Powered by Deep Web Technologies
Note: This page contains sample records for the topic "dl dolomitic limestone" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


1

The effects of calcitic and dolomitic limestone rates and particle sizes on soil chemical changes, plant nutrient concentration, and yields of corn and Coastal bermudagrass on two acid Texas soils  

E-Print Network (OSTI)

Directed by Dr. Warren B. Anderson Two, 4, snd 6 tons/ acre of calcitic and dolomitic limestone in three particle size ranges were disked into a Katy fine sandy loam prior to planting corn. Identical treatments were broadcast on a Boy loamy fine sand... neutralized soil acidity faster than did the dolomitic source. All calcitic limestone treatments significantly increased Ca in the surface 6 inches of soil. The 4- and 6-ton/acre rates of fine, and the 6-ton/acre rate of medium calcitic limestone...

Haby, Vincent A

2012-06-07T23:59:59.000Z

2

Niagara Limestone  

NLE Websites -- All DOE Office Websites (Extended Search)

Niagara Limestone Niagara Limestone Nature Bulletin No. 282-A November 11, 1967 Forest Preserve District of Cook County Richard B. Ogilvie, President Roland F. Eisenbeis, Supt. of Conservation NIAGARA LIMESTONE Chicago stands at the crossroads of America -- the heart of the Middle West -- and one of the most important natural resources upon which it depends is the Niagara limestone beneath it. The bedrock in this region consists of layer upon layer of limestones, shales and sandstones stacked almost a half mile thick on top of the ancient granite, once molten, that formed the original surface of the earth before oceans formed and life appeared. The Niagara limestone is the uppermost layer here but few of us are aware of it because it is covered with soil and ground up rock -- glacial drift -- ranging from a few feet to a hundred or more feet in depth.

3

Stratigraphy and diagenesis of the Mississippian Lodgepole Limestone, Williston Basin, North Dakota  

SciTech Connect

Stratigraphic correlation of the Lodgepole Limestone (Bottineau Interval) indicates a sequence of three clinoform-shaped wedges that filled in the early Williston Basin. To date four productive 100m thick mounds have been discovered in the Lodgepole Limestone at Dickinson Field. The mounds seem to have nucleated at the toe of slope of the first highstand system tract and were subsequently buried by the second highstand systems tract. By isopaching each of the systems tracts one can predict were other mounds might have nucleated. Burial depth of the Bakken Shale-Lodgepole Limestone contact grade from 0.6 km at the edge of the Williston Basin to 3.4 km in the center. With increased depth the basal Lodgepole Limestone shows three phases of dolomitization, which are: small clear early dolomite; later iron rich fracture filling saddle dolomite and a later iron rich dolomite that seems to follow stylolites. Pre-oil migration mineralization of the overlying limestone include minor amounts of: anhydrite, pyrite, iron poor sphalerite, late iron rich sphalerite, chalcopyrite and celestite.

Grover, P.W. (Texas A M Univ., College Station, TX (United States))

1996-01-01T23:59:59.000Z

4

Stratigraphy and diagenesis of the Mississippian Lodgepole Limestone, Williston Basin, North Dakota  

SciTech Connect

Stratigraphic correlation of the Lodgepole Limestone (Bottineau Interval) indicates a sequence of three clinoform-shaped wedges that filled in the early Williston Basin. To date four productive 100m thick mounds have been discovered in the Lodgepole Limestone at Dickinson Field. The mounds seem to have nucleated at the toe of slope of the first highstand system tract and were subsequently buried by the second highstand systems tract. By isopaching each of the systems tracts one can predict were other mounds might have nucleated. Burial depth of the Bakken Shale-Lodgepole Limestone contact grade from 0.6 km at the edge of the Williston Basin to 3.4 km in the center. With increased depth the basal Lodgepole Limestone shows three phases of dolomitization, which are: small clear early dolomite; later iron rich fracture filling saddle dolomite and a later iron rich dolomite that seems to follow stylolites. Pre-oil migration mineralization of the overlying limestone include minor amounts of: anhydrite, pyrite, iron poor sphalerite, late iron rich sphalerite, chalcopyrite and celestite.

Grover, P.W. [Texas A& M Univ., College Station, TX (United States)

1996-12-31T23:59:59.000Z

5

Preparing limestone for burning  

Science Journals Connector (OSTI)

Classification of limestone before burning can be done by the screening method ... enables us to use the heat of the waste gases from the calcination units.

V. I. Goncharov; T. P. Kirichenko

6

Comparison of the morphology of alkali–silica gel formed in limestones in concrete affected by the so-called alkali–carbonate reaction (ACR) and alkali–silica reaction (ASR)  

SciTech Connect

The morphology of alkali–silica gel formed in dolomitic limestone affected by the so-called alkali–carbonate reaction (ACR) is compared to that formed in a siliceous limestone affected by alkali–silica reaction (ASR). The particle of dolomitic limestone was extracted from the experimental sidewalk in Kingston, Ontario, Canada that was badly cracked due to ACR. The siliceous limestone particle was extracted from a core taken from a highway structure in Quebec, affected by ASR. Both cores exhibited marked reaction rims around limestone particles. The aggregate particles were polished and given a light gold coating in preparation for examination in a scanning electron microscope. The gel in the ACR aggregate formed stringers between the calcite crystals in the matrix of the rock, whereas gel in ASR concrete formed a thick layer on top of the calcite crystals, that are of the same size as in the ACR aggregate.

Grattan-Bellew, P.E., E-mail: p.grattan-bellew@sympatico.ca [Materials and Petrographic Research G-B Inc., 472 Edison Avenue, Ottawa, ON, Canada K2A 1T9 (Canada); Chan, Gordon [NRC Construction, Bldg., M20, 1200 Montreal Road, Ottawa, ON, Canada K1A 0R6 (Canada)] [NRC Construction, Bldg., M20, 1200 Montreal Road, Ottawa, ON, Canada K1A 0R6 (Canada)

2013-05-15T23:59:59.000Z

7

Lead, zinc, and strontium in limestone cap rock from Tatum salt dome, Mississippi  

SciTech Connect

Limestone cap rock at Tatum salt dome, Mississippi, contains disseminated pyrite, sphalerite, and galena, and disseminated to massive amounts of strontianite (SrCO/sub 3/) and celestite (SrSO/sub 4/). Sulfide minerals are locally present in bitumen-rich areas of the upper, massive portion of the limestone cap rock, whereas strontium minerals are disseminated throughout this zone. However, sulfide and strontium minerals are most abundant in the lower banded portion of the limestone cap rock, which consists of alternating subhorizontal light and dark-colored bands. The dark bands are composed of calcite of variable grain size, sulfides, quartz, dolomite, albite, and up to 1% bitumen that apparently formed by the biodegradation of crude oil. Lighter bands are composed of variable amounts of coarsely crystalline, euhedral calcite, strontianite, and celestite resulting in strontium (Sr) contents of up to 30% locally. Banded limestone cap rock at Tatum dome formed at the top of the actively dissolving anhydrite zone by a combination of sulfate reduction and oxidation of liquid hydrocarbons by bacteria to cause the precipitation of calcite and sulfide minerals and the accumulation of insoluble residue from the anhydrite (quartz, albite, dolomite). Lead and zinc in the sulfide minerals could have been derived from the dissolving anhydrite, but the abundance of Sr minerals present requires an external source. Present-day oil field brines in central Mississippi contain up to 3000 ppm Sr, and basin brines of similar composition apparently contributed Sr to the cap-rock environment during formation.

Saunders, J.A.

1988-09-01T23:59:59.000Z

8

The Mississippian Leadville Limestone Exploration Play, Utah and Colorado-Exploration Techniques and Studies for Independents  

SciTech Connect

The Mississippian (late Kinderhookian to early Meramecian) Leadville Limestone is a shallow, open-marine, carbonate-shelf deposit. The Leadville has produced over 53 million barrels (8.4 million m{sup 3}) of oil/condensate from seven fields in the Paradox fold and fault belt of the Paradox Basin, Utah and Colorado. The environmentally sensitive, 7500-square-mile (19,400 km{sup 2}) area that makes up the fold and fault belt is relatively unexplored. Only independent producers operate and continue to hunt for Leadville oil targets in the region. The overall goal of this study is to assist these independents by (1) developing and demonstrating techniques and exploration methods never tried on the Leadville Limestone, (2) targeting areas for exploration, (3) increasing deliverability from new and old Leadville fields through detailed reservoir characterization, (4) reducing exploration costs and risk especially in environmentally sensitive areas, and (5) adding new oil discoveries and reserves. The final results will hopefully reduce exploration costs and risks, especially in environmentally sensitive areas, and add new oil discoveries and reserves. The study consists of three sections: (1) description of lithofacies and diagenetic history of the Leadville at Lisbon field, San Juan County, Utah, (2) methodology and results of a surface geochemical survey conducted over the Lisbon and Lightning Draw Southeast fields (and areas in between) and identification of oil-prone areas using epifluorescence in well cuttings from regional wells, and (3) determination of regional lithofacies, description of modern and outcrop depositional analogs, and estimation of potential oil migration directions (evaluating the middle Paleozoic hydrodynamic pressure regime and water chemistry). Leadville lithofacies at Libon field include open marine (crinoidal banks or shoals and Waulsortian-type buildups), oolitic and peloid shoals, and middle shelf. Rock units with open-marine and restricted-marine facies constitute a significant reservoir potential, having both effective porosity and permeability when dissolution of skeletal grains, followed by dolomitization, has occurred. Two major types of diagenetic dolomite are observed in the Leadville Limestone at Lisbon field: (1) tight 'early' dolomite consisting of very fine grained (<5 {micro}m), interlocking crystals that faithfully preserve depositional fabrics; and (2) porous, coarser (>100-250 {micro}m), rhombic and saddle crystals that discordantly replace limestone and earlier very fine grained dolomite. Predating or concomitant with late dolomite formation are pervasive leaching episodes that produced vugs and extensive microporosity. Most reservoir rocks within Lisbon field appear to be associated with the second, late type of dolomitization and associated leaching events. Other diagenetic products include pyrobitumen, syntaxial cement, sulfide minerals, anhydrite cement and replacement, and late macrocalcite. Fracturing (solution enlarged) and brecciation (autobrecciation) caused by hydrofracturing are widespread within Lisbon field. Sediment-filled cavities, related to karstification of the exposed Leadville, are present in the upper third of the formation. Pyrobitumen and sulfide minerals appear to coat most crystal faces of the rhombic and saddle dolomites. The fluid inclusion and mineral relationships suggest the following sequence of events: (1) dolomite precipitation, (2) anhydrite deposition, (3) anhydrite dissolution and quartz precipitation, (4) dolomite dissolution and late calcite precipitation, (5) trapping of a mobile oil phase, and (6) formation of bitumen. Fluid inclusions in calcite and dolomite display variable liquid to vapor ratios suggesting reequilibration at elevated temperatures (50 C). Fluid salinities exceed 10 weight percent NaCl equivalent. Low ice melting temperatures of quartz- and calcite-hosted inclusions suggest chemically complex Ca-Mg-bearing brines associated with evaporite deposits were responsible for mineral deposition. The overall conclusion from th

Thomas Chidsey

2008-09-30T23:59:59.000Z

9

Experimental deformation of natural and synthetic dolomite  

E-Print Network (OSTI)

Natural and hot isostatically pressed dolomite aggregates were experimentally deformed at effective pressures of Pe = 50 ?? 400 MPa, temperatures of 400 ?? 850??C, and strain rates of ?& = 1.2x10-4 s-1 to 1.2x10-7 s-1. Coarse- and fine...

Davis, Nathan Ernest

2005-11-01T23:59:59.000Z

10

DL-36361 UC-414 I  

NLE Websites -- All DOE Office Websites (Extended Search)

DL-36361 DL-36361 UC-414 I * Discovery of the Most Distant Supernovae and the Quest for L l Gerson Goldhaber and Saul Perlmutter Lawrence Berkeley Laboratory and Center for Particle Astrophysics University of California, Berkeley, CA 94720 Silvia Gabi, Ariel Goobar, Alex Kim, Mathew Kim, and Reynald Pain Lawrence Berkeley Laboratory, University of California Berkeley, CA 94720 Carl Pennypacker and Ivan Small Lawrence Berkeley Laboratory and Space Sciences Laboratory University of California, Berkeley, CA 94720 Brian Boyle, Richard Ellis, and Richard McMahon Institute of Astronomy, Cambridge, United Kingdom and Peter Bunclarlc, Dave Carter, and Roberto Terlevich Royal Greenwich Observatory, Cambridge, United Kingdom May 1994 T h i s work w a s supported in part by the U.S. Department of Energy under Contract No. DE-AC03-76SF00098,

11

ITP Mining: Energy and Environmental Profile of the U.S. Mining Industry: Chapter 9: Limestone and Crushed Rock  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

9 9 Limestone and Crushed Rock Crushed rock is one of the most accessible natural resources and a major basic raw material. It is used in construction, agriculture, and other industries using complex chemical and metallurgical processes. Despite the low value of its basic products, the crushed rock industry is a major contributor to and an indicator of the economic well being of the nation. Forms Of Crushed Rock About three-quarters of the crushed stone production is limestone and dolomite, followed by, in descending order of tonnage: granite, traprock, sandstone and quartzite, miscellaneous stone, marble, slate, calcareous marl, shell, volcanic cinder and scoria. Limestone, one of the largest produced crushed rock, is a sedimentary rock composed

12

Sala Dolomite-Catalysed Conversion of Tar from Biomass Pyrolysis  

Science Journals Connector (OSTI)

Dolomite from the Swedish Sala quarry has been examined as a possible catalyst for cracking and steam reforming of tar produced during pyrolysis of biomass.

K. Sjöström; G. Taralas; L. Liinanki

1988-01-01T23:59:59.000Z

13

Diagenetic features of Trenton Limestone in northern Indiana: petrographic evidence for Late (Mesogenetic) Dolostone  

SciTech Connect

Three conventional cores of the entire Trenton section were examined in detail by in-depth visual description, analysis of more than 250 thin sections, scanning electron microscopy, and x-ray diffraction. The cores are located in the northern half of Indiana where they span the major dolostone pinch-out that is the trap for the prolific Trenton oil and gas field. The Trenton Limestone is completely dolomitized in northern Indiana. Dolostone abundance decreases to the south where the dolostone is restricted to the upper few feet of the formation. Two major types of dolostone are recognized. The top 5-20 ft of the Trenton cores consists of medium crystalline nonporous xenotopic ferroan dolostone. Mesogenetic dewatering of the overlying Maquoketa shale is the proposed dolomitizing mechanisms for this ferroan dolostone cap. Below the ferroan dolostone cap in northern Indiana is coarsely crystalline dolostone, which consists of thin intercalated subfacies of porous idiotopic and nonporous xenotopic dolostone. This is the dominant dolostone type and is the reservoir in the Trenton field. The coarsely crystalline dolostone postdates the ferroan dolostone cap, chert nodule formation, and initial pressure solution. Therefore, this dolostone is considered to have formed relatively late in the diagenetic history of the Trenton under mesogenetic conditions. In the northernmost core, nearly all of the secondary dolomitic porosity is plugged by poikilotopic gypsum and minor amounts of calcite and celestite. Other diagenetic features observed in Trenton are also discussed, including silicification, ferroan calcite cement, upper Trenton contact formation, hardgrounds, and pressure solution.

Fara, D.R.

1986-08-01T23:59:59.000Z

14

Subsurface stratigraphy and depositional history of Madison Limestone (Mississippian), Williston Basin  

SciTech Connect

Cyclic carbonate-evaporite deposits of the Madison Limestone (Mississippian) in the Williston basin are made up of four main facies. From basin to shelf, the normal facies transition is from offshore deeper water (Lodgepole) facies to crinoidal-algal banks and back-bank fine carbonate, evaporite, and minor terrigenous clastic beds on the shallow shelf. Five major depositional cycles are correlated and mapped on the basis of shaley marker beds identified on gamma-ray-neutron or gamma-ray-sonic logs. The marker beds are interpreted as reworked and redistributed silt and clay-size sediments originally deposited, possibly by eolian processes, on the emergent shelf during low sea level phases of cycle development. From oldest to youngest, the first two cycles are characterized by increasing amounts of crinoidal-bioclastic and oolite-algal carbonates, culminating in the Mission Canyon facies of the middle cycle. The upper two cycles are characterized by increasing amounts of evaporite deposits, culminating in the Charles salt facies of the youngest cycle. Much of the Madison section on the south and east flanks of the basin consists of dolomite. Dolomite content decreased toward the basin center, where a major share of Madison petroleum production is located. Reservoir beds in the oil fields are primarily partially dolomitized oolite-algal or crinoidal-bioclastic bank carbonates. Most of the productive petroleum reservoirs are located in the middle cycles of the Madison.

Peterson, J.A.

1985-05-01T23:59:59.000Z

15

Dimensions, texture-distribution, and geochemical heterogeneities of fracture–related dolomite geobodies hosted in Ediacaran limestones, northern Oman  

Science Journals Connector (OSTI)

...identification and genesis as revealed by staining: Journal of Sedimentary Petrology, v.-36, p.-. Faqira, M. , M. Rademakers, and A. M. Afifi, 2009, New insights into the Hercynian Orogeny, and their implications for the Paleozoic hydrocarbon...

Veerle Vandeginste; Cédric M. John; John W. Cosgrove; Christina Manning

16

Kinematic hardening of a porous limestone  

Science Journals Connector (OSTI)

A concept for a kinematic hardening yield surface in stress space for Cordova Cream limestone (Austin Chalk) developed by Celle and Cheatham (1981) has been improved using Ziegler's modification of Prager's ha...

J. B. Cheatham Jr.; M. B. Allen; C. C. Celle

17

Shallow meteoric alteration and burial diagenesis of massive dolomite in the Castle Reef Formation, northwest Montana  

E-Print Network (OSTI)

Precambrian (750 + 25 Ma; Mudge, et al. , 1968) and very Late Cretaceous to early Tertiary (Mudge, 1972). Any formation or recrystallization of dolomite by hydrothermal fluids must have occurred before the Jurassic since pre-Jurassic dolomite overgrowths... Precambrian (750 + 25 Ma; Mudge, et al. , 1968) and very Late Cretaceous to early Tertiary (Mudge, 1972). Any formation or recrystallization of dolomite by hydrothermal fluids must have occurred before the Jurassic since pre-Jurassic dolomite overgrowths...

Whitsitt, Philip Mark

2012-06-07T23:59:59.000Z

18

Hydrothermal Dolomites in the Early Albian (Cretaceous) Platform Carbonates  

E-Print Network (OSTI)

Hydrothermal Dolomites in the Early Albian (Cretaceous) Platform Carbonates (NW Spain): Nature carbonates de la plate-forme albienne précoce (Crétacé; NO de l'Espagne): nature et origine des dolomies et trouvent dans les carbonates albiens, déposés dans le bassin Basque-Cantabrique suite à une subsidence

Paris-Sud XI, Université de

19

The Ranero Hydrothermal Dolomites (Albian, Karrantza Valley, Northwest Spain)  

E-Print Network (OSTI)

The Ranero Hydrothermal Dolomites (Albian, Karrantza Valley, Northwest Spain): Implications Recherche Développement, Carbonate Sedimentology Group, avenue Larribau s/n, 64018 Pau Cedex - France e'Espagne) sont présentées dans cette étude. Les corps dolomitiques sont encaissés dans des carbonates de

Paris-Sud XI, Université de

20

An integrated approach to evaluating the suitability of the Potosi Dolomite as a carbon sequestration target  

Science Journals Connector (OSTI)

...The Eminence is a relatively light-colored, fine- to medium-grained dolomite that contains abundant chert, quartz grains...thick to massively bedded, gray to light brown, fine- to medium-crystalline dolomite characterized by vugs lined with dolomite...

Hannes E. Leetaru; Valeri Smith; Yasmin Adushita; Jared T. Freiburg

Note: This page contains sample records for the topic "dl dolomitic limestone" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


21

Biomass Gasification in Fluidized Bed:? Where To Locate the Dolomite To Improve Gasification?  

Science Journals Connector (OSTI)

Figure 5 Steam content in the flue gas vs relative amount of dolomite used for two different locations of the dolomite and for two gasifying agents; (a) gasification with H2O + O2 mixtures, GR = 0.86?1.16, ... Figure 6 Low heating value of the flue gas for two locations of the dolomite and for two gasifying agents; (a) gasification with H2O + O2 mixtures, GR = 0.86?1.16, ... Figure 7 Gas yield for two locations of the dolomite and for two gasifying agents; (a) gasification with H2O + O2 mixtures; GR = 0.86?1.16, ...

José Corella; María-Pilar Aznar; Javier Gil; Miguel A. Caballero

1999-10-28T23:59:59.000Z

22

Limestone, Oklahoma: Energy Resources | Open Energy Information  

Open Energy Info (EERE)

Limestone, Oklahoma: Energy Resources Limestone, Oklahoma: Energy Resources Jump to: navigation, search Equivalent URI DBpedia Coordinates 36.3159295°, -95.7491501° Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"ROADMAP","zoom":14,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"350px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":36.3159295,"lon":-95.7491501,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}

23

Glacioeustatic Transgressive Reflux: Stratiform Dolomite in Pennsylvanian Bioherms of the Western Orogrande Basin, New Mexico  

Science Journals Connector (OSTI)

...mound rocks from the Virgilian Panther Seep Formation, Hembrillo Canyon...suggesting that, in general, car-bon in the dolomites was derived...alteration of dolomite: A review: Car-bonates and Evaporites, v...Simo, T., eds., Advances in Car-bonate Sequence Stratigraphy...

Gerilyn S. Soreghan; Michael H. Engel; Roger A. Furley; Katherine A. Giles

24

Biomass Gasification:? Produced Gas Upgrading by In-Bed Use of Dolomite  

Science Journals Connector (OSTI)

When some calcined dolomite (OCa·OMg) is used in the bed of a biomass gasifier of fluidized bed type the raw gas produced is cleaner than when only silica sand is used in it as fluidizing medium. In-bed dolomite changes the product distribution at the ...

Ana Olivares; María P. Aznar; Miguel A. Caballero; Javier Gil; Eva Francés; José Corella

1997-12-01T23:59:59.000Z

25

Management of solid wastes from the Limestone Injection Dry Scrubbing (LIDS) clean coal technology. Final report  

SciTech Connect

The objectives of this project were to characterize by-products from a pilot Limestone Injection Dry Scrubbing (LIDS) process and to develop processes directed toward the safe and economic use or disposal of these wastes. Because LIDS is a developing Clean Coal technology, a database of chemical and physical characteristics of the by-product was first developed. During the course of this project, it was found that the waste alone did not form high-strength products sufficient for use in construction and engineering applications. Therefore, the project was redirected to evaluate the by-product as a soil-cement and Portland cement raw material, agricultural liming agent, backfill/landfill material component, and mine reclamation/neutralizing agent. Based on these evaluations, the most viable uses for the LIDS byproduct include use in mine reclamation or as a neutralization agent. If soluble sulfites can be minimized by avoiding a dolomitic LIDS reagent, use as an agricultural liming agent has promise. Interest from an Ohio utility in the LIDS process suggests possible application of results at the demonstration or commercial stages.

Musiol, W.F. Jr.; Czuczwa, J.M.

1993-03-01T23:59:59.000Z

26

Mathematical Modeling on Open Limestone Channel  

E-Print Network (OSTI)

Acid mine drainage (AMD) is the outflow of acidic water from metal mines or coal mines. When exposed to air and water, metal sulfides from the deposits of the mines are oxidized and produce acid, metal ions and sulfate, which lower the pH value of the water. An open limestone channel (OLC) is a passive and low cost way to neutralize AMD. The dissolution of calcium into the water increases the pH value of the solution. A differential equation model is numerically solved to predict the variation of concentration of each species in the OLC solution. The diffusion of Calcium due to iron precipitates is modeled by a linear equation. The results give the variation of pH value and the concentration of Calcium.

Bandstra, Joel; Wu, Naiyi

2014-01-01T23:59:59.000Z

27

Geochemistry and origin of regional dolomites: Annual progress report, July 26, 1987-March 15, 1988  

SciTech Connect

This progress report covers accomplishments over the past year. Over the past year we have continued to maintain a group of excellent graduate students working on petrology of dolomites and closely allied topics. The research topics include: (1) U-Th-Pb systematics in Burlington-Keokuk carbonates;(2) solid inclusions and non-carbonate phases in dolomites of the Burlington-Keokuk FMS;(3) Porosity and permeability in dolomites of Burlington-Keokuk FMS;(4) X-ray microprobe analysis of trace elements using synchroton radiation;(5) Dolomitization of Devonian reef complexes Canning basin western Australia;(6) Quantitative modeling of major and trace elements and isotopes during carbonate diagenesis;(7) Modeling of regional fluid flow;and (8) Stable isotope geochemistry and cathode luminescence of crinoids from the Burlington-Keokuk FMS.

Hanson, G.N.; Meyers, W.J.

1988-03-01T23:59:59.000Z

28

Note on the genesis of brucite in contact metamorphism of dolomite  

Science Journals Connector (OSTI)

Consideration of available thermodynamic data and the published results of direct experiments relating to (1) formation. of periclase from dolomite and (2) hydration of periclase to brucite, permits the following...

Professor Dr. Francis J. Turner

1965-01-01T23:59:59.000Z

29

A dolomite preheater-economizer for use of the exhaust gas heat of rotary kilns  

Science Journals Connector (OSTI)

In the Seversk Dolomite Combine a prototype of a preheater-economizer for utilization of the heat of the ... exhaust gases at the inlet to the preheater-economizer of 550–600°C and passage through...

G. S. Rasput'ko; V. V. Churilov; V. I. Rogovskii; Ya. N. Rudnitskii…

30

Abu Dhabi sabkha, Persian Gulf, revisited: Application of strontium isotopes to test an early dolomitization model  

SciTech Connect

A study of brines and diagenetically altered minerals from coastal sabkha of Abu Dhabi, Persian Gulf, was undertaken to test the flood recharge-evaporative pumping model for early dolomitization using strontium isotopes as a tracer. The {sup 87}Sr/{sup 86}Sr ratio of the sabkha brines defines a pattern of both horizontal and vertical mixing of coastal seawater and continental ground water consistent with a previously proposed model. The {sup 87}Sr/{sup 86}Sr ratio of the diagenetic dolomites indicates early dolomitization by marine recharge waters. The {sup 87}Sr/{sup 86}Sr ratio of gypsum from the dolomitization area (1.4 to 4.4 km from high-tide mark) and seaward reflects precipitation from marine brines, but more landward (6 to 9 km), gypsum and anhydrite record a continental signal in the minerals suggests a paragenetic evaporative sequence (dolomite {yields} gypsum {yields} anhydrite). The dolomitizing fluid is evaporated seawater that recharges the sabkha aquifer during supratidal flooding and is afterward pumped upward through the saturated zone by evaporative processes.

Mueller, D.W.; McKenzie, J.A. (Swiss Federal Institute of Technology, Zuerick (Switzerland)); Mueller, P.A. (Univ. of Florida, Gainesville (USA))

1990-07-01T23:59:59.000Z

31

Ground-water flow modeling of the Culebra dolomite  

SciTech Connect

This hydrogeologic modeling study has been performed as part of the regional hydrologic characterization of the Waste Isolation Pilot Plant (WIPP) site in southeastern New Mexico. The study has produced an estimation of the transmissivity and Darcy-velocity distributions in the Culebra Dolomite Member of the Permian Rustler Formation at the WIPP site. The results of this study are intended to support Sandia National Laboratories performance-assessment calculations. The three-dimensional finite-difference code SWIFT II was employed for the numerical modeling, using a variable-fluid-density and single-porosity formulation. The spatial scale of the model, 21.3 km by 30.6 km, was chosen to allow simulation of regional-scale pumping tests conducted at the H-3 and H-11 hydropads and the WIPP-13 borehole, which are located south, southeast, and northwest, respectively, of the center of the WIPP site. The modeled area includes and extends beyond the controlled area defined by the WIPP-site boundaries. The work performed in this study consisted of modeling the hydrogeology of the Culebra in two stages: steady-state modeling to develop the best estimate of the undisturbed head distribution (i.e., of the hydraulic conditions before excavation of the WIPP shafts, which began in 1981) and superimposed transient modeling of local hydrologic response to excavation of the four WIPP shafts at the center of the WIPP site, as well as to various well tests. The transient modeling used the calculated steady-state freshwater heads as initial conditions. 144 refs., 98 figs., 23 tabs.

LaVenue, A.M.; Cauffman, T.L.; Pickens, J.F. (INTERA, Inc., Austin, TX (USA))

1990-10-01T23:59:59.000Z

32

Formation of diagenetic dolomite in coastal sabkha along Arabian (Persian) Gulf  

SciTech Connect

Aragonitic intertidal sediments are being dolomitized in the subsurface supratidal environment of a sabkha along the south shore of the Arabian (Persian) Gulf as a result of the percolation of wind-driven marine-derived brines. The development of abundant diagenetic dolomite results from a optimum combination of high mMg/sup 2 +//mCa/sup 2 +/ ratio fluids, a rapid flow rate which is related to the flooding frequency and sediment permeability, and a shoreline configuration that maintains the proper conditions for a sufficient length of time. Most diagenetic dolomite forms at the expense of primary aragonite according to the reaction: Mg/sup 2 +/ + 2CaCO/sub 3/(arag) ..-->.. CaMg(CO/sub 3/)/sub 2/ + Ca/sup 2 +/. Dolomite forms under the following conditions: (a) chloride concentration between 3.25 and 3.75 mCl/sup -//Kg; (b) mMg/sup 2 +//mCa/sup 2 +/ greater than about 6; (c) pH between 6.3 and 6.9; (d) minimum P/sub CO2/ of 10/sup -2/ to 10/sup -3/ atm; (e) temperature between 25 and 40/sup 0/C; (f) saturation with respect to gypsum; and (g) reducing environment in association with hydrogen sulfide. Other recent dolomite occurrences in the Bahamas, Florida, and Bonaire are significantly different in terms of stratigraphy, degree of lithification, and evaporite mineral association from those in the Arabian Gulf.

Patterson, R.J. (Univ. of Petroleum and Minerals, Dhahran, Saudi Arabia); Kinsman, D.J.J.

1982-01-01T23:59:59.000Z

33

Limestone and Ash Storage Silos and Lime Preparation Equipment, Part  

NLE Websites -- All DOE Office Websites (Extended Search)

Limestone and Ash Storage Silos and Lime Preparation Equipment, Part Limestone and Ash Storage Silos and Lime Preparation Equipment, Part of the System to Inject Limestone Sorbent for SO, Control. Nucla, CO Nucla...continued Before being repowered, the plant consisted of three 12 MWe coal stoker- fired units built in 1959, which were taken out of service in 1984 due to low efficiency and high fuel cost. Antici- pating a need for additional power in the early 1990s. and after review of many power generation alternatives, CUEA started constmction of the re- powered Nucla CFB plant in Novem- ber 1984 and completed the project in May 1987. The original boilers were replaced with a new Fympower Corp. CFB bailer, a new high pressure 74 MWe steam turbine generator was installed, the three original 12 MWe steam turbines were

34

Hydrothermal dolomites in SW Sardinia (Italy): evidence for a widespread late-Variscan fluid flow event  

E-Print Network (OSTI)

Hydrothermal dolomites in SW Sardinia (Italy): evidence for a widespread late-Variscan fluid flow, the Cambrian carbonates underwent ductile deformation and greenschist facies metamorphism. The same is true-temperature metamorphic rocks within the overlying nappes. It is assumed that a late-Variscan hydrothermal event, which

Boni, Maria

35

Curie temperature analyses of Upper Jurassic and Lower Cretaceous pelagic limestones  

Science Journals Connector (OSTI)

......strongly ferromagnetic minerals, IRM acquisition and...weakly ferromagnetic minerals such as goethite and...thermomagnetic analysis, pelagic lime- stones 1 Introduction...magnetite, other magnetic minerals including haematite...sandy limestone gray-green marly limestone "Ammonitico......

Bruno Galbrun; Robert F. Butler

1986-09-01T23:59:59.000Z

36

Calcined Dolomite, Magnesite, and Calcite for Cleaning Hot Gas from a Fluidized Bed Biomass Gasifier with Steam:? Life and Usefulness  

Science Journals Connector (OSTI)

Calcined Dolomite, Magnesite, and Calcite for Cleaning Hot Gas from a Fluidized Bed Biomass Gasifier with Steam:? Life and Usefulness ... About the temperature effect, at low (800 °C) and medium (840 °C) temperatures, the calcite is soon deactivated. ...

Jesús Delgado; María P. Aznar; José Corella

1996-10-08T23:59:59.000Z

37

Core analyses for selected samples from the Culebra Dolomite at the Waste Isolation Pilot Plant site  

SciTech Connect

Two groups of core samples from the Culebra Dolomite Member of the Rustler Formation at and near the Waste Isolation Pilot Plant were analyzed to provide estimates of hydrologic parameters for use in flow-and-transport modeling. Whole-core and core-plug samples were analyzed by helium porosimetry, resaturation and porosimetry, mercury-intrusion porosimetry, electrical-resistivity techniques, and gas-permeability methods. 33 refs., 25 figs., 10 tabs.

Kelley, V.A.; Saulnier, G.J. Jr. (INTERA, Inc., Austin, TX (USA))

1990-11-01T23:59:59.000Z

38

The origin of brucite in hydrothermally altered limestone near Devil Peak, Nevada.  

E-Print Network (OSTI)

??Open-space brucite was identified in veins crosscutting hydrothermally altered limestone near the Devil Peak rhyolite plug in southern Nevada. The brucite occurs with serpentine, calcite,… (more)

Knupp, Rhonda L.

1999-01-01T23:59:59.000Z

39

Protective effect of endolithic fungal hyphae on oolitic limestone buildings Nicolas Concha-Lozano a  

E-Print Network (OSTI)

limestone from four quarries and eight monuments exposed on various environmental conditions focusing molding. Study of weathering forms on old quarries indicates that lichens colonization (Verrucaria

Boyer, Edmond

40

Reservoir Characterization and Enhanced Oil Recovery Potential in Middle Devonian Dundee Limestone Reservoirs, Michigan Basin, USA.  

E-Print Network (OSTI)

?? Middle Devonian Rogers City and subjacent Dundee Limestone formations have combined oil production in excess of 375 MMBO. In general, hydrocarbon production occurs in… (more)

Abduslam, Abrahim

2012-01-01T23:59:59.000Z

Note: This page contains sample records for the topic "dl dolomitic limestone" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


41

Mercury Control Demonstration Projects Cover Photos: * Top: Limestone Power Plant  

NLE Websites -- All DOE Office Websites (Extended Search)

6 FEBRUARY 2008 6 FEBRUARY 2008 Mercury Control Demonstration Projects Cover Photos: * Top: Limestone Power Plant * Bottom left: AES Greenidge Power Plant * Bottom right: Presque Isle Power Plant A report on three projects conducted under separate cooperative agreements between the U.S. Department of Energy and: * Consol Energy * Pegasus Technologies * We Energies  Mercury Control Demonstration Projects Executive Summary ............................................................................ 4 Background ......................................................................................... 5 Mercury Removal Projects ................................................................ 7 TOXECON(tm) Retrofit For Mercury and Multi-Pollutant Control on Three 90-MW Coal-Fired Boilers ........................................7

42

Note on Evaluation of AWG Port Utilization Probabilities dl(1, j), j = 1, D, D -1, and  

E-Print Network (OSTI)

1 Note on Evaluation of AWG Port Utilization Probabilities dl(1, j), j = 1, D, D - 1, and dl(1, 1, D - 1 In this appendix we evaluate dl(1, j) for j = 1, D, D-1, i.e., the output port j is not a direct neighbor of sender port D, and note that the dl(1, j) are the same for these AWG ports j. We

Reisslein, Martin

43

Hydrochemical Impacts of Limestone Rock Mining Ghinwa M. Naja & Rosanna Rivero &  

E-Print Network (OSTI)

. 2002). Even though the environmental impacts of ore and coal mining have been adequately investigated, the impact of limestone rock mining has not been well studied. Water Air Soil Pollut DOI 10.1007/s11270-mail: mnaja@evergladesfoundation.org #12;Quarrying of limestone aggregate currently repre- sents in the USA

Demers, Nora Egan

44

Autonomous Remote Crack Displacement Monitoring of a Residence Near a Limestone  

E-Print Network (OSTI)

Autonomous Remote Crack Displacement Monitoring of a Residence Near a Limestone Quarry, Naples a limestone quarry. The object is to quantitatively compare crack re- sponse to blast-induced ground motion for construction and raw materials. For instance, neighbors of road aggregate quarries often perceive

45

Introduction to Geomorphology Lecture 1 1  

E-Print Network (OSTI)

of this debris get compacted and cemented together (sandstone, mudstone, limestone, Halite). 3) Metamorphic Inorganic Biochemical Limestone (calcite) Dolomite Halite Gypsum Limestone (calcite) Chert Coal

Venditti, Jeremy G.

46

Isotope (?13C and ?18O) compositions of dolomites from the Permian evaporitic sequences of the Eastern Russian Plate: Evidence from the Syukeevo gypsum deposit  

Science Journals Connector (OSTI)

Carbon and oxygen isotope compositions has been studied in dolomites of the Syukeevo gypsum deposit located in the Eastern Russian Plate. Values of ?13C in the dolomites vary from 0.3 to 6.6 ‰; ?18O, from 28.0 to...

R. Kh. Sungatullin; V. N. Kuleshov; R. I. Kadyrov

2014-09-01T23:59:59.000Z

47

Aggregation of n-octanoyl-dl-cysteine in aqueous solvent systems  

E-Print Network (OSTI)

indicated the predominant sites of interaction of thymine with the micellar n-octanoyl-dl-cysteine. At the lower pH ranges of 6. 0 and 7. 5 thymine primarily interacts with protons close to the sulfhydryl group of the surfactant while at the higher p... concentration Deoxyribonucleic acid n-Octanoyl-dl-cysteine Tetrahydrofuran Nuclear magnetic resonance Surfactant concentration Observed chemical shift of surfactant Micellar chemical shift of surfactant Monomeric chemical shift of surfactant Monomeric...

