Office of Scientific and Technical Information (OSTI)

    ID Service Document Files and References Available Downloads for this Document: applicationpdf icon Poster DOE Data ID Service Last updated on Tuesday 22 December...

  6. RAPID/Roadmap/18-ID-b | Open Energy Information

    Open Energy Info (EERE)

    demonstrate insurance coverage that would protect the community from incurring clean-up costs in the event of the developer's insolvency. 18-ID-b.5 - Facility siting license...

  7. RAPID/Roadmap/6-ID-c | Open Energy Information

    Open Energy Info (EERE)

    Tools Contribute Contact Us Drinking Water Permit (6-ID-c) 06IDCDrinkingWaterPermit.pdf Error creating thumbnail: Page number not in range. Error creating thumbnail: Page number...

  8. RAPID/Roadmap/7-ID-a | Open Energy Information

    Open Energy Info (EERE)

    Contact Us Power Plant Siting Process (7-ID-a) 07IDAPowerPlantSitingConstruction.pdf Error creating thumbnail: Page number not in range. Error creating thumbnail: Page number...

  9. RAPID/Roadmap/13-ID-a | Open Energy Information

    Open Energy Info (EERE)

    Contribute Contact Us State Land Use Assessment (13-ID-a) 13IDALandUseAssessment.pdf Error creating thumbnail: Page number not in range. Error creating thumbnail: Page number...

  10. RAPID/Roadmap/6-ID-a | Open Energy Information

    Open Energy Info (EERE)

    load A load is overlegal if the load is: width over 8'6"; Over 14' tall; Truck and trailer combined are over 75' long; or The load weighs over 80,000 pounds. 6-ID-a.2 - Meet...

  11. RAPID/Roadmap/19-ID-a | Open Energy Information

    Open Energy Info (EERE)

    to 19-ID-a.5 - Is a Change in Point of Diversion, Place of Use, Period of Use, or Nature of Use Needed for an Existing Water Right If the proposed activity will require a...

  12. RAPID/Roadmap/3-ID-a | Open Energy Information

    Open Energy Info (EERE)

    the IDL becomes involved only if they are notified and the Land Board requests their involvement. 3-ID-a.3 - Consultation (optional) IDL may meet with any other state agency to...

  13. Beamline 4-ID-C | Advanced Photon Source

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    C 4-ID-C Home Recent Publications XSD-MM Home MM Advisory Committees FAQs Beamline Info Instrumentation Magnet Materials Internal Useful Links Current APS status ESAF System GUP...

  14. Employee Assistance Self-ID Form | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Form-HQ PDF icon Employee Assistance Self-ID Form More Documents & Publications DOE HQ Special Needs Assistance in an Emergency DOE Emergency Special Needs Self-Identification...

  15. RAPID/Roadmap/3-ID-d | Open Energy Information

    Open Energy Info (EERE)

    Toolkit BETA About Bulk Transmission Geothermal Hydropower Solar Tools Contribute Contact Us Land Use Permit (3-ID-d) The Idaho Department of Lands issues Land Use Permits for...

  16. T-642: RSA SecurID update to Customers

    Broader source: [DOE]

    RSA investigation has revealed that the attack resulted in certain information being extracted from RSA's systems. Some of that information is related to RSA's SecurID two-factor authentication products

  17. Microsoft Word - DOE-ID-INL-15-070.docx

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    DOE-ID-INL-15-070 excluded petroleum and natural gas products that pre-exist in the environment such that there would be uncontrolled or unpermitted releases; (4) have the...

  18. Vermont Hazardous Waste Handler Site ID Form | Open Energy Information

    Open Energy Info (EERE)

    to library Legal Document- Permit ApplicationPermit Application: Vermont Hazardous Waste Handler Site ID FormLegal Abstract This form is used to notify the Vermont Agency of...

  19. NERSC Helps Physicists ID New Molecules With Unique Features

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    NERSC Helps Physicists ID New Molecules With Unique Features NERSC Helps Physicists ID New Molecules With Unique Features Hollow magnetic cage molecules may have applications in technology, healthcare August 10, 2013 NERSC supercomputing resources helped Virginia Commonwealth University (VCU) researchers determine it may be possible to create large, hollow magnetic cage molecules that could be used in medicine as a drug delivery system to noninvasively treat tumors and in other emerging

  20. Physicists ID Mechanism that Stabilizes Plasma in Tokamaks

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Physicists ID Mechanism that Stabilizes Plasma in Tokamaks Physicists ID Mechanism that Stabilizes Plasma in Tokamaks Calculations Run at NERSC Create 3D Simulations of Fusion Plasmas January 4, 2016 Contact: Kathy Kincade,, +1 510 495 2124 jardinfusion A cross-section of the virtual plasma showing where the magnetic field lines intersect the plane. The central section has field lines that rotate exactly once. Image: Stephen Jardin A team of physicists led by Stephen Jardin of