Shelley, Ralph Ray

2012-06-07T23:59:59.000Z

48

Variations in Mg/Ca as a control on distribution of strontium concentrations and delta/sup 18/O in upper Tertiary dolomites from Bahamas  

SciTech Connect

Strontium concentrations and delta/sup 18/O are commonly used to infer the gross composition of dolomitizing waters, yet the bases for such inferences are not firmly established. A new approach to calibrating these 2 parameters is suggested from analyses of a section of upper Tertiary dolomites from the Bahamas. In an interval of dolomite, 120 m (394 ft) from a core taken on San Salvador Island, mole % MgCO/sub 3/ is correlated positively with delta/sup 18/O, and negatively with strontium. Strontium substitutes mainly for calcium, thus the negative correlation with mole % MgCO/sub 3/. Dolomites are enriched between 3 to 7% in delta/sup 18/O as compared with coprecipitated calcite, and thus the positive correlation. These two covariations indicate the need to consider the stoichiometric coefficient of dolomites, and to normalize strontium concentrations and delta/sup 18/O with their respective stoichiometric coefficients before inferring their relationship with fluid composition.

Swart, P.K.; Dawans, J.M.

1984-04-01T23:59:59.000Z

49

Benefits and costs of tourism and outdoor recreation in the Natural Park of the Ampezzo Dolomites (Veneto-Italy)  

E-Print Network (OSTI)

1 Benefits and costs of tourism and outdoor recreation in the Natural Park of the Ampezzo Dolomites economy. The Alps Agreement too, with particular regard to Tourism Protocol has underlined that tourism development has to be sustainable. Therefore, we need to know tourism and outdoor recreation benefits

Tempesta, Tiziano

50

Interpretations of Tracer Tests Performed in the Culebra Dolomite at the Waste Isolation Pilot Plant Site  

SciTech Connect

This report provides (1) an overview of all tracer testing conducted in the Culebra Dolomite Member of the Rustler Formation at the Waste Isolation Pilot Plant (WPP) site, (2) a detailed description of the important information about the 1995-96 tracer tests and the current interpretations of the data, and (3) a summary of the knowledge gained to date through tracer testing in the Culebra. Tracer tests have been used to identify transport processes occurring within the Culebra and quantify relevant parameters for use in performance assessment of the WIPP. The data, especially those from the tests performed in 1995-96, provide valuable insight into transport processes within the Culebra. Interpretations of the tracer tests in combination with geologic information, hydraulic-test information, and laboratory studies have resulted in a greatly improved conceptual model of transport processes within the Culebra. At locations where the transmissivity of the Culebra is low (< 4 x 10{sup -6} m{sup 2}/s), we conceptualize the Culebra as a single-porosity medium in which advection occurs largely through the primary porosity of the dolomite matrix. At locations where the transmissivity of the Culebra is high (> 4 x 10{sup -6} m{sup 2}/s), we conceptualize the Culebra as a heterogeneous, layered, fractured medium in which advection occurs largely through fractures and solutes diffuse between fractures and matrix at multiple rates. The variations in diffusion rate can be attributed to both variations in fracture spacing (or the spacing of advective pathways) and matrix heterogeneity. Flow and transport appear to be concentrated in the lower Culebra. At all locations, diffusion is the dominant transport process in the portions of the matrix that tracer does not access by flow.

MEIGS,LUCY C.; BEAUHEIM,RICHARD L.; JONES,TOYA L.

2000-08-01T23:59:59.000Z

51

Investigation of elastic weakening in limestone and sandstone samples from moisture adsorption  

Science Journals Connector (OSTI)

......Tittmann (2008) showed that adhesion forces on quartz, mica and calcite minerals...limestones and sandstones shows that the fundamental difference between their respective elastic...Rock Physics and Phase Relations, A Handbook of Physical Constants, AGU Refrence......

L. Pimienta; J. Fortin; Y. Guéguen

2014-01-01T23:59:59.000Z

52

On the Dynamic Fragmentation of two Limestones using Edge-on Impact Tests  

E-Print Network (OSTI)

, a crinoidal limestone and the so-called "blanche de Beaucaire." These rocks are extracted from quarries. The mining and quarrying industries aim at controlling the block size distributio

53

Enhancement of direct sulfation of limestone by Na2CO3 addition  

Science Journals Connector (OSTI)

For an oxy-fuel circulating fluidized bed combustion system, the limestone calcination is normally prevented due to excessive CO2 partial pressures and the limestone is subject to a direct sulfation reaction. The enhancement of the direct sulfation of limestone by Na2CO3 was investigated under high CO2 partial pressure in a thermogravimetric apparatus (TGA) and scanning electron microscope (SEM) analysis method. A commercial limestone with a mean size of 18.8 ?m was used. Experimental results indicate that the incorporation of Na+ ions in solid product CaSO4 lattice structures results in formation of more extrinsic point defects in the crystal lattices of CaSO4 and a significantly increased solid-state diffusivity/mobility in the solid product. So the direct sulfation of Na2CO3-doped limestone shows higher rate and higher degree of conversion in the later stage of sulfation, in comparison with the direct sulfation of original limestone. The reaction changes from diffusional control to chemical reaction control in the presence of Na2CO3 because of the effect of foreign ions on accelerating the solid-state diffusion.

Chuanmin Chen; Ye Zhuang; Chunbo Wang

2009-01-01T23:59:59.000Z

54

Laboratory column experiments for radionuclide adsorption studies of the Culebra dolomite member of the Rustler Formation  

SciTech Connect

Radionuclide transport experiments were carried out using intact cores obtained from the Culebra member of the Rustler Formation inside the Waste Isolation Pilot Plant, Air Intake Shaft. Twenty-seven separate tests are reported here and include experiments with {sup 3}H, {sup 22}Na, {sup 241}Am, {sup 239}Np, {sup 228}Th, {sup 232}U and {sup 241}Pu, and two brine types, AIS and ERDA 6. The {sup 3}H was bound as water and provides a measure of advection, dispersion, and water self-diffusion. The other tracers were injected as dissolved ions at concentrations below solubility limits, except for americium. The objective of the intact rock column flow experiments is to demonstrate and quantify transport retardation coefficients, (R) for the actinides Pu, Am, U, Th and Np, in intact core samples of the Culebra Dolomite. The measured R values are used to estimate partition coefficients, (kd) for the solute species. Those kd values may be compared to values obtained from empirical and mechanistic adsorption batch experiments, to provide predictions of actinide retardation in the Culebra. Three parameters that may influence actinide R values were varied in the experiments; core, brine and flow rate. Testing five separate core samples from four different core borings provided an indication of sample variability. While most testing was performed with Culebra brine, limited tests were carried out with a Salado brine to evaluate the effect of intrusion of those lower waters. Varying flow rate provided an indication of rate dependent solute interactions such as sorption kinetics.

Lucero, D.A.; Heath, C.E. [Sandia National Labs., Albuquerque, NM (United States); Brown, G.O. [Oklahoma State Univ., Stillwater, OK (United States). Biosystems and Agricultural Engineering Dept.

1998-04-01T23:59:59.000Z

55

Conceptual model for transport processes in the Culebra Dolomite Member, Rustler Formation  

SciTech Connect

The Culebra Dolomite Member of the Rustler Formation represents a possible pathway for contaminants from the Waste Isolation Pilot Plant underground repository to the accessible environment. The geologic character of the Culebra is consistent with a double-porosity, multiple-rate model for transport in which the medium is conceptualized as consisting of advective porosity, where solutes are carried by the groundwater flow, and fracture-bounded zones of diffusive porosity, where solutes move through slow advection or diffusion. As the advective travel length or travel time increases, the nature of transport within a double-porosity medium changes. This behavior is important for chemical sorption, because the specific surface area per unit mass of the diffusive porosity is much greater than in the advective porosity. Culebra transport experiments conducted at two different length scales show behavior consistent with a multiple-rate, double-porosity conceptual model for Culebra transport. Tracer tests conducted on intact core samples from the Culebra show no evidence of significant diffusion, suggesting that at the core scale the Culebra can be modeled as a single-porosity medium where only the advective porosity participates in transport. Field tracer tests conducted in the Culebra show strong double-porosity behavior that is best explained using a multiple-rate model.

Holt, R.M. [Holt Hydrogeology, Placitas, NM (United States)] [Holt Hydrogeology, Placitas, NM (United States)

1997-08-01T23:59:59.000Z

56

Chemical and radiochemical characteristics of groundwater in the Culebra Dolomite, southeastern New Mexico  

SciTech Connect

The nation's first geologic repository for radioactive waste is being excavated in southeastern New Mexico at the Waste Isolation Pilot Plant (WIPP). Post-closure radioactive release scenarios from WIPP often involve hydrologic transport of radionuclides through the overlying Rustler Formation, in the Culebra Dolomite Member. The Environmental Evaluation Group (EEG) has conducted an investigation of the chemistry of culebra groundwater. Analysis revealed the following: salinities in Culebra groundwater generally increase from west to east; a Na-Cl type water dominates over most of the sampled area with a Ca-SO/sub 4/ type occurring in the southern to southwestern area; exclusive of the low-salinity southern area, most wells located on the same general flow path have similar ion ratios; dissolved uranium content in Culebra groundwater is relatively high, with marked disequilibrium between U-238 and U-234 activities; Ra-226 and Ra-228 are sometimes present in relatively large amounts; Th-228 was detected in samples from 5 wells; and Cs-137 was detected in several samples. 39 refs., 21 figs., 2 tabs.

Chapmen, J.B.

1988-03-01T23:59:59.000Z

57

MR-Trackable Intramyocardial Injection Catheter P.V. Karmarkar,1* D.L. Kraitchman,1  

E-Print Network (OSTI)

MR-Trackable Intramyocardial Injection Catheter P.V. Karmarkar,1* D.L. Kraitchman,1 I. Izbudak,1 L.V. Hofmann,1 L.C. Amado,2 D. Fritzges,1 R. Young,3 M. Pittenger,3 J.W.M. Bulte,1 and E. Atalar1 ventricular remodeling. MRI can be effectively used to differentiate in- farcted from healthy myocardium. MR

Atalar, Ergin

58

Kinetics of on Goethite: A Pressure Relaxation Study. P. G. GROSSL*, MJ. EICK, D.L.  

E-Print Network (OSTI)

I Kinetics of on Goethite: A Pressure Relaxation Study. P. G. GROSSL*, MJ. EICK, D.L. SPARKS, and C the adsorption/desorption of the oxyanions, chromate and arsenate, on goethite (a-FeOOH). Experimental conditions included equilibration of a 10 g L-l goethite (surface area 52 m2 g-l) suspension with initial total

Sparks, Donald L.

59

Accumulation of surface-applied agricultural limestone in acid soils of east Texas  

E-Print Network (OSTI)

, Georgetown is considered a 20 Table 2. Elemental analysis of agricultural limestone sam les ( ercenta e basis) . T Source %Ca %N %Si %Fe %Nn Georgetown Hugo Idabel 34. 6a 37. 4b 35. 2a 3. 0a 1. 0a 0. 2a 0. 00a 0. 3b 0. 4b 0. 2a 0. 05b 0. 4b 1. 7c 0.... Wilding (Member) Marvin W. Rowe (Member) E. C. A. Run (Head of Department) August 1987 ABSTRACT Accumulation of Surface-applied Agricultural Limestone in Acid Soils of East Texas. (August 1987) Earl Raymond Allen, B. Stf University of Illinois...

Allen, Earl Raymond

2012-06-07T23:59:59.000Z

60

u.s. Dl1PARUIFNT OF ENERGY EERE PROJECT MAN AGEMENT CENTER NEPA DETERMINATION  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Dl1PARUIFNT OF ENERGY Dl1PARUIFNT OF ENERGY EERE PROJECT MAN AGEMENT CENTER NEPA DETERMINATION Page I of2 STATE: TX RECIPIENT:E1 Paso, TX PROJECT PV Solar Demonstration Project ARRA-EECBG-City of EI Paso, TX TITLE: Funding Opportunity Announcement Number Procurement Instrument Number NEPA Control Number CID Number DE-FOA-OOOOO13 DE-EEOOOO964 GFQ-0000964-OO3 G0964 Based on my review orlhe information concerning the proposed action, as NEPA Compliance Officer (authoriJ'ÂŁd under DOE Order 451.IA), I have made the rollowing determination: ex, EA, EIS APPENDIX AND NUMBER: Description: 85.16 Solar photovoltalc systems The installation, modification, operation, and removal of commercially available solar pholovoltaic systems located on a building or other structure (such as rooftop, parking lot or facility, and mounted to

Note: This page contains sample records for the topic "dl dolomitic limestone" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


61

Voltage Dependent Carrier Collection in CdTe Solar Cells D.L. Btzner1  

E-Print Network (OSTI)

Voltage Dependent Carrier Collection in CdTe Solar Cells D.L. BĂ€tzner1 , Guido Agostinelli2 , A to 1000nm, i.e. the band edge region of CdTe. Region I is further divided in a `blue' part between 300 nm III is as well subdivided in region IIIa from about 800 nm to the band gap of CdTe (~850 nm

Romeo, Alessandro

62

Depositional facies, textural characteristics, and reservoir properties of dolomites in Frobisher-Alida interval in southwest North Dakota  

SciTech Connect

The Mississippian Frobisher-Alida interval is an upward-shoaling cycle that began with open-marine sedimentation and culminated with the deposition of a widespread sabkha-salina evaporite. This cycle is the most prolific oil-producing interval in the North Dakota portion of the Williston basin. Most Frobisher-Alida production in the southern Williston basin is from dolomite reservoirs. The six major facies defined in this paper are lithologic suites that represent sediments and precipitates deposited in similar environments. 20 figures, 5 tables.

Petty, D.M.

1988-10-01T23:59:59.000Z

63

Concrete international /january 2010 35 Portland limestone cement (PLC) is produced by  

E-Print Network (OSTI)

Concrete international /january 2010 35 Portland limestone cement (PLC) is produced by blending demonstration of PLC concrete in the late-fall construction of a parking lot at a ready mixed concrete plant near Gatineau, QC, Canada. The performance of the plastic and hardened concretes produced with PLC

64

Remanent Magnetism in Jurassic Red Limestones and Radiolarites from the Alps  

Science Journals Connector (OSTI)

......magnetism of ferromagnetic minerals by chemical reactions...represented by limestones-red lime- stones of various types...The basal portion is green to grey. The upper contact...covered I Radiolarite, green-gray Shale, greenish-gray...potentially ferromagnetic mineral present. The haematite......

Robert B. Hargraves; Alfred G. Fischer

1959-03-01T23:59:59.000Z

65

Distribution of authigenic albites in a limestone succession of the Helvetic Domain, eastern Switzerland  

E-Print Network (OSTI)

exclusively in limestones with a carbonate content higher than 80 wt-%. A diagenetic or hydrothermal origin contenant plus de 80 %m de carbonate. La possibilité d'une origine diagéné- tique ou hydrothermale est to a thin section scale, and we discuss a possible diagenetic or hydrothermal origin of these albites. 2

Gilli, Adrian

66

Modeling Surface Waves from Aboveground and Underground Explosions in Alluvium and Limestone  

Science Journals Connector (OSTI)

...reinke@dtra.mil The May 2012 HUMBLE REDWOOD III (HRIII) experiment series...alluvium conducted as part of the HUMBLE REDWOOD I and II (HRI and HRII) experiments...limestone as part of the May 2012 HUMBLE REDWOOD III (HRIII) experiment series...

Jessie L. Bonner; David R. Russell; Robert E. Reinke

67

Geochemical and optical characterization of diagenetic and hydrothermal dolomite from the Bonneterre formation within the Southeastern Missouri Lead-Zinc District  

E-Print Network (OSTI)

core, b. single high Fe rim, c. single outer dark rim 73 41 MS-1-1044. 0 Color cathodoluminescence, 200X. . 74 42 MS-1-1044. 0 Ferrous iron staining of dolomite by potassium ferricyanide, uncrossed nicols, 200X. . . , 74 43 MS-1-1044. 0 Linescan... rim 3, e. single rim 4. . . . . . . . . . . . . . . . 76 LIST OF FIGURES (continued) ~Fi ure ~Pa e 46 MS-4-983. 0 a. Ferrous iron staining of dolomite by potassium ferricyanide, uncrossed nicols, 220X. . . . . . 77 47 NS-4-983. 0b Plane light...

Borkowski, Richard Michael

1983-01-01T23:59:59.000Z

68

Lithologic and structural controls of limestone-hosted Pb-Zn-Ag mineralization in Chihuahua, Mexico  

SciTech Connect

The state of Chihuahua contains some of the most important limestone-hosted ore deposits in Mexico. The best example are Santa Eulalia and Naica which together have produced 53 million tons or ore averaging 7.7% Pb, 6.4% Zn, and 280 g/ton Ag. These deposits occur as mantos and chimneys often accompanied by calc-silicates. Among the most critical questions in this type of deposit is the control that the limestone-host exerts on the mineralizing process. Here the authors present the first detailed data on the stratigraphic and lithologic character of the limestone-hosts at Naica and Santa Eulalia. All ore at Naica and Santa Eulalia is hosted by micrites, biomicrites and biosparites indicative of generally quiet marine deposition. The authors work suggests that the western edge of the this trough might be a low angle, east dipping ramp which extends below the Sierra Madre Occidental. The primary permeability of the limestone that hosts Naica and Santa Eulalia is in the micro to nanodarcy range. The effective permeability has been augmented by 3 or 4 stages of micro-fracturing. Most of the ore is controlled by these fractures and by felsic dikes, which in cases are mostly endoskarn. Stylolites also appear to have exerted a control on the mineralizing process. Numerous instances of alteration and recrystallization confined to one side of a horizontal stylolite have been noted. At Santa Eulalia, horizontal stylolites have controlled the emplacement of massive sulfide mantos, suggesting that the mineralizing process was rather passive.

Lofquist, D.J.; Ruiz, J.

1985-01-01T23:59:59.000Z

69

Characterisation of hydraulic fractures in limestones using X-ray microtomography  

E-Print Network (OSTI)

Hydraulic tension fractures were produced in porous limestones using a specially designed hydraulic cell. The 3D geometry of the samples was imaged using X-ray computed microtomography before and after fracturation. Using these data, it was possible to estimate the permeability tensor of the core samples, extract the path of the rupture and compare it to the heterogeneities initially present in the rock.

Renard, Francois; Desrues, Jacques; Plougonven, Erwan; Ougier-Simonin, Audrey

2006-01-01T23:59:59.000Z

70

The stratigraphy and environment of deposition of productive Wilcox clays in west central Freestone and southeast Limestone Counties, Texas  

E-Print Network (OSTI)

THE STRATIGRAPHY AND ENVIRONMENT OF DEPOSITION OF PRODUCTIVE WILCOX CLAYS IN WEST CENTRAL FREESTONE AND SOUTHEAST LIMESTONE COUNTIES, TEXAS A Thesis by STEPHANIE ANNE SHELVEY Submitted to the Graduate College of Texas ARM University... in partial fulfillment of the requirement for the degree of MASTER OF SCIENCE May 1986 Major Subject: Geology THE STRATIGRAPHY AND ENVIRONMENT OF DEPOSITION OF PRODUCTIVE WILCOX CLAYS IN WEST CENTRAL FREESTONE AND SOUTHEAST LIMESTONE COUNTIES, TEXAS A...

Shelvey, Stephanie Anne

2012-06-07T23:59:59.000Z

71

Diagenesis of sandstones from the Douglas Creek member of the Green River Formation (Eocene) at Red Wash field, Uintay County, Utah  

E-Print Network (OSTI)

, sandstone and some limestone and dolomite beds. The Garden Creek Member at Red Wash Field is about 550 ft (168 m) thick. The Parachute Creek Member, overlying the Garden Creek, is largely oil shale, gray shale, and limestone and dolomite beds..., sandstone and some limestone and dolomite beds. The Garden Creek Member at Red Wash Field is about 550 ft (168 m) thick. The Parachute Creek Member, overlying the Garden Creek, is largely oil shale, gray shale, and limestone and dolomite beds...

Ray, Earl Scott

2012-06-07T23:59:59.000Z

72

U.S. Dl1PARl'MENT OF ENERGY EERE PROJECT MAN AG EMENT CENTER  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

r-.u..~ r-.u..~ , U.S. Dl1PARl'MENT OF ENERGY EERE PROJECT MAN AG EMENT CENTER NEPA DEl'ElU.,nNAl'ION RECIPIENT:WA Dept. of Commerce PROJECT TITLE: Washington State Ferries Biodiesel Project· Phase II Page 1 of3 STATE: WA Funding Opportunity Announcement Number ProcuR'mentlnstrument Number NEPA Control Number em Number DE-FOA-OOOOO52 EEOOOO139 GF0-0000139-039 EE139 Based on my review orlhe Information concerning the propostd action, as NEPA Compliance Officer (authorized under DOE Order 45I.1A), I have made tbe rollowing determination: ex, EA, EIS APPENDIX AND NUMBER: Description: B5.22 Alternative fuel vehicle fueling stations The installation, modification, operation, and removal of alternative fuel vehicle fueling stations (such as for compressed

73

ANALYTICAL DATA SHEET ANALYTICAL DEPT. - HEALTH Al\rD SAFETY DlVlSlON  

Office of Legacy Management (LM)

em IVIL, u-3 em IVIL, u-3 1' 1L, I -' I ANALYTICAL DATA SHEET ANALYTICAL DEPT. - HEALTH Al\rD SAFETY DlVlSlON 1956 1. H.# fL22 Industrial Hygiene or Medical Dept. Sample Nor& 3 Date Collected- 5117 by --Route to CES CES r Location IQJKER-PEMJNS Co- Type of Sample-waternalyzed for F Alpha Remarks -&I GG -- u - Beta Samples of water discharged to river during Steam clean- No, Ra ing of equipment. Oil PH Be Th Sample No. Hour Sample Description (RT Please analyze for gm/U/gal. BP-1 P- RO-Kneader BP-2 K- N-Kneader BP-3 Omera Feeder - __-- .___ -- i ___- ------I - 1 I . ----.--- - ------ .-___ _- I I - 3" - 1 ' : i ' Nt! w-d Analytical Chemistry Section: - Date Received 5-21-56 bY %b. Date Reported 5-2 Z-56 by&b. Method of Analysis Fluorimeter

74

EERE PROJECT MANAGEMENT CDITER Nl!PA Dl!Tl!Rl\llNATION  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

... ... ~ . u.s DEPAR lENT OFl!NERG' EERE PROJECT MANAGEMENT CDITER Nl!PA Dl!Tl!Rl\llNATION Page 1 of2 RECIPIENT:Stanford University STATE: CA PROJECf TITLE: In·Situ X·Ray Analysis of Rapid Thermal Processing for Thin·FiI Solar Cells: Closing the Gap between Production and Laboratory Efficiency Funding Opportunity Announcement Number DE·FOA-0000654 Procurement Instrument Number DE·EE0005951 NEPA Control Number em Number GFQ-0005951·001 G05951 Based on my review of the information concerning the proposed action, as NEPA Compliance Officer (authorized under DOE Order 4SI.IA), I have made the following determination: CX, EA, EIS APP~:NDIX AND NUMBER: Description: A9 Information gathering, analysis, and dissemination 81.31 Installation or

75

Dl!PARThlENT OF ENERGY EERE PROJECT \1A~AGEMENT CENTER  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

~"'-'~' ~"'-'~' u.s. Dl!PARThlENT OF ENERGY EERE PROJECT \1A~AGEMENT CENTER NEPA DETEIU.llNATION Page 1 of2 REel PIENT:County of Somerset STATE: NJ PROJECT TITl.E : Somerset County Renewable Energy Initiative Funding Opportunity Announcement Number Procurement Instrument Number NEPA Control Number CID Number DE-EEOOO3199 GFOOOO3199-001 G03199 BaSC'd on my review o!tbe information concerning the proposed action, as NEPA Compliance Officrr (authorized under DOE Order 451.1A), I have made the following detenninatioo: ex, EA, [IS APPENDIX AND NUMBER: Description: 85.16 Solar photovoltaic systems The installation, modification , operation, and removal of commercially available solar photoyoltaic systems located on a building or other structure (such as rooftop. parking lot Of facility

76

Rvision par r-ensembles de bases de connaissances en DL-LiteR S. Benferhat1  

E-Print Network (OSTI)

2 E. WĂŒrbel3 1 UniversitĂ© d'Artois - Nord de France, CRIL-CNRS UMR 8188. 2 UniversitĂ© d- vision" for revising DL-Lite knowledge bases. Such stra- tegy of revision is based on inconsistency

Paris-Sud XI, Université de

77

Limestone/adipic acid FGD and stack opacity reduction pilot plant tests at Big Rivers  

SciTech Connect

Big Rivers Electric Corporation (BREC) contracted Peabody Process Systems, Inc. (PPSI) to install a flue gas cleaning (FGC) pilot plant at the BREC R.D. Green Station Unit No. 2 located at Sebree, KY. A six month test program was completed demonstrating technology for: alternatives to using lime as an alkali; methods for improving cake dewatering; identification of the causes of high stack opacity; and methods for the reduction of high stack opacity. This paper presents highlights extracted from the reports submitted by PPSI to BREC on this test program. BREC was primarily interested in reduction of operating costs, if possible, by using an alkali less expensive than lime, and by improving the poor dewatering characteristic inherent in a dolomitic lime system. BREC was also within compliance for particulate emissions and opacity in the duct after the dry electrostatic precipitator, but not in compliance with the stack opacity regulation, and therefore wanted to investigate methods for stack opacity reduction.

Laslo, D.; Bakke, E.; Chisholm, E.

1984-01-01T23:59:59.000Z

78

ANALYTICAL DATA SHEET ANALYTICAL DEPT. - HEALTH AhD SAFETY DlVlSlDN  

Office of Legacy Management (LM)

ANALYTICAL DEPT. - HEALTH AhD SAFETY DlVlSlDN I -. . Industrial Hygiene or Medical Dept. 1956 I. H.# 984 Sample Nos. l2 Date Collected- o/2g by&- Route to J" Location SSi4.X CUiTn! CXJitP. Type of Sample&-dust Analyzed for F Alpha x Remarks P~UXC~JGIi.' ON. 14lCI11~ U Beta - IIoll0Wi.n~ slucs - NO, Ra Oil PH Be Th Sample No. 7573p Hour Sample Description 1355 CZ Orxxator sets slul: into place, closes shield over machine S starts &ill. oil coolant flows through hollow drill ____ 3 is rebounded back through an openiq covers 1 cor.lp N9 8775 Analytical Chemistry Section: Date Received 7-2-66 by hb Date Reported 74X& bY IIR Method of Analysis Alpha sdntillation cam 2 % ' CJly Counting Data: BKGD .27 c/min GE0 4o% /min 1 I c- d/ill/M 3

79

DEPXRTMEKT OF ENV]RO~:MENTAL F'ROTECTION DlVklOh OF  

Office of Legacy Management (LM)

. * . * @.+<, .-- v 7, -e -5 u i' ;. - - : ,.:,, 4-.1M-4. a". : ' - l-1 &dp d 3-m 3jPr5Py DEPXRTMEKT OF ENV]RO~:MENTAL F'ROTECTION DlVklOh OF ~NVIR0N~Eh~A.L OUR' tiIn - . BUREAU OF R&DllmcN t=ROTE~lOH ' 1 ,_ jBD 5cOTCH ROAD. ~R~%~obi. fd. 1. 08628 .' - ._ -_ _ . . : S=_srterrjer 27, 1977 - ,. _ :.- ,_..I \ L . x=- a-. JEC): f' eust C--l L-9 ,c:c- -*r 2ze E&f&y _3=iz=Et=g cr;i\' ==Siq ' ---res"LE;, c2iiIps - de- ~-z7~~to3, Bew --d Jersey DE540 3ez' -- . w- Tecsk: i 25, 1577, A&=!= --t' -jD,r= of

80

Stratigraphic variations and secondary porosity within the Maynardville Limestone in Bear Creek Valley, Y-12 Plant, Oak Ridge, Tennessee  

SciTech Connect

To evaluate groundwater and surface water contamination and migration near the Oak Ridge Y-12 plant, a Comprehensive Groundwater Monitoring Plan was developed. As part of the Maynardville exit pathways monitoring program, monitoring well clusters were ii installed perpendicular to the strike of the Maynardville Limestone, that underlies the southern part of the Y-12 Plant and Bear Creek Valley (BCV). The Maynardville Project is designed to locate potential exit pathways of groundwater, study geochemical characteristics and factors affecting the occurrence and distribution of water-bearing intervals, and provide hydrogeologic information to be used to reduce the potential impacts of contaminants entering the Maynardville Limestone.

Goldstrand, P.M. [Univ. of Nevada, Reno, NV (United States)

1995-05-01T23:59:59.000Z

Note: This page contains sample records for the topic "dl dolomitic limestone" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


81

DEPARTMENT OF ENERGY EERE PROJECT MANAGEMENT CENTER N1!PA Dl!1'ElU.llNATION  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

N1!PA Dl!1'ElU.llNATION N1!PA Dl!1'ElU.llNATION RECIPIENT:City of Perth Amboy PROJECT TITLE : Municipal Complex Solar Power Project Page 1 of2 STATE: NJ Funding Opportunity Announl::ement Number Procurement Instrument Number NEPA Control Number elD Number Congressionally Directed Project DE· EEOOO3172 GF0-0003172..Q01 EE3172 Based on my review of the information concerning the proposed action, as N[PA Compliance Officer (authoro.ed under DOE Order451.1A),1 have made tbe following determination: ex, EA, EIS APPENDIX AND NUMBER: Description: 8 5.1 Adions to oonserve energy, demonstrate potential energy conservation, and promote energy-efficiency that do not increase the indoor concentratIOns of potentially harmful substances. These actions may involve financial and technical

82

Recrystallization in CdTe/CdS A. Romeo, D.L. Batzner, H. Zogg, A.N. Tiwari*  

E-Print Network (OSTI)

Recrystallization in CdTe/CdS A. Romeo, D.L. BaĂ?tzner, H. Zogg, A.N. Tiwari* Thin Film Physics with HVE and CBD grown CdS window layers. q 2000 Elsevier Science S.A. All rights reserved. Keywords: Cd and to different deposition techniques of the window layer. Chemi- cal bath deposition (CBD) grown CdS is preferred

Romeo, Alessandro

83

Influence of Limestone Addition in a 10 kWth Chemical-Looping Combustion Unit Operated with Petcoke  

Science Journals Connector (OSTI)

Influence of Limestone Addition in a 10 kWth Chemical-Looping Combustion Unit Operated with Petcoke ... The fuel fed was a petcoke, and the gasifying agent was steam. ... (14) To date, continuous testing with ilmenite as an oxygen carrier has been performed with a Mexican petcoke,(15, 16) South African coal,(17) and Colombian bituminous coal. ...

Ana Cuadrat; Carl Linderholm; Alberto Abad; Anders Lyngfelt; Juan Adánez

2011-08-29T23:59:59.000Z

84

Strontium and carbon isotope stratigraphy of the Late Jurassic shallow marine limestone in western Palaeo-Pacific, northwest Borneo  

E-Print Network (OSTI)

Strontium and carbon isotope stratigraphy of the Late Jurassic shallow marine limestone in western-Pacific a b s t r a c t Strontium and carbon isotope stratigraphy was applied to a 202 m-thick shallow marine, which was deposited in the western Palaeo-Pacific. Strontium isotopic ratios of rudist specimens suggest

Gilli, Adrian

85

Laboratory Investigations in Support of Dioxide-Limestone Sequestration in the Ocean  

SciTech Connect

Research under this Project has proven that liquid carbon dioxide can be emulsified in water by using very fine particles as emulsion stabilizers. Hydrophilic particles stabilize a CO{sub 2}-in-H{sub 2}O (C/W) emulsion; hydrophobic particles stabilize a H{sub 2}O-in-CO{sub 2} (W/C) emulsion. The C/W emulsion consists of tiny CO{sub 2} droplets coated with hydrophilic particles dispersed in water. The W/C emulsion consists of tiny H{sub 2}O droplets coated with hydrophobic particles dispersed in liquid carbon dioxide. The coated droplets are called globules. The emulsions could be used for deep ocean sequestration of CO{sub 2}. Liquid CO{sub 2} is sparsely soluble in water, and is less dense than seawater. If neat, liquid CO{sub 2} were injected in the deep ocean, it is likely that the dispersed CO{sub 2} droplets would buoy upward and flash into vapor before the droplets dissolve in seawater. The resulting vapor bubbles would re-emerge into the atmosphere. On the other hand, the emulsion is denser than seawater, hence the emulsion plume would sink toward greater depth from the injection point. For ocean sequestration a C/W emulsion appears to be most practical using limestone (CaCO{sub 3}) particles of a few to ten ?m diameter as stabilizing agents. A mix of one volume of liquid CO{sub 2} with two volumes of H{sub 2}O, plus 0.5 weight of pulverized limestone per weight of liquid CO{sub 2} forms a stable emulsion with density 1087 kg m{sup -3}. Ambient seawater at 500 m depth has a density of approximately 1026 kg m{sup -3}, so the emulsion plume would sink by gravity while entraining ambient seawater till density equilibrium is reached. Limestone is abundant world-wide, and is relatively cheap. Furthermore, upon disintegration of the emulsion the CaCO{sub 3} particles would partially buffer the carbonic acid that forms when CO{sub 2} dissolves in seawater, alleviating some of the concerns of discharging CO{sub 2} in the deep ocean. Laboratory experiments showed that the CaCO{sub 3} emulsion is slightly alkaline, not acidic. We tested the release of the CO{sub 2}-in-H{sub 2}O emulsion stabilized by pulverized limestone in the DOE National Energy Technology Laboratory High Pressure Water Tunnel Facility (HPWTF). Digital photographs showed the sinking globules in the HPWTF, confirming the concept of releasing the emulsion in the deep ocean. We modeled the release of an emulsion from the CO{sub 2} output of a 1000 MW coal-fired power plant at 500 m depth. The emulsion would typically sink several hundred meters before density equilibration with ambient seawater. The CO{sub 2} globules would rain out from the equilibrated plume toward the ocean bottom where they would disintegrate due to wave action and bottom friction. Conceptual release systems are described both for an open ocean release and a sloping seabed release of the emulsion.

Dan Golomb; Eugene Barry; David Ryan; Stephen Pennell; Carl Lawton; Peter Swett; Devinder Arora; John Hannon; Michael Woods; Huishan Duan; Tom Lawlor

2008-09-30T23:59:59.000Z

86

In situ vitrification of Oak Ridge National Laboratory soil and limestone  

SciTech Connect

Process feasibility studies were successfully performed on two different developmental scales to determine the technical application of in situ vitrification (ISV) to Oak Ridge National Laboratory (ORNL) intermediate-level waste. In the laboratory, testing was performed on crucibles containing quantities of 50% ORNL soil and 50% ORNL limestone. In the engineering-scale testing, a 1/12-scaled simulation of ORNL Trench 7 was constructed and vitrified, resulting in waste product soil and limestone concentrations of 68% and 32%, respectively. Results from the two scales of testing indicate that the ORNL intermediate-level waste sites may be successfully processed by ISV; the waste form will retain significant quantities of the cesium and strontium. Because /sup 137/Cs is the major component of the radionuclide inventory in the ORNL seepage pits and trenches, final field process decontamination factors (i.e., off gas at the ground surface relative to the waste inventory) of 10/sup 4/ are desired to minimize activity buildup in the off-gas system. These values were realized during the engineering-scale test for both cesium and strontium. The vitrified material effectively contained 99.996% of the cesium and strontium placed in the engineering-scale test. This is equivalent to decontamination factors of greater than 10/sup 4/. Volume reduction for the engineering-scale test was 60%. No migration of the cesium to the uncontaminated surrounding soil was detected. These favorable results indicate that, once verified in a pilot-scale test, an adequately designed ISV system could be produced to treat the ORNL seepage pits and trenches without excessive activity accumulation in the off-gas treatment system.

Carter, J.G.; Bates, S.O.; Maupin, G.D.

1987-03-01T23:59:59.000Z

87

Changes in Perforation-Induced Formation Damage With Degree of Underbalance: Comparison of Sandstone and Limestone Formations  

SciTech Connect

Field data and recently developed models provide some guidance for estimating the underbalance needed to obtain fully functional perforations, but there are little data available that relate flow efficiency to lower underbalances in different rock types. To improve understanding of the surge cleanup process, we have performed two series of perforation flow tests in Berea Sandstone and in Bedford Limestone cores at increasing levels of underbalance. Flow tests were performed according to modified API RP43, section 4 test procedures. At the conclusion of the tests, the cores were analyzed using high-resolution X-ray CT techniques. The shape, dimensions and total volumes of both the open tunnel and the remaining embedded liner metal were extracted from the CT data and correlated with the underbalance and with the flow test results. Open tunnel diameters and volumes are much lower in the limestone samples. While the amount of metal remaining in the tunnel and at the perforation tip decreases dramatically with underbalance in Berea Sandstone cores, the amount of metal is nearly constant in the limestone cores. Conversely, the tunnel volume increases with underbalance in the Sandstone cores but stays constant in the limestone. Core flow efficiency results correlate with these observations. There is a sharp increase in CFE in the sandstone samples as the tunnel volumes increase and little change in CFE in the limestone samples corresponding to unchanging tunnel volume. The tests also offer some evidence of the cleanup mechanism at the perforation tip, at least in the sandstone cores. Samples at intermediate underbalance levels show evidence of open tunnel space in an annulus surrounding the metal slug at the tip. This suggests that cleanup may proceed at least partially by axial flow through crushed rock surrounding the metal. As this material erodes away, the metal is loosened and is flushed from the tunnel. Existing models for cleanup are based primarily on radial flow.