  1. Microsoft Word - DOE-ID-12-033 Nebraska EC B3-6 B3-10.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    3 SECTION A. Project Title: Radiation tolerance and mechanical properties of nanostructured ceramic/metal composites - University of Nebraska SECTION B. Project Description This project will consist of studying the ion irradiation and mechanical response of amorphous Si-C-O and Si-Al-C-O alloys, understanding the role of amorphous-ceramic/metal interface on irradiation and mechanical properties, and evaluating structural integrity and overall mechanical performance of the composite under extreme

  2. Microsoft Word - DOE-ID-12-035 BNL EC B3-6 B3-10.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    5 SECTION A. Project Title: Radiation-induced ductility enhancement in amorphous Fe and Al2O3+TiO2 nanostructured coatings in fast neutron and high temperature environments of next generation reactors - Brookhaven National Laboratory SECTION B. Project Description The effects of fast neutrons on the nanostructured coatings deposited on steel alloy and titanium alloy substrates will be studied with particular focus on ductility restoration and the influence of temperature. Irradiated specimens

  3. Microsoft Word - DOE-ID-12-039 ORNL EC B3-6 B3-10.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    9 SECTION A. Project Title: Accelerated development of Zr-containing new generation FM steels for advanced nuclear reactors - Oak Ridge National Laboratory SECTION B. Project Description The objective of this project is to develop a new generation of Zr-containing FM steels with enhanced high-temperature performance comparable to those of the ODS ferritic steels but still fit within the scope of conventional economic steel production methods. This is accomplished primarily by designing and

  4. Microsoft Word - DOE-ID-12-043 UC-Davis EC B3-6[1].doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    3 SECTION A. Project Title: Study of intermetallic nanostructures for light-water reactor materials - Regents of the University of California SECTION B. Project Description This project will investigate if intermetallic coherent particles can be used to remove the radiation damage from the matrix in material to create a radiation tolerant structural material. It is the aim of this proposal to perform systematic experimental and computational investigations to understand the role of the

  5. Microsoft Word - DOE-ID-13-043 Michigan EC B3-6 B1-31.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    3 SECTION A. Project Title: High Fidelity Ion Beam Simulation of High Dose Neutron Irradiation - University of Michigan SECTION B. Project Description The University of Michigan proposes to demonstrate the capability to predict the evolution of microstructure and properties of structural materials in-reactor and at high doses, using ion irradiation as a surrogate for reactor irradiations. Tasks within this proposal include expansion of capabilities at the Michigan Ion Beam Laboratory, ion beam

  6. Microsoft Word - DOE-ID-13-058 Iowa St S&T EC B3-6.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    8 SECTION A. Project Title: In-pile Thermal Conductivity Characterization with Time Resolved Raman- Iowa State University of Science and Technology SECTION B. Project Description Iowa State University of Science and Technology proposes to study thermal conductivity to understand the behavior predict the performance of the nuclear fuel system at a microstructural level. Objectives include: 1. Develop a novel time resolved Raman technology for a direct measurement of fuel and cladding thermal

  7. Microsoft Word - DOE-ID-14-037 Ohio State University _2 EC B3-6.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    7 SECTION A. Project Title: Rare Earth Electrochemical Property Measurements and Phase Diagram Development in a Complex Molten Slat Mixture for Molten Salt Recycling - Ohio State University SECTION B. Project Description The research activities consist of conducting fundamental data measurements and phase diagram development for rare earths in complex molten salts for applications to development of rare earth drawdown electrolysis for molten salt recycle. The primary goal of the proposed

  8. Microsoft Word - DOE-ID-14-038 Ohio State University _4 EC B3-6.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    8 SECTION A. Project Title: Experimental Investigation and CFD Analysis of Steam Ingress Accidents in HTGRs - Ohio State University SECTION B. Project Description Ohio State University The goal of the proposed research is to better understand steam ingress phenomenon in High-Temperature Gas Reactors. The specific objectives are to: 1. Experimentally investigate steam ingress accidents caused by a postulated SG tube rupture initiating event, focusing on the integral effects of both the

  9. Microsoft Word - DOE-ID-14-039 Oregon State University _1 EC B3-6.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    39 SECTION A. Project Title: Fluid Stratification Separate Effects Analysis, Testing, and Benchmarking- Oregon State University SECTION B. Project Description Oregon State University will perform research to experimentally characterize, in a scaled separate effects test facility, the role of stratified flow as it contributes to the air-ingress accident related to a high-temperature gas reactor. Thus the study has the following scope: 1. Implement scaling analysis to preserve the dominant

  10. Microsoft Word - DOE-ID-14-041 Oregon State University _2 EC B3-6.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    1 SECTION A. Project Title: Imagining a Dry Storage Cask with Cosmic Ray Muons- Oregon State University SECTION B. Project Description Oregon State University will build a prototype system for monitoring spent nuclear fuel dry storage casks (DSCs) using cosmic ray muon imaging technique. Such a system will have the capability of verifying and measuring the content inside a DSC without opening it. This proposal has six major tasks: i) a literature survey on the current state-of-knowledge related

  11. Microsoft Word - DOE-ID-14-044 Georgia Institute of Tech_3 EC B3-6.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    4 SECTION A. Project Title: Fundamental Study of Key Issues Related to Advanced S-CO2 Brayton Cycle: Prototypic HX Development and Cavitation - Georgia Institute of Technology SECTION B. Project Description Georgia Institute of Technology will perform research (integrated experimental, numerical and analytical work) that utilizes the existing facilities at the university to address the key scientific and operational issues pertinent to the compact heat exchanger systems and turbo-machinery. The

  12. Microsoft Word - DOE-ID-14-046 Penn State University EC B3-6.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    6 SECTION A. Project Title: Multi-Sensor Inspection and Robotic Systems for Dry Storage Casks - Pennsylvania State University SECTION B. Project Description The objective of Pennsylvania State University's research is to develop sensors, monitoring methodologies, and a delivery system to ensure safe dry storage of used nuclear fuel. SECTION C. Environmental Aspects / Potential Sources of Impact The action will use existing facilities and will not create additional environmental impacts above

  13. Microsoft Word - DOE-ID-14-049 Iowa State University EC B3-6.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    49 SECTION A. Project Title: Advanced Models for Nondestructive Evaluation of Aging Nuclear Power Plant Cables - Iowa State University SECTION B. Project Description Iowa State University will perform R&D related to modeling the aging of two major NPP cable polymers - ethylene propylene rubber (EPR) and cross-linked polyethylene (XLPE). The cable polymers will be aged under various conditions e.g. elevated temperature, neutron/gamma irradiation, and water immersion. The testing using

  14. Microsoft Word - DOE-ID-14-050 University of Houston EC B3-6.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    50 SECTION A. Project Title: Periodic Material-Based Seismic Base Isolators for Small Modular Reactors-University of Houston SECTION B. Project Description The University of Houston will develop a 3D periodic foundation that can completely obstruct or change the energy pattern of the earthquake before it reaches the structure of small modular reactors. To demonstrate the effectiveness of this innovative isolation technology for SMRs, a scaled down SMFR structure supported on a 3D periodic

  15. Microsoft Word - DOE-ID-14-051 University of South Carolina EC B3-6.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    1 SECTION A. Project Title: Experimental Determination and Mechanistic Modeling of Used Fuel Drying by Vacuum and Gas Circulation for Dry Cask Storage - University of South Carolina SECTION B. Project Description The University of South Carolina will construct a mock nuclear used fuel assembly using depleted uranium. The investigation will address questions surrounding the amount, form, and location of water remaining in dry casks. The project will construct a vacuum drying system, and use

  16. Microsoft Word - DOE-ID-14-057 University of Florida EC B3-6.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    7 SECTION A. Project Title: Experimental Validation of UO2 Microstructural Evolution for NEAMS tool MARMOT - University of Florida SECTION B. Project Description The University of Florida will experimentally validate the NEAMS tool for the computer model MARMOT. Surrogate oxide (CeO2) and depleted uranium oxide (UO2) will be used for this study and will be formed into pellets of various types then characterized. SECTION C. Environmental Aspects / Potential Sources of Impact The depleted UO 2

  17. Microsoft Word - DOE-ID-14-061 Cal-Berkeley EC B3-6.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    61 SECTION A. Project Title: Selective ligands for uranyl via combinatorial peptoid libraries: A synthetic, structural, thermodynamic and computational study - University of California Berkeley SECTION B. Project Description University of California Berkeley will conduct research aimed at developing a fundamental understanding of how donor ligands bind to the uranyl ion, UO2 2+, with the longer-term goal of using this information to tackle selective recognition of uranyl in aqueous solution.

  18. Microsoft Word - DOE-ID-14-063 School of Mines EC B3-6.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    3 SECTION A. Project Title: -Controlling Hexavalent Americium - A Centerpiece to a Compact Nuclear Fuel Cycle - Colorado School of Mines SECTION B. Project Description The Colorado School of Mines will lead research into the development of sufficient knowledge to exploit the fundamental chemistry of Am to enable an industrially-viable means to co-recover the major and minor actinide elements from used nuclear fuel. This study will be conducted via two separate, but complementary lines of

  19. Microsoft Word - DOE-ID-14-066 University of Wisconsin EC B3-6.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    6 SECTION A. Project Title: Development of Self-Healing Zirconium Silicide Coatings for Improved Performance of Zirconium- Alloy Fuel Cladding - University of Wisconsin SECTION B. Project Description The objectives of the proposed research by the University of Wisconsin will be: (1) development of Zr-silicide coatings on Zr- alloy substrates, (2) corrosion studies of Zr-silicide coatings in normal reactor environment and LOCA conditions, including a fundamental understanding of thermodynamic and

  20. Microsoft Word - DOE-ID-14-067 MesoCoat EC B3-6.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    7 SECTION A. Project Title: Functionally Gradient Transition Joint for Dissimilar Metal Welding using Plasma Arc Lamps- MesoCoat, Inc. SECTION B. Project Description MesoCoat, Inc. will conduct research on an advanced joining technique (plasma arc lamp process) to improve properties at the joint, such as strength, irradiation resistance, corrosion resistance, and creep as well as to control and understand residual stress, heat affected zones, and/or phase stability during joining. SECTION C.