Detwiler, R; Halleck, P M; Karacan, C O; Hardesty, J

2003-10-22T23:59:59.000Z

88

LABORATORY INVESTIGATIONS IN SUPPORT OF CARBON DIOXIDE-LIMESTONE SEQUESTRATION IN THE OCEAN  

SciTech Connect

In the second half of the second contractual year the construction of the High Pressure Flow Reactor (HPFR) was completed, tested, and satisfactory results have been obtained. The major component of the HPFR is a Kenics-type static mixer in which two fluids are thoroughly mixed. In our case the two fluids are liquid or supercritical CO{sub 2} and a slurry of pulverized limestone (CaCO{sub 3}) in pure or artificial seawater. The outflow from the static mixer is an emulsion consisting of CO{sub 2} droplets coated with a sheath of CaCO{sub 3} particles dispersed in water. The coated CO{sub 2} droplets are called globules, and the emulsion is called globulsion. By adjusting the proportions of the two fluids, carbon dioxide and water, the length and pressure drop across the static mixer, globules with a fairly uniform distribution of diameters can be obtained. By using different particle sizes of CaCO{sub 3}, globules can be obtained that are lighter or heavier than water, thus floating or sinking in a water column. The globulsion ensuing from the static mixer flows into a high pressure cell with windows, where the properties of the globules can be observed, such as their diameter and settling velocity. Using the Stokes' equation, the specific gravity of the globules can be determined. Also, a second generation High Pressure Batch Reactor (HPBR) was constructed. This reactor allows better mixing of the ingredients, more accurate temperature and pressure control, better illumination and video camera observations. In this reactor we established that CO{sub 2}-in-water globulsions can be formed stabilized by other particles than pulverized limestone. So far, we used flyash obtained from a local coal-fired power plant, and a pulverized magnesium silicate mineral, lizardite, Mg{sub 3}Si{sub 2}O{sub 5}(OH){sub 4}, obtained from DOE's Albany Research Laboratory. In the reporting period we conducted joint experiments in NETL's high pressure water tunnel facility. Thanks to the longer travel path of the globules, and the excellent optical instrumentation available at NETL, we were able to more accurately obtain globule diameters and settling velocities.

Dan Golomb; Eugene Barry; David Ryan; Carl Lawton; Peter Swett; John Hannon; Huishan Duan

2004-09-01T23:59:59.000Z

89

Column Experiments for Radionuclide Adsorption Studies of the Culebra Dolomite: Retardation Parameter Estimation for Non-Eluted Actinide Species  

SciTech Connect

The U.S. Department of Energy (DOE) has been developing a nuclear waste disposal facility, the Waste Isolation Pilot Plant (WIPP), located approximately 42 km east of Carlsbad, New Mexico. The WIPP is designed to demonstrate the safe disposal of transuranic wastes produced by the defense nuclear-weapons program. Performance assessment analyses (U.S. DOE, 1996) indicate that human intrusion by inadvertent and intermittent drilling for resources provide the only credible mechanisms for significant releases of radionuclides horn the disposal system. These releases may occur by five mechanisms: (1) cuttings, (2) cavings, (3) spallings, (4) direct brine releases, and (5) long-term brine releases. The first four mechanisms could result in immediate release of contaminant to the accessible environment. For the last mechanism, migration pathways through the permeable layers of rock above the Salado are important, and major emphasis is placed on the Culebra Member of the Rustler Formation because this is the most transmissive geologic layer in the disposal system. For reasons of initial quantity, half-life, and specific radioactivity, certain isotopes of Th, U, Am, and Pu would dominate calculated releases from the WIPP. In order to help quanti~ parameters for the calculated releases, radionuclide transport experiments have been carried out using five intact-core columns obtained from the Culebra dolomite member of the Rustler Formation within the Waste Isolation Pilot Plant (WIPP) site in southeastern New Mexico. This report deals primarily with results of mathematical analyses related to the retardation of %J%, 24%, and 24'Am in two of these cores (B-Core - VPX26-11A and C-Core - VPX28-6C). All B-Core transport experiments were done using Culebra-simukmt brine relevant to the core recovery location (the WIPP air-intake shaft - AIS). Most experiments with C-Core were done with AIS brine with some admixture of a brine composition (ERDA-6) that simulated deeper formation brines. No significant changes in transport behavior were observed for changes in brine. Hydraulic characteristics (i.e., apparent porosity and apparent dispersion coefficient) for the cores were obtained via experiments using conservative tracer `Na. Elution experiments carried out over periods of a few days with tracers `*U and %Np indicated that these tracers were weakly retarded as indicated by delayed elution of these species. Elution experiments with tracers `%, 24'Pu, and 24'Ani were performed, but no elution of any of these species was observed in any flow experiment to date, including experiments of up to two years duration. However, B-Core was subjected to tomographic analysis from which a retardation factor can be inferred for%. Moreover, the fact of non- elution for 24*Pu and 24'Am after more than two years brine flow through C-Core can be coupled with the minimum detectable activity for each of these species to compute minimum retardation factors in C-Core. The retardation factors for all three species can then be coupled with the apparent hydraulic characteristics to estimate an apparent minimum solutionhock distribution coefficient, &, for each actinide. The specific radionuclide isotopes used in these experiments were chosen to facilitate analysis. Even though these isotopes are not necessarily the same as those that are most important to WIPP performance, they are isotopes of the same elements, and . their chemical and transport properties are therefore identical to those of isotopes in the WIPP inventory. The retardation factors and & values deduced from experimental results strongly support the contention that sorption in the Culebra provides an effective barrier to release of Th, Pu, and Am during the regulatory period.

Brown, G.O.; Lucero, D.A.; Perkins, W.G.

1999-01-01T23:59:59.000Z

90

Recovery and utilization of gypsum and limestone from scrubber sludge. [Quarterly] technical report, March 1, 1993--May 31, 1993  

SciTech Connect

Wet flue-gas desulfurization units in coal-fired power plants produce a large amount of sludge which must be disposed of, and which is currently landfilled in most cases. Increasing landfill costs are gradually forcing utilities to find other alternatives. In principle, this sludge can be used to make gypsum (CaSO{sub 4}-2H{sub 2}O) for products such as plaster-of-Paris and wallboard, but only if impurities such as unreacted limestone and soluble salts are removed, and the calcium sulfite (CaSO{sub 3}) is oxidized to calcium sulfate (CaSO{sub 4}). This project is investigating methods for removing the impurities from the sludge so that high-quality, salable gypsum products can be made. Work done in the previous quarter concentrated on developing a low-cost froth flotation process that could remove limestone, unburned carbon, and related contaminants from the sludge while recovering the bulk of the calcium sulfite and gypsum. In the current quarter, experiments to remove impurities from the sludge using a water-only cyclone were conducted. The cyclone has been found to be effective for removing the coarser limestone impurities, as well as removing contaminants such as fine gravel and grinding-ball chips. These results show that the cyclone will be very complementary with froth flotation, which mainly removes the very fine impurities.

Kawatra, S.K.; Eisele, T.C. [Michigan Technological Univ., Houghton, MI (United States). Dept. of Metallurgical and Materials Engineering

1993-09-01T23:59:59.000Z

91

CANSOLV{reg_sign} system FGD: An alternative to limestone SO{sub 2} control in FBC  

SciTech Connect

This paper describes the process chemistry, components, emissions, and by-products of the CANSOLV{reg_sign} System SO{sub 2} scrubbing technology, a regenerable process for economical, highly selective capture of SO{sub 2} from gas streams, with outlet SO{sub 2} concentration down to a few ppm if desired. In fluid bed combustors, the CANSOLV{reg_sign} System FGD process can be substituted for limestone injection, realizing significant cost savings. With CANSOLV{reg_sign} System Technology, the FGD by-product is pure, water saturated SO{sub 2} which can be used on site or sold as a commodity chemical or converted into sulfuric acid or sulfur. Since FGD costs with the CANSOLV{reg_sign} System process are only weakly sensitive to the concentration of SO{sub 2} in the feed gas, high sulfur low costs fuels including petroleum coke can be burned economically. Compared with limestone injection in FBC, the CANSOLV{reg_sign} System FGD process eliminates the need for limestone handling. Solid by-product volumes are very significantly reduced, simplifying both collection and disposal. Chemical consumption is essentially eliminated. The process generates a valuable by-product instead of a costly waste stream. Fuel costs can be minimized and significant operating cost savings can be expected. 3 refs., 4 figs.

Parisi, P.J.; Sarlis, J.N. [Cansolv Technologies Inc., Montreal, Quebec (Canada)

1997-12-31T23:59:59.000Z

92

U.S. DEPARTIl1ENT OF ENERGY EERE PROJECT MANAGEMENT CENTER NEPA Dl!TFR1ITNATION  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

ENT OF ENERGY ENT OF ENERGY EERE PROJECT MANAGEMENT CENTER NEPA Dl!TFR1ITNATION RECIPIENT:Colorado School of Mines Page 1 on STATE: CO PROJECT TITLE: Time-lapse Joint Inversion of GEOphysical Data and its Application to Geothermal Prospecting GEODE Funding Opportunity Announcement Number DOE DE-FOA-OOOO522 Procurement Instrument Number OE-EEOOO5513 NEPA Control Number em Number GFO-o005513-Q01 0 Based on my review ofthe information concerning the proposed action, as NEPA Compliance Officer (authorized under DOE Order 451.IA), 1 have made the following determination: ex, EA, EIS APPENDIX AND NUMBER: Description: A9 1nformation ga thering, a nalysis, a nd d issem ination Information gathering (including, but not limited to, literature surveys, inventories, site visils, and audits), data analysis

93

PMC·Fr.. U.S. Dl?PARThIENT OFFNFRGY EERE PROJECT MANAGEMENT CE~TER  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Fr.. Fr.. U.S. Dl?PARThIENT OFFNFRGY EERE PROJECT MANAGEMENT CE~TER Nl!PA DF=llNATION RECIPIENT:Oregon Stale University-NNMREC PROJECT TITLE : Pacific Marine Energy Center FY2012 Funding Page 1 of3 STATE: OR Funding Opportunity Announcement Number Procurement Instrument Number NEPA Control Number CID Number G098030 DE-FG36-08GOI8179 GFO-GOI8179-004 G018179 Based on my review of the information concerning the proposed action, as NEPA Compliance Officer (authorized under DOE Order 451. 1A), I have made the following determination: ex, EA, EIS APPENDIX AND NUMBER: Description: A9 Inform ation gathering, analys is, and disseminatlon A1 1 Technical advice and assistance to organizations Information gathering (including, but not limited to, literature surveys, inventories, site visits, and

94

RECIPIENT:QDOE U.S. Dl1PARTlIIENT OF ENERGY EERE PROJECT MANAGEMENT CENTER  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

QDOE QDOE U.S. Dl1PARTlIIENT OF ENERGY EERE PROJECT MANAGEMENT CENTER Nl!PA DETERMINATION Page 1 of2 STATE: OR PROJECT TITL.E : SEP ARRA - Deployment of Innovative Energy Efficiency and Renewable Energy - Agriculture - Dufur & HanncrCantrell Funding Opportunity Announcement Number Pro<:uremeniinstruml.'nt Number NEPA Control Number elD Number OE-FOA-OOOOOS2 EEOOOO140 GF0-0000140-001 EE140 Based on my review of the Information concerning the proposed action, as NEPA Compliance Officer (authorized under DOE Order 4SUA), I have made the following determination: ex, EA, EIS APPENDIX AND NUMBER: De~cription: 85.1 Actions to conserve energy. demonstrate potential energy oonservalion, and promote energy-efficiency that do not increase the indoor concentrations o

95

DEPARThIENT OF ENERGY EERE PROJECT MANAGEMENT CENTER NEPA Dl!1'FIt1.fiNATION  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

DEPARThIENT OF ENERGY DEPARThIENT OF ENERGY EERE PROJECT MANAGEMENT CENTER NEPA Dl!1'FIt1.fiNATION RECIPIENT:Biomass Energy Resource Center PROJECf TITLE: Biomass Energy Resource Center - Core and Program Support Page 1 of2 STATE: VT Funding Opportunity Annoum:emenl Number Procu~ment Instrument Number NEPA Control Number CID Number COP DE-FG36-06G086103,AOO4 GFO-G086103-003 0 Based on my review oflhl' information concerning the proposed action, as NEPA Compliance Officer (aulhoru.ed under DOE Order 451.1A), I bne made the following determination: ex, EA, EIS APPF..NDIX AND NUMBER: Description: A9 Information gathering (including, but not limited 10, literature surveys, inventories, audits), data analysis (including computer modeling), document preparation (such as conceptual design or feasibility studies, analytical energy supply and

96

An investigation of the creep phenomena exhibited by Solenhofen limestone, halite, and cement under medium confining pressures  

E-Print Network (OSTI)

BY SOLENHOFEN LIMESTONE, HALITE, AND CFMI-NT UNDFR MEPIUI CONFINING PRESSURES A THESIS Bv HALCOMBE A. KENDALL A PPROVEO AS TO STYLE AND CONTENT BY AIRMAN OF COMM TTEE EAD OF PEPARTMENT ~M* 19 8 A BSTRACT TABLE OF CONTENTS PAGE 1 INTRODUCT ION... SPECI'i NS. . FIGURE 9 . FAILURE OF HALITE CRYSTALS . . ABSTRACT THE DYNAMICS OF THE CREEP PHENOMENA OF ROCKS I S KNOWN TO BE INTER RELATED WI TH THE NATURAL ENVIROMENTAL COND IT IONG FOUND DEEP IN THE CRUST OF THE EARTH ~ AHONG THESE COND I...

Kendall, Halcombe Augustus

2012-06-07T23:59:59.000Z

97

Diagenetic controls on porosity and permeability in Miocene carbonates, La Molata, Spain  

E-Print Network (OSTI)

and oxygen isotopes, Sr concentration and 87Sr/86Sr. The carbonate platform was extensively dolomitized at the end of the Miocene but before Pliocene deposition. Amount of dolomite increases basinward and down section; limestone is restricted to the most...

Li, Zhaoqi

2012-05-31T23:59:59.000Z

98

Cryogenic friction behavior of PTFE based solid lubricant composites N.L. McCook, D.L. Burris, P.L. Dickrell and W.G. Sawyer*  

E-Print Network (OSTI)

Cryogenic friction behavior of PTFE based solid lubricant composites N.L. McCook, D.L. Burris, P life [4,5], ability to operate from cryogenic temperature (4 K) to 500 K, and their relative that operate at cryogenic temperatures, there is a paucity of data available for friction coeffi- cients

Sawyer, Wallace

99

The feedback phase instability in the HBT-EP tokamak D.L. Nadle, C. Cates, H. Dahi, M.E. Mauel,  

E-Print Network (OSTI)

The feedback phase instability in the HBT-EP tokamak D.L. Nadle, C. Cates, H. Dahi, M.E. Mauel, D of a performance limiting feedback phase instability in the HBT-EP toka- mak are reported. The phase instability instability limits feedback performance in HBT-EP by decreasing the feedback loop's phase accuracy as gain

Mauel, Michael E.

100

Kinetics of Adsorption of Selenate and Selonite at the Goethite/Water InterfAce. p.e. ZHANG* and D.L. SPARKS.  

E-Print Network (OSTI)

Kinetics of Adsorption of Selenate and Selonite at the Goethite/Water InterfAce. p.e. ZHANG* and D.L. SPARKS. Univ. of Delaware. Mechanisms and kinetics of SeO, and Se~ at the goethite/water interface were

Sparks, Donald L.

Note: This page contains sample records for the topic "dl dolomitic limestone" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


101

Recovery and utilization of gypsum and limestone from scrubber sludge. Technical report, December 1, 1992--February 28, 1993  

SciTech Connect

Wet flue-gas desulfurization units in coal-fired power plants produce a large amount of sludge which must be disposed of, and which is currently landfilled in most cases. Increasing landfill costs are gradually forcing utilities to find other alternatives. In principle, this sludge can be used to make gypsum (CaSO{sub 4}-2H{sub 2}O) for products such as plaster-of-Paris and wallboard, but only if impurities such as unreacted limestone and soluble salts are removed, and the calcium sulfite (CaSO{sub 3}) is oxidized to calcium sulfate (CaSO{sub 4}). This project is investigating methods for removing the impurities from the sludge so that high-quality, salable gypsum products can be made. Work done in the previous quarter concentrated on developing a dependable technique for analysis of scrubber sludge, so that it would be possible to determine exactly how well a particular purification process was working. This technique was then used to characterize the sludge from a particular Illinois power station. In the current quarter, studies were carried out using froth flotation to produce a product that could be oxidized to high-purity gypsum. These experiments have been quite successful, due to certain properties of the limestone impurity that makes it easier to remove by this method than was expected.

Kawatra, S.K.; Eisele, T.C. [Michigan Technological Univ., Houghton, MI (United States). Dept. of Metallurgical and Materials Engineering; Banerjee, D. [Illinois Clean Coal Inst., Carterville, IL (United States)

1993-05-01T23:59:59.000Z

102

An evaluation of acid frac/matrix stimulation of a tight limestone formation in exploratory wells in Kuwait  

SciTech Connect

With the advent of Kuwait's intensive exploratory activities to locate and test deeper geologic structures, tighter and very low porosity limestone formations were progressively encountered. Most of these hydrocarbon bearing formations initially appeared to be very stubborn and hardly indicated any fluid influx into the well-bore. In certain cases the hydrostatic head was nearly completely removed by unloading the well practically down to perforations, thereby creating optimum draw-down but it either resulted in poor inflow or none at all. In the absence of currently available chemicals, equipment, job design engineering and better understanding of tight carbonate formations and their responses to various acid formulations, some of these could have slipped into unattractive categories. With the implementation of specially designed matrix and acid-frac treatments, these formation have, however, been unmasked and turned out to be highly potential finds now. This paper basically outlines the salient features of theoretical and operational aspects of stimulating and testing some of the very low porosity hard limestone formations in Kuwait recently.

Singh, J.R.

1985-03-01T23:59:59.000Z

103

Pilot-scale Limestone Emission Control (LEC) process: A development project. Volume 1, Main report and appendices A, B, C, and D: Final report  

SciTech Connect

ETS, Inc., a pollution consulting firm with headquarters in Roanoke, Virginia, has developed a dry, limestone-based flue gas desulfurization (FGD) system. This SO{sub 2} removal system, called Limestone Emission Control (LEC), can be designed for installation on either new or existing coal-fired boilers. In the LEC process, the SO{sub 2} in the flue gas reacts with wetted granular limestone that is contained in a moving bed. A surface layer of principally calcium sulfate (CaSO{sub 4}) is formed on the limestone. Periodic removal of this surface layer by mechanical agitation allows high utilization of the limestone granules. A nominal 5,000 acfm LEC pilot plant has been designed, fabricated and installed on the slipstream of a 70,000 pph stoker boiler providing steam to Ohio University`s Athens, Ohio campus. A total of over 90 experimental trials have been performed using the pilot-scale moving-bed LEC dry scrubber as a part of this research project with run times ranging up to a high of 125 hours. SO{sub 2} removal efficiencies as high as 99.9% were achievable for all experimental conditions studied during which sufficient humidification was added to the LEC bed. The LEC process and conventional limestone scrubbing have been compared on an equatable basis using flue gas conditions that would be expected at the outlet of the electrostatic precipitator (ESP) of a 500 MW coal-fired power plant. The LEC was found to have a definite economic advantage in both direct capital costs and operating costs. Based on the success and findings of the present project, the next step in LEC process development will be a full-scale commercial demonstration unit.

Prudich, M.E. [Ohio Univ., Athens, OH (United States); Appell, K.W.; McKenna, J.D. [ETS, Inc., Roanoke, VA (United States)

1994-03-01T23:59:59.000Z

104

LABORATORY INVESTIGATIONS IN SUPPORT OF CARBON DIOXIDE-LIMESTONE SEQUESTRATION IN THE OCEAN  

SciTech Connect

This semi-annual progress reports includes further findings on CO{sub 2}-in-Water (C/W) emulsions stabilized by fine particles. In previous reports we described C/W emulsions using pulverized limestone (CaCO{sub 3}), flyash, and a pulverized magnesium silicate mineral, lizardite, Mg{sub 3}Si{sub 2}O{sub 5}(OH){sub 4}, which has a similar composition as the more abundant mineral, serpentine. All these materials formed stable emulsions consisting of droplets of liquid or supercritical CO{sub 2} coated with a sheath of particles dispersed in water. During this semi-annual period we experimented with pulverized beach sand (10-20 {micro}m particle diameter). Pulverized sand produced an emulsion similar to the previously used materials. The globules are heavier than water, thus they accumulate at the bottom of the water column. Energy Dispersive X-ray (EDX) analysis revealed that the sand particles consisted mainly of SiO{sub 2}. Sand is one of the most abundant materials on earth, so the economic and energy penalties of using it for ocean sequestration consist mainly of the cost of transporting the sand to the user, the capital and operating costs of the pulverizer, and the energy expenditure for mining, shipping and grinding the sand. Most likely, sand powder would be innocuous to marine organisms if released together with CO{sub 2} in the deep ocean. We examined the effects of methanol (MeOH) and monoethanolamine (MEA) on emulsion formation. These solvents are currently used for pre- and post-combustion capture of CO{sub 2}. A fraction of the solvents may be captured together with CO{sub 2}. A volume fraction of 5% of these solvents in a mix of CO{sub 2}/CaCO{sub 3}/H{sub 2}O had no apparent effect on emulsion formation. Previously we have shown that a 3.5% by weight of common salt (NaCl) in water, simulating seawater, also had no appreciable effect on emulsion formation. We investigated the formation of inverted emulsions, where water droplets coated with pulverized materials are dispersed in liquid or supercritical CO{sub 2}. This is a Water-in-CO{sub 2} emulsion (W/C) stabilized by particles. For a W/C emulsion it is necessary to employ hydrophobic particles, where the particles are primarily wetted by CO{sub 2}. We used the following hydrophobic particles: carbon black, coal dust, and Teflon. All materials were either obtained as fine particles or ground to 10-20 {micro}m size. All these hydrophobic particles produced a stable W/C emulsion.

Dan Golomb; Eugene Barry; David Ryan; Carl Lawton; Peter Swett; Huishan Duan; Matthew Woodcock

2005-04-01T23:59:59.000Z

105

Laboratory Investigations in Support of Carbon Dioxide-Limestone Sequestration in the Ocean  

SciTech Connect

This semi-annual progress reports includes further findings on CO{sub 2}-in-Water emulsions stabilized by fine particles of limestone (CaCO{sub 3}). Specifically, here we report on the tests performed in the DOE National Energy Technology Laboratory High Pressure Water Tunnel Facility (HPWTF) using a Kenics-type static mixer for the formation of a CO{sub 2}-H{sub 2}O emulsion stabilized by fine particles of CaCO{sub 3}. The tested static mixer has an ID of 0.5 cm, length 23.5 cm, number of baffles 27. Under pressure, a slurry of CaCO{sub 3} particles (mean particle size 6 {micro}m) in reverse osmosis (RO) water and liquid CO{sub 2} were co-injected into the mixer. From the mixer, the resulting emulsion flowed into the HPWTF, which was filled with RO water kept at 6.8 MPa pressure and 4, 8 or 12 C. The emulsion plume was photographed by three video cameras through spy windows mounted on the wall of the HPWTF. The mixer produced an emulsion consisting of tiny CO{sub 2} droplets sheathed with a layer of CaCO{sub 3} particles dispersed in water. The sheathed droplets are called globules. The globules diameter was measured to be in the 300-500 {micro}m range. The globules were sinking in the HPWTF, indicating that they are heavier than the ambient water. The tests in the HPWTF confirmed that the Kenics-type static mixer is an efficient device for forming a CO{sub 2}-H{sub 2}O emulsion stabilized by fine particles of CaCO{sub 3}. The static mixer may prove to be a practical device for sequestering large quantities of CO{sub 2} in the deep ocean in the form of a CO{sub 2}-H{sub 2}O-CaCO{sub 3} emulsion. The static mixer can be mounted at the end of pipelines feeding the mixer. The static mixer has no moving parts. The pressure drop across the mixer that is necessary to sustain good mixing is created by the hydrostatic pressure of liquid CO{sub 2} and the slurry of CaCO{sub 3} in the pipes that feed the mixer. The tests in the HPWTF demonstrated that the emulsion plume is heavier than ambient seawater, hence the plume will sink to greater depth from the release point. Preliminary modeling indicates that an emulsion plume released at 500 m depth (the minimum depth required to prevent liquid CO{sub 2} flashing into vapor) may sink hundreds of meters before the plume comes to rest in the density stratified ocean water. Furthermore, tests in our laboratory showed that the emulsion is slightly alkaline, not acidic, because of the excess of CaCO{sub 3} particles present in the plume. Thus, the release of the CO{sub 2}-H{sub 2}OCaCO{sub 3} emulsion in the deep ocean is not likely to acidify the seawater around the release point. The possible acidification of seawater is the major environmental hazard if pure liquid CO{sub 2} were released in the deep ocean.

Dan Golomb; Eugene Barry; David Ryan; Stephen Pennell; Peter Swett; Huishan Duan; Michael Woods

2006-04-01T23:59:59.000Z

106

--No Title--  

National Nuclear Security Administration (NNSA)

early Permian in age and consist of 22,000 feet of limestone, dolomite, quartzite, shale, and conglomerate beds. The predominantly volcanic Oak Springs formation of Tertiary...

107

Title  

National Nuclear Security Administration (NNSA)

early Permian in age and consist of 22,000 feet of limestone, dolomite, quartz- ite, shale, and conglomerate beds. The predominantly volcanic Oak Springs formation of Tertiary...

108

Numerical simulation of ground-water flow in the Culebra dolomite at the Waste Isolation Pilot Plant (WIPP) site: Second interim report  

SciTech Connect

This hydrogeologic modeling study has been performed as part of the regional hydrologic characterization of the Waste Isolation Pilot Plant (WIPP) Site in southeastern New Mexico. The study resulted in an estimation of the transmissivity distrubution, hydraulic potentials, flow field, and fluid densities in the Culebra Dolomite Member of the Permian Rustler Formation at the WIPP site. The three-dimensional finite-difference code SWIFT-II was employed for the numerical modeling, using variable-fluid-density and a single-porosity formulation. The modeled area includes and extends beyond the WIPP controlled zone (Zone 3). The work performed consisted of modeling the hydrogeology of the Culebra using two approaches: (1) steady-state modeling to develop the best estimate of the undisturbed head distribution, i.e., of the situation before sinking if the WIPP shafts, which began in 1981; and (2) superimposed transient modeling of local hydrologic responses to excavation of the three WIPP shafts at the center of the WIPP site, as well as to various well tests. Boundary conditions (prescribed constant fluid pressures and densities) were estimated using hydraulic-head and fluid-density data obtained from about 40 wells at and near the WIPP site. The transient modeling used the calculated steady-state freshwater heads as initial conditions. 107 refs., 112 figs., 22 tabs.

LaVenue, A.M.; Haug, A.; Kelley, V.A.

1988-03-01T23:59:59.000Z

109

Pneumatic conveying of coal and coal-limestone mixtures as applied to atmospheric fluidized-bed combustion. [Effects of moisture, velocity, particle size  

SciTech Connect

Pneumatic conveying experiments with coal and coal-limestone mixtures were performed on a conveying system designed to represent the feed lines in the Tennessee Valley Authority 20 MW atmospheric fluidized bed combustor. The experimental conditions were chosen to cover the anticipated combustor operating ranges. The results have led to a fundamental understanding of the operating limits associated with coal surface moisture, air velocity, coal and limestone fines, solids to air ratio, and limestone to coal ratio. Coal surface moisture was found to be the most important parameter affecting handling and transport. Specific upper limits for surface moisture were established. It was demonstrated that addition of dry limestone can reduce the conveying problems associated with wet coal. The air velocities causing saltation and surge flow were determined for a variety of conveying conditions. These velocities were related qualitatively to solids to air ratio, particle size, and surface moisture. Conveying pressure drop was also measured for a variety of conditions. In the absence of saltation, the horizontal, frictional pressure drop was only a function of the solids to air ratio and the air flow conditions. Comparison of the ORNL pressure drop data with the results of other investigators had led to the conclusion that there are two basic modes of flow in dilute-phase conveying; a primarily viscous mode and a primarily inertial mode. A general pressure drop model has been developed for the inertial mode.

Daw, C S; Thomas, J F

1982-01-01T23:59:59.000Z

110

DEVELOPMENT OF HIGH EFFICIENCY FLEXIBLE CdTe SOLAR CELLS A.Romeo, M. Arnold, D.L. Btzner, H. Zogg and A.N. Tiwari*  

E-Print Network (OSTI)

to the solar panel that can be adapted to any kind of shape and is easy to deploy in space. In the last yearsDEVELOPMENT OF HIGH EFFICIENCY FLEXIBLE CdTe SOLAR CELLS A.Romeo, M. Arnold, D.L. BĂ€tzner, H. Zogg Telephone: +44-1509-227031 E-mail: a.n.tiwari@lboro.ac.uk ABSTRACT: Polycrystalline thin film solar cells

Romeo, Alessandro

111

A study of the effects of limestone rock asphalt screenings on the structural properties of hot-mix asphaltic concrete made with siliceous materials  

E-Print Network (OSTI)

School of the Agricultural and Mechanical College of Texas in partial fulfillment of the requirements for the degree of MASTER OF SCIENCE August 1958 Major Subject: Civil Engineering A STUDY OF THE EFFECTS OF LIMESTONE ROCK ASPHALT SCREENINGS... to Bob M. Gallaway, Associate Pro- fessor of Civil Engineering, without whose guidance and inspiration this work would not have been possible; to Charles J. Keese, Asso- ciate Professor of Civil Engineering, for valued advice and criticism; to Dr. E...

Albritton, Oscar Willard

1958-01-01T23:59:59.000Z

112

Limestone calcination with CO{sub 2} capture (II): decomposition in CO{sub 2}/steam and CO{sub 2}/N{sub 2} atmospheres  

SciTech Connect

Decomposition of limestone particles (0.25-0.5 mm) in a steam dilution atmosphere (20-100% steam in CO{sub 2}) was investigated by using a continuously operating fluidized bed reactor for CO{sub 2} capture. The decomposition conversion of limestone increased as the steam dilution percentage in the CO{sub 2} supply gas increased. At a bed temperature of 1193 K, the conversions were 72% without dilution (100% CO{sub 2}) and 98% with 60% steam dilution. The decomposition conversions obtained with steam dilution and N{sub 2} dilution differed significantly, and this result is explained in terms of the difference between the heat transfer to particle in steam and N{sub 2} dilution atmosphere. The reactivities of the CaO produced from limestone decomposition with steam dilution and without dilution (100% CO{sub 2}) were tested by means of hydration and carbonation reactions. In the hydration test, the time required for complete conversion (CaO{yields}Ca(OH){sub 2}) of the CaO produced by steam dilution was approximately half that required for the CaO produced without dilution. In the carbonation test, carbonation conversion (CaO{yields}CaCO{sub 3}) of the CaO produced by steam dilution was approximately 70%, whereas the conversion was approximately 40% for the CaO produced without dilution. 17 refs., 8 figs., 5 tabs.

Yin Wang; Shiying Lin; Yoshizo Suzuki [National Institute of Advanced Industrial Science and Technology, Ibaraki (Japan)

2008-07-15T23:59:59.000Z

113

Interpretation of data obtained from non-destructive and destructive post-test analyses of an intact-core column of culebra dolomite  

SciTech Connect

The U.S. Department of Energy (DOE) has been developing a nuclear waste disposal facility, the Waste Isolation Pilot Plant (WIPP), located approximately 42 km east of Carlsbad, New Mexico. The WIPP is designed to demonstrate the safe disposal of transuranic wastes produced by the defense nuclear-weapons program. Pefiormance assessment analyses (U.S. DOE, 1996) indicate that human intrusion by inadvertent and intermittent drilling for resources provide the only credible mechanisms for significant releases of radionuclides horn the disposal system. These releases may occur by five mechanisms: (1) cuttings, (2) cavings, (3) spallings, (4) direct brine releases, and (5) long- term brine releases. The first four mechanisms could result in immediate release of contaminant to the accessible environment. For the last mechanisq migration pathways through the permeable layers of rock above the Salado are important, and major emphasis is placed on the Culebra Member of the Rustler Formation because this is the most transmissive geologic layer in the disposal system. For reasons of initial quantity, half-life, and specific radioactivity, certain isotopes of T~ U, Am, and Pu would dominate calculated releases from the WIPP. In order to help quantifi parameters for the calculated releases, radionuclide transport experiments have been carried out using five intact-core columns obtained from the Culebra dolomite member of the Rustler Formation within the Waste Isolation Pilot Pknt (WIPP) site in southeastern New Mexico. This report deals primarily with results of analyses for 241Pu and 241Am distributions developed during transport experiments in one of these cores. All intact-core column transport experiments were done using Culebra-simukmt brine relevant to the core recovery location (the WIPP air-intake shaft - AK). Hydraulic characteristics (i.e., apparent porosity and apparent dispersion coefficient) for intact-core columns were obtained via experiments using conservative tracer `Na. Elution experiments carried out over periods of a few days with tracers `2U and `?Np indicated that these tracers were weakly retarded as indicated by delayed elution of these species. Elution experiments with tracers 24% and 24*Arn were performed, but no elution of either species was observed in any flow experiment to date, including experiments of many months' duration. In order to quanti~ retardation of the non-eluted species 24*Pu and 241Arn afler a period of brine flow, non-destructive and destructive analyses of an intact-core column were carried out to determine distribution of these actinides in the rock. Analytical results indicate that the majority of the 241Am is present very near the top (injection) surface of the core (possibly as a precipitate), and that the majority of the 241Pu is dispersed with a very high apparent retardation value. The 24]Pu distribution is interpreted using a single-porosity advection-dispersion model, and an approximate retardation value is reported for this actinide. The specific radionuclide isotopes used in these experiments were chosen to facilitate analysis. Even though these isotopes are not necessarily the same as those that are most important to WIPP performance, they are isotopes of the same elements, and their chemical and transport properties are therefore identical to those of isotopes in the inventory.

Lucero, Daniel L.; Perkins, W. George

1998-09-01T23:59:59.000Z

114

Permitting and solid waste management issues for the Bailly Station wet limestone Advanced Flue Gas Desulfurization (AFGD) system  

SciTech Connect

Pure Air (a general partnership between Air Products and Chemicals, Inc., and Mitsubishi Heavy Industries America, Inc.). is constructing a wet limestone co-current advanced flue gas desulfurization (AFGD) system that has technological and commercial advantages over conventional FGD systems in the United States. The AFGD system is being installed at the Northern Indiana Public Service Company's Bailly Generating Station near Gary, Indiana. The AFGD system is scheduled to be operational by the Summer, 1992. The AFGD system will remove at least 90 percent of the sulfur dioxide (SO{sub 2}) in the flue gas from Boilers 7 and 8 at the Station while burning 3.2 percent sulfur coal. Also as part of testing the AFGD system, 95 percent removal of SO{sub 2} will be demonstrated on coals containing up to 4.5 percent sulfur. At the same time that SO{sub 2} is removed from the flue gas, a gypsum by-product will be produced which will be used for wallboard manufacturing. Since the AFGD system is a pollution control device, one would expect its installation to be received favorably by the public and regulatory agencies. Although the project was well received by regulatory agencies, on public group (Save the Dunes Council) was initially concerned since the project is located adjacent to the Indiana Dunes National Lakeshore. The purpose of this paper is to describe the project team's experiences in obtaining permits/approvals from regulatory agencies and in dealing with the public. 1 ref., 1 fig., 2 tabs.

Bolinsky, F.T. (Pure Air, Allentown, PA (United States)); Ross, J. (Northern Indiana Public Service Co., Hammond, IN (United States)); Dennis, D.S. (United Engineers and Constructors, Inc., Denver, CO (United States). Stearns-Roger Div.); Huston, J.S. (Environmental Alternatives, Inc., Warren NJ (USA))

1991-01-01T23:59:59.000Z

115

A re-assessment of age dating of fossiliferous limestones in eastern Sabah, Borneo: Implications for understanding the origins of the Indo-Pacific marine biodiversity hotspot  

Science Journals Connector (OSTI)

On the basis of a combined larger benthic foraminifera, nannofossil and strontium isotope dating programme we confidently re-assign muddy carbonate deposits from the Lower Kinabatangan River Area of Borneo to the Oligocene rather than the Early Miocene. High-diversity, coral-rich (> 50 species) deposits are here tightly constrained to predominately at, or just after, the Early to Late Oligocene boundary (Larger benthic foraminifera zone — Te1, Nannofossil zone — NP24, Sr isotope ages — 28.8–27.6 Ma). This new dating potentially pushes back the start of the Indo-West Pacific Centre of Marine Diversity, at least for corals, about 5 million years earlier than previous data indicated. Our new data supports maintaining separation of the muddy carbonates (previously defined as the Lower Kinabatangan Limestones: Haile & Wong, 1965) from nearby crystalline limestones of the Gomantong Limestone Formation dated here as Early Miocene (Larger benthic foraminifera zone — Te5/earliest Tf1, Sr isotope age — 21.0 Ma). This apparently punctuated development of shallow marine carbonates is seen at several locations in northern Borneo; an area underlain by oceanic crust and long dominated by very deep marine sedimentation (Hutchison, 2005). The opportunistic formation of clastic-influenced coastal and isolated biohermal carbonates is both an important palaeontological data point and a geological marker of changing basin settings. The new data on the first shallow marine deposits in a long established deep marine location, and evidence for unconformities, has important implications for the regional tectonic model, in an area of hydrocarbon exploration.

Laura B. McMonagle; Peter Lunt; Moyra E.J. Wilson; Kenneth G. Johnson; Christina Manning; Jeremy Young

2011-01-01T23:59:59.000Z

116

U.S. DI!PARThlENT OF ENERGY EERE PROJECT MANAGEMENT CENTER Nl!PA Dl1TImfiNATION  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

PARThlENT OF ENERGY PARThlENT OF ENERGY EERE PROJECT MANAGEMENT CENTER Nl!PA Dl1TImfiNATION RECIPIENT: BeIi Geospace, Inc Page 1 of2 STATE: TX PROJECT TITLE: Geothermal Technology Advancement for Rapid Development of Resources in the U.S. Funding OpportunUy Announcement Number Procurement Instrument Number NEPA Control Number em Number DE·FQA'()()()()S22 OE-EEOOO5515 GF0-0005515-001 G05515 Bued on my review oftbe information concerning the proposro action, as NEPA Compliance Officer (authorized under DOE Ordtr 4SI.IA), I have made the following determination: ex, EA, EIS APPENDIX AND NUMBER: Description : A9 Information gathering, analysis, and dissemination Information gathering (induding, but not limited to, literature surveys, inventories, site visits. and audits), data analysis

117

Paleotopography and Sea-level Controls on Facies Distribution and Stratal Architecture in the Westerville Limestone Member (Upper Pennsylvanian) NE Kansas and NW Missouri  

E-Print Network (OSTI)

Packstone Facies 35 Microbial Boundstone Facies 40 Coarse-Grained Packstone Facies 44 STRATIGRAPHIC CORRELATIONS AND SEQUENCE-STRATIGRAPHIC INTERPRETATIONS 45 Stratigraphic Datum (Surface A) 58 Wea Shale 58 Surface B 63 Westerville Limestone Member 63... Interval W1 63 Surface C 70 Interval W2 73 Surface D 79 Interval W3 83 Surface E 93 Nellie Bly Formation and Quivira Shale Member 93 Relative Sea-Level Curve 94 DISCUSSION 102 Relative Sea-Level Curve 102 v Paleotopography, Relative Sea Level, and Carbonate...

Fairchild, Justin M.

2012-05-31T23:59:59.000Z

118

173. NICKEL SORPTION KINETICS ON THE CLAY FRACTION OF A SOIL. D.R. Roberts and D.L. Sparks, Department of Plant and Soil Sciences, University of Delaware, Newark,  

E-Print Network (OSTI)

173. NICKEL SORPTION KINETICS ON THE CLAY FRACTION OF A SOIL. D.R. Roberts and D.L. Sparks the fate of heavy metal contaminants in the soil environment. Past studies of heavy metal sorption kinetics. This study exannines Ni(II) sorption and desorption kinetics on the clay fraction (

Sparks, Donald L.

119

Electric Equipment of the Dolomites Railway  

Science Journals Connector (OSTI)

... current at 2700 volts is adopted. This is done by the use of only one substation situated near Cortina, a little more than half-way from the power terminus. The ... the power terminus. The conversion of the alternating to direct current is done at the substation by means of two mercury arc rectifiers each of 11,000 kilowatts capacity at 3000 ...

1932-01-02T23:59:59.000Z

120

Magnetic mineralogy of pelagic limestones  

Science Journals Connector (OSTI)

......are found in pelagic lime- 434 R. Freeman stones...each phase of magnetic mineral, and indicates some...to the Rock-forming Minerals, Long- mans, Green & Co., London. El...1976. Opaque oxide minerals in meteorites, in Oxide......

Roy Freeman

1986-04-01T23:59:59.000Z

Note: This page contains sample records for the topic "dl dolomitic limestone" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


121

Mann, C.P., Stix, J., Vallance, J.W., and Richer, M., 2004, Subaqueous intracaldera volcanism, Ilopango Caldera, El Salvador, Central America, in Rose, W.I., Bommer, J.J., Lpez, D.L., Carr, M.J., and Major, J.J., eds., Natural hazards in El Salvador: Boul  

E-Print Network (OSTI)

, Ilopango Caldera, El Salvador, Central America, in Rose, W.I., Bommer, J.J., LĂłpez, D.L., Carr, M.J., and Major, J.J., eds., Natural hazards in El Salvador: Boulder, Colorado, Geological Society of America of America Special Paper 375 2004 Subaqueous intracaldera volcanism, Ilopango Caldera, El Salvador, Central

Long, Bernard

122

Microsoft Word - mitchell-dl.doc  

NLE Websites -- All DOE Office Websites (Extended Search)

Characterizing Particle Size, Water Path and Photon Characterizing Particle Size, Water Path and Photon Tunneling in Ice and Water Clouds David L. Mitchell Atmospheric Sciences Division Desert Research Institute Reno, Nevada Robert P. d'Entremont Satellite Meteorology Group Atmospheric and Environmental Research, Inc. Lexington, Massachusetts Abstract Global information of ice water path (IWP) in ice clouds is urgently needed for testing of global climate models (GCMs) and other applications, but satellite retrievals of IWP are still in the developing stages, and tend to have large uncertainties (e.g. factor of 3 or more). Results of a new retrieval method are presented here that may have relatively low uncertainties, using several thermal-radiance channels. Recent research indicates that ice-cloud radiative properties depend on more than effective diameter

123

CM200DL-Final.doc  

NLE Websites -- All DOE Office Websites (Extended Search)

CM200 CM200 Core Status: new users must complete 2 trouble free training sessions and pass the drivers test to work independently during Core sessions. Flex Status: core users must complete 5 trouble free sessions to work during Flex sessions. To reserve a CM200 session, go to www/ncem.lbl.gov, click on "Microscope Scheduling", use proposal number and password to log in. You may only sign up for one Core session at a time. To cancel a session, email your request to the technical staff in charge of the microscope. CORE LICENSE TEST Safety  Understand emergency shut down procedure  Know emergency contact numbers  Know where LN protective equipment is  Find updated operating instruction and notice (?) Instrument Preparation  Check V7 closed and SSC on and in cooling

124

TEAM0.5DL.doc  

NLE Websites -- All DOE Office Websites (Extended Search)

0.5 0.5 Core Status: new users must complete 2 training sessions and pass a sample exchange exam to work independently during Core sessions (regular work hours). Flex Status: core users must complete 5 Core sessions and pass a driving test to work during Flex sessions (evening and weekend hours). All TEAM 0.5 scheduling must be coordinated through Peter Ercius at Percius@lbl.gov. You may be assigned only two sessions per month. CORE LICENSE Safety  Understand emergency shut-down procedure  Demonstrate handling of the column valves  Point out where emergency contact numbers are posted  Know how to contact NCEM staff for support Instrument preparation  Show how to check basic vacuum functionality and target pressure values  (Gun: 1, Liner: 18-20 and Octagon: < 10)

125

Mechanical characteristics of folds in Upper Cretaceous strata in the Disturbed Belt of northwestern Montana  

E-Print Network (OSTI)

Jurassic when the basin became filled with a thi. n sequence of sandstones and shales. Non-marine shale, sandstone, conglomerate, and fresh- water limestone were deposited during Late Jurassic and very Early Cretaceous. A sea from the north invaded... limestone and dolomite units. The Mississippian is directly overlain by a thin sequence of Jurassi. c clastic rocks. Above the Jut'assic lies the thick conformable sequence of alternating shales and sandstones of Cretaceous age. Together, the Jurassic...

Gilbert, Pat Kader

2012-06-07T23:59:59.000Z

126

Cavity Decoupling of Small Explosions in Limestone  

Science Journals Connector (OSTI)

...New Mexico, as a part of the HUMBLE REDWOOD III experiments. Two charges...Experiment Overview As a part of the HUMBLE REDWOOD III (HR III) experiment, three...Photogrammetric Report for the HUMBLE REDWOOD III Experiments (DTRA/J9CXTT...

Anastasia Stroujkova; Robert Reinke; Jeff Duray; Jessie Bonner

127

Preservation of limestone material culture with siloxanes  

E-Print Network (OSTI)

. The dark area represents the siloxane penetration depth in the stone. 62 Figure 4. 3. Energy dispersive X-ray spectrograms of three different distances away from the penetration depth. All three measurements were taken at a magnification of X120, with a...

Miller, Ann Elizabeth

2001-01-01T23:59:59.000Z

128

In metamorphosed limestone, dolostone,and marble  

E-Print Network (OSTI)

) or more in areas of subsidence from piping in thick unconsolidated material Fissures and voids present to a depth of 50 ft (15 m) in areas of subsidence from piping in thick,unconsolidated material Fissures

Torgersen, Christian

129

NOTES ON THE FISHES OF EAST TENNESSEE '"By Barton Warren Evermann and Samuel F. Hildebrand  

E-Print Network (OSTI)

dolomite. In the valley of Chattanooga' Creek west of the ridge, Chickamauga limestone occurs again, while, which is about the elevation of the western boundary of the great valley. Lookout Creek on the west has confined almost wholly to east Tennessee, and entirely to the Tennessee River Basin. The valley of east

130

MICROBIOLOGY IN THE PETROLEUM INDUSTRY  

Science Journals Connector (OSTI)

...anaerobic forms. Some muds, particularly lime base muds, have a pH above 10.5 and...postulated to react with cal- careous minerals such as limestone and dolomite in the...calcium sulfide. The solution of the minerals was expected to result in an increase...

John B. Davis; David M. Updegraff

1954-12-01T23:59:59.000Z

131

GEOLOGY O F THE NORTHERN PCIRT O F DRY MOUNTAXN,  

E-Print Network (OSTI)

;BRIGHAM YOUNG UNIVERSITY RESEARCH STUDIES Geology Seri,es Vol. 3 No. 2 April, 1956 GEOLOGY OF THE NORTHERN Dolomite Pine Canyon Limestone Humbug Formation Tertiary System North Horn Formation Moroni Formation Quaternary System Pre-Lake Bonneville Fanglomerate Lake Bonneville Sediments Recent Lake Sediments Igneous

Seamons, Kent E.

132

Creating a Geologic Play Book for Trenton-Black River Appalachian Basin Exploration  

SciTech Connect

Preliminary isopach and facies maps, combined with a literature review, were used to develop a sequence of basin geometry, architecture and facies development during Cambrian and Ordovician time. The main architectural features--basins, sub basins and platforms--were identified and mapped as their positions shifted with time. This is significant because a better understanding of the control of basin geometry and architecture on the distribution of key facies and on subsequent reservoir development in Ordovician carbonates within the Trenton and Black River is essential for future exploration planning. Good exploration potential is thought to exist along the entire platform margin, where clean grainstones were deposited in skeletal shoals from Indiana thorough Ohio and Ontario into Pennsylvania. The best reservoir facies for the development of hydrothermal dolomites appears to be these clean carbonates. This conclusion is supported by observations taken in existing fields in Indiana, Ontario, Ohio and New York. In contrast, Trenton-Black River production in Kentucky and West Virginia has been from fractured, but non-dolomitized, limestone reservoirs. Facies maps indicate that these limestones were deposited under conditions that led to a higher argillaceous content than the cleaner limestones deposited in higher-energy environments along platform margins. However, even in the broad area of argillaceous limestones, clean limestone buildups have been observed in eastern outcrops and, if present and dolomitized in the subsurface, may provide additional exploration targets. Structure and isopach maps developed as part of the structural and seismic study supported the basin architecture and geometry conclusions, and from them some structural control on the location of architectural features may be inferred. This portion of the study eventually will lead to a determination of the timing relative to fracturing, dolomitization and hydrocarbon charging of reservoirs in the Trenton and Black River carbonates. The focus of this effort will shift in the next few months from regional to more detailed structural analyses. This new effort will include topics such as the determination of the source of the hot, dolomitizing fluids that created hydrothermal dolomite reservoirs in the Black River, and the probable migration paths of these fluids. Faults of suitable age, orientation and location to be relevant for hydrothermal dolomite creation in the Trenton-Black River play will be isolated and mapped, and potential fairways delineated. A detailed study of hydrothermal alteration of carbonate reservoirs was completed and is discussed at length in this report. New ideas that were developed from this research were combined with a literature review and existing concepts to develop a model for the development of hydrothermal dolomite reservoirs in the study area. Fault-related hydrothermal alteration is a key component of this model. Hydrothermal alteration produces a spectrum of features in reservoirs, ranging from leached limestone and microporosity to matrix dolomite, saddle dolomite-lined breccias, zebra fabrics and fractures. Mineralization probably occurred during the pressure drop associated with the rise of fluids up the fault system, and is due to the mixing of hydrothermal fluids with cooler, in situ fluids. Once they began to cool themselves, the hydrothermal fluids, which had a lower pH and higher salinity than formation fluids, were capable of leaching the host limestones. Microporosity is common in leached limestones, and it is likely that it was formed, in some cases, during hydrothermal alteration. Dolomite leaching occurs near the end of the paragenetic sequence, and may significantly enhance porosity. However, leaching of dolomite typically is followed by the precipitation of calcite or anhydrite, which reduces porosity. A final conclusion is that hydrothermal alteration may be more common than previously thought, and some features previously attributed to other processes may be in fact be hydrothermal in origin. Production d

Douglas G. Patchen; Taury Smith; Ron Riley; Mark Baranoski; David Harris; John Hickman; John Bocan; Michael Hohn

2005-09-30T23:59:59.000Z

133

Determination of lithology from well logs using a neural network  

SciTech Connect

The authors have developed a computer program to automatically determine lithologies from well logs using a back-propagation neural network. Unlike a conventional serial computer, a neural network is a computational system composed of nodes (sometimes called neurons, neurodes, or units) and the connections between these nodes. Neural computing attempts to emulate the functions of the mammalian brain, thus mimicking thought processes. The neural network approach differs from previous pattern recognition methods in its ability to learn from examples. Unlike conventional statistical methods, this new approach does not require sophisticated mathematics and a large amount of statistical data. This paper discusses the application of neural networks to a pattern recognition problem in geology: the determination of lithology from well logs. The neural network determined the lithologies (limestone, dolomite, sandstone, shale, sandy and dolomitic limestones, sandy dolomite, and shale sandstone) from selected well logs in a fraction of the time required by an experienced human log analyst.

Rogers, S.J.; Fang, J.H. (Univ. of Alabama, Tuscaloosa (United States)); Karr, C.L.; Stanley, D.A. (Bureau of Mines, Tuscaloosa, AL (United States))

1992-05-01T23:59:59.000Z

134

Prevention of Salt Damage inPrevention of Salt Damage in LimestoneLimestone  

E-Print Network (OSTI)

with a solution of polyacrylic acid (PAA) will reduce the crystallization pressure. #12;Warping Experiment Experiment Sample Size ~ 10 x 2.5 x 1.0 cm 1. Polyacrylic acid (PAA) treatment 2. Dried at 105ïżœC 3 Crystal cP L Ld #12;Warping Sample Sets PAA treatments No PAA 0.75% PAA solution 1.5% PAA solution 3

Petta, Jason

135

Synthesis and development of processes for the recovery of sulfur from acid gases. Part 1, Development of a high-temperature process for removal of H{sub 2}S from coal gas using limestone -- thermodynamic and kinetic considerations; Part 2, Development of a zero-emissions process for recovery of sulfur from acid gas streams  

SciTech Connect

Limestone can be used more effectively as a sorbent for H{sub 2}S in high-temperature gas-cleaning applications if it is prevented from undergoing calcination. Sorption of H{sub 2}S by limestone is impeded by sintering of the product CaS layer. Sintering of CaS is catalyzed by CO{sub 2}, but is not affected by N{sub 2} or H{sub 2}. The kinetics of CaS sintering was determined for the temperature range 750--900{degrees}C. When hydrogen sulfide is heated above 600{degrees}C in the presence of carbon dioxide elemental sulfur is formed. The rate-limiting step of elemental sulfur formation is thermal decomposition of H{sub 2}S. Part of the hydrogen thereby produced reacts with CO{sub 2}, forming CO via the water-gas-shift reaction. The equilibrium of H{sub 2}S decomposition is therefore shifted to favor the formation of elemental sulfur. The main byproduct is COS, formed by a reaction between CO{sub 2} and H{sub 2}S that is analogous to the water-gas-shift reaction. Smaller amounts of SO{sub 2} and CS{sub 2} also form. Molybdenum disulfide is a strong catalyst for H{sub 2}S decomposition in the presence of CO{sub 2}. A process for recovery of sulfur from H{sub 2}S using this chemistry is as follows: Hydrogen sulfide is heated in a high-temperature reactor in the presence of CO{sub 2} and a suitable catalyst. The primary products of the overall reaction are S{sub 2}, CO, H{sub 2} and H{sub 2}O. Rapid quenching of the reaction mixture to roughly 600{degrees}C prevents loss Of S{sub 2} during cooling. Carbonyl sulfide is removed from the product gas by hydrolysis back to CO{sub 2} and H{sub 2}S. Unreacted CO{sub 2} and H{sub 2}S are removed from the product gas and recycled to the reactor, leaving a gas consisting chiefly of H{sub 2} and CO, which recovers the hydrogen value from the H{sub 2}S. This process is economically favorable compared to the existing sulfur-recovery technology and allows emissions of sulfur-containing gases to be controlled to very low levels.

Towler, G.P.; Lynn, S.

1993-05-01T23:59:59.000Z

136

dlCC Opt: Optimization Software for Renewable Energy Projects...  

NLE Websites -- All DOE Office Websites (Extended Search)

indicators of project opportunities. Many existing programs require the user to enter the size (kW) of the renewable energy system in order to start calculations. However,...

137

DL-940 1/08 Animal Health Diagnostic Center  

E-Print Network (OSTI)

These are instructions for collecting specimens for Campylobacter fetus culture fluorescent antibody and Tritrichomonas with protective sheath 5. Sterile rubber bulb (return to lab for credit to your account) Needed but not supplied by the AHDC 6. Syringe (3cc) and needle Procedures 1. Attach rubber bulb to collection catheter 2

Keinan, Alon

138

SSC-DL Version 1.0 SIRTF Science Center  

E-Print Network (OSTI)

-SED 6741 Code walk-through fixes/updates to "LoadIrsaPtgMetaData" perl subroutine. 6735 New module-masked pixels are NaN'd in final mips24 BCD products.. 6710 Update GenSBPHFsForCampaign.pl following comments from code walk-thru.. 6679 Update w_po

Masci, Frank

139

18 Modeling high-performance HBTs D.L. Pulfrey  

E-Print Network (OSTI)

an acceptable base resistance. A short base width leads directly to an improved cut-off frequency, fT , which, when coupled with the lower base resistance, leads to an improved oscillation frequency, fmax. These consideration is also given to the incorporation of the compact model for JC into a large-signal equivalent

Pulfrey, David L.

140

Kentucky, Tennessee: corniferous potential may be worth exploring  

SciTech Connect

The driller's term, corniferous, refers to all carbonate and clastic strata, regardless of geologic age, underlying the regional unconformity below the late Devonian-early Mississippian New Albany shale and overlying the middle Silurian Clinton shale in the study area. From oldest to youngest, the formations that constitute the corniferous are the middle Silurian Keefer formation, the middle Silurian Lockport dolomite, the upper Silurian Salina formation, the lower Devonian Helderberg limestone, the lower Devonian Oriskanysandstone, the lower Devonian Onondaga limestone, and in the extreme western portion of the study area, the middle Devonian Boyle dolomite. The overlying New Albany shale also is termed Ohio shale or Chattanooga shale in the Appalachian Basin. To drillers, it is known simply as the black shale. The study area is located in E. Kentucky on the western flank of the Appalachian Basin and covers all or parts of 32 counties.

Currie, M.T.

1982-05-01T23:59:59.000Z

Note: This page contains sample records for the topic "dl dolomitic limestone" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


141

Quantifying Surface Subsidence along US Highway 50, Reno County, KS using Terrestrial LiDAR  

E-Print Network (OSTI)

of the 1900's many oil wells were drilled. These wells tapped into the Hutchinson Salt Member which was coined as the "lost circulation zone" when drillers would pass through it due to its high solubility, low strength and contact with the drilling fluid... of the larger Wellington Formation which mainly consists of gray shales interbedded with argillaceous limestone and dolomite intervals in addition to the Hutchinson Salt. Above the Wellington Formation lies the Ninnescah Shale. The Ninnescah Shale is made up...

Herrs, Andrew J.

2010-04-23T23:59:59.000Z

142

Pyroprocessing of fine industrial minerals in a suspension flash calciner  

Science Journals Connector (OSTI)

ABSTRACT Suspension flash calcining is well suited for heat treatment of -20 mesh and finer materials at temperatures up to 1400°C. The system has been applied to a number of materials including limestone, dolomite, phosphate and gypsum, which are discussed in this paper. The system operates in a countercurrent mode, incorporating one to three suspension cyclone preheat stages ahead of a suspension flash calciner; followed by one to three suspension cyclone cooling stages. Operating temperatures range from 1100–1200°C for limestone and dolomite, to 800–900°C for phosphate and 150–300°C for gypsum. Fuel is normally fired directly into the suspension flash calciner vessel, or as in the case of gypsum in a separately fired air heater. Flash calcination offers a unique approach to the processing of fine materials. The short residence time of the flash calciner system works to prevent overburning, however the excellent heat transfer that is achieved allows the calcination load to be accomplished. KEYWORDS - Suspension, Calcining, Calcination, Limestone, Dolomite, Gypsum, Phosphate

W.E. Lindquist; S.M. Cohen; B.T. Field

1988-01-01T23:59:59.000Z

143

Limestone Creek, Florida: Energy Resources | Open Energy Information  

Open Energy Info (EERE)

6.9428352°, -80.1411545° 6.9428352°, -80.1411545° Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"ROADMAP","zoom":14,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"350px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":26.9428352,"lon":-80.1411545,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}

144

Limestone County, Texas: Energy Resources | Open Energy Information  

Open Energy Info (EERE)

5461078°, -96.663812° 5461078°, -96.663812° Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"ROADMAP","zoom":14,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"350px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":31.5461078,"lon":-96.663812,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}

145

Limestone County, Alabama: Energy Resources | Open Energy Information  

Open Energy Info (EERE)

7800072°, -86.9423801° 7800072°, -86.9423801° Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"ROADMAP","zoom":14,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"350px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":34.7800072,"lon":-86.9423801,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}

146

Experimental High Velocity Acid Jetting in Limestone Carbonates  

E-Print Network (OSTI)

Acid jetting is a well stimulation technique that is used in carbonate reservoirs. It typically involves injecting acid down hole at high flow rates through small orifices which cause high velocities of acid to strike the borehole wall...

Holland, Christopher

2014-04-30T23:59:59.000Z

147

Fracture testing of Edwards limestone: a statistical treatment  

E-Print Network (OSTI)

to represent strength data. It is the authors contention that assigning statistical distributions to "material properties" is preferred over assigning fixed constant values. Weibul1 [6] states, "the lack of agreement between the theory of strength... of materials and engineering practice is due to an unallowable extension of the limits of the theory of elasticity in its applications. " Weibull's view is that this lack of agreement between theory and practice is of fundamental nature and is caused...

Redding, David Earl

2012-06-07T23:59:59.000Z

148

The electrical conductivity of sandstone, limestone and granite  

Science Journals Connector (OSTI)

......logs, Southern Yucca Flat, Nevada Test Site, US Geol. Surv. Rep. Spec...rock and soil samples from the Nevada Test Site, US Geol. Surv. Rep. Spec...Spring formation in Area 12 at the Nevada test site, ch. 5, pp. 1-10. eds......

A. Duba; A. J. Piwinskii; M. Santor; H. C. Weed

1978-06-01T23:59:59.000Z

149

High-calcium, high-reflectance limestone resources of Illinois  

Science Journals Connector (OSTI)

...measurements were made using a Photovolt Corporat ion reflectance spectrophotometer complying with ASTM Standard E-97 and TAPPI tentative stan- d a r d T 6 4 6 M - 5 4 . E a c h s a m p l e f o r reflectance measurement was pressed into a briquet, using...

150

Spatial prediction of caves in San Andres dolomite, Yates field, west Texas  

SciTech Connect

Persistent speculation that caves played a key role in the high flow rates of many early wells in the Yates field (203 wells potentialed for more than 10,000 BOPD each, 26 wells for more than 80,000 BOPD each) has raised questions of why the caves exist, how many there are, and how to incorporate them into reservoir management practice. This paper describes the use of probability theory to answer these questions.

Nosal, E.A.; Carlson, J.L.; Craig, D.H.

1988-02-01T23:59:59.000Z

151

A Comparative Study of Dolomite Dissolution in Simple Organic Acids and Chelating Agents  

E-Print Network (OSTI)

Acid treatments have predominantly been conducted using HCl for its availability, high rock dissolving power and soluble reaction products. At high temperatures, rapid spending of the acid with carbonates prevents deeper penetration distance...

Adenuga, Olusegun O

2013-05-03T23:59:59.000Z

152

Association of Dolomite and Anhydrite in the Recent Sediments of the Persian Gulf  

Science Journals Connector (OSTI)

... forming part of a programme of research on the Recent sediments of the Trucial Coast, Persian ...PersianGulf ...

R. CURTIS; G. EVANS; D. J. J. KINSMAN; D. J. SHEARMAN

1963-02-16T23:59:59.000Z

153

Calcined Dolomite: Alternative to Lime for Minimizing Undesirable Element Leachability from Fly Ash  

Science Journals Connector (OSTI)

In contrast, for the TCD-treated sample, the principal peaks for several newly formed minerals, including hydrocalumite (3CaO·Al2O3·Ca(OH)2·12H2O) (or hydrotalcite), portlandite (Ca(OH)2), and ettringite (3CaO·Al2O3·3CaSO4·32H2O), were found. ... H hydrocalumite (or hydrotalcite); M mullite; E ettringite; P portlandite; Q quartz; K kalinite; C calcite; He hematite; Ge gehlenite hydrate; G gypsum. ... There was also a small peak for ettringite present. ...

Qinghai Guo; Eric J. Reardon

2012-06-14T23:59:59.000Z

154

Sphalerite mineralization in deep lying dolomites of Upper Arbuckle age, west central Kansas  

Science Journals Connector (OSTI)

...line with thistypeof reason- ing,asareother,butlesspronounced,abruptshiftsin streamdirection,along the Arkansas, Cimmaron and CanadianRivers. Oil and Gas ProductionTrends.--The regionalN 52 E trend of the AldrichPool (Fig. 7) is consideredsignificant...

David Le Count Evans

155

Chemical exchange between seawater and nonstoichiometric dolomite: an experimental investigation in a flow-through system  

E-Print Network (OSTI)

the composition of the pore fluid to be monitored as reactions occur. Average flow rates are contmlled by the volume of fluid sample removed and the time interval between samples. Cylindrical cores (4. 5 cm O. D. x 10. 2 cm) or chips of Burlington... time. The seawater evolved primarily by losing Mg and gaining Ca; however, examination of the solids by X-ray diffraction, mass spectrometry, and cathodoluminescence petrography could not detect the changes in the solid. Dissolution...

Richards, Jennifer Ann

1989-01-01T23:59:59.000Z

156

Acidizing Dolomite Reservoirs Using HCL Acid Prepared with Seawater: Problems and Solutions  

E-Print Network (OSTI)

Collection PI N itro g en Overburden Pump P I Oil Refill Oil Collection Fluid Waste B rin e P isto n D I P isto n A cid P isto n Syringe Pump 9 Figure 2: Cross-section view of core holder. Corefloods testing initial... 230 250 270 290 0 1 2 3 4 5 6 7 8 [ C a ] 2 + a n d [ M g ] 2 + , m g / L P r e s s u r e D r o p A c r o s s C o r e , P S I PV DI Water Run at 77°F: [Ca] 2+ , [Mg] 2+ , and Pressure Data Pressure Drop Across Core Calcium Concentration...

Arensman, Dennis G

2014-04-28T23:59:59.000Z

157

Petroleum potential of lower and middle Paleozoic rocks in Nebraska portion of Mid-Continent  

SciTech Connect

Central North America during the Paleozoic was characterized by northern (Williston) and southern (Anadarko) depositional regimes separated by a stable Transcontinental arch. Nebraska lies on the southern flank of this arch and contains the northern zero edges of the lower and middle Paleozoic rocks of the southern regime. Most of these rocks are secondary dolomites with zones of excellent intercrystalline porosity. The Reagan-LaMotte Sandstones and the overlying Arbuckle dolomites are overlapped by Middle Ordovician rocks toward the Transcontinental arch. Rocks equivalent to the Simpson consist of a basal sand (St. Peter) and overlying interbedded gray-green shales and dolomitic limestones. An uppermost shale facies is present in the Upper Ordovician (Viola-Maquoketa) eastward and southward across Nebraska. The dolomite facies extends northward into the Williston basin. The Silurian dolomites, originally more widely deposited, are overlapped by Devonian dolomites in southeastern Nebraska. Upper Devonian rocks exhibit a regional facies change from carbonate to green-gray shale to black shale southeastward across the Mid-Continent. Mississippian carbonates overlap the Devonian westward and northward across the Transcontinental arch. Pennsylvanian uplift and erosion were widespread, producing numerous stratigraphic traps. Sands related to the basal Pennsylvanian unconformity produce along the Cambridge arch. Arbuckle, Simpson, Viola, and Hunton production is present in the Forest City basin and along the Central Kansas uplift. Although source rocks are scarce and the maturation is marginal, current theories of long-distance oil migration encourage exploration in the extensive lower and middle Paleozoic reservoirs in this portion of the Mid-Continent.

Carlson, M.P. (Univ. of Nebraska, Lincoln (USA))

1989-08-01T23:59:59.000Z

158

Geology and Petrophysics of the Ozouri Group, Central Gabon  

SciTech Connect

The Ozouri Group in Gabon is comprised of finely textured siliceous dolomitic and calcareous claystones, shales, limestones, dolomites, porcellanite and cherts. It was deposited during the Late Paleocene and Early Eocene on a transgressive continental margin. It is highly siliceous and organically rich, with affinities to the Miocene Monterey Formation of California. It is often fractured by deeper structural movement of the underlying Ezanga salt. Economic oil production from the Ozouri is dependent on the most effective combination of matrix (storage) and fracture (deliverability) porosity. The most efficient combination can be related to variations in the lithologic and petrophysical characteristics of the formation. Horizontal drilling techniques can be utilized to fully exploit production from the Ozouri Group.

Dunne, L.A.; Johnson, P.R.; DeSantis, S.B. [Amoco Exploration and Production Company, Houston, TX (United States)

1996-08-01T23:59:59.000Z

159

Sulfur removal in advanced two stage pressurized fluidized bed combustion. Technical report, 1 March--31 May 1994  

SciTech Connect

The objective of this study is to obtain data on the rates of reaction between hydrogen sulfide (H{sub 2}S) and uncalcined calcium-based sorbents under operating conditions relevant to first stage (carbonizer) of Advanced Two-Stage Pressurized Fluidized-Bed Combustors (PFBC). In these systems the CO{sub 2} partial pressure in the first stage generally exceeds the equilibrium value for calcium carbonate decomposition. Therefore, removal of sulfur compounds takes place through the reaction between H{sub 2}S and calcium carbonate. To achieve this objective, the rates of reaction between hydrogen sulfide and uncalcined calcium-based sorbents will be determined by conducting tests in pressurized thermogravimetric analyzer (TGA) and high-pressure/high-temperature fluidized-bed reactor (HPTR) units. The effects of sorbent type, sorbent particle size, reactor temperature and pressure, and CO{sub 2} and H{sub 2}S partial pressures on the sulfidation reaction rate will be determined. During this quarter a series of sulfidation tests were conducted in the high-pressure/high-temperature fluidized-bed reactor (HPTR) units. The effects of sorbent type, sorbent particle size, reactor temperature and pressure, and CO{sub 2} and H{sub 2}S partial pressures on the sulfidation reaction rate will be determined. During this quarter a series of sulfidation tests were conducted in the high-pressure high-temperature thermogravimetric analyzer (HPTGA unit) using limestone and dolomite. The results suggest that half-calcined dolomite is much more reactive than uncalcined limestone. Also, temperature in the range of 800 to 950 C did not significantly affect the sulfidation reaction rates for both limestone and dolomite.

Abbasian, J.; Chowdiah, P.; Hill, A.H.; Rue, D.M. [Inst. of Gas Technology, Chicago, IL (United States)

1994-09-01T23:59:59.000Z

160

u.s. Dl!PARThIENT OF ENERGY EERE PROJECT MANAGEMENT CENTER NEPA DETERMINATION  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

PARThIENT OF ENERGY PARThIENT OF ENERGY EERE PROJECT MANAGEMENT CENTER NEPA DETERMINATION Page 1 of2 RECIPIENT: University of Oregon STATE: OR PROJECT TITLE: Vapor Transport Deposition for Thin Film III-V Photovoltaics fo'unding Opportunity Announcement Number Procurement Instrument Number NEPA Control Number CID Number DE-FOA..()()()()654 DE-EEOOO5957 GF0-0005957·0Q1 Based on my review of the information concerning the proposed action, as NI<:PA Compliance Officer (authorized under DOE Order 451.1A), I have made the following determination : ex, EA, EIS APPENDIX AND NUMBER: Description: A9 Information gathering, analysis, and dissemination Information gathering (including, but not limited to, literature surveys, inventories, site visits, and audits). data analysis (including, but not limited to, computer modeling), document preparation

Note: This page contains sample records for the topic "dl dolomitic limestone" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


161

u.s. Dl!PAR1'M:ENT OF ENERGY EERE PROJECT MANAGEMENT CENTER  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

PAR1'M:ENT OF ENERGY PAR1'M:ENT OF ENERGY EERE PROJECT MANAGEMENT CENTER NEPA DETERlIIINATION RECIPIENT :University of California San Diego PROJECT TITL.E: San Diego Center for Algae Biotechnology Page 1 of2 STATE: CA Funding Opportunity Announcement Number Procurement Instnlment Number NEPA Control Number em Number EEOOO3142 GF0-10-582 EE3142 Based on my review ortbe information concerning the proposed action, as NEPA Compliance Officer (authorukd under DOE Order 451.1A), I have made the following determination: ex, EA, EIS APPENDIX AND NUMBER: Description: 83.6 Siting . construction (or modification), operation, and deoommissioning of facilities for indoor bench-scale research projects and conventional laboratory operations (for example. preparation of chemical standards and sample analYSIS):

162

u.s. Dl!PARTMENT OF ENERGY EERE PROJECT MANAGEMENT CENTER Nl!PA DETERMINATION  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

PARTMENT OF ENERGY PARTMENT OF ENERGY EERE PROJECT MANAGEMENT CENTER Nl!PA DETERMINATION RECIPIENT:WA Dept of Commerce Page 1 of3 STATE: WA PROJECT TITLE: SEP ARRA · WSU Anaerobic Digester - Nutrient Recovery Technology - Vander Haak Dairy Funding Opportunity Announcement Number Procurement Instrument Number NEPA Control Number CID Number EEOOOO139 GF0-0000139-040 0 Based on my review of the Information concerning the proposed action, as NEPA Compliance Officer (authorized under DOE Order 4S1.1A), I have made tbe following determination: ex, EA, EIS APPENDIX AND NUMBER: Description: A9 Information gathering, analysis, and dissemination Information gathering (including, but not limited to, literature surveys, inventories, site visils, and audits), data analysis (including

163

Data Compression and Harmonic Analysis D.L. Donoho, M. Vetterli,  

E-Print Network (OSTI)

, Littlewood­Paley theory, Sampling Theorem. ``Like the vague sighings of a wind at even, That wakes perhaps less familiar to the Information Theory community, growing out of the field of harmonic analysis analysis in this century. Typically, the problems and achievements of this field have involved goals

Donoho, David

164

Data Compression and Harmonic Analysis D.L. Donoho, M. Vetterli,  

E-Print Network (OSTI)

, Littlewood-Paley theory, Sampling Theorem. "Like the vague sighings of a wind at even, That wakes perhaps less familiar to the Information Theory community, growing out of the field of harmonic analysis analysis in this century. Typically, the problems and achievements of this field have involved goals

Donoho, David

165

TFI: RTEfuST, T{ ftd rDl-.I: 91.1.1.41493997  

E-Print Network (OSTI)

, windows, ventilators and partitions with extruded built up standard tubular sections/ appropriate Z for glazing I paneling, C.p. Oiass / stainless steel screws, all complete as per archjtectural drawings in aluminum doors, windows shutters and partition frames with C.p. brass / stainless steel screws etc

Bandyopadhyay, Antar

166

TRIAC: A code for track measurements using image analysis tools D.L. Patiris a  

E-Print Network (OSTI)

.G. Ioannides a,* a Nuclear Physics Laboratory, Department of Physics, University of Ioannina, 451 10 Ioannina State Nuclear Track Detectors CR39. The program using image analysis tools counts the number of tracks for dosimetry proposes and classifies the tracks according to their radii for the spectrometry of alpha

Blekas, Konstantinos

167

A. E. K.Ris Ris-M-Dl^ Title and author(s)  

E-Print Network (OSTI)

Mechanics to Prer.oure Vocicel Reliability Analysis ty P.E. Becher and Arne Pedersen pages + tables -f- 16 OF STATISTICAL LINEAR ELASTIC FRACTURE MECHANICS TO PRESSURE VESSEL RELIABILITY ANALYSIS P.E. BECHER, A. PEDERSEN sampling. Copies to Library Reactor 100 50 Abstract to Available on request from the Library of the Danish

168

The foundational inequalities of D.L. Burkholder and some of their ...  

E-Print Network (OSTI)

Aug 3, 2011 ... multipliers obtained by projections (conditional expectations) of trans- formations of ...... of conformally invariant energy functionals and regularity of solutions to the generalized .... The Poisson process ??(t) of intensity ? arises from (0,0, ??1), where ?1 is the Dirac ...... other techniques, in the near future.

2011-08-03T23:59:59.000Z

169

Measurement of the B -> Dl nu branching fractions and form factor  

E-Print Network (OSTI)

J. Lee, 19 H. Schwarthoff, 19 A. Wolf, 19 M.M. Zoeller, 19 S.J. Richichi, 20 H. Severini, 20 P. Skubic, 20 A. Undrus, 20 M. Bishai, 21 S. Chen, 21 J. Fast, 21 J.W. Hinson, 21 N. Menon, 21 D.H. Miller, 21 E.I. Shibata, 21 I.P.J. Shipsey, 21 S. Glenn... efficiency and the smearing in ?w. The fraction of D 0 , 2 ?n decays in each w bin that is recon- structed is 17% to 21% and the average ?w resolution is 0.026, about one-half the bin width. The small statistical uncertainty in e ij is represented by s 2 e ij...

Ammar, Raymond G.; Baringer, Philip S.; Bean, Alice; Besson, David Zeke; Coppage, Don; Darling, C.; Davis, Robin E. P.; Kotov, S.; Kravchenko, I.; Kwak, Nowhan; Zhou, L.

1999-05-01T23:59:59.000Z

170

Transitional Cell Hyperplasia in the Bladders of Dogs Fed dl-Tryptophan  

Science Journals Connector (OSTI)

...these experiments add further fuel to the concept that tryptophan...available at a more resonable price, and a feeding experiment designed...REFERENCES 1. Brown, R. R., Price, J. M., Friedell, G. H...T., Brown, R. R., and Price, J. M. Incidence of Mouse...

J. L. Radomski; E. M. Glass; and William B. Deichmann

1971-11-01T23:59:59.000Z

171

Matematik Dnyas>, 2003 K>fl Tbitak Bilim dl (1979) sahibi, k>rk do-  

E-Print Network (OSTI)

> ayn> ĂŒniversiteden 1953'te ald>. 1960'da Ege Ă?niversitesi T>p FakĂŒltesi'nde "yabanc> ma- tematik ve- l>flt>. Ege Ă?niversitesi'nde doçent (1965) ve profe- sör (1967) oldu. 1969-76 y>llar> aras>nda OD>rma Merke- zi'nde, 1995-97'de Gebze'de, Elektronik ve Krip- toloji Araflt>rma Merkezi'nde görev ald>. 1997

Sertöz, Ali Sinan

172

ISSN:1575-6807 D.L.: GC-1317-1999  

E-Print Network (OSTI)

Universitario de Ciencias y Tecnologías Cibernéticas Universidad de Las Palmas de Gran Canaria Campus de Tafira) Universidad de Las Palmas de Gran Canaria (ULPGC) Las Palmas de Gran Canaria December 4-6, 2003 Organized Editorial Commite in alphabetic order · Alvarez Luis (Universidad de Las Palmas de Gran Canaria) · Baumela

Granada, Universidad de

173

DOE/SC-ARM-13-003 ARM Lead Mentor Selection Process DL Sisterson  

NLE Websites -- All DOE Office Websites (Extended Search)

of the instrument system in a timely manner. * Use the Data Quality Problem Report (DQPR) process to alert the Site Scientist Team and Site Operations Team to problems with the...

174

LIMB Demonstration Project Extension  

SciTech Connect

The DOE LIMB Demonstration Project Extension is a continuation of the EPA Limestone Injection Multistage Burner (LIMB) Demonstration. EPA ultimately expects to show that LIMB is a low cost control technology capable of producing moderate SO{sub x} and NO{sub x} control (50--60 percent) with applicability for retrofit to the major portion of the existing coal-fired boiler population. The current EPA Wall-Fired LIMB Demonstration is a four-year project that includes design and installation of a LIMB system at the 105-MW Unit 4 boiler at Ohio Edison's Edgewater Station in Lorain, Ohio. LIMB Extension testing continued during the quarter with lignosulfonated hydrated lime, pulverized limestone, and hydrated dolomitic lime while firing 1.8% and 3% sulfur coals. Sulfur dioxide removal efficiencies were equivalent to the results found during EPA, base LIMB testing. Sulfur dioxide removal efficiencies were lower than expected while testing with pulverized limestone without humidification. A slight increase in sulfur capture was noted while injecting pulverized limestone at the 187' elevation and with the humidifier outlet temperature at 145{degree}F.

Not Available

1990-09-21T23:59:59.000Z

175

An insoluble residue study of the upper Walnut Formation, Comanche Peak Limestone, and Edwards Limestone, Bosque and western McLennan counties, Texas  

E-Print Network (OSTI)

occurred as light brown, rounded grains in 17 percent of the samples. Spinel was found in 8 samples and zircon was present in 10 samples. Magnetite was present as black, rounded grains in 20 per- cent of the samples. The recognition of magnetite... occurred as light brown, rounded grains in 17 percent of the samples. Spinel was found in 8 samples and zircon was present in 10 samples. Magnetite was present as black, rounded grains in 20 per- cent of the samples. The recognition of magnetite...

Simpson, Jimmie Darrell

2012-06-07T23:59:59.000Z

176

Reviving Abandoned Reservoirs with High-Pressure Air Injection: Application in a Fractured and Karsted Dolomite Reservoir  

SciTech Connect

Despite declining production rates, existing reservoirs in the United States contain vast volumes of remaining oil that is not being effectively recovered. This oil resource constitutes a huge target for the development and application of modern, cost-effective technologies for producing oil. Chief among the barriers to the recovery of this oil are the high costs of designing and implementing conventional advanced recovery technologies in these mature, in many cases pressure-depleted, reservoirs. An additional, increasingly significant barrier is the lack of vital technical expertise necessary for the application of these technologies. This lack of expertise is especially notable among the small operators and independents that operate many of these mature, yet oil-rich, reservoirs. We addressed these barriers to more effective oil recovery by developing, testing, applying, and documenting an innovative technology that can be used by even the smallest operator to significantly increase the flow of oil from mature U.S. reservoirs. The Bureau of Economic Geology and Goldrus Producing Company assembled a multidisciplinary team of geoscientists and engineers to evaluate the applicability of high-pressure air injection (HPAI) in revitalizing a nearly abandoned carbonate reservoir in the Permian Basin of West Texas. The Permian Basin, the largest oil-bearing basin in North America, contains more than 70 billion barrels of remaining oil in place and is an ideal venue to validate this technology. We have demonstrated the potential of HPAI for oil-recovery improvement in preliminary laboratory tests and a reservoir pilot project. To more completely test the technology, this project emphasized detailed characterization of reservoir properties, which were integrated to access the effectiveness and economics of HPAI. The characterization phase of the project utilized geoscientists and petroleum engineers from the Bureau of Economic Geology and the Department of Petroleum Engineering (both at The University of Texas at Austin) to define the controls on fluid flow in the reservoir as a basis for developing a reservoir model. The successful development of HPAI technology has tremendous potential for increasing the flow of oil from deep carbonate reservoirs in the Permian Basin, a target resource that can be conservatively estimated at more than 1.5 billion barrels. Successful implementation in the field chosen for demonstration, for example, could result in the recovery of more than 34 million barrels of oil that will not otherwise be produced. Geological and petrophysical analysis of available data at Barnhart field reveals the following important observations: (1) the Barnhart Ellenburger reservoir is similar to most other Ellenburger reservoirs in terms of depositional facies, diagenesis, and petrophysical attributes; (2) the reservoir is characterized by low to moderate matrix porosity much like most other Ellenburger reservoirs in the Permian Basin; (3) karst processes (cave formation, infill, and collapse) have substantially altered stratigraphic architecture and reservoir properties; (4) porosity and permeability increase with depth and may be associated with the degree of karst-related diagenesis; (5) tectonic fractures overprint the reservoir, improving overall connectivity; (6) oil-saturation profiles show that the oil-water contact (OWC) is as much as 125 ft lower than previous estimations; (7) production history and trends suggest that this reservoir is very similar to other solution-gas-drive reservoirs in the Permian Basin; and (8) reservoir simulation study showed that the Barnhart reservoir is a good candidate for HPAI and that application of horizontal-well technology can improve ultimate resource recovery from the reservoir.

Robert Loucks; Stephen C. Ruppel; Dembla Dhiraj; Julia Gale; Jon Holder; Jeff Kane; Jon Olson; John A. Jackson; Katherine G. Jackson

2006-09-30T23:59:59.000Z

177

Facies and Reservoir Characterization of the Permian White Rim Sandstone, Black Box Dolomite, and Black Dragon Member of the Triassic  

E-Print Network (OSTI)

), and an upper sandy dolowackestone (0-16 ft or 0-4.9 m). Porosity and permeability analyses indicate reservoir dolomudstone lithofacies has relatively poor reservoir quality with porosity up to 9.4% and permeability up 390 ft or 119 m), and an upper marine reworked facies (about 70 ft or 21 m). Porosity and permeability

Seamons, Kent E.

178

Magnesium Production by the Pidgeon Process Involving Dolomite Calcination and MgO Silicothermic Reduction:? Thermodynamic and Environmental Analyses  

Science Journals Connector (OSTI)

It is produced via a carbothermic reaction by applying an electric arc on a mixture of quartz sand, carbon (coke, petcoke, or coal), and iron oxide (hematite). ... C(gr) was taken as the model for the carbon source (coal, coke, or petcoke), and Fe(s) and Si(s) were the models for the alloy ferrosilicon. ... As shown in Table 2, the coproduction of 1 kg of pure Mg ingot and of 2.328 kg of CH3OH would require, according to eq 7 and assuming solar process heat, 49.58 MJ of coke (or petcoke) for the reaction. ...

M. Halmann; A. Frei; A. Steinfeld

2008-03-06T23:59:59.000Z

179

Value engineering the construction of long tunnels in the dolomites of northern Illinois, United States of America  

SciTech Connect

Fermi National Accelerator Laboratory (Fermilab), a high-energy physics laboratory operated by the Universities Research Association for the US Department of Energy, is developing plans for the construction of accelerator tunnels. The accelerator designs vary as a function of particles accelerated, technologies used and energies targeted. However, all accelerators require the excavation of long tunnels, up to 700 km in length, and tunnel costs represent a major portion of project budgets. This paper documents the findings of two studies undertaken to identify tunnel cost-drivers and outlines steps taken to initiate the ''value engineering'' of the tunnels.

Laughton, Christopher; /Fermilab

2000-01-01T23:59:59.000Z

180

Precipitation of ordered dolomite via simultaneous dissolution of1 calcite and magnesite: New experimental insights into an old2  

E-Print Network (OSTI)

hydrothermal conditions (from 100 to25 200°C). The temperature and high-carbonate alkalinity have significantly; High-carbonate alkalinity; Magnesite; Calcite; Crystal growth;46 Hydrothermal systems.47 48 insu29 of superstructure ordering reflections in XRD patterns, was determined when high-carbonate30

Paris-Sud XI, Université de

Note: This page contains sample records for the topic "dl dolomitic limestone" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


181

Reaction of Calcite and Dolomite with In-Situ Gelled Acids, Organic Acids, and Environmentally Friendly Chelating Agent (GLDA)  

E-Print Network (OSTI)

the viscosity of HCl-formic acids studied in chapter 4. 2.1 Rotating Disk Apparatu s The rotating disk reactor system (RDR) is used for primarily two important applications in the oil and gas industry. First, RDR is used to conduct corrosion tests... corrosion inhibitors, and type of metal tubular on the corrosion rate can be determined using the RDR. The RDR can also be used also to conduct a kinetics/diffusion study at the designated pressure and temperature. The availability of the fundamental...

Rabie, Ahmed 1978-

2012-11-16T23:59:59.000Z

182

Mixed water phreatic dolomitization of Jurassic oolites in the Upper Smackover Member, East Texas Basin: petrologic and isotopic evidence  

E-Print Network (OSTI)

deposited on a salt high. The Jurassic paleotopography and the high energy of the ooid shoal depositional environment supports this hypothesis. The present well location is on the flank of a salt structure and salt structures were present in Smackover... it is the simplest model that explains the presence and distribution of the various diagenetic features. The scale and geometry of the Jurassic meteoric lens was a func- tion of local and regional geology. The meteoric lens may have beer part of a regional...

Bowers, Keith Douglas

2012-06-07T23:59:59.000Z

183

Geoscience/engineering characterization of the interwell environment in carbonate reservoirs based on outcrop analogs, Permian Basin, West Texas and New Mexico - petrophysical characterization of the South Cowden Grayburg Reservoir, Ector County, Texas. Final report  

SciTech Connect

Reservoir performance of the South Cowden Grayburg field suggests that only 21 percent of the original oil in place has been recovered. The purpose of this study is to construct a realistic reservoir model to be used to predict the location of the remaining mobile oil. Construction of reservoir models for fluid-flow simulation of carbonate reservoirs is difficult because they typically have complicated and unpredictable permeability patterns. Much of the difficulty results from the degree to which diagenetic overprinting masks depositional textures and patterns. For example, the task of constructing a reservoir model of a limestone reservoir that has undergone only cementation and compaction is easier than constructing a model of a karsted reservoir that has undergone cavern formation and collapse as well as cementation and compaction. The Permian-age carbonate-ramp reservoirs in the Permian Basin, West Texas and New Mexico, are typically anhydritic dolomitized limestone. Because the dolomitization occurred soon after deposition, depositional fabrics and patterns are often retained, and a reservoir model can be constructed using depositional concepts. Recent studies of the San Andres outcrop in the Guadalupe Mountains and the Seminole San Andres reservoir in the Permian Basin illustrate how depositional fabrics and patterns can be used to construct a reservoir model when depositional features are retained.

Lucia, F.J.

1997-06-01T23:59:59.000Z

184

Regional stratigraphy and general petroleum geology, Williston Basin  

SciTech Connect

Paleozoic sedimentary rocks in the Northern Great Plains and northern Rocky Mountain region include a sequence of dominantly shallow-water marine carbonate, clastic, and evaporite deposits of Middle Cambrian through Early Permian age. The lower part of the Paleozoic section is a sequence of marine sandstone, shale, and minor limestone, rangeing in age from Middle Cambrian through Middle Ordovician. Some porous sandstone beds occur in this section, mainly in the eastern and southern bordering areas of the Williston basin and Central Montana trough. Upper Ordovician through middle Upper Mississippian rocks are primarily carbonate beds, which contain numerous widespread cyclic interbeds of evaporite and fine-grained clastic deposits. Carbonate mounds or banks were deposited through most of this time in the shallow-water areas of the Williston basin and northern Rocky Mountains. Porous units, mainly dolomite or dolomitic limestone, are common but discontinuous in most of this sequence, and are more widespread in the eastern and southern margins of the Williston basin. Cumulative petroleum production (January 1982) in the United States part of the Williston basin was about 1.1 billion bbl of oil and 1.6 tcf gas. Estimated remaining recoverable reserves are about 400 million bbl of oil and 0.8 tcf gas. U.S. Geological Survey 1980 estimates of undiscovered recoverable oil and gas resources are about 900 million bbl of oil and 3.5 tcf gas.

Peterson, J.A.; Maccary, L.M.

1985-05-01T23:59:59.000Z

185

Depositional environment of Lower Permian Stone Corral Formation  

SciTech Connect

The Lower Permian Stone Corral Formation is a 5-8 ft thick unit of dolomitic limestone and shale in a sequence of red beds that crops out in south-central Kansas. It forms a good stratigraphic marker bed in the subsurface, where it consists mainly of anhydrite (the Cimmaron anhydrite) up to 100 ft thick. At outcrop, the formation is weathered and consists of 2 interfingering facies - a crinoidal-echinoidal grainstone (in the north) and a laminated mudstone (in the south). Both the grainstone and mudstone exhibit diagenetic alteration. The grainstone is composed of well-rounded allochems of crinoid and echinoid fragments with scattered ooids, sponge spicules, peloids, and possible foraminifers and ostracods. Layers of sponge spicules alternate with peloid or ooid layers. The mudstone facies has a clotted texture and has laminations defined by the occurrence of fenestral fabric and peloids. Dolomite occurring in the Stone Corral Formation is of secondary origin. The grainstone is interpreted as being lagoonal in origin, whereas the mudstone facies is interpreted as supratidal. The grumous (clotted) texture may indicate phreatic diagenesis. The absence of anhydrite on outcrop, where it was presumably leached by surface waters leaving the less soluble dolomite, is additional evidence for a regional disconformity above the unit on the eastern side of a large, shallow, evaporitic basin.

Hylton, A.K.; Merriam, D.F.

1985-02-01T23:59:59.000Z

186

Failure mode analysis for lime/limestone FGD systems. Volume 3. Plant profiles. Part 2  

SciTech Connect

Plant profiles are given for the following plants: Tombigbee 2, 3; Apache 2, 3; Cholla 1, 2; Four Corners 1, 2, 3; Laramie River 1; Green 1, 2; Duck Creek 1; Craig 1, 2; Conesville 5, 6; Coal Creek 1, 2; Elrama 1, 2, 3, 4; and Phillips 1, 2, 3, 4, 5, 6. (DLC)

Kenney, S.M.; Rosenberg, H.S.; Nilsson, L.I.O.; Oxley, J.H.

1984-08-01T23:59:59.000Z

187

Modeling ofHybrid (Heat Radiation and Microwave) High Temperature Processing ofLimestone  

E-Print Network (OSTI)

2 l Ceralink, Inc., Troy, NY, USA 2 Department of Mathematical Sciences, Worcester Polytechnic Institute, Worcester, MA, USA 3 Institute of Radioelectronics, Warsaw University of Technology, Warsaw electromagnetic (EM) and compu tational fluid dynamics (CFD) analyses and thus cannot be easily extended

Yakovlev, Vadim

188

Evaluation of high-purity limestones and dolostones in northern Michigan  

Science Journals Connector (OSTI)

...are an additional concern. If deposits are not located near markets, cheap transpor- tation must be available. In Michigan...w a s per formed with a Model 35 Sprague and H e n w o o d diesel-powered rig equipped with AQ-size wire-line equ ipment...

189

Three-dimensional roughness of stylolites in limestones Francois Renard,1,2  

E-Print Network (OSTI)

of competition between the long-range elastic redistribution of local stress fluctuations, which roughen

190

An insoluble residue study of the Comanche Peak and Edwards limestones of Kimble County, Texas  

E-Print Network (OSTI)

through 5 of the Uuager sectioa. XXIII. Units 18 through 22 of the Segovie sectioa. . . XXIV. Units 15 through 18 of the Begovie section. . . XXV. Uaits 13 through 16 of the Segovia sectioa. . . . . . . . . 66 68 XXVI. Units 8 through 13... this horisou wU, 1 be celle4 the Waterfall horisoc. Ths Waterfall horisoc was cot observe4 at the Rcsgsr sectioc because oaly Chs lover part of the R4wsrds liosstoca was erposod la that ssctioa. Ths Watec'fall horisocc is 115 feet above Cha Cocsaccchs peak...

Jurik, Paul Peter

2012-06-07T23:59:59.000Z

191

Diagenesis of Strawn limestone, South Carlsbad Field, Eddy County, New Mexico.  

E-Print Network (OSTI)

??Strawn bioherms in South Carlsbad Field represent carbonate mud mounds formed by sediment trapping and baffling organisms, which colonized topographically higher areas of the sea… (more)

Maley, Elaine Gail

1977-01-01T23:59:59.000Z

192

A study to improve the engineering properties of limestone rock asphalt paving mixtures  

E-Print Network (OSTI)

asphalt is a naturally occuring calcareous material with its interstices filled with natural bitumen. Deposits of this material exist in various locations throughout the United States. The 1 imestone rock asphalt materials used for thi s study... streets, parking lots, etc . Since the aggregate contains natural bitumen, the amount of additional asp baltic binder required to produce a quality paving mixture is reduced. Consequently, the cost of building a road with this material is reduced...

Goodwin, Philip Wayne

1978-01-01T23:59:59.000Z

193

A study of strain characteristics in a limestone gravel subjected to repetitive loading  

E-Print Network (OSTI)

. Spencer J. Buchanan for enthusiasm and guidance; Nr. James C. Armstrong and Mr. Lionel Milberger for aid in the testing program; Mr. Frank H. Scrivner for assistance in the statistics' analysis; M". s. Bette Osborn for typing the manuscript; ard. to my.... ? gravelly sand increased approximately five to 21 per cent (depending on the lateral pressure and initial void ratio) after 20, 000- 25, 000 repetitive loadings at two-thirds of the ultimate strength, Armstrong studied the effect of loading rate...

Hargis, Louis Lane

1963-01-01T23:59:59.000Z

194

Paleoautecology of Caninia torquia (Owen) from the Beil Limestone Member (Pennsylvanian, Virgilian), Kansas  

E-Print Network (OSTI)

soft mud sub- 3 strate. Baird ( 1971) recognized two coral assemblages, a "Coral-Algal Community Wackestone" on the Nebraska shelf and a "Fusulinid-Coral Assemblage Wackestone" on the Nebraska shelf and in the Forest City basin. In the former... ( 1971) concluded that this assemblage lived in slightly deeper waters than the coral-algal community. Paleoecology of midcontinent Penn.sylva- nian rugose corals.—Most pre-1950 work on Pennsylvanian rugose corals was taxonomic, and later studies included...

Maerz, R. H., Jr.

1978-06-14T23:59:59.000Z

195

An insoluble residue study of the Cretaceous Cow Creek Limestone of Central Texas  

E-Print Network (OSTI)

Regional Stratigr chy. Local Stratigrapby 14 14 Honeycut Bend. Cyoress Creek. Hickory Creek. Cox Crossing Hamilton Pool. IB 19 2O 21 21 Rebecca Creek. PALEONTOLOGY MINERALOGY 23 25 Page Introduction 27 Constituents of the Sand... in Central Texas 17 5. Feldspar and. chert-quartz ratios and averages plotted for each section 37 6. Zonation and suggested field correlation of the Hickory Creek, Cox Crossing, Hamilton Pool, and Rebecca Creek sections 41 7. Zonation and suggested...

Morton, William Rogers

2012-06-07T23:59:59.000Z

196

Trace fossils of Fort Hays Limestone Member of Niobrara Chalk (Upper Cretaceous), west-central Kansas  

E-Print Network (OSTI)

of more resistant chalk, or the burrows of other genera (Pl. 1, fig. 4-5; Pl. 2, fig. 1). In places the cores of horizontal burrow systems are weathered to form small cavities in the rock (Pl. 1, fig. 2), resembling the "cavity preserva- tion" of BROMLEY... structures are described in as much detail as possible. SYSTEMATIC DESCRIPTIONS Genus ASTEROSOMA von Otto, 1854 [A,tercuoma VON Ono, 1854, i n 151 DIAGNOSIS.—Star-shaped structures having an elevated center; rays are bulbous, tapered distally, and wrinkled...

Frey, R. W.

1970-07-17T23:59:59.000Z

197

.:tiure Cited ., ^,"t*'{A.. "A Studv of the Interactions of Limestone in  

E-Print Network (OSTI)

an estimate of -230 r.netric tons from air pollution fallout originating in the Chicago?1 - - - ;' ,;il, p \\\\'-,-flidrocarbon Extractiongf-.rd Mine Drain- - :'iis'ii,L" in Chemical Engtteer concentration of lead and the histor-v-of local lead pollution sources(3). High surficial concentrationsof lead

Short, Daniel

198

Microfacies of the Commache Peak Limestone (Lower Cretaceous), north-central Texas  

E-Print Network (OSTI)

LIIGESTONE W4LNUT FORMATION ARENACEOUS GROUP RED RIVER GROUP Q GLEN ROSE OR ALTERNAI'ING SECS I-0 TRINTY OR BASAL SANDS GLEN RDSE FORMATION I-? 7 NAVIS PEAK IL & Gl D ALLIED FORMATIONS Fig. 1. History of stratigraphic nomenclature for the Texas... Cretaceous. Down-to-basin fault- ing w1thin the Balcones system, which began during Glen Rose (pre- Fredericksburg) deposition, tended only to cause very slight thick- ening 1n the downdip direct1on within the Lower Cretaceous rocks on the shelf (Hayward...

Gruebel, Marilyn May

2012-06-07T23:59:59.000Z

199

Geology of the Northwest Wortham area, Navarro, Limestone, and Freestone counties, Texas  

E-Print Network (OSTI)

~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ EQUIPMENT USED ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ o ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ 9 Conveyor P1pe . . . . , , . . . . . . , . . . ~ . . . . . . . , . ~ . . . . o ~ ~ ~ ~ 9 Transparent Section of Pips... ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ 20 Geometric Mean Diameter ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ 2O Procednre Used o ~ \\ ~ ~ ~ ~ ~ ~ \\ ~ ~ ~ ~ ~ ~ ~ o ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ 21 Conveyor Testing...

Brown, Clifford Littleton

2012-06-07T23:59:59.000Z

200

3-D characterization of weathered building limestones by high resolution synchrotron X-ray microtomography  

E-Print Network (OSTI)

of external environmental agents (physical, chemical and biological) such as rain, pollution, sunlight throughout the world. Every stone extracted from a quarry is subjected to deterioration due to the action extracted from quarries or from buildings, but in places where the sampled stones can be assumed

Paris-Sud XI, Université de

Note: This page contains sample records for the topic "dl dolomitic limestone" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


201

Palaeomagnetic investigation of Middle Devonian limestones of Algeria and the Gondwana reconstruction  

Science Journals Connector (OSTI)

......particularly when a combined thermal and AF treatment is applied...behaviour of the samples upon thermal and AF demagnetization, the...initial susceptibility upon thermal treatment, hysteresis cycles...igneous complex. Red Sea Hills, Sudan, Geophys. J. Int., 99......

Brigitte Smith; Alexis Moussine-Pouchkine; Ali Aït Kaci Ahmed

1994-10-01T23:59:59.000Z

202

Diagenetic history and evolution of porosity of the Cotton Valley Limestone, Southeastern Smith County, Texas  

E-Print Network (OSTI)

into post-Jurassic time, the Sabine Platform experienced several phases of upward movement, especially in the mid-Late Cretaceous (Halbouty and Halbouty, 1982). This uplift resulted in the present Sabine Uplift. In the study area, structural features... into post-Jurassic time, the Sabine Platform experienced several phases of upward movement, especially in the mid-Late Cretaceous (Halbouty and Halbouty, 1982). This uplift resulted in the present Sabine Uplift. In the study area, structural features...

Covington, Thomas Edward

2012-06-07T23:59:59.000Z

203

Limestone-Particle-Stabilized Macroemulsion of Liquid and Supercritical Carbon Dioxide in Water for Ocean Sequestration  

Science Journals Connector (OSTI)

In relation to ocean disposal of CO2 from power plants, a comprehensive plume model was developed to simulate the dynamic, near-field behavior of CO2 released in the water column as either a buoyant liq. ... from flue gases and injected into the oceans. ...

D. Golomb; E. Barry; D. Ryan; C. Lawton; P. Swett

2004-07-20T23:59:59.000Z

204

Application of borehole geophysics to fracture identification and characterization in low porosity limestones and dolostones  

SciTech Connect

Geophysical logging was conducted in exploratory core holes drilled for geohydrological investigations at three sites used for waste disposal on the US Department of Energy's Oak Ridge Reservation. Geophysical log response was calibrated to borehole geology using the drill core. Subsequently, the logs were used to identify fractures and fractured zones and to characterize the hydrologic activity of such zones. Results of the study were used to identify zones of ground water movement and to select targets for subsequent piezometer and monitoring well installation. Neutron porosity, long- and short-normal resistivity, and density logs exhibit anomalies only adjacent to pervasively fractured zones and rarely exhibit anomalies adjacent to individual fractures, suggesting that such logs have insufficient resolution to detect individual fractures. Spontaneous potential, single point resistance, acoustic velocity, and acoustic variable density logs, however, typically exhibit anomalies adjacent to both individual fractures and fracture zones. Correlation is excellent between fracture density logs prepared from the examination of drill core and fractures identified by the analysis of a suite of geophysical logs that have differing spatial resolution characteristics. Results of the study demonstrate the importance of (1) calibrating geophysical log response to drill core from a site, and (2) running a comprehensive suite of geophysical logs that can evaluate both large- and small-scale rock features. Once geophysical log responses to site-specific geological features have been established, logs provide a means of identifying fracture zones and discriminating between hydrologically active and inactive fracture zones. 9 figs.

Haase, C.S.; King, H.L.

1986-01-01T23:59:59.000Z

205

Grounding of a 230 kV Transmission line over a Limestone Ridge.  

E-Print Network (OSTI)

?? This thesis is a case study of a 230 kV transmission line in Lao P.D.R. Grounding of electrical systems is essential for safety and… (more)

Grubbström, Emma

2011-01-01T23:59:59.000Z

206

Paleoenvironmental analysis of the Cotton Valley Limestone, southeastern Smith County, Texas  

E-Print Network (OSTI)

of bedding on composition. Part, icles vere classified as ooids, peloids, intraclasts, oncolites, pisolites, siliciclastics, mudstone, cement, skeletal, and grapestones. The percentage of each depositional particle type was calculated for each thin... 200 ft (60 m) of the formation. General lithologies include mudstones to wackestones, skeletal packstones to grai nstones, non-skeletal packstones to grainstones, minor siliciclastics, and transitional lithologies. Each of these major lithic types...

Glynn, William George

2012-06-07T23:59:59.000Z

207

Submarine diagenesis in Lower Cretaceous coral-rudist reefs, Mural Limestone, southeastern Arizona  

E-Print Network (OSTI)

and accelerating voltage of 12. 5 Kev. Carbon and oxygen isotopes were measured for eight different reef constituents, and for whole-rock samples from the skeletal grainstone facies. Powdered samples obtain- ed with a dental drill were roasted at 325' C for one...-sized mollusc fragments, and large ( 1-3 mm) benthic foraminifers of the genera Orbitolina and Miliolina. Also common are subround, sand-sized grains containing micrite rims infilled by clear, blocky calcite. These altered skeletal grains were probably...

Cross, Scott Lewis

2012-06-07T23:59:59.000Z

208

Paleoenvironment of an upper Cotton Valley (Knowles limestone) patch reef, Milam County, Texas  

E-Print Network (OSTI)

'ny limes. ones, and algal boundstones with stromatoporoids and corals. The boundstores include frsmestones, bindstones and bafflestones which represent an elonga. te wave resistant encrusted skeletal patch reef tha+ developed on a salt- generated... skeletal constituents observed in thin sections. He was very gene. ous in his advice, and time given to me which made much of this study possible. I would like to ext nd my deepest tharks to my parents, Mr. and, Mrs. Kent C. Cregg, and my brother Jeff...

Cregg, Allen Kent

2012-06-07T23:59:59.000Z

209

Arun field  

SciTech Connect

The Arun field is a giant gas-condensate field operated by Mobil and Pertamina with over 20,000 acres of closure at the top of the Arun reservoir. A middle-shelf patch reef complex of early to middle Miocene age is the producing facies at the Arun field. About 1,100 ft of porous limestones, encased in shales, create a stratigraphic trap for overpressure hydrocarbons. Three main carbonate lithologies were encountered during the examination of over 4,300 ft of core; (1) a reef facies consisting of vuggy, coral encrusting, red-algal boundstones, (2) a near-reef facies consisting of foraminiferal, mixed-skeletal packstones with gravel-size coral fragments, and (3) an interreef lagoonal facies consisting of benthonic-foram packstones. Twenty-two species of corals have been identified from Arun reef facies; major reef-forming coals, listed in order of decreasing abundance, are Porites cf P. Lutes, Cyphastrea microphthalma, Astreopora myriophthalma, Styloconiella gunetheri, Porites solida, and Acropora ssp. The Arun reef is comprised of limestones (with minor amounts of dolomite). No shale beds occur in the sequence, and all carbonate facies are in communication. A pervasive microporosity, occurring throughout the Arun Limestone, results from meteoric alteration of original carbonate mud to form a microrhombic porosity that accounts for about three-fourths of the field's total porosity.

Jordan, C.F. Jr.; Abdullah, M.

1988-01-01T23:59:59.000Z

210

ENVIRONMENTAL RESEARCH 30, 291-304 (1983) Wollastonite Exposure and Lung Fibrosis  

E-Print Network (OSTI)

metamorphic limestone deposits. The commercially mined deposit is located in Lappeenranta, where the limestone

Ahmad, Sajjad

211

A study of the back contacts on CdTe/CdS solar cells D.L. Batznera  

E-Print Network (OSTI)

Institute of Technology, ZuĂ?rich, Technoparkstr. 1, 8005 ZuĂ?rich, Switzerland b ANTEC GmbH, Industriestrasse 2-4, 65779 Kelkheim, Germany Abstract Conventional back contacts on CdTe/CdS solar cells layer thickness and stability issues have been studied. Different etchants not only clean the Cd

Romeo, Alessandro

212

Frank Masci (1)MIPS D/L Review (S6), August 7, 2001 Optical Distortion and its Representation  

E-Print Network (OSTI)

-imaged focal planes. l Distortion is significant. Code-V optical ray trace models: 4.7% (24”m), 7.9% (70”m No re-gridding is done to make the BCD and correct for distortion. Instead, the distortion

Masci, Frank

213

NETL: Onsite Research  

NLE Websites -- All DOE Office Websites (Extended Search)

Fluid-Bed Gasifier/Modular Gas Cleanup Rig Fluid-Bed Gasifier/Modular Gas Cleanup Rig NETL is developing a technology base for tomorrow's highly efficient, near-zero-emissions power plants including FutureGen. One of the promising technologies NETL is pursuing is advanced fluidized-bed combustion (FBC). Pressurized FBC (PFBC) systems use a mixture of burning coal, a sorbent such as limestone or dolomite, and jets of air to produce a high-pressure gas stream at temperatures that can drive a gas turbine. Steam generated from the heat in the fluidized bed may be sent to a steam turbine, creating a highly efficient combined-cycle system. Removing and recovering particulates and contaminants from the gas and steam are accomplished in treatment vessels once combustion has occurred. PFBC may also play a role in hydrogen fuel production.

214

Decontamination of combustion gases in fluidized bed incinerators  

DOE Patents (OSTI)

Sulfur-containing atmospheric pollutants are effectively removed from exit gas streams produced in a fluidized bed combustion system by providing a fluidized bed of particulate material, i.e. limestone and/or dolomite wherein a concentration gradient is maintained in the vertical direction. Countercurrent contacting between upwardly directed sulfur containing combustion gases and descending sorbent particulate material creates a concentration gradient across the vertical extent of the bed characterized in progressively decreasing concentration of sulfur, sulfur dioxide and like contaminants upwardly and decreasing concentration of e.g. calcium oxide, downwardly. In this manner, gases having progressively decreasing sulfur contents contact correspondingly atmospheres having progressively increasing concentrations of calcium oxide thus assuring optimum sulfur removal.

Leon, Albert M. (Mamaroneck, NY)

1982-01-01T23:59:59.000Z

215

Calcination and pyroprocessing of mineral fines  

Science Journals Connector (OSTI)

ABSTRACT During the past 40 years we have witnessed an interesting development in technologies for calcination and pyroprocessing of fine-grained material. This has led to the gas suspension principles now being widely used in the cement industry and in chemical processing systems for solids. The present paper deals with the dilute-phase systems and summarises the developments over the past 10 years illustrating the importance of raw material properties and product specifications in the selection and design of GSC systems. Methods for the characterisation of raw materials, such as crushed rock, flotation concentrates and hydrates, are illustrated with examples from industrial plants operating on dolomite, limestone and alumina hydrate. KEY WORDS GSC Gas Suspension Calcination Lime, Dolime, Alumina, Minerals Processing

E.A. Neubert

1988-01-01T23:59:59.000Z

216

Formation waters from Mississippian-Pennsylvanian reservoirs, Illinois basin, USA: Chemical and isotopic constraints on evolution and migration  

SciTech Connect

We have analyzed a suite of seventy-four formation-water samples from Mississippian and Pennsylvanian carbonate and siliciclastic strata in the Illinois basin for major, minor, and trace element concentrations and for strontium isotopic composition. A subset of these samples was also analyzed for boron isotopic composition. Data are used to interpret origin of salinity and chemical and Sr isotopic evolution of the brines and in comparison with a similar data set from an earlier study of basin formation waters from Silurian-Devonian reservoirs. Systematics of Cl-Br-Na show that present Mississippian-Pennsylvanian brine salinity can be explained by a combination of subaerial seawater evaporation short of halite saturation and subsurface dissolution of halite from an evaporite zone in the middle Mississippian St. Louis Limestone, along with extensive dilution by mixing with meteoric waters. Additional diagenetic modifications in the subsurface interpreted from cation/Br ratios include K depletion through interaction with clay minerals, Ca enrichment, and Mg depletion by dolomitization, and Sr enrichment through CaCO[sub 3] recrystallization and dolomitization. Ste. Genevieve Limestone (middle Mississippian) formation waters show [sup 87]Sr/[sup 86]Sr ratios in the range 0.70782-0.70900, whereas waters from the siliciclastic reservoirs are in the rante 0.70900-0.71052. Inverse correlations between [sup 87]Sr/[sup 86]Sr and B,Li, and Mg concentrations suggest that the brines acquired radiogenic [sup 87]Sr through interaction with siliciclastic minerals. Completely unsystematic relations between [sup 87]Fr/[sup 86]Sr and 1/Sr are observed; Sr concentrations in Ste. Genevieve and Aux Vases (middle Mississippian) waters appear to be buffered by equilibrium with respect to SrSo[sub 4]. These formation waters are distinguished from Silurian-Devonian brines in the basin by elevated Cl/Br and Na/Br ratios and by unsystematic Sr isotope relationships.

Stueber, A.M. (Southern Illinois Univ., Edwardsville (United States)); Walter, L.M.; Huston, T.J. (Univ. of Michigan, Ann Arbor (United States)); Pushkar, P. (Wright State Univ., Dayton, OH (United States))

1993-02-01T23:59:59.000Z

217

Alteration of alkali reactive aggregates autoclaved in different alkali solutions and application to alkali-aggregate reaction in concrete  

SciTech Connect

Surface alteration of typical aggregates with alkali-silica reactivity and alkali-carbonate reactivity, i.e. Spratt limestone (SL) and Pittsburg dolomitic limestone (PL), were studied by XRD and SEM/EDS after autoclaving in KOH, NaOH and LiOH solutions at 150 deg. C for 150 h. The results indicate that: (1) NaOH shows the strongest attack on both ASR and ACR aggregates, the weakest attack is with LiOH. For both aggregates autoclaved in different alkali media, the crystalline degree, morphology and distribution of products are quite different. More crystalline products are formed on rock surfaces in KOH than that in NaOH solution, while almost no amorphous product is formed in LiOH solution; (2) in addition to dedolomitization of PL in KOH, NaOH and LiOH solutions, cryptocrystalline quartz in PL involves in reaction with alkaline solution and forms typical alkali-silica product in NaOH and KOH solutions, but forms lithium silicate (Li{sub 2}SiO{sub 3}) in LiOH solution; (3) in addition to massive alkali-silica product formed in SL autoclaved in different alkaline solutions, a small amount of dolomite existing in SL may simultaneously dedolomitize and possibly contribute to expansion; (4) it is promising to use the duplex effect of LiOH on ASR and ACR to distinguish the alkali-silica reactivity and alkali-carbonate reactivity of aggregate when both ASR and ACR might coexist.

Lu Duyou [College of Materials Science and Engineering, Nanjing University of Technology, 5 New Model Road, Nanjing, Jiangsu, 210009 (China) and ICON/CANMET, Natural Resources Canada, 405 Rochester Street, Ottawa, ON, K1A 0G1 (Canada)]. E-mail: duyoulu@njut.edu.cn; Mei Laibao [College of Materials Science and Engineering, Nanjing University of Technology, 5 New Model Road, Nanjing, Jiangsu, 210009 (China); Xu Zhongzi [College of Materials Science and Engineering, Nanjing University of Technology, 5 New Model Road, Nanjing, Jiangsu, 210009 (China); Tang Mingshu [College of Materials Science and Engineering, Nanjing University of Technology, 5 New Model Road, Nanjing, Jiangsu, 210009 (China); Fournier, Benoit [ICON/CANMET, Natural Resources Canada, 405 Rochester Street, Ottawa, ON, K1A 0G1 (Canada)

2006-06-15T23:59:59.000Z

218

Evaporite diagenesis driven by synsedimentary evolution of brines  

SciTech Connect

Back-reaction of brines has modified cyclic shallow water carbonate-sulfate-halite sequences (Permian) in the Palo Duro basin, Texas Panhandle. Successive parts of regressive evaporite cycles were deposited from progressively more highly evaporated seawater. The reaction of the brine with sediments deposited during earlier parts of each cycle was the major force criving diagenetic reactions and determining the final mineralogy. Normal marine limestones at the base of cycles were dolomitized in the shallow subsurface environments by brines that precipitated brine-pool evaporites in the upper parts of cycles. Gypsum dehydrated to anhydrite at burial depths of 1-2m beneath the brine-pool floor as brine salinity increased toward halite saturation. Diagenetic limpid dolomite and anhydrite replacing halite were probably derived from mixed meteoric and evaporated-marine brines squeezed from mudstone beds during compaction in the shallow subsurface. Anhydrite and halite pervasively cemented and partly replaced carbonates and gypsum. The resulting low permeability limited later diagenetic alteration, so that the early diagenetic textures and mineralogy were preserved in the burial environment. Reduction in permeability occurred before the transgression initiating the next cycle; the only major result of the introduction of seawater into the evaporite environment was dissolution of the last-deposited few meters of halite.

Hovorka, S.D.

1988-01-01T23:59:59.000Z

219

The stratigraphy of selected Mission Canyon wireline log markers, US portion of the Williston basin, North Dakota  

SciTech Connect

The Mission Canyon Formation along the northeast flank of the US Williston basin has been informally subdivided into intervals (members) based on wireline log markers. Wireline log responses of the markers are produced by both lithologic changes and radioactive elements present within these thin stratigraphic intervals. The wireline markers were originally described as transgressive events. Detailed stratigraphic analyses of the Sherwood and State A markers indicate they were deposited during progradation and sea level stillstand. A typical facies tract from east to west within the Sherwood marker contains anhydrites and anhydritic dolomites deposited in sabkha environments; patterned dolomudstones along shoreline trends (the Sherwood argillaceous marker); and limestones in shoaling environments along the Mission Canyon shelf (Sherwood gamma marker). During stillstand, brines produced in sabkha environments (east of the Sherwood shoreline) were enriched in magnesium and potassium. These brines migrated basinward first, dolomitizing mudstones. These brines were magnesium depleted by the time they reached shoals along the shelf. Potassium, however, remained in the system and is present within the marker along the shelf, as shown by a slight increase in API units on Spectrologs.

Hendricks, M.L. (Hendricks and Associates, Inc., Denver, CO (United States))

1991-06-01T23:59:59.000Z

220

Dolomite in Permian Paleosols of the Bravo Dome CO2 Field, U.S.A.: Permian Reflux Followed by Late Recrystallization at Elevated Temperature  

Science Journals Connector (OSTI)

...of Petroleum Geology, Atlas of Oil and Gas Fields...1999, Palaeogeographic Atlas: University of Texas-Arlington...Gabal Ataqu, northwest Gulf of Suez, Egypt: Sedimentary Geology...Sandstone Member United States wind transport Yeso Formation...

Katherine A. Hartig; Gerilyn S. Soreghan; Robert H. Goldstein; Michael H. Engel

Note: This page contains sample records for the topic "dl dolomitic limestone" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


221

Dolomite in Permian Paleosols of the Bravo Dome CO2 Field, U.S.A.: Permian Reflux Followed by Late Recrystallization at Elevated Temperature  

Science Journals Connector (OSTI)

...marine-nonmarine evaporite unit (Hylton 1988; Hovorka et al. 1993). The conditions that led to the deposition of the Cimmaron Anhydrite could have induced reflux of Mg-rich (marine or mixed marine-nonmarine) brines through the Abo-Tubb study...

Katherine A. Hartig; Gerilyn S. Soreghan; Robert H. Goldstein; Michael H. Engel

222

Hydrostatic pressure and fluid-density distribution of the Culebra Dolomite member of the Rustler Formation near the Waste Isolation Pilot Plant, southeastern New Mexico  

SciTech Connect

The primary objectives of the Pressure - Density Survey were to obtain the middle-of-formation pressures, determine well-bore fluid densities, define well-bore fluid density stratification, and to provide, where possible, formation water density values for wells where little or no information on densities exists. The survey collected ground-water pressure and density data during three field testing periods during the years 1986 and 1987. Data were collected from 33 individual wells located in the vicinity of the WIPP Site. 18 refs., 10 figs., 10 tabs.

Crawley, M.E.

1988-05-01T23:59:59.000Z

223

Effect of limestone reactivity on the digestibility of nutrients in sorghum based diets fed to lactating Holstein cows  

E-Print Network (OSTI)

' the starch- digesting enzyme, pancreatic alpha-amylase. Thus, fecal starch loss in cows fed high energy rations has increased, and, in turn, income over feed costs for a dairyman has d. ecreased. Attempts have been made to improve starch digestibi- lity... in all regions, intestinal maltase activity in intestinal mucosa exceed- ed amylase activity. On the other hand, Mayes and Orskov (28) showed that alpha amylase activity was also not limiting over-all starch utilization in sheep infused with gelled...

Malasri, Kriangchitt Banphabutr

2012-06-07T23:59:59.000Z

224

R tuart Haszeldine, University of Edinburgh, Edinburgh, United Kingdom Oil Charge Preserves Deep-Burial Porosity in Sandstones and Limestones  

E-Print Network (OSTI)

fluvial, shallow marine and deepwater reservoirs with unusually large porosity at the field crest permeability and 10% extra porosity. Prevention of cementation is not due, in these cases, due to clay coating chalk reservoirs do not have these problems. Cementation normally destroys porosity by 3km, however many

Haszeldine, Stuart

225

Mineralogical and chemical evolution of contaminated igneous rocks at a gabbro-limestone contact, Christmas Mountains, Big Bend region, Texas  

Science Journals Connector (OSTI)

...WT%SiOz WT.% S i0 2 Figure 4. AFM diagram for igneous and contaminated igneous rocks...S i O z Figure 3. Harker variation diagrams for igneous and contaminated igneous rocks...g 2 S i 2 0 6 ( Fe ,Mn) 2 Si 2 0g MHD Cat Fe.MnlSi^Og GABBRO O PYROXENITE...

226

Steam Reactivation and Separation of Limestone Sorbents for High Temperature Post-combustion CO2 Capture from Flue Gas.  

E-Print Network (OSTI)

?? Increasing global population and demand for energy has raised concerns of excessive anthropogenic greenhouse gas emissions from consumption of fossil fuels. Coal, in particular,… (more)

Wang, Alan Yao

2012-01-01T23:59:59.000Z

227

900 South Limestone | 317 Wethington Building | Lexington, KY 40536 | 859.323.6306 A WORLD-CLASS HOSPITAL  

E-Print Network (OSTI)

-CLASS HOSPITAL Uniquely Kentucky The Celebrate Kentucky Wall "Celebrate Kentucky" Photographers: Jeanie Adams of the hospital and will help every Kentuckian feel a part of UK HealthCare and this new facility. #12;The arts enhance the healing environment but they also invite people to visit the hospital when they are well

MacAdam, Keith

228

Failure mode analysis for lime/limestone FGD system. Volume III. Plant profiles. Part 1 of 3  

SciTech Connect

This volume contains plant profiles for: Petersburg 3; Hawthorn 3, 4; La Cygne 1; Jeffry 1, 2; Lawrence 4, 5; Green River 1-3; Cane Run 4, 5; Mill Creek 1, 3; Paddy's Run 6; Clay Boswell 4; Milton R. Young 2; Pleasants 1, 2; and Colstrip 1, 2. (DLC)

Kenney, S.M.; Rosenberg, H.S.; Nilsson, L.I.O.; Oxley, J.H.

1984-08-01T23:59:59.000Z

229

Initial test results of the limestone injection multistage burner (LIMB) demonstration project. Report for September 1984-April 1988  

SciTech Connect

This paper discusses SO/sub 2/ removal efficiency and low-NOx burner performance obtained during short term tests, as well as the impact of LIMB ash on electrostatic precipitator (ESP) performance at Ohio Edison's Edgewater Station. Project goals are to demonstrate 50% or more SO/sub 2/ removal at a Ca/S molar stoichiometry of 2.0 and NOx emissions of less than 0.5 lb/million Btu while maintaining boiler operability and reliability. The tests, conducted before September 1987, indicated that 55-60% SO/sub 2/ removal and NOx emissions on the order of 0.48 lb/million Btu are achievable. The increased dust loading of a high-resistivity ash typically limited continuous operation to 2-6 hr. The paper discusses how the LIMB ash gave rise to back corona which, in turn, increased stack opacity to regulated levels. The extension of the project to include humidification of the flue gas is also described as a way to minimize these effects.

Nolan, P.S.; Hendriks, R.V.

1988-05-01T23:59:59.000Z

230

Diagenetic history and the evolution of porosity in the Cotton Valley Limestone, Teague Townsite Field, Freestone County, Texas  

E-Print Network (OSTI)

) Regional stratigraphic column of the Upper Jurassic for the Gulf Coast Subsurface Diagrammatic dip-section showing the stratigraphic relationships of pre-Cretaceous strata of East Texas (after Fall, 1974). Location of wells showing the configuration.... Regional stratigraphic column of the Upper Jurassic for the Gulf Coast Subsurface. Fig. 5. Diagrammatic dip-section showing the stratigraphic relationships of pre-Cretaceous strata of East Texas (after Fall, 1974). DIAGRAMMATIC STRATIGRAPHIC DIP SECTION...

Steffensen, Carl Kristian

2012-06-07T23:59:59.000Z

231

An insoluble residue study of the Comanche Peak and Edwards limestones in central Kimble and eastern Sutton counties, Texas  

E-Print Network (OSTI)

and leucoxsns ars the most ooxxmon Crso? minerals yxesent. Other trace minerals include garnets glauconite? staux'elite, rutile, spinel ~ biotit?s pyrite~ spidote and anthophylkita Uoloanie glass is classed with ths txsos minerals, Constituents... and leucoxsns ars the most ooxxmon Crso? minerals yxesent. Other trace minerals include garnets glauconite? staux'elite, rutile, spinel ~ biotit?s pyrite~ spidote and anthophylkita Uoloanie glass is classed with ths txsos minerals, Constituents...

Graczyk, Edward John

2012-06-07T23:59:59.000Z

232

LIMB Demonstration Project Extension and Coolside Demonstration  

SciTech Connect

This report presents results from the limestone Injection Multistage Burner (LIMB) Demonstration Project Extension. LIMB is a furnace sorbent injection technology designed for the reduction of sulfur dioxide (SO[sub 2]) and nitrogen oxides (NO[sub x]) emissions from coal-fired utility boilers. The testing was conducted on the 105 Mwe, coal-fired, Unit 4 boiler at Ohio Edison's Edgewater Station in Lorain, Ohio. In addition to the LIMB Extension activities, the overall project included demonstration of the Coolside process for S0[sub 2] removal for which a separate report has been issued. The primary purpose of the DOE LIMB Extension testing, was to demonstrate the generic applicability of LIMB technology. The program sought to characterize the S0[sub 2] emissions that result when various calcium-based sorbents are injected into the furnace, while burning coals having sulfur content ranging from 1.6 to 3.8 weight percent. The four sorbents used included calcitic limestone, dolomitic hydrated lime, calcitic hydrated lime, and calcitic hydrated lime with a small amount of added calcium lignosulfonate. The results include those obtained for the various coal/sorbent combinations and the effects of the LIMB process on boiler and plant operations.

Goots, T.R.; DePero, M.J.; Nolan, P.S.

1992-11-10T23:59:59.000Z

233

LIMB Demonstration Project Extension and Coolside Demonstration. [Final report  

SciTech Connect

This report presents results from the limestone Injection Multistage Burner (LIMB) Demonstration Project Extension. LIMB is a furnace sorbent injection technology designed for the reduction of sulfur dioxide (SO{sub 2}) and nitrogen oxides (NO{sub x}) emissions from coal-fired utility boilers. The testing was conducted on the 105 Mwe, coal-fired, Unit 4 boiler at Ohio Edison`s Edgewater Station in Lorain, Ohio. In addition to the LIMB Extension activities, the overall project included demonstration of the Coolside process for S0{sub 2} removal for which a separate report has been issued. The primary purpose of the DOE LIMB Extension testing, was to demonstrate the generic applicability of LIMB technology. The program sought to characterize the S0{sub 2} emissions that result when various calcium-based sorbents are injected into the furnace, while burning coals having sulfur content ranging from 1.6 to 3.8 weight percent. The four sorbents used included calcitic limestone, dolomitic hydrated lime, calcitic hydrated lime, and calcitic hydrated lime with a small amount of added calcium lignosulfonate. The results include those obtained for the various coal/sorbent combinations and the effects of the LIMB process on boiler and plant operations.

Goots, T.R.; DePero, M.J.; Nolan, P.S.

1992-11-10T23:59:59.000Z

234

Geologic characterization report for the Paradox Basin Study Region, Utah Study Areas. Volume 6. Salt Valley  

SciTech Connect

Surface landforms in the Salt Valley Area are generally a function of the Salt Valley anticline and are characterized by parallel and subparallel cuestaform ridges and hogbacks and flat valley floors. The most prominent structure in the Area is the Salt Valley anticline. Erosion resulting from the Tertiary uplift of the Colorado Plateau led to salt dissolution and subsequent collapse along the crest of the anticline. Continued erosion removed the collapse material, forming an axial valley along the crest of the anticline. Paleozoic rocks beneath the salt bearing Paradox Formation consist of limestone, dolomite, sandstone, siltstone and shale. The salt beds of the Paradox Formation occur in distinct cycles separated by an interbed sequence of anhydrite, carbonate, and clastic rocks. The Paradox Formation is overlain by Pennsylvanian limestone; Permian sandstone; and Mesozoic sandstone, mudstone, conglomerate and shale. No earthquakes have been reported in the Area during the period of the historic record and contemporary seismicity appears to be diffusely distributed, of low level and small magnitude. The upper unit includes the Permian strata and upper Honaker Trail Formation. The current data base is insufficient to estimate ground-water flow rates and directions in this unit. The middle unit includes the evaporites in the Paradox Formation and no laterally extensive flow systems are apparent. The lower unit consists of the rocks below the Paradox Formation where permeabilities vary widely, and the apparent flow direction is toward the west. 108 refs., 39 figs., 9 tabs.

Not Available

1984-12-01T23:59:59.000Z

235

Alteration of alkali reactive aggregates autoclaved in different alkali solutions and application to alkali-aggregate reaction in concrete (II) expansion and microstructure of concrete microbar  

SciTech Connect

The effect of the type of alkalis on the expansion behavior of concrete microbars containing typical aggregate with alkali-silica reactivity and alkali-carbonate reactivity was studied. The results verified that: (1) at the same molar concentration, sodium has the strongest contribution to expansion due to both ASR and ACR, followed by potassium and lithium; (2) sufficient LiOH can completely suppress expansion due to ASR whereas it can induce expansion due to ACR. It is possible to use the duplex effect of LiOH on ASR and ACR to clarify the ACR contribution when ASR and ACR may coexist. It has been shown that a small amount of dolomite in the fine-grained siliceous Spratt limestone, which has always been used as a reference aggregate for high alkali-silica reactivity, might dedolomitize in alkaline environment and contribute to the expansion. That is to say, Spratt limestone may exhibit both alkali-silica and alkali-carbonate reactivity, although alkali-silica reactivity is predominant. Microstructural study suggested that the mechanism in which lithium controls ASR expansion is mainly due to the favorable formation of lithium-containing less-expansive product around aggregate particles and the protection of the reactive aggregate from further attack by alkalis by the lithium-containing product layer.

Lu Duyou [College of Materials Science and Engineering, Nanjing University of Technology, 5 New Model Road, Nanjing, 210009 (China)]. E-mail: duyoulu@njut.edu.cn; Mei Laibao [College of Materials Science and Engineering, Nanjing University of Technology, 5 New Model Road, Nanjing, 210009 (China); Xu Zhongzi [College of Materials Science and Engineering, Nanjing University of Technology, 5 New Model Road, Nanjing, 210009 (China); Tang Mingshu [College of Materials Science and Engineering, Nanjing University of Technology, 5 New Model Road, Nanjing, 210009 (China); Mo Xiangyin [Analysis and Test Central, Nanjing Normal University, 122 Ninghai Road, Nanjing, 210097 (China); Fournier, Benoit [ICON/CANMET, Natural Resources Canada, 405 Rochester Street, Ottawa, ON, K1A 0G1 (Canada)

2006-06-15T23:59:59.000Z

236

Progradational sequences in lower Ordovician portion of Deadwood Formation, Williston basin  

SciTech Connect

In the Williston basin, the Cambrian and Ordovician Deadwood Formation can be divided into six informal members based on gamma-ray log characteristics. Members C through F are Early Ordovician (Tremadocian to Arenigian) and consist of three progradational sequences. In ascending order, the sequences consist of (1) a mixed sandstone-limestone lithotype, (2) limestone lithotypes ranging from mudstone to grainstone, (3) bioturbated, peloidal, calcareous, siliciclastic mudstone and siltstone, (4) bioturbated to planar-laminated, peloidal, calcareous siltstone and sandstone, (5) Skolithos-bored, cross-bedded to planar-laminated quartzarenite, (6) bioturbated dolomite and anhydrite-cemented fossiliferous quartz wacke, and (7) silty laminated dolomudstone. The asymmetrical sequences represent progradation of a siliciclastic shoreline, back-barrier lagoon, and intertidal algal flat over a siliciclastic shelf and a distal carbonate shoal. The present distribution of the sequences and individual lithotypes in the Williston basin is a function of the limited eastward advance of the carbonate shoal during transgression, the limited westward advance of the shoreline during progradation, deep shoreface erosion of the previous sequence during rapid transgression, and Middle Ordovician erosion.

Anderson, D.

1988-07-01T23:59:59.000Z

237

Regional lithofacies patterns of the louark group in northeast Texas  

SciTech Connect

The northeasternmost part of the East Texas basin is a relatively simple area in which to observe the lithologic patterns of the Late Jurassic Smackover, Buckner and Gilmer sedimentary wedge. Throughout most of the area, the Smackover is a shallowing-upward carbonate capped by a variably dolomitized grainstone. The overlying Buckner grades from updip red beds to downdip anhydrite with red beds overlying anhydrite in most of the area. The Buckner grades into the Smackover and thus pinches out downdip. The Gilmer consists largely of limestone that grades updip into sandstone and downdip into shale or muddy limestones. Those gross patterns, coupled with critical interpretations of paleoenvironment based on more detailed lithologic observations, lead to a simple synthesis of geologic history. With marine inundation of the east Texas area and a lack of terrigenous influx, carbonate began to accumulate and a Smackover shallow marine/shoreline complex prograded basinward. Behind the shoreline complex, a starved area developed whose landward side filled with a red bed wadi plain and marine side with gypsum precipitated in a hypersaline lagoon. The most restricted areas of the lagoon saw halite precipitation. The Buckner complex prograded basinward behind the Smackover paralic facies creating a sedimentary platform that projected 70 km into the basin. A marine transgression reestablished limestone deposition of the Gilmer on the Buckner platform. The shallow-marine Gilmer prograded across the shallow platform back to the location of the youngest Smackover shoreline. The shoreline facies aggraded at the platform edge until Terrigenous clastics in the western part of the area near the top of the Gilmer evidently record a short-lived regression. Since the Buckner/Gilmer boundary represents a more profound depositional change than the gradational Buckner/Smackover contact, it seems appropriate to consider the Buckner a formation rather than a member of the Gilmer.

Swenson, D.R. (Energy Development, Bellaire, TX (United States))

1993-09-01T23:59:59.000Z

238

Evidence for Abiogenic Hydrocarbons  

Science Journals Connector (OSTI)

... showing an intimate association of bitumen with dolomite, baryte, galena, blende, chalcopyrite and aurichalcite, but this mineralization is confined to the zone of dolomitization. Bitumen also occurs in ...

P. C. SYLVESTER-BRADLEY; R. J. KING

1963-05-25T23:59:59.000Z

239

Epoxy, ZnO, and PTFE nanocomposite: friction and wear optimization N.L. McCook, B. Boesl, D.L. Burris and W.G. Sawyer*  

E-Print Network (OSTI)

Epoxy, ZnO, and PTFE nanocomposite: friction and wear optimization N.L. McCook, B. Boesl, D and increase the wear resistance of epoxy, nanoparticles of zinc oxide and polytetrafluoro- ethylene (PTFE procedure in order to find a volume percent for optimized wear resistance and friction coefficient

Sawyer, Wallace

240

de la pression de l'air (entre zero et 75 millimtres), et restent les mmes quc les surfaces dl'S ballons soient noircies ou non, ce qui  

E-Print Network (OSTI)

galvamscher Combinationen durch die WĂ€rme (Changements qu'eprouve la force Ă©lectromotrice des combinaisons

Boyer, Edmond

Note: This page contains sample records for the topic "dl dolomitic limestone" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


241

Effects of d,l-2-Difluoromethylornithine and Indomethacin on Mammary Tumor Promotion in Rats Fed High n-3 and/or n-6 Fat Diets  

Science Journals Connector (OSTI)

...522:5 n-3OthersCorn oil"11.22.125.059...respectively. The menhaden oil was provided by Dr. Tony...Chemical Co., St. Louis, Missouri. Corn oil was purchased from Seaway...were killed using CO: gas. A complete necropsy examination...

Soad H. Abou-El-Ela; Keith W. Prasse; Robert L. Farrell; Richard W. Carroll; Adelbert E. Wade; and Opal R. Bunce

1989-03-15T23:59:59.000Z

242

F. Jerry Lucia Publications  

E-Print Network (OSTI)

/Sections Lucia, F. J., 1995, Chapter 14, Lower Paleozoic cavern development, collapse, and dolomitization

Yang, Zong-Liang

243

Technology transfer report: feasibility study for the use of geothermal brine in the Ashdod area, Israel  

SciTech Connect

The hydrothermal potential of the Ashdod area, Israel, was evaluated to determine its suitability as the low grade energy source required to operate the Ashdod desalination plant. An estimated 1250 cubic meters per hour of 120/sup 0/C brine would be adequate to supply the hot water necessary for operating the desalination plant. Considerable interest in oil exploration in the Ashdod area resulted in the drilling of six wells into the Jurassic formations by Oil Exploration (Investments) Ltd. (OEL) in 1976-1980. A small amount of oil was found in two wells, Ashdod 2 and 5. The remaining wells were abandoned as ''dry holes''. Evaluation of the drill cuttings, cores, and the electric logs defined two lithologic units of potential interest for hydrothermal exploitation, the Zohar and Shderot Dolomites. Investigation of the hydrothermal potential of the Jurassic formations underlying the Ashdod area has revealed that the aquifer temperatures range between 85 and 92/sup 0/C. The hydrologic parameters are not well defined; however the matrix permeability of the dolomites and limestones is probably between 1 and 10 md. This is insufficient permeability for a large scale pumping operation such as the one required to operate the desalination plant. Therefore, successful utilization of the resource requires the presence of significant fractures and/or connected vugs in the formation. The very low well productivity and formation plugging may indicate that permeability of the fracture zones may easily be impaired, suggesting that the fracture zones are not suitable production intervals. Until a test is conducted on a properly completed well, it is not possible to evaluate the deliverability of wells tapping these aquifers. 14 refs., 8 figs.

Benson, S.M.

1984-08-01T23:59:59.000Z

244

Chemical characteristics of waters in Karst Formations at the Oak Ridge Y-12 Plant  

SciTech Connect

Several waste disposal sites are located adjacent to or on a karst aquifer composed of the Cambrian Maynardville Limestone (Cmn) and the Cambrian Copper Ridge Dolomite (Ccr) at the U.S. Department of Energy Oak Ridge Y-12 Plant in Oak Ridge, TN. Highly variable chemical characteristics (i.e., hardness) can indicate that the portion of the aquifer tapped by a particular well is subject to a significant quick-flow component where recharge to the system is rapid and water levels and water quality change rapidly in response to precipitation events. Water zones in wells at the Y-12 Plant that exhibit quick-flow behavior (i.e., high hydraulic conductivity) are identified based on their geochemical characteristics and variability in geochemical parameters, and observations made during drilling of the wells. The chemical data used in this study consist of between one and 20 chemical analyses for each of 102 wells and multipart monitoring zones. Of these 102 water zones, 10 were consistently undersaturated with respect to calcite suggesting active dissolution. Repeat sampling of water zones shows that both supersaturation and undersaturation with respect to dolomite occurs in 46 water zones. Twelve of the zones had partial pressure of CO{sub 2} near atmospheric values suggesting limited interaction between recharge waters and the gases and solids in the vadose zone and aquifer, and hence, relatively short residence times. The preliminary data suggest that the Cmn is composed of a complicated network of interconnected, perhaps anastomosing, cavities. The degree of interconnection between the identified cavities is yet to be determined, although it is expected that there is a significant vertical and lateral interconnection between the cavities located at shallow depths in the Cnm throughout Bear Creek Valley and the Y-12 Plant area.

Shevenell, L.A. [Univ. of Nevada, Reno, NV (United States). Nevada Bureau of Mines and Geology

1994-11-01T23:59:59.000Z

245

Rhabdomesid bryozoans of the Wreford Megacyclothem (Wolfcampian, Permian) of Nebraska, Kansas, and Oklahoma  

E-Print Network (OSTI)

t..A Kan Tpk. [5,413 # 111 L1_60) 0111111111111111111111E111111111111111111111111111111111111111111111111tioontin(n% 40„,„ 4bIllmm 11ou111111111111011111111111110111111 Nummumais - :11111iiiimummill1111111111111O111 :wow ROCK TYPES algal limestone... [72 algal molluscan limestone.. chalky limestone =I cherty limestone calcareous shole. El brachiopod-molluscan limestone interbedded with calcareous shale !I various noncherty limestones (mostly molluscan and brachiopod-molluscan limestones (mostly...

Newton, G. B.

1971-10-22T23:59:59.000Z

246

Diagenetic origin of ironstone crusts in the Lower Cenomanian Bahariya Formation, Bahariya Depression, Western Desert, Egypt  

Science Journals Connector (OSTI)

Abstract In this paper, a new interpretation of the ironstone crusts of the Bahariya Formation as late diagenetic products is provided. The siliciclastic Lower Cenomanian Bahariya Formation outcropping in the northern part of the Bahariya Depression (Western Desert, Egypt) is subdivided into three informal units that are mainly composed of thinly laminated siltstone, cross-bedded and massive sandstone, fossiliferous sandstone/sandy limestone and variegated shale. Abundant ironstone crusts occur preferentially within its lower and upper units but are absent in the middle unit. The ironstone crusts show selective replacement of carbonate components, including calcretes, by iron oxyhydroxides. More permeable parts of the terrigenous beds such as burrow traces, subaerial exposure surfaces, concretionary features and soft-sediment deformation structures led to heterogeneous distribution of the iron oxyhydroxides. A variety of diagenetic minerals, where goethite and hematite are the main end-products, were characterized by mineralogical analysis (XRD), petrography and SEM observation, and geochemical determinations (EMPA). Other diagenetic minerals include Fe-dolomite/ankerite, siderite, manganese minerals, barite, silica, illite/smectite mixed-layer, and bitumen. These minerals are interpreted to be formed in different diagenetic stages. Some minerals, especially those formed during eodiagenesis, show features indicative of biogenic activity. During burial, dolomite and ankerite replaced preferentially the depositional carbonates and infilled secondary porosity as well. Also during mesodiagenesis, the decomposition of organic matter resulted in the formation of bitumen and created reducing conditions favorable for the mobilization of iron-rich fluids in divalent stage. Telodiagenesis of the Cenomanian Bahariya deposits took place during the Turonian–Santonian uplift of the region. This resulted in partial or total dissolution of Fe-dolomite and ankerite which was concomitant to iron oxyhydroxide precipitation upon mixing with shallow oxygenated water. Circulation of reducing iron-rich fluids through fractures and inter and intrastratal discontinuities is proposed as an alternative model to explain the controversial source of iron for the ironstone crusts of the Bahariya Formation. The origin of iron-rich fluids is probably related to the basement rocks. The provided model relates the fluid movements through fractures and discontinuities with the preferential replacement of carbonates. This combination of processes is consistent with the heterogeneous geometries and the wide distribution of the ironstones.

A.M. Afify; M.E. Sanz-Montero; J.P. Calvo; H.A. Wanas

2015-01-01T23:59:59.000Z

247

Heterogeneous Shallow-Shelf Carbonate Buildups in the Paradox Basin, Utah and Colorado: Targets for Increased Oil Production and Reserves Using Horizontal Drilling Techniques  

SciTech Connect

The Paradox Basin of Utah, Colorado, Arizona, and New Mexico contains nearly 100 small oil fields producing from carbonate buildups within the Pennsylvanian (Desmoinesian) Paradox Formation. These fields typically have one to 10 wells with primary production ranging from 700,000 to 2,000,000 barrels (111,300-318,000 m{sup 3}) of oil per field and a 15 to 20 percent recovery rate. At least 200 million barrels (31.8 million m{sup 3}) of oil will not be recovered from these small fields because of inefficient recovery practices and undrained heterogeneous reservoirs. Several fields in southeastern Utah and southwestern Colorado are being evaluated as candidates for horizontal drilling and enhanced oil recovery from existing vertical wells based upon geological characterization and reservoir modeling case studies. Geological characterization on a local scale is focused on reservoir heterogeneity, quality, and lateral continuity, as well as possible reservoir compartmentalization, within these fields. This study utilizes representative cores, geophysical logs, and thin sections to characterize and grade each field's potential for drilling horizontal laterals from existing development wells. The results of these studies can be applied to similar fields elsewhere in the Paradox Basin and the Rocky Mountain region, the Michigan and Illinois Basins, and the Midcontinent region. This report covers research activities for the first half of the fourth project year (April 6 through October 5, 2003). The work included (1) analysis of well-test data and oil production from Cherokee and Bug fields, San Juan County, Utah, and (2) diagenetic evaluation of stable isotopes from the upper Ismay and lower Desert Creek zones of the Paradox Formation in the Blanding sub-basin, Utah. Production ''sweet spots'' and potential horizontal drilling candidates were identified for Cherokee and Bug fields. In Cherokee field, the most productive wells are located in the thickest part of the mound facies of the upper Ismay zone, where microporosity is well developed. In Bug field, the most productive wells are located structurally downdip from the updip porosity pinch out in the dolomitized lower Desert Creek zone, where micro-box-work porosity is well developed. Microporosity and micro-box-work porosity have the greatest hydrocarbon storage and flow capacity, and potential horizontal drilling target in these fields. Diagenesis is the main control on the quality of Ismay and Desert Creek reservoirs. Most of the carbonates present within the lower Desert Creek and Ismay have retained a marine-influenced carbon isotope geochemistry throughout marine cementation as well as through post-burial recycling of marine carbonate components during dolomitization, stylolitization, dissolution, and late cementation. Meteoric waters do not appear to have had any effect on the composition of the dolomites in these zones. Light oxygen values obtained from reservoir samples for wells located along the margins or flanks of Bug field may be indicative of exposure to higher temperatures, to fluids depleted in {sup 18}O relative to sea water, or to hypersaline waters during burial diagenesis. The samples from Bug field with the lightest oxygen isotope compositions are from wells that have produced significantly greater amounts of hydrocarbons. There is no significant difference between the oxygen isotope compositions from lower Desert Creek dolomite samples in Bug field and the upper Ismay limestones and dolomites from Cherokee field. Carbon isotopic compositions for samples from Patterson Canyon field can be divided into two populations: isotopically heavier mound cement and isotopically lighter oolite and banded cement. Technology transfer activities consisted of exhibiting a booth display of project materials at the annual national convention of the American Association of Petroleum Geologists, a technical presentation, a core workshop, and publications. The project home page was updated on the Utah Geological Survey Internet web site.

Thomas C. Chidsey; Kevin McClure; Craig D. Morgan

2003-10-05T23:59:59.000Z

248

Comparative study of the reactions of metal oxides and carbonates with H{sub 2}S and SO{sub 2}. Final technical report, September 1990--February 1994  

SciTech Connect

The primary objective of this project had been the investigation of the effects of pore structure on the capacity of porous metal oxides for removal of gaseous pollutants from flue gases of power plants (SO{sub 2}) and hot coal gas (primarily H{sub 2}S). Porous calcines obtained from natural precursors (limestones and dolomites) and sorbents based on zinc oxide were used as model systems in our experimental studies, which included reactivity evolution experiments and pore structure characterization using a variety of methods. The key idea behind this project was to appropriately exploit the differences of the sulfidation and sulfation reactions (for instance, different molar volumes of solid products) to elucidate the dependence of the sorptive capacity of a porous sorbent on its physical microstructure. In order to be able to proceed faster and more productively on the analysis of the above defined problem, it was decided to employ in our studies solids whose reaction with SO{sub 2} (limestone calcines) or H{sub 2}S (sorbents based on zinc oxide) had been investigated in detail in past studies by our research group. Reactivity vs time or conversion vs time studies were conducted using thermogravimetry and fixed-bed and fluidized-bed reactors. The pore structure of partially reacted samples collected at selected time instants or conversion levels was analyzed by gas adsorption and mercury porosimetry. For better characterization of the pore structure of the solid samples, we also carried out intraparticle diffusivity measurements by the peak-broadening (chromatographic) method, using a system developed for this purpose in our laboratory. In the context of this part of the project, we also conducted a detailed theoretical investigation of the measurement of effective diffusivities in porous solids using the diffusion-cell method.

Sotirchos, S.V.

1994-03-01T23:59:59.000Z

249

Little Knife field - US Williston basin  

SciTech Connect

Little Knife field is a combination structural and stratigraphic trap located near the structural center of the Williston basin, North Dakota. The field is approximately 12 mi (19.3 km) long and 2.5 to 5.5 mi (4 to 8.9 km) wide. Little Knife was discovered by Gulf Oil in 1976 as part of a regional exploration play involving a transition from impermeable to porous carbonate rocks. In 1987, ultimate recovery from the Mission Canyon (Mississippian) reservoir was estimated to be 97.5 MMBO. This included 57.5 MMBO primary, 27 MMBO secondary, and 13 MMBO tertiary (CO{sub 2}) oil. At present the field is still under primary recovery, since utilization efforts have not been successful. Approximately one-third of Little Knife's 130 ft (39.6 m) oil column is trapped by structural closure beneath a regional anhydrite seal in a north-south-trending anticline. The remaining two-thirds of the oil column is trapped where the reservoir beds change facies from porous dolostones and dolomitic limestones to nonporous limestones. Structural entrapment accounts for approximately 50% (127 MMBO) of the OOIP, but covers only 30% of the producing area. Production is from the upper portions of the Mission Canyon Formation, a regressive, shoaling-upward carbonate-anhydrite sequence deposited in a slowly shrinking epeiric sea. The Mission Canyon in the Little Knife area is divided into six zones that record predominantly cyclic, subtidal deposition. These are overlain by prograding lagoonal, tidal flat, and sabkha beds. The source of Mission Canyon oil is thought to be the Bakken Formation, an organic-rich shale at the base of the Mississippian.

Wittstrom, M.D.; Lindsay, R.F. (Chevron USA, Inc., Midland, TX (United States))

1991-03-01T23:59:59.000Z

250

Estimation of the damage of a porous limestone from continuous (P- and S-) wave velocity measurements under uniaxial loading and different hydrous conditions  

Science Journals Connector (OSTI)

......Schubnel et al. 2005) and shale (Dewhurst Siggins 2006; Sarout...indicates that the damage is anisotropic. This decrease in Young's...isotropic and became progressively anisotropic during loading. Indeed, during...microcracks and stress field on shale anisotropy, Geophys. J......

J. Eslami; D. Grgic; D. Hoxha

2010-12-01T23:59:59.000Z

251

Carbon and oxygen isotope halos in the host limestone, El Mochito Zn-Pb-(Ag) skarn massive sulfide-oxide deposit, Honduras  

Science Journals Connector (OSTI)

...sulfide-oxide deposit, Honduras Rodrigo Vazquez Torsten W. Vennemann...deposit, Honduras Vazquez Rodrigo Author University of Michigan...Valanginian Barriasien Todos Santos Fm, Upper Jurassic Middle...Yojoa Nueva Main I 4000 Todos Santos Fm. Faults 6000 8000 10000...

Rodrigo Vazquez; Torsten W. Vennemann; Stephen E. Kesler; Norman Russell

252

Moduli dispersion and attenuation in limestones in the laboratory L. Adam and M. Batzle, Center for Rock Abuse, Colorado School of Mines  

E-Print Network (OSTI)

variations in the intrinsic attenuation as a function of fluid content, and rock permeability at reservoir is common practice in reservoir rock physics. With knowl- edge of these properties, enhanced oil recovery transmitted through the rock core. We investigate the relation of permeability to attenuation, as well

253

High-volume natural volcanic pozzolan and limestone powder as partial replacements for portland cement in self-compacting and sustainable concrete  

E-Print Network (OSTI)

the resulting self-compacting concrete (SCC). Petrographicity, which satisfy self-compacting concrete criteria withoutcement in self-compacting and sustainable concrete K. Celik

2014-01-01T23:59:59.000Z

254

A study of some of the factors influencing the laboratory determination of the relative permeability-saturation relationship for large diameter limestone cores  

E-Print Network (OSTI)

Simultaneous Air-Brine Infection Studies Static Capillary Pressure Tests . . . ~ . . . . Relative Permeability-Saturation Relationship for Various Type Ned. ia . 8 2. Typical Capillary Pressure-Saturation Curve . . . . . . 14 A Core After Embeddment...-Satuz'ation Relationship For Darst Creek Field. Cores Employing Stepwise Air InJectioc ~ ~ ~ ~ ~ 37 Brine Re. ative Permeability-Saturation Relationship Fcr Darst, Creek Field. Cores 1, 2, 2A Employing Simultaneous Air-Brine In...

Young, Roy M

2012-06-07T23:59:59.000Z

255

Experimental and Modeling Study of Sulfur Capture by Limestone in Selected Conditions of Air-Fired and Oxy-fuel Circulating Fluidized-Bed Boilers  

Science Journals Connector (OSTI)

Liu et al.(5) noticed the influence of the system itself, noting that SO2 is enriched in the furnace of oxy-fuel combustion systems because the flue gas is recycled. ... This work has also been supported by the Academy of Finland under Grant 124368 and Foster Wheeler Energia Oy. ... In this study, the influence of CO2 on sulfur capture efficiency was studied during fluidized-bed desulfurization by experiments and modeling. ...

Sirpa Takkinen; Timo Hyppänen; Jaakko Saastamoinen; Toni Pikkarainen

2011-06-30T23:59:59.000Z

256

Superfund record of decision (EPA Region 1): Loring Air Force Base, operable unit 3 (Debris Disposal Unit), Limestone, ME, September 27, 1996  

SciTech Connect

This decision document presents the final remedies for OU3, which consists of 17 sites: No further action for the following 14 NFA (no further action) sites - Ohio Road Debris Area, Oklahoma Road Debris Area, KC-135 Crash Area, Dumpster Cleaning Area Site/Building 7841, Explosive Ordnance Disposal (EOD) Area-Cylinders, Golf Course Maintenance Shed Area, Chapman Pit Debris Area, 9000 Debris Area, Solvent/Paint Dock Area, Prima Beef Debris Area, Buildings 8951 and 8960 (DRMO), Old PX Gas Station UST, F-106A Crash Area, and Demineralization Plant; Further investigation for the Outdoor Firing Range and EOD Range; and Remedial action for the Contract Storage Shed Area site to address the contaminated soils/sediments.

NONE

1997-04-01T23:59:59.000Z

257

Superfund record of decision (EPA Region 1): Loring Air Force Base, Operable Units 3, 5, 10, and 11, Limestone, ME, August 21, 1998  

SciTech Connect

The Loring Air Force Base National Priorities List (NPL) Site is located in Aroostook County, Maine. This decision document presents the selected remedial actions for the source areas at the following sites located within OUs 3, 5, 10, and 11 at the Site: OU3 - Explosive Ordnance Disposal (EOD) Range Outdoor Firing Range; OU5 -- Base Exchange Service Station (BXSS); OU10 -- Pumphouse (PH) 8210; PH 8270; Former Solvent Storage Building (FSSB); and OU11 -- Refueling Maintenance Shop Area (RMSA); Vehicle Maintenance Building (VMB); The USAF has evaluated the potential risks to human health and the environment at each of the these sites and developed the site-specific remediation goals for the source areas at each of these sites based on the future land use determinations made in the April 1996 Record of Decision (PB96-963703) for the Disposal of Loring Air Force Base, Maine. Therefore, the No Further CERCLA Action decisions for the source areas at each of these sites is based on the assumption that future land use at each site shall be in accordance with the Disposal ROD (i.e., that real property comprising the site shall be parceled, disposed of, and reused in accordance with the Disposal ROD).

NONE

1999-03-01T23:59:59.000Z

258

THE COMPOSITION OF BRYOPHYTE COMMUNITIES ON LIMESTONE VERSUS BASALT SUBSTRATES IN COASTAL AND MID-ELEVATION FORESTS OF MO'OREA, FRENCH POLYNESIA  

E-Print Network (OSTI)

and macronutrients, like phosphorous, (Bailey 1996) which isP=0.0034). Lastly, the phosphorous concentration isin a higher pH. Finally, phosphorous levels were 3ppm higher

Wu, Jasper

2012-01-01T23:59:59.000Z

259

DILUTE SURFACTANT METHODS FOR CARBONATE FORMATIONS  

SciTech Connect

There are many carbonate reservoirs in US (and the world) with light oil and fracture pressure below its minimum miscibility pressure (or reservoir may be naturally fractured). Many carbonate reservoirs are naturally fractured. Waterflooding is effective in fractured reservoirs, if the formation is water-wet. Many fractured carbonate reservoirs, however, are mixed-wet and recoveries with conventional methods are low (less than 10%). Thermal and miscible tertiary recovery techniques are not effective in these reservoirs. Surfactant flooding (or huff-n-puff) is the only hope, yet it was developed for sandstone reservoirs in the past. The goal of this research is to evaluate dilute (hence relatively inexpensive) surfactant methods for carbonate formations and identify conditions under which they can be effective. Anionic surfactants (SS-6656, Alfoterra 35, 38, 63,65,68) have been identified which can change the wettability of the calcite surface to intermediate/water-wet condition as well or better than the cationic surfactant DTAB with a West Texas crude oil in the presence of Na{sub 2}CO{sub 3}. All the carbonate surfaces (Lithographic Limestone, Marble, Dolomite and Calcite) show similar behavior with respect to wettability alteration with surfactant 4-22. Anionic surfactants (5-166, Alfoterra-33 and Alfoterra-38 and Alfoterra-68), which lower the interfacial tension with a West Texas crude oil to very low values (<10{sup -2} nM/m), have also been identified. Plans for the next quarter include conducting wettability, mobilization, and imbibition studies.

Kishore K. Mohanty

2004-01-01T23:59:59.000Z

260

Market Assessment and Technical Feasibility Study of Pressurized Fluidized Bed Combustion Ash Use  

SciTech Connect

Western Research Institute in conjunction with the Electric Power Research Institute, Foster Wheeler Energy International, Inc. and the U.S. Department of Energy Technology Center (METC), has undertaken a research and demonstration program designed to examine the market potential and the technical feasibility of ash use options for pressurized fluidized bed combustion (PFBC) ashes. The assessment is designed to address six applications, including: (1) structural fill, (2) road base construction, (3) supplementary cementing materials in portland cement, (4) synthetic aggregate, and (5) agricultural/soil amendment applications. Ash from low-sulfur subbituminous coal-fired Foster Wheeler Energia Oy pilot circulating PFBC tests in Karhula, Finland, and ash from the high-sulfur bituminous coal-fired American Electric Power (AEP) bubbling PFBC in Brilliant, Ohio, were evaluated in laboratory and pilot-scale ash use testing. This paper addresses the technical feasibility of ash use options for PFBC unit using low- sulfur coal and limestone sorbent (karhula ash) and high-sulfur coal and dolomite sorbents (AEP Tidd ash).

Bland, A.E.; Brown, T.H. [Western Research Inst., Laramie, WY (United States)

1996-12-31T23:59:59.000Z

Note: This page contains sample records for the topic "dl dolomitic limestone" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


261

Hummingbird structure in southeastern Saskatchewan  

SciTech Connect

Saskatchewan's first Devonian oil pool was discovered September 1966, at Hummingbird, 45 mi (72 km) southwest of Weyburn, Saskatchewan. The Hummingbird structure, located on the northwest flank of the Williston basin, is domal is nature and covers approximately 1 mi/sup 2/ (2.6 km/sup 2/). Oil production is from two zones. The Ratcliffe Member of the Mississippian Charles Formation produces from an algal and bioclastic limestone averaging 49 ft (15 m) thick. The Devonian Birdbear Formation produces from a finely crystalline vuggy dolomite averaging 56 ft (17 m) thick. The Hummingbird structure is a sedimentary structure resulting from multiple-stage salt solution and collapse. Recurring local solution of Middle Devonian Prairie Evaporite during Late Devonian and Early Mississippian time resulted in collapse of overlying strata and deposition of compensating thicknesses of Souris River, Duperow, and Bakken sediments. Between Mississippian and Cretaceous time, solution of Prairie Evaporite in the surrounding area caused collapse of all super-Prairie evaporite beds. The extra Souris River, Duperow, and Bakken strata at Hummingbird created the structure. Vertical migration of formation waters along a high-angle fault is suggested as the cause of the local salt solution at Hummingbird.

Smith, D.D.

1985-05-01T23:59:59.000Z

262

Brine inclusions in halite and the origin of the Middle Devonian Prairie evaporites of Western Canada  

SciTech Connect

Brines were extracted from fluid inclusions in Lower Salt halite of the Middle Devonian Prairie Formation in Saskatchewan, Canada. The brines were analyzed by ion chromatography and were found to be of the Na-K-Mg-Ca-Cl type. They do not fall along a simple evaporation trend. Brines from clear, diagenetic halite are significantly lower in Na{sup +} and higher in Mg{sup 2+}, and Cl{sup {minus}} than brines from cloudy, subaqueously formed halite with chevron structures. The isotopic composition of strontium and sulfur in anhydrite associated with the halites was found to be the same as that of Middle Devonian seawater. The composition of the inclusion brines can be derived from that of modern seawater by evaporation, extensive dolomitization of limestone, and albitization of clay minerals. Other evolution paths are, however, also feasible, and it is impossible to rule out effects due to the addition of nonmarine waters (hydrothermal solutions, surface runoff, and groundwater), or dissolutional recycling of existing evaporites within the Prairie evaporite basin. These analyses and published data on brine inclusions in halite from a number of Phanerozoid evaporite deposits show that the Na-K-Mg-Ca-Cl type brine is more common than the Na-K-Mg-Cl-SO{sub 4} type, which is expected from evaporation of modern seawater.

Horita, J. [Oak Ridge National Lab., TN (United States). Chemical and Analytical Sciences Div.; Weinberg, A.; Das, N.; Holland, H.D. [Harvard Univ., Cambridge, MA (United States). Dept. of Earth and Planetary Sciences

1996-09-01T23:59:59.000Z

263

In situ bioremediation in Europe  

SciTech Connect

Site remediation activity in Europe is increasing, even if not at the forced pace of the US. Although there is a better understanding of the benefits of bioremediation than of other approaches, especially about in situ bioremediation of contaminated soils, relatively few projects have been carried out full-scale in Europe or in the US. Some engineering companies and large industrial companies in Europe are investigating bioremediation and biotreatment technologies, in some cases to solve their internal waste problems. Technologies related to the application of microorganisms to the soil, release of nutrients into the soil, and enhancement of microbial decontamination are being tested through various additives such as surfactants, ion exchange resins, limestone, or dolomite. New equipment has been developed for crushing and mixing or injecting and sparging the microorganisms, as have new reactor technologies (e.g., rotating aerator reactors, biometal sludge reactors, and special mobile containers for simultaneous storage, transportation, and biodegradation of contaminated soil). Some work has also been done with immobilized enzymes to support and restore enzymatic activities related to partial or total xenobiotic decontamination. Finally, some major programs funded by public and private institutions confirm that increasing numbers of firms have a working interest in bioremediation.

Porta, A. [Battelle Europe, Geneva (CH); Young, J.K.; Molton, P.M. [Pacific Northwest Lab., Richland, WA (US)

1993-06-01T23:59:59.000Z

264

Facies variation, diagenesis, and exploration potential of the Cretaceous rudist-bearing carbonates of the Arabian Gulf  

SciTech Connect

The Cretaceous rudist-bearing carbonates of the Arabian Gulf region are proven exploration targets for hydrocarbons and form the reservoirs of a number of giant fields, including Bu Hasa, Fateh, Fahud, Idd El Shargi, Rumaila, Shaybah, and Shah. Rudist buildups occur in three principal formations: (1) Aptian Shuaiba, (2) Cenomanian Mishrif, and (3) Maastrichtian Simsima. A regional subaerial unconformity marks the upper boundary of each of these formations. Associated with the rudists that dominate the Shuaiba Formation are calcareous algal crusts, foraminifera, and echinoid plates, which accumulated in mudstone, packstone, and carbonate sands. The Mishrif Formation contains mollusk fragments, bioclasitc packstones to grainstones, miliolid and nonrudist bivalves in muddy limestones, and rudist (mainly radiolitids and caprinids) conglomeratic floatstones, with fragmented rudists mixed with wackestone lithoclasts. The Mishrif sediments accumulated as a progradational, low-energy leeward margin formed in marginal slope, shoal-backshoal, and lagoonal settings. The Simsima Formation consists of bioclastic grainstone to packstone, and dolomitic lime mudstones to wackestone. The excellent reservoir porosity and permeability of the rudist deposits and their associated sediments are the products of primary and secondary diagenesis. Freshwater leaching during post-Aptian, post-Cenomanian, and post-Maastrichtian erosion enhanced the secondary moldic porosity. Fracturing locally improved porosity and permeability. Other porosity types that occur include interparticle, intraparticle, vuggy, growth framework, shelter, intercrystalline, and karstic. Because of their favorable depositional and post-depositional conditions, the Cretaceous succession of rudists in this region contains many giant oil fields.

Alsharhan, A.S. [U.A.E. Univ., Al Ain (United Arab Emirates)

1995-04-01T23:59:59.000Z

265

Ordovician Red River {open_quotes}B{close_quotes}: Horizontal oil play in the southern Williston basin  

SciTech Connect

Recent application of horizontal drilling technology to the Ordovician Red River {open_quotes}B{close_quotes} zone in the southern Williston basin has resulted in a successful oil play, with more than 100 wells drilled in 1995 and 1996. The Red River {open_quotes}B{close_quotes} reservoir is a dolomitized laminated carbonate with microsucrosic porosity of 8-25% and permeabilities in the range of 1-66 md. It occurs within the middle of three depositional cycles ({open_quotes}A,{close_quotes} {open_quotes}B,{close_quotes} and {open_quotes}C{close_quotes}) that form the upper Red River Formation. Each cycle consists of a lower burrowed limestone, middle laminated member, and capping anhydrite or lime mudstone. The {open_quotes}B{close_quotes} reservoir is confined to the {open_quotes}B{close_quotes} laminated member and consists of an upper portion, characterized by better reservoir quality, and a lower, less permeable portion. Horizontal drilling has the advantage of significantly increasing well-bore exposure to the upper, more permeable portion. Well data indicate the total Red River {open_quotes}B{close_quotes} porosity zone has remarkable extent over parts of southwestern North Dakota, southeastern Montana, and northwestern South Dakota. Productivity from horizontal well displays considerable variation that can be correlated with structure/tectonic patterns and with reservoir petrophysical character.

Montgomery, S.L.

1997-04-01T23:59:59.000Z

266

ENGINEERING A NEW MATERIAL FOR HOT GAS CLEANUP  

SciTech Connect

The overall purpose of this project was to develop a superior, regenerable, calcium-based sorbent for desulfurizing hot coal gas with the sorbent being in the form of small pellets made with a layered structure such that each pellet consists of a highly reactive lime core enclosed within a porous protective shell of strong but relatively inert material. The sorbent can be very useful for hot gas cleanup in advanced power generation systems where problems have been encountered with presently available materials. An economical method of preparing the desired material was demonstrated with a laboratory-scale revolving drum pelletizer. Core-in-shell pellets were produced by first pelletizing powdered limestone or other calcium-bearing material to make the pellet cores, and then the cores were coated with a mixture of powdered alumina and limestone to make the shells. The core-in-shell pellets were subsequently calcined at 1373 K (1100 C) to sinter the shell material and convert CaCO{sub 3} to CaO. The resulting product was shown to be highly reactive and a very good sorbent for H{sub 2}S at temperatures in the range of 1113 to 1193 K (840 to 920 C) which corresponds well with the outlet temperatures of some coal gasifiers. The product was also shown to be both strong and attrition resistant, and that it can be regenerated by a cyclic oxidation and reduction process. A preliminary evaluation of the material showed that while it was capable of withstanding repeated sulfidation and regeneration, the reactivity of the sorbent tended to decline with usage due to CaO sintering. Also it was found that the compressive strength of the shell material depends on the relative proportions of alumina and limestone as well as their particle size distributions. Therefore, an extensive study of formulation and preparation conditions was conducted to improve the performance of both the core and shell materials. It was subsequently determined that MgO tends to stabilize the high-temperature reactivity of CaO. Therefore, a sorbent prepared from dolomite withstands the effects of repeated sulfidation and regeneration better than one prepared from limestone. It was also determined that both the compressive strength and attrition resistance of core-in-shell pellets depend on shell thickness and that the compressive strength can be improved by reducing both the particle size and amount of limestone in the shell preparation mixture. A semiempirical model was also found which seems to adequately represent the absorption process. This model can be used for analyzing and predicting sorbent performance, and, therefore, it can provide guidance for any additional development which may be required. In conclusion, the overall objective of developing an economical, reusable, and practical material was largely achieved. The material appears suitable for removing CO{sub 2} from fuel combustion products as well as for desulfurizing hot coal gas.

T.D. Wheelock; L.K. Doraiswamy; K.P. Constant

2003-09-01T23:59:59.000Z

267

Geology of the Loyal Valley-West area, Mason County, Texas  

E-Print Network (OSTI)

Sandstone Member. Gap Mountain Limestone Member Lion Mountain Limestone Member . 31 A'ilberns Formation . 32 Welge Sandstone Mexnber. Morgan Creek Limestone Member . Point Peak Shale Member 33 36 San Saba Limestone Member . Ox dovician Systexn... Saadstone Member. 25 Weathered Surface of the Cap Mountain Limestone Member . VII. Sandstone Bed in the Cap Mountain Limestone Member 30 Contact Be~eon the Lion Mountain and Welge Members . IX. Weathered Morgan Creek Limestoae Member 38 Bioherms...

Kmiecik, Jerome Gregory

2012-06-07T23:59:59.000Z

268

E-Print Network 3.0 - abandoned aggregate quarries Sample Search...  

NLE Websites -- All DOE Office Websites (Extended Search)

ECONOMICAL... of Limestone Quarry By-Products for Developing Economical Self-Compacting Concrete Principle Investigator Name... limestone quarry in Wisconsin generates over...

269

A Novel Assay to Assess Primary Human Cancer Infectibility by Replication-Selective Oncolytic Adenoviruses  

Science Journals Connector (OSTI)

...dl922-947) and replication-defective (dl312) adenoviruses...adenovirus receptor (CAR) and tissue viability...dl922-947) and replication-defective (dl312) adenoviruses...adenovirus receptor (CAR) and tissue viability...predicted, the replication-defective adenovirus dl312 was...

Yaohe Wang; Stephen Thorne; Joseph Hannock; Jennelle Francis; Tina Au; Tony Reid; Nick Lemoine; David Kirn; and Gunnel Halldén

2005-01-01T23:59:59.000Z

270

spe438-20 page 1 Garrison, N.J., Busby, C.J., Gans, P.B., Putirka, K., and Wagner, D.L., 2008, A mantle plume beneath California? The mid-Miocene Lovejoy flood basalt, northern  

E-Print Network (OSTI)

-Miocene Lovejoy flood basalt, northern California Noah J. Garrison Cathy J. Busby Phillip B. Gans Department the eastern Snake River Plain toward the Yellowstone caldera (Armstrong et al., 1975; Rodgers et al., 1990

Busby, Cathy

271

174. THE EFFECTS OF RESIDENCE TIME ON THE RETENTION OF ARSENATE BY GOETHITE. S.E. O'Reilly and D.L. Sparks, Department of Plant and Soil Sciences, University  

E-Print Network (OSTI)

174. THE EFFECTS OF RESIDENCE TIME ON THE RETENTION OF ARSENATE BY GOETHITE. S.E. O'Reilly and D on goethite. Batch sorption and desorption studies were conducted at pH 6 for periods up to 2 months. Arsenate sorption increased slowly with time. As residence time between arsenate and goethite increased

Sparks, Donald L.

272

Geography 5: People and Earth's Ecosystems Lecture Outline  

E-Print Network (OSTI)

), evaporites (halite, gypsum), marine organisms or chemical precipitates (e.g. limestone) 12 Metamorphic Rocks

273

Discrete Element Modeling of Influences of Aggregate Gradation and Aggregate Properties on Fracture in Asphalt Mixes  

E-Print Network (OSTI)

............................................................................ 65 Case I: A Blend of Soft Limestone and Hard Limestone ...... 65 Case II: A Blend of Sandstone and Soft Limestone .............. 68 Comparison of Case I and Case II Results... Strength ......................................................................... 44 3.6 Internal Force Changes with Change in Applied Load for Soft Limestone Mixtures ............................................................. 48 3...

Mahmoud, Enad Muhib Ahmad

2010-07-14T23:59:59.000Z

274

COMPARISON OF MICRO-INCH IN-PLANE AND OUT-OF-PLANE RESPONSE OF CRACKS  

E-Print Network (OSTI)

limestone quarries. In two locations, sensors that measure in-plane and normal displacement were installed

275

E-Print Network 3.0 - arthrobacter sp 32c Sample Search Results  

NLE Websites -- All DOE Office Websites (Extended Search)

DL149 GGS dilution 1 Actino Arthrobacter DL150 GGS dilution 1 Actino Subtercola Source: Colorado at Boulder, University of - Alpine Microbial Observatory Collection:...

276

Dilute Acid Hydrolysis of Oligomers in Hydrothermal Pretreatment Hydrolyzate into Monomers with High Yields  

E-Print Network (OSTI)

Klass DL. 1998. Biomass for renewable energy, fuels, andNational Renewable Energy Laboratory.2003, Biomass feedstockKlass DL. 1998. Biomass for Renewable Energy, Fuels and

Tsai, Yueh-Du

2012-01-01T23:59:59.000Z

277

IMPROVING CO2 EFFICIENCY FOR RECOVERING OIL IN HETEROGENEOUS RESERVOIRS  

SciTech Connect

The third annual report of ''Improving CO{sub 2} Efficiency for Recovery Oil in Heterogeneous Reservoirs'' presents results of laboratory studies with related analytical models for improved oil recovery. All studies were designed to optimize utilization and extend the practice of CO{sub 2} flooding to a wider range of reservoirs. Chapter 1 describes the behavior at low concentrations of the surfactant Chaser International CD1045{trademark} (CD) versus different salinity, pressure and temperature. Results of studies on the effects of pH and polymer (hydrolyzed polyacrylamide?HPAM) and CO{sub 2} foam stability after adsorption in the core are also reported. Calcium lignosulfonate (CLS) transport mechanisms through sandstone, description of the adsorption of CD and CD/CLS onto three porous media (sandstone, limestone and dolomite) and five minerals, and the effect of adsorption on foam stability are also reported. In Chapter 2, the adsorption kinetics of CLS in porous Berea sandstone and non-porous minerals are compared by monitoring adsorption density change with time. Results show that adsorption requires a much longer time for the porous versus non-porous medium. CLS adsorption onto sandstone can be divided into three regions: adsorption controlled by dispersion, adsorption controlled by diffusion and adsorption equilibrium. NaI tracer used to characterize the sandstone had similar trends to earlier results for the CLS desorption process, suggesting a dual porosity model to simulate flow through Berea sandstone. The kinetics and equilibrium test for CD adsorption onto five non-porous minerals and three porous media are reported in Chapter 3. CD adsorption and desorption onto non-porous minerals can be established in less than one hour with adsorption densities ranging from 0.4 to 1.2 mg of CD per g of mineral in decreasing order of montmorillonite, dolomite, kaolinite, silica and calcite. The surfactant adsorption onto three porous media takes much longer than one hour, with Berea sandstone requiring the longest time. In Chapter 4, comparisons of static adsorption of CLS, CD, and CLS/CD mixtures onto five pure minerals showed that the presence of CLS decreased the adsorption of CD onto the five minerals by 20 to 70%. Dynamic CLS/CD mixture adsorption tests onto Berea sandstone and Indian limestone cores showed that competitive adsorption between CD and CLS generally takes several days to reach equilibrium. Foam stability and interfacial tension tests on both injected and effluent samples were performed which showed that both foam stability and IFT decreased due to adsorption. Also it appears that there is a chromatographic effect on the surfactants in flow through porous media. Progress was realized in developing general equations for stress sensitivity on non-Darcy parameters (permeability and non-Darcy coefficient), and the multiphase flow induced by a high flow rate was confirmed as a mechanism for injectivity loss in CO{sub 2} flooding. In Chapter 5, a general equation is defined based on 60 general equations of permeability stress sensitivity and non-Darcy coefficient stress sensitivity and definitions of nominal permeability, nominal non-Darcy coefficient, permeability stress sensitivity, and non-Darcy coefficient stress sensitivity. The equations of stress sensitivity are independent of pressure, temperature, and rock properties and existing empirical correlations of the nominal permeability and nominal non-Darcy coefficient can be used when laboratory data are not available. This provides a tool to quantify the change of permeability and non-Darcy coefficient due to change of effective stress resulted from reservoir injection and/or production.

Reid B. Grigg; Robert K. Svec; Zhengwen Zeng; Baojun Bai; Yi Liu

2004-09-27T23:59:59.000Z

278

Oil possibilities of Mesozoic in Mexican High Plateau  

SciTech Connect

Platform rocks that crop out in the Sierra Madre Oriental possibly limit the Tampico-Misantla basin to the east and the Mexican Jurassic Cretaceous geosyncline to the west. It is considered that part of the Sierra Madre Occidental served as a limit to the geosyncline from the west of Jalisco to the east of Sonora. The rocks that were studied consist of limestones, dolomites, shales, sandstones, and marls, mostly of marine origin. Results of petroleum drilling indicate that some rocks show a degree of metamorphism, especially Jurassic and Triassic rocks. In places, rocks in allochthonous blocks were drilled that showed repetition of the formations, and the drilling objectives could not be reached. In the northern part of Chihuahua, some wells were drilled in bolsons or grabens filled by Tertiary and Quaternary clastic material or overflows and volcanic rocks. According to the results obtained from this study, the following steps should be taken: (1) increase the studies of geologic and geochemical detail, (2) determine which parts of the area, from the thickness of Mesozoic sediments are prospects for more detailed studies, (3) use mining information to locate and classify areas of metamorphism, which will surely condemn some areas, especially near the Sierra Madre Occidental, (4) increase drilling of stratigraphic tests as well as those with petroleum objectives, (5) construct Mesozoic isopach maps of Mesozoic formations from geophysical information and surface and subsurface geology, and (6) study drilling records to obtain related to geohydrology, ecology, and electrical log information from the surface to total depth of the well.

Lopez, R.E.

1984-09-01T23:59:59.000Z

279

Sedimentology, diagenesis, and trapping style, Chesterian Tar Springs sandstone at Inman Field, Gallatin County, Illinois  

SciTech Connect

The Tar Springs Sandstone in southern Illinois is often over-looked as a pay, yet it can be a prolific producer. The Inman Field, discovered in 1940, produces from several cyclic Chesterian sandstones from structural-stratigraphic traps in the Wabash Valley Fault System of southeastern Illinois. The oil was sourced from the Devonian New Albany Shale and apparently migrated vertically along the Wabash Valley faults to its present location, thus charging many of the Chesterian and lower Pennsylvanian sands in the field. The Tar Springs Sandstone produces from stacked distributary channel sand reservoirs up to 125 feet thick which have cut up to 40 feet into laterally equivalent non-reservoir, delta-fringe facies and the underlying Glen Dean Limestone. The reservoir sands are well-sorted, fine- to medium-grained quartz arenites with less than 5% feldspar and chert. Quartz grains have quartz overgrowths. Feldspar grains are clouded in thin-section and show pronounced etching and dissolution in SEM. Diagenetic kaolinite and small amounts of illite and magnesium-rich chlorite occur in intergranular pores. Sparry, iron-rich dolomite or ankerite that fills pores in irregular millimeter-size patches, occupies up to 10% of the reservoir rock. Typical reservoir porosity ranges from 16 to 19 percent and permeability ranges from 60 to 700 md. By contrast non-reservoir delta-fringe sands typically have porosities of 6 to 12 percent and permeabilities of 1 to 20 md. Delta-fringe Tar Springs shales act as impermeable lateral and vertical seals, aiding in stratigraphic trapping.

Morse, D.G. [Illinois State Geological Survey, Champaign, IL (United States)

1996-09-01T23:59:59.000Z

280

Enhancing the use of coals by gas reburning-sorbent injection  

SciTech Connect

This Clean Coal Technology project will demonstrate a combination of two developed technologies to reduce both NO[sub x] and SO[sub x] emissions: gas reburning and calcium based dry sorbent injection. The demonstrations will be conducted on two pre-NSPS utility boilers representative of the US boilers which contribute significantly to the inventory of acid rain precursor emissions: tangentially and cyclone fired units. Gas reburning is a combustion modification technique that consists of firing 80--85 percent of the fuel (corresponding to the total heat release) in the lower furnace. Reduction of NO[sub x] to molecular nitrogen (N[sub 2]) is accomplished via the downstream injection of the remaining fuel requirement in the form of natural gas (which also reduces the total SO[sub x] emissions). In a third stage, burnout air is injected at lower temperatures in the upper furnace to complete the combustion process without generating significant additional NO[sub x]. Dry sorbent injection consists of injecting calcium based sorbents (such as limestone, dolomite, or hydrated lime) into the combustion products. For sulfation of the sorbent to CaSO[sub 4], an injection temperature of about 1230[degrees]C is optimum, but calcium-sulfur reactions can also take place at lower temperatures. Thus, the sorbent may be injected at different locations, such as with the burnout air, at the exit from the superheater, or into the ducting downstream of the air heater with H[sub 2]0 added for humidification. The calcium sulfate or sulfite products are collected together with unreacted sorbent fly ash by the electrostatic precipitator. The specific goal of this project is to demonstrate NO[sub x] and SO[sub x] emission reductions of 60 percent and 50 percent, respectively, on two coal fired utility boilers having the design characteristics mentioned above.

Not Available

1992-11-16T23:59:59.000Z

Note: This page contains sample records for the topic "dl dolomitic limestone" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


281

Enhancing the use of coals by gas reburning-sorbent injection. Environmental monitoring quarterly report No. 9, July 1--September 30, 1992  

SciTech Connect

This Clean Coal Technology project will demonstrate a combination of two developed technologies to reduce both NO{sub x} and SO{sub x} emissions: gas reburning and calcium based dry sorbent injection. The demonstrations will be conducted on two pre-NSPS utility boilers representative of the US boilers which contribute significantly to the inventory of acid rain precursor emissions: tangentially and cyclone fired units. Gas reburning is a combustion modification technique that consists of firing 80--85 percent of the fuel (corresponding to the total heat release) in the lower furnace. Reduction of NO{sub x} to molecular nitrogen (N{sub 2}) is accomplished via the downstream injection of the remaining fuel requirement in the form of natural gas (which also reduces the total SO{sub x} emissions). In a third stage, burnout air is injected at lower temperatures in the upper furnace to complete the combustion process without generating significant additional NO{sub x}. Dry sorbent injection consists of injecting calcium based sorbents (such as limestone, dolomite, or hydrated lime) into the combustion products. For sulfation of the sorbent to CaSO{sub 4}, an injection temperature of about 1230{degrees}C is optimum, but calcium-sulfur reactions can also take place at lower temperatures. Thus, the sorbent may be injected at different locations, such as with the burnout air, at the exit from the superheater, or into the ducting downstream of the air heater with H{sub 2}0 added for humidification. The calcium sulfate or sulfite products are collected together with unreacted sorbent fly ash by the electrostatic precipitator. The specific goal of this project is to demonstrate NO{sub x} and SO{sub x} emission reductions of 60 percent and 50 percent, respectively, on two coal fired utility boilers having the design characteristics mentioned above.

Not Available

1992-11-16T23:59:59.000Z

282

Enhancing the use of coals by gas reburning-sorbent injection. Environmental monitoring quarterly report No. 8, April 1--June 30, 1992  

SciTech Connect

Clean Coal Technology implies the use of coal in an environmentally acceptable manner. Coal combustion results in the emission of two types of acid rain precursors: oxides of sulfur (sox) and oxides of nitrogen (NO{sub x}). This Clean Coal Technology project will demonstrate a combination of two developed technologies to reduce both NO{sub x} and SO{sub x} emissions. Gas reburning and calcium based dry sorbent injection. The demonstrations will be conducted on two pre-NSPS utility boilers representative of the US boilers which contribute significantly to the inventory of acid rain precursor emissions. Gas reburning is a combustion modification technique that consists of firing 80--85 percent of the fuel (corresponding to the total heat release) in the lower furnace. Reduction of NO{sub x} to molecular nitrogen (N{sub 2}) is accomplished via the downstream injection of the remaining fuel requirement in the form of natural gas (which also reduces the total SO{sub x} emissions). In a third stage, burnout air is injected at lower temperatures in the upper furnace to complete the combustion process without generating significant additional NO{sub x}. Dry sorbent injection consists of injecting calcium based sorbents (such as limestone, dolomite, or hydrated lime) into the combustion products. For sulfation of the sorbent to CaSO{sub 4}, an injection temperature of about 1230{degrees}C is optimum, but calcium-sulfur reactions can also take place at lower temperatures. Thus, the sorbent may be injected at different locations, such as with the burnout air, at the exit from the superheater, or into the ducting downstream of the air heater with H{sub 2}O added for humidification. The specific goal of this project is to demonstrate NO{sub x} and SO{sub x} emission reductions of 60 percent and 50 percent, respectively, on two coal fired utility boilers having the design characteristics mentioned above.

Not Available

1992-07-27T23:59:59.000Z

283

Enhancing the use of coals by gas reburning-sorbent injection  

SciTech Connect

Clean Coal Technology implies the use of coal in an environmentally acceptable manner. Coal combustion results in the emission of two types of acid rain precursors: oxides of sulfur (sox) and oxides of nitrogen (NO[sub x]). This Clean Coal Technology project will demonstrate a combination of two developed technologies to reduce both NO[sub x] and SO[sub x] emissions. Gas reburning and calcium based dry sorbent injection. The demonstrations will be conducted on two pre-NSPS utility boilers representative of the US boilers which contribute significantly to the inventory of acid rain precursor emissions. Gas reburning is a combustion modification technique that consists of firing 80--85 percent of the fuel (corresponding to the total heat release) in the lower furnace. Reduction of NO[sub x] to molecular nitrogen (N[sub 2]) is accomplished via the downstream injection of the remaining fuel requirement in the form of natural gas (which also reduces the total SO[sub x] emissions). In a third stage, burnout air is injected at lower temperatures in the upper furnace to complete the combustion process without generating significant additional NO[sub x]. Dry sorbent injection consists of injecting calcium based sorbents (such as limestone, dolomite, or hydrated lime) into the combustion products. For sulfation of the sorbent to CaSO[sub 4], an injection temperature of about 1230[degrees]C is optimum, but calcium-sulfur reactions can also take place at lower temperatures. Thus, the sorbent may be injected at different locations, such as with the burnout air, at the exit from the superheater, or into the ducting downstream of the air heater with H[sub 2]O added for humidification. The specific goal of this project is to demonstrate NO[sub x] and SO[sub x] emission reductions of 60 percent and 50 percent, respectively, on two coal fired utility boilers having the design characteristics mentioned above.

Not Available

1992-07-27T23:59:59.000Z

284

Identification of lithofacies using Kohonen self-organizing maps  

Science Journals Connector (OSTI)

Lithofacies identification is a primary task in reservoir characterization. Traditional techniques of lithofacies identification from core data are costly, and it is difficult to extrapolate to non-cored wells. We present a low-cost automated technique using Kohonen self-organizing maps (SOMs) to identify systematically and objectively lithofacies from well log data. \\{SOMs\\} are unsupervised artificial neural networks that map the input space into clusters in a topological form whose organization is related to trends in the input data. A case study used five wells located in Appleton Field, Escambia County, Alabama (Smackover Formation, limestone and dolomite, Oxfordian, Jurassic). A five-input, one-dimensional output approach is employed, assuming the lithofacies are in ascending/descending order with respect to paleoenvironmental energy levels. To consider the possible appearance of new logfacies not seen in training mode, which may potentially appear in test wells, the maximum number of outputs is set to 20 instead of four, the designated number of lithofacies in the study area. This study found eleven major clusters. The clusters were compared to depositional lithofacies identified by manual core examination. The clusters were ordered by the SOM in a pattern consistent with environmental gradients inferred from core examination: bind/boundstone, grainstone, packstone, and wackestone. This new approach predicted lithofacies identity from well log data with 78.8% accuracy which is more accurate than using a backpropagation neural network (57.3%). The clusters produced by the SOM are ordered with respect to paleoenvironmental energy levels. This energy-related clustering provides geologists and petroleum engineers with valuable geologic information about the logfacies and their interrelationships. This advantage is not obtained in backpropagation neural networks and adaptive resonance theory neural networks.

Hsien-Cheng Chang; David C Kopaska-Merkel; Hui-Chuan Chen

2002-01-01T23:59:59.000Z

285

Petroleum exploration of Winnipegosis Formation in north-central North Dakota (Williston basin)  

SciTech Connect

The Winnipegosis Formation (Middle Devonian) in north-central Dakota has the greatest potential for large oil reserves in the Williston basin. The Winnipegosis carbonate (50 to 325 ft thick) was deposited in the southeast end of the Elk Point restricted sea. During Winnipegosis deposition, the Williston basin could be divided into two distinct environments: (1) a deep starved basin with accompanying pinnacle reefs separated by interreef, laminated limestone and (2) a surrounding carbonate shelf. Within the carbonate shelf are patch reefs, banks, and tidal flats. Overlying the Winnipegosis carbonate is the Prairie Formation, which has a basal anhydrite (0 to 70 ft thick) and an overlying salt (0 to 650 ft thick). These were deposited in a regressive phase of the Elk Point sea and act as seals for Winnipegosis oil entrapment. Currently, oil production from the Winnipegosis in the Williston basin is from stratigraphic traps and from small structures on the carbonate shelf. The most significant accumulation to date is Temple field, in which 11 wells produce from +/- 20 ft of Winnipegosis dolomite. The pinnacle reef environment has potential for significant oil reserves from 250-ft thick reefs covering 160 ac or less. Two pinnacle reefs have had free-oil recoveries from thin pay zones. The Rainbow/Zama fields in northwest Alberta have an ultimate reserve of more than 1 billion bbl of oil from Keg River reefs, which are correlative and similar to the Winnipegosis reefs in North Dakota. The strong seismic reflection that originates from the Winnipegosis-Prairie evaporite interface provides an excellent means of detecting Winnipegosis reefs. Amplitude of the Winnipegosis reflection is reduced dramatically over the reefs. The resulting dim spot is one criteria used in identifying reefs.

Guy, W.J. Jr.; Braden, K.W.

1986-08-01T23:59:59.000Z

286

Local and synoptic mechanisms causing Southern California’s Santa Ana winds  

E-Print Network (OSTI)

DL (1994) Global physical climatology. Academic Press, Sancisely the month when the climatology of temperature favors

Hughes, Mimi; Hall, Alex

2010-01-01T23:59:59.000Z

287

Steam reforming of gasification-derived tar for syngas production  

Science Journals Connector (OSTI)

Abstract In this study, the steam reforming of tar was catalyzed by dolomite, Ni/dolomite, and Ni/CeO2 for syngas production under different reaction temperature and weight hourly space velocity (WHSV, h?1). The tar was the major side product from the biomass gasification. Current results revealed that the nickel doped catalyst on dolomite with CO2 in the feed stream yielded the highest H2 and syngas production among all reaction conditions. Comparing to the use of dolomite, when Ni–dolomites was used as catalyst, the yield of H2 increased by 33%, the yield of syngas increased by 7%, and the yield of CH4 decreased by 59%. It was also found that the yield of syngas, H2, or CO under the Ni/dolomite catalyst were significant higher (p  CO2 concentration in the feed stream > reaction temperature > weight hourly space velocity.

Alex C.-C. Chang; Lung-Shiang Chang; Cheng-You Tsai; Yu-Chun Chan

2014-01-01T23:59:59.000Z

288

The composition and diagenesis of the Upper Queen Formation (Guadalupian, Permian) at Concho Bluff North and Concho Bluff Queen Fields, Upton and Crane Counties, Texas  

E-Print Network (OSTI)

) potassium feldspar overgrowths, and (4) pore-filling anhydrite, dolomite, and halite cements during an early diagenetic phase. Subsequent dissolution of the anhydrite, dolomite, and halite by acidic pore-waters created high porosities (mean=15/o...) and permeabilities (mean&0. 1 md). Fluids and gases used in enhanced recovery techniques will follow pathways created by dissolution of the anhydrite, dolomite, and halite cements within the sandflat facies. However, caution must be used with fluids that can...

McKone, Charles Joseph

2012-06-07T23:59:59.000Z

289

PHILOSOPHICAL SOCIETY OF WASHINGTON  

Science Journals Connector (OSTI)

...limonite, calcite, dolomite, smithsonite, cerussite, aurichalcite, hydrozincite, imalachite, azurite, calamine, nmuscovite...Kansas. This minie also furnishes covellite, cuprite and aurichalcite. The observed paragenesis generally follows tlhis order...

CHARLES K. WEAD

1902-05-30T23:59:59.000Z

290

THE SECTION OF GEOLOGY AND MINERALOGY OF THE NEW YORK ACADEMY OF SCIENCES  

Science Journals Connector (OSTI)

...limonite, calcite, dolomite, smithsonite, cerussite, aurichalcite, hydrozincite, imalachite, azurite, calamine, nmuscovite...Kansas. This minie also furnishes covellite, cuprite and aurichalcite. The observed paragenesis generally follows tlhis order...

EDMUND O. HOVEY

1902-05-30T23:59:59.000Z

291

Comparaison de la rponse de diffrents essais statiques pour 5 rejets de concentrateur faible  

E-Print Network (OSTI)

relative à pH 5 Dissolution Calcite, aragonite, dolomite, magnésite, brucite 1,00 Grande réactivité

Aubertin, Michel

293

Effects of low temperature preheating on the pyrolysis products from blocks of oil shale.  

E-Print Network (OSTI)

??Oil shale is a sedimentary rock composed of inorganic and organic fractions. The inorganic minerals contained in oil shale include: dolomite, calcite, quartz, i1 lite,… (more)

Alston, David W.

1905-01-01T23:59:59.000Z

294

Use of Performance Cements in Colorado and Utah: Laboratory Durability Testing and Case Studies  

E-Print Network (OSTI)

in Canada since 2008 ­ Up to 15 percent limestone ASTM C595 and AASHTO M 240 are balloting a limestone;Ready Mix Maintenance Facility Constructed 2008-2009 LEED Certification ­ Silver or Gold 13, 915

295

A Field Study of Seismic Attenuation In Layered Sedimentary Rocks—II. Crosshole Data  

Science Journals Connector (OSTI)

......Carboniferous limestones, shales and sandstones. Estimates...at least in part, to anisotropic intrinsic attenuation...Carboniferous limestones, shales and sandstones. Estimates...at least in part, to anisotropic intrinsic attenuation......

I. R. Portsmouth; M. H. Worthington; J. P. Neep

1993-04-01T23:59:59.000Z

296

Allan J. Dyson: Managing the UCSC Library, 1979-2003  

E-Print Network (OSTI)

there are underground caverns. Limestone . . . Reti: Yes.they bridged the caved-in cavern by putting the pillars inthere was a giant limestone cavern underneath and they had

Dyson, Allan J.; Reti, Irene; Regional History Project, UCSC Library

2006-01-01T23:59:59.000Z

297

Analysis of Energy-Efficiency Opportunities for the Cement Industry in Shandong Province, China  

E-Print Network (OSTI)

like blast furnace slag, fly ash, coal gangue, limestone,In ordinary VSKs, high-ash anthracite coal and raw materialsAsh Limestone Gypsum Other (please specify) Other (please specify) Total Yearly Energy Consumption (ton) Coal

Price, Lynn

2010-01-01T23:59:59.000Z

298

A Review of Hazardous Chemical Species Associated with CO2 Capture from Coal-Fired Power Plants and Their Potential Fate in CO2 Geologic Storage  

E-Print Network (OSTI)

additives to control combustion, and capture gaseous or volatile pollutants, e.g. limestone for SO 2 removal,

Apps, J.A.

2006-01-01T23:59:59.000Z

299

Energy Efficiency Improvement Opportunities for the Cement Industry  

E-Print Network (OSTI)

like blast furnace slag, fly ash, coal gangue, limestone,Blast Furnace Slag Fly ash Cinder Coal gangue Lime- stone

Worrell, Ernst

2008-01-01T23:59:59.000Z

300

BY EWEN CALLAWAY he iconic status of Archaeopteryx, the  

E-Print Network (OSTI)

up in limestone quarries in Bavaria, southern Germany, in the early 1860s. Until recently, they were

Napp, Nils

Note: This page contains sample records for the topic "dl dolomitic limestone" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


301

MONITORING OF CRACKS ON THE BELL TOWER OF ST. ANASTASIA CATHEDRAL IN ZADAR CROATIA  

E-Print Network (OSTI)

stones of limestone, the older part from the local quarries, while the newer part mainly from the quarry

Paris-Sud XI, Université de

302

Basics of Mineralogy Geology 200  

E-Print Network (OSTI)

: Isometric - diamond, garnet, halite, pyrite Hexagonal - quartz, calcite, dolomite Tetragonal - not common or halite, fluorite Carbonates - calcite, dolomite Sulfates - gypsum, anhydrite Silicates - quartz, biotite element #12;Halite -- an example of a halide mineral #12;Anhydrite -- example of a sulfate mineral #12

Kammer, Thomas

303

Nonsulfide zinc deposits in the SilesiaCracow district, Southern Poland  

E-Print Network (OSTI)

generations of the hydrothermal ore-bearing dolomite (OBD I, II, III). A fundamental ore control is believed­dolomite are particularly abundant. This ore type is commonly consid- ered as a peripheral hydrothermal alteration product.8±0.3). The uniform and low carbon isotope values of red galman smithsonite are unusual for supergene carbon- ate

Boni, Maria

304

Geology, isotope geochemistry and ore genesis of the Shanshulin carbonate-hosted Pb–Zn deposit, southwest China  

Science Journals Connector (OSTI)

Abstract The Shanshulin Pb–Zn deposit occurs in Upper Carboniferous Huanglong Formation dolomitic limestone and dolostone, and is located in the western Yangtze Block, about 270 km west of Guiyang city in southwest China. Ore bodies occur along high angle thrust faults affiliated to the Weishui regional fault zone and within the northwestern part of the Guanyinshan anticline. Sulfide ores are composed of sphalerite, pyrite, and galena that are accompanied by calcite and subordinate dolomite. Twenty-two ore bodies have been found in the Shanshulin deposit area, with a combined 2.7 million tonnes of sulfide ores grading 0.54 to 8.94 wt.% Pb and 1.09 to 26.64 wt.% Zn. Calcite samples have ?13CPDB and ?18OSMOW values ranging from ? 3.1 to + 2.5‰ and + 18.8 to + 26.5‰, respectively. These values are higher than mantle and sedimentary organic matter, but are similar to marine carbonate rocks in a ?13CPDB vs. ?18OSMOW diagram, suggesting that carbon in the hydrothermal fluid was most likely derived from the carbonate country rocks. The ?34SCDT values of sphalerite and galena samples range from + 18.9 to + 20.3‰ and + 15.6 to + 17.1‰, respectively. These values suggest that evaporites are the most probable source of sulfur. The ?34SCDT values of symbiotic sphalerite–galena mineral pairs indicate that deposition of sulfides took place under chemical equilibrium conditions. Calculated temperatures of S isotope thermodynamic equilibrium fractionation based on sphalerite–galena mineral pairs range from 135 to 292 °C, consistent with previous fluid inclusion studies. Temperatures above 100 °C preclude derivation of sulfur through bacterial sulfate reduction (BSR) and suggest that reduced sulfur in the hydrothermal fluid was most likely supplied through thermo-chemical sulfate reduction (TSR). Twelve sphalerite samples have ?66Zn values ranging from 0.00 to + 0.55‰ (mean + 0.25‰) relative to the JMC 3-0749L zinc isotope standard. Stages I to III sphalerite samples have ?66Zn values ranging from 0.00 to + 0.07‰, + 0.12 to + 0.23‰, and + 0.29 to + 0.55‰, respectively, showing the relatively heavier Zn isotopic compositions in later versus earlier sphalerite. The variations of Zn isotope values are likely due to kinetic Raleigh fractional crystallization. The 206Pb/204Pb, 207Pb/204Pb and 208Pb/204Pb ratios of the sulfide samples fall in the range of 18.362 to 18.573, 15.505 to 15.769 and 38.302 to 39.223, respectively. The Pb isotopic ratios of the studied deposit plot in the field that covers the upper crust, orogenic belt and mantle Pb evolution curves and overlaps with the age-corrected Proterozoic folded basement rocks, Devonian to Lower Permian sedimentary rocks and Middle Permian Emeishan flood basalts in a 207Pb/204Pb vs. 206Pb/204Pb diagram. This observation points to the derivation of Pb metal from mixed sources. Sphalerite samples have 87Sr/86Sr200 Ma ratios ranging from 0.7107 to 0.7115 similar to the age-corrected Devonian to Lower Permian sedimentary rocks (0.7073 to 0.7111), higher than the age-corrected Middle Permian basalts (0.7039 to 0.7078), and lower than the age-corrected Proterozoic folded basement (0.7243 to 0.7288). Therefore, the Sr isotope data support a mixed source. Studies on the geology and isotope geochemistry suggest that the Shanshulin deposit is a carbonate-hosted, thrust fault-controlled, strata-bound, epigenetic, high grade deposit formed by fluids and metals of mixed origin.

Jia-Xi Zhou; Zhi-Long Huang; Zhi-Cheng Lv; Xiang-Kun Zhu; Jian-Guo Gao; Hassan Mirnejad

2014-01-01T23:59:59.000Z

305

Fructose impairs glucose-induced hepatic triglyceride synthesis  

E-Print Network (OSTI)

The area under the curve (AOC) (Mean SD) for each of theand area under the curve (AOC, mg/dl Ś min) for glucosea. BL b. IPGT blood glucose AOC mg/dl x min c. 120 min Serum

Huang, Danshan; Dhawan, Tania; Young, Stephen; Yong, William H; Boros, Laszlo G; Heaney, Anthony P

2011-01-01T23:59:59.000Z

306

Macronutrient and energy content of breast milk of mothers delivering prematurely  

Science Journals Connector (OSTI)

The protein, lactose, fat and energy contents of the fore-milk of mother with ... weeks of lactation, the mean (±SD) energy (Kcal/dl), protein (g/dl) ... days, there was a decline in protein content while fat, la...

Vinod K. Paul; Meharban Singh; L. M. Srivastava…

307

NETL: Oil & Natural Gas Technologies Reference Shelf - Presentation on CO2  

NLE Websites -- All DOE Office Websites (Extended Search)

CO2 Sequestration Potential of the North Michigan Silurian Reef CO2 Sequestration Potential of the North Michigan Silurian Reef CO2 Sequestration Potential of the North Michigan Silurian Reef Authors: Brian Toelle, Chaoqing Yang (speaker), and Tracee Imai, Schlumberger Ltd. Venue: Eastern Section of the American Association of Petroleum Geologists 2007 Annual Meeting, Lexington, KY, September 16–18, 2007 (http://www.uky.edu/KGS/esaapg07/ [external site]). Abstract: The Northern Silurian Reef trend of the Michigan Basin was developed within the stratigraphic unit historically referred to as the Niagaran Brown. Within the past few years this unit was renamed the Guelph Formation. Over 700 reefs make up this trend, with some of these being over 300 acres in size and having produced more than 5 million barrels of oil. Estimates of the total amount of hydrocarbons produced for the entire trend have been reported to be as much as nearly a half a billion barrels. The U.S. Department of Energy has funded a study of an ongoing enhanced oil recovery project being conducted on a reef within this trend and entailing CO2 injection. The Charlton 30/31 reef, located in Otsego County, MI, like many other reefs in the play, was discovered and developed during the 1970s and 1980s. This field has completed its primary production phase, during which six wells produced 2.6 million of the field’s estimated 7 million barrels of oil in place. This reservoir is characterized as a low-porosity, low-permeability limestone matrix with irregular dolomitized intervals providing a secondary network of higher porosity and permeability, which controls fluid flow throughout the reservoir. The estimated average porosity in this reef is just slightly over 6 percent. As part of this study, the reservoir attributes identified at the Charlton 30/31 reef were extended to the entire Northern Reef Trend in order to determine its CO2 sequestration capacity. Additionally, the potential oil recovery has been estimated.

308

Optimizing Fracture Treatments in a Mississippian "Chat" Reservoir, South-Central Kansas  

SciTech Connect

This project is a collaboration of Woolsey Petroleum Corporation (a small independent operator) and the Kansas Geological Survey. The project will investigate geologic and engineering factors critical for designing hydraulic fracture treatments in Mississippian ''chat'' reservoirs. Mississippian reservoirs, including the chat, account for 159 million m3 (1 billion barrels) of the cumulative oil produced in Kansas. Mississippian reservoirs presently represent {approx}40% of the state's 5.6*106m3 (35 million barrels) annual production. Although geographically widespread, the ''chat'' is a heterogeneous reservoir composed of chert, cherty dolomite, and argillaceous limestone. Fractured chert with micro-moldic porosity is the best reservoir in this 18- to 30-m-thick (60- to 100-ft) unit. The chat will be cored in an infill well in the Medicine Lodge North field (417,638 m3 [2,626,858 bbls] oil; 217,811,000 m3 [7,692,010 mcf] gas cumulative production; discovered 1954). The core and modern wireline logs will provide geological and petrophysical data for designing a fracture treatment. Optimum hydraulic fracturing design is poorly defined in the chat, with poor correlation of treatment size to production increase. To establish new geologic and petrophysical guidelines for these treatments, data from core petrophysics, wireline logs, and oil-field maps will be input to a fracture-treatment simulation program. Parameters will be established for optimal size of the treatment and geologic characteristics of the predicted fracturing. The fracturing will be performed and subsequent wellsite tests will ascertain the results for comparison to predictions. A reservoir simulation program will then predict the rate and volumetric increase in production. Comparison of the predicted increase in production with that of reality, and the hypothetical fracturing behavior of the reservoir with that of its actual behavior, will serve as tests of the geologic and petrophysical characterization of the oil field. After this feedback, a second well will be cored and logged, and procedure will be repeated to test characteristics determined to be critical for designing cost-effective fracture treatments. Most oil and gas production in Kansas, and that of the Midcontinent oil industry, is dominated by small companies. The overwhelming majority of these independent operators employ less than 20 people. These companies have limited scientific and engineering expertise and they are increasingly needing guidelines and technical examples that will help them to not be wasteful of their limited financial resources and petroleum reserves. To aid these operators, the technology transfer capabilities of the Kansas Geological Survey will disseminate the results of this study to the local, regional, and national oil industry. Internet access, seminars, presentations, and publications by Woolsey Petroleum Company and Kansas Geological Survey geologists and engineers are anticipated.

K. David Newell; Saibal Bhattacharya; Alan Byrnes; W. Lynn Watney; Willard Guy

2005-10-01T23:59:59.000Z

309

A mesostate-space model for EEG and MEG Jean Daunizeau and Karl J. Friston  

E-Print Network (OSTI)

-determination of DL inverse solutions (Grova et al., 2006). More recently, models of the coupling between active brain

Daunizeau, Jean

310

E-Print Network 3.0 - anchored carbon fiber Sample Search Results  

NLE Websites -- All DOE Office Websites (Extended Search)

; Activated carbon; Carbon fibers; D. Electrical (electronic) properties Electromagnetic interference (EMI... ) shielding is increas- ... Source: Chung, Deborah D.L. -...

311

Applied Clay Science, 1 (1985) 89--101 89 Elsevier Science Publishers B.V., Amsterdam --Printed in The Netherlands  

E-Print Network (OSTI)

in The Netherlands KINETICS OF POTASSIUM EXCHANGE IN HETEROGENEOUS SYSTEMS D.L. SPARKS and T.H. CARSKI Department

Sparks, Donald L.

312

3. Vorticity 3.1. Definition and interpretation of vorticity  

E-Print Network (OSTI)

2 u · dl = 0 if inviscid. (3.6) Eq.(3.6) is Kelvin's Circulation Theorem: for inviscid, uniform.5), we get dC dt = C - p + gz + 2 u · dl . Again the (...) · dl term integrates out, leaving dC dt = C

Read, Peter L.

313

Lucky Mound field: A new Mississippian Sherwood shoreline field  

SciTech Connect

Lucky Mound field produces oil and gas from the Sherwood interval of the Mississippian Mission Canyon Formation. Presently, eight wells are producing with development ongoing. Extensive coring, testing, logging, and petrographic evaluations throughout the field have allowed for detailed analysis of reservoir characteristics and paleoenvironmental interpretation. Sherwood shoreline fields typically produce from reservoir-quality packstones and grainstones trapped by a lateral facies changes into impermeable dolomite and anhydrite. At Lucky Mound, packstones, grainstones, and a productive dolomite facies all contribute to the producing interval. The productive dolomite facies is generally found in the upper portion of the Sherwood along the eastern margin of the field. Porosity as high as 22% and permeability values up to 16 md are present in the dolomite facies. These dolomites are the result of complete to partial replacement of micrite. In addition, the dolomitization process has enhanced intercrystalline and intraparticle porosity throughout the Sherwood interval. Pore types present include vuggy, intergranular, intraparticle, and intercrystalline. Pore occluding and replacive cements include fibrous calcite, prismatic calcite spar, baroque dolomite, anhydrite, celestite, pyrite, and chert. An understanding of carbonate depositional environments, diagenetic processes, Williston basin structural development, and Sherwood reservoir behavior is essential in the exploration for new Sherwood fields.

Fisher, R.W. (Balcron Oil, Billings, MT (United States)); Hendricks, M.L. (Hendricks and Associates, Inc., Denver, CO (United States))

1991-06-01T23:59:59.000Z

314

Paleoenvironmental analysis of the lower Mississippian Caballero Formation and the Andrecito member of the Lake Valley Formation in the northern Sacramento Mountains Otero County, New Mexico  

E-Print Network (OSTI)

lower, light olive-gray nodular- limestone, (2) a middle, greenish-gray calcareous-shale containing limestone nodules, and (3) an upper, dark-gray, thin-bedded limestone. Primary sedimentary-structures are relatively rare. The nodular bedding may... and thin packstone-lenses are rare; except in the upper part of the Caballero Formation. The Caballero Formation contains mostly skeletal grains. No coated grains are present and only a trace of silt is found. The skeletals are comprised of whole...

Blount, William Markham

2012-06-07T23:59:59.000Z

315

Probabilistic analysis of air void structure and its relationship to permeability and moisture damage of hot mix asphalt  

E-Print Network (OSTI)

with thickness for field cores. ..............................27 5 Difference in air void content with thickness for SGC limestone cores. .............28 6 Difference in air void content with thickness for SGC granite cores...................29 7 Examples... distribution for SGC granite cores. ............46 x FIGURE Page 20 Permeability vs. PSP using Lognormal distribution for SGC limestone cores....47 21 Permeability vs. PSP using Weibull distribution for SGC limestone cores...

Castelblanco Torres, Adhara

2006-04-12T23:59:59.000Z

316

NETL F 451.1/1-1, Categorical Exclusion Designation Form  

NLE Websites -- All DOE Office Websites (Extended Search)

302017 Briggs White (Px7546) Chicago, IL Alstom's Limestone Chemical Looping Gasification Process for High Hydrogen Syngas Generation This part of the project will be...

317

Download  

Science Journals Connector (OSTI)

Apr 25, 1975 ... chemical analyses of sediments (e.g. Hutch- inson and ... chemical and biological composition of .... platform of Cenozoic marinc limestone.

2000-01-04T23:59:59.000Z

318

EMSL - Subsurface Flow and Transport  

NLE Websites -- All DOE Office Websites (Extended Search)

carbonate (CaCO3) geochemical reactions exert a fundamental control on the evolution of porosity and permeability in shallow-to-deep subsurface siliciclastic and limestone rock...

319

E-Print Network 3.0 - attenuation coefficient measurements Sample...  

NLE Websites -- All DOE Office Websites (Extended Search)

and attenuation in limestones in the laboratory L. Adam and M. Batzle, Center for Rock Abuse, Colorado School of Mines Summary: for reservoir characterization. We measure...

320

Subsurface Site Characterization  

Office of Legacy Management (LM)

and limestone. The Green River Formation is the primary formation of interest for oil shale development in the region. Quaternary-age deposits of alluvium, mudflows, talus...

Note: This page contains sample records for the topic "dl dolomitic limestone" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


321

E-Print Network 3.0 - amorphous aluminum powder Sample Search...  

NLE Websites -- All DOE Office Websites (Extended Search)

slag... by limestone powder and BFS can lower the cost and enhance the greenness of concrete, since the production Source: Li, Victor C. - Departments of Civil and Environmental...

322

International Symposium on Site Characterization for CO2 Geological Storage  

E-Print Network (OSTI)

and limestone; extensive halite beds in SE Black Mesa basindeposits include gypsum and halite. The fine-grained unitsParadox Formation shale, halite, and anhydrite serve as

Tsang, Chin-Fu

2006-01-01T23:59:59.000Z

323

E-Print Network 3.0 - als tracer zur Sample Search Results  

NLE Websites -- All DOE Office Websites (Extended Search)

Engineering, Reservoir Simulation Research Collection: Fossil Fuels 50 Pathogen and chemical transport in the karst limestone of the Biscayne aquifer Summary: and described by...

324

Pennsylvanian Spiriferacea and Spiriferinacea of Kansas  

E-Print Network (OSTI)

unit is thin, the group as a whole is a fairly compact sequence, which stands jCool Creek Ls.Holt Shale Du Bois Limestone Turner Creek Shale Sheldon Lin-fester. 2.: tones Point Shalt lowa Palen Shale Co Li lone Hanford Limestone / Calhoun Shale Thin... unit is thin, the group as a whole is a fairly compact sequence, which stands jCool Creek Ls.Holt Shale Du Bois Limestone Turner Creek Shale Sheldon Lin-fester. 2.: tones Point Shalt lowa Palen Shale Co Li lone Hanford Limestone / Calhoun Shale Thin...

Spencer, R. S.

1967-01-27T23:59:59.000Z

325

Coal Gasification Systems Solicitations  

NLE Websites -- All DOE Office Websites (Extended Search)

Low Cost Coal Conversion to High Hydrogen Syngas; FE0023577 Alstom's Limestone Chemical Looping Gasification Process for High Hydrogen Syngas Generation; FE0023497 OTM-Enhanced...

326

Microsoft Word - RIN 12044518 DVP  

Office of Legacy Management (LM)

Bedrock wells are completed in the San Andres LimestoneGlorieta Sandstone hydrologic unit and are identified by the suffix (SG). The LTSP requires monitoring for molybdenum,...

327

Understanding Water and Solute Fluxes in Diverse Catchments  

E-Print Network (OSTI)

chalk, limestone, shale, unconsolidated sediments montane/mixed forest, residential unconsolidated alluvium sandstone,broadleaf forest/swamp unconsolidated sediments 25 f 100 h,i

Godsey, Sarah

2009-01-01T23:59:59.000Z

328

Building Stones  

E-Print Network (OSTI)

Ancient Egyptian limestone quarries: A petrological survey.pp. 195 - 212. 2001 Ancient quarries near Amarna. Egyptian36 - 38. 2010 An early Roman quarry for anhydrite and gypsum

2012-01-01T23:59:59.000Z

329

THE ROLE OF ARCHAEAL METHANOGENS IN BIOMINERALIZATION AND METAL CYCLING: FROM THE MICROSCOPIC TO THE GLOBAL SCALE  

E-Print Network (OSTI)

Archaea, including methanogens, comprise 20% of microbial biomass in global oceans. This study examines the role of Archaeal cell walls in primary low-temperature (30oC) dolomite formation, the impact of biogenic methane ...

Kenward, Paul Alexander

2010-12-16T23:59:59.000Z

330

Rock-water interactions of the Madison Aquifer, Mission Canyon Formation, Williston Basin, North Dakota  

E-Print Network (OSTI)

system. Results (i.e., degree of saturation with respect to calcite, dolomite, halite, gypsum, and anhydrite) were integrated with a graphical matrix analysis program to produce color-coded maps that depict potential precipitation-dissolution boundaries...

Spicer, James Frank

2012-06-07T23:59:59.000Z

331

Thermophysical properties of the Po Basin rocks  

Science Journals Connector (OSTI)

......7 per cent. 4.2.2 Anisotropic rocks Anisotropy of shales, silty shales and siltstones...dolomites). Horizons of shales, silty shales and siltstones are present...the presence of thermally anisotropic sheet silicates, note that......

V. Pasquale; G. Gola; P. Chiozzi; M. Verdoya

2011-07-01T23:59:59.000Z

332

The Effects of Initial Condition of Fracture Surfaces, Acid Spending, and Type on Conductivity of Acid Fracture  

E-Print Network (OSTI)

. Another area of interest is the variation of conductivity along the fracture due to acid spending. We also investigated the contact time, acid system type, and treatment temperature effects on conductivity using San Andres dolomite cores. The results...

Almomen, Ali Mansour

2013-07-24T23:59:59.000Z

333

HYDRAULIC CALCULATIONS FOR A MODIFIED IN-SITU RETORT  

E-Print Network (OSTI)

D. C. , 1974), 2. Oil Shale Tract C-b: Materials (AshlandRiver, containing the oil shale; and the Wasatch foundationof dolomitic marlstone (oil shale) and soluble materials.

Hall, W.G.

2012-01-01T23:59:59.000Z

334

Colloid Formation at Waste Plume Fronts  

E-Print Network (OSTI)

Although dolomite and brucite (eqs 3 and 4) were notMg 2+ +2H 2 O = Mg(OH) 2 (Brucite) +2H + 2Al(OH) 4- + 4(Ca,

Wan, Jiamin; Tokunaga, Tetsu K.; Saiz, Eduardo; Larsen, Joern T.; Zheng, Zuoping; Couture, Rex A.

2004-01-01T23:59:59.000Z

335

Description and crystal structure of maghrebite, MgAl2(AsO4)2(OH)2·8H2O, from Aghbar, Anti-Atlas, Morocco: first arsenate in the laueite mineral group  

Science Journals Connector (OSTI)

...other minerals include erythrite, talmessite/roselite-beta, wendwilsonite...crystals of roselite-wendwilsonite and talmessite were deposited within dolomite in quartzitic...isolated maghrebite crystal on Co-bearing talmessite. Picture width: 1 mm. 3. Appearance...

Nicolas Meisser; Joël Brugger; Sergey Krivovichev; Thomas Armbruster; Georges Favreau

336

Stratigraphy, structural geology and metamorphism of the Inwood Marble Formation, northern Manhattan, NYC, NY  

E-Print Network (OSTI)

of recrystallized dolomite and subordinate calcite marble the Inwood Marble was used for quarrying and mineral of northern Manhattan and by the late 1700s commercial quarries were in full operation. This work continued

Merguerian, Charles

337

Simulating minerals pyroprocessing by thermal analysis  

Science Journals Connector (OSTI)

TG and DTA studies on laboratory cement raw mixes and raw dolomite have been extensively reported in the literature. This paper discusses four aspects. (1) Calcination kinetics of raw mix by isothermal TG and ...

A. Bhattacharya

1993-01-01T23:59:59.000Z

338

Modeling of Sorption-Enhanced Steam Reforming in a Dual Fluidized Bubbling Bed Reactor  

Science Journals Connector (OSTI)

The kinetics of the steam methane reforming and water-gas shift reactions are based on literature values, whereas experimentally derived carbonation kinetics are used for the carbonation of a dolomite. ... An equilibrium H2 concentration of ?98% on a dry basis was reached at 600 °C and 1 atm, with Arctic dolomite (Franzefoss A/S) as the CO2-acceptor. ... loss?by?ignition ...

Kim Johnsen; John R. Grace; Said S. E. H. Elnashaie; Leiv Kolbeinsen; Dag Eriksen

2006-05-11T23:59:59.000Z

339

Design of a PSi header processor for the X.25 packet level protocol  

E-Print Network (OSTI)

processor data for Begin CP of the Receive DL Data. 4. 14. Connection processor data for Call Connected HP of the Receive DL Data. 4. 15. Connection processor data for Close CP of the Receive DL Data.... Connection processor data for Call Request HP . . . ? 4. 20. Connection processor data for Call Accepted HP . . . 4. 21. Connection processordataforClear Request HP . . . 52 53 53 4. 22. Connection processor data for Detach CP 2 . . . . . 54 5. 1...

Yu, Tsai-Fa

2012-06-07T23:59:59.000Z

340

Kinematic inversion for the 2-D horizontal and vertical qP-wave velocities and depths to interfaces applied to the TACT seismic profile, southern Alaska  

Science Journals Connector (OSTI)

......the upper 5 km of the crust is anisotropic. The range of anisotropy for...the rock samples, limestone-anisotropic shale. Since the ray path is velocity-dependent...equation (1986) for limestone-anisotropic shale using the following data (Levin......

E. A. Boztepe; L. W. Braile

1994-11-01T23:59:59.000Z

Note: This page contains sample records for the topic "dl dolomitic limestone" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


341

Q-anisotropy of qP waves in finely-layered media Jose M. Carcione, Stefano Picotti ...  

E-Print Network (OSTI)

by Schoenberg and Muir (1989) for anisotropic single constituents. Backus averaging for the lossless case has for Q- anisotropy (see Carcione, 2007). Analyses on sequences of sandstone-limestone and shale-limestone with different degrees of anisotropy indicate that the quality factors of the shear modes are more anisotropic

Santos, Juan

342

NMO correction in anisotropic media using ray velocity  

Science Journals Connector (OSTI)

......methods consisting of anisotropic NMO correction (Alkhalifah...Fig. 3(b), from Shale limestone . Figure 3...Taylor sandstone, (b) Shale limestone from Thomsen...Fig. 4 compares two anisotropic NMO methods assuming...bottom of Dog Creek shale layer located at a depth......

M. Sadri; M. A. Riahi

2009-12-01T23:59:59.000Z

343

Early strawn biostratigraphy: What is the Caddo  

SciTech Connect

Caddo limestone is used to describe parts of the lower Strawn limestone on the Eastern shelf. The lower Strawn limestone as generally deposited on an eroded Ellenburger surface, but may overlie eroded Mississippian or even Atokan rocks preserved in topographic lows on the Ellenburger surface. Above the Caddo limestone is a sequence of clastics overlain by the Goen Limestone of early Strawn age. The Goen Limestone, in turn, is overlain by clastics which are overlain by the late Strawn Capps Limestone. As long as knowledge of fusulinid zonation was restricted to rocks of early Cherokee, late Cherokee, and Marmaton age, regional correlations of these carbonate units were manageable. With refinement of zonation, however, the Caddo, Goen, and Capps limestones can be subdivided into discrete units of different age. In each of these age zones, the units are further divisible on the basis of environments of deposition and subsequent diagenesis. Current results indicate that the early Strawn carbonates are cyclical and were deposited during numerous glacio-eustatic sea level fluctuations.

Reid, A.M.

1987-02-01T23:59:59.000Z

344

Nature's green revolution: the remarkable evolutionary rise of C4 plants  

Science Journals Connector (OSTI)

...rapidly than C3 grasses in hot, open conditions after a recent burn (Knapp Medino 1999). Herbivores may also tip the balance between...Carboniferous limestone series stem scars 24.8 23.3 88 BurghLee Pit, UK Carboniferous limestone series internal stem 23.5 21...

2006-01-01T23:59:59.000Z

345

100% Pet coke or pet coke blends combustion  

SciTech Connect

Information is outlined on the combustion of 100 percent petroleum coke or petroleum coke blends. Data are presented on NISCO overviews; fuel (coke) characteristics; delayed coke analysis (1995-96); limestone characteristics/effects; limestone preparation; ash characteristics; vortex finders; agglomerization; and NISCO performance results.

Swindle, D.L.

1996-12-31T23:59:59.000Z

346

Journal of Sedimentary Research, 2010, v. 80, 943954 Research Article  

E-Print Network (OSTI)

boreholes advanced to depths of 400­450 cm (top of limestone bedrock) from the Chattanooga Coke Plant (CCP of anthropogenically remolded clay soil fill containing coal clinker, cinder grains, and limestone gravel; most layers of coarse fill were impregnated with creosote and coal tar. Most undisturbed soil (below 1 m depth

GonzĂĄlez, Luis A.

347

E-Print Network 3.0 - american erionite-associated mesothelioma...  

NLE Websites -- All DOE Office Websites (Extended Search)

Chernyavsky AI, Jolkovsky DL, Pinkerton KE, Grando SA. A Summary: and Liu H. Incomplete birth certificates: a risk marker for infant mortality. American Journal of Public......

348

Nonprice incentives and energy conservation.  

E-Print Network (OSTI)

individual choices about energy efficiency. Proc. Natl.4. Costa DL, Kahn ME (2013) Energy conservation “nudges” andInformation strategies and energy conservation behavior: a

Asensio, OI; Delmas, MA

2015-01-01T23:59:59.000Z

349

ENVIRONMENTAL REVIEW FOR CATEGORICAL EXCLUSION DETERMINATION  

NLE Websites -- All DOE Office Websites (Extended Search)

RoclDl'ainage Maintenance Montrose County, Colorado A. Brief Description of Proposal: Western...

350

E-Print Network 3.0 - allowing direct observation Sample Search...  

NLE Websites -- All DOE Office Websites (Extended Search)

Observation Software Systems DASEL Technical Report 200707DL01 Summary: , this simple logic could be encoded directly into either the observer construction or event response...

351

E-Print Network 3.0 - acid-induced stress resistance Sample Search...  

NLE Websites -- All DOE Office Websites (Extended Search)

stress sensing, as described by the fractional change in resistance per unit... for the resistance away from the ... Source: Chung, Deborah D.L. - Department of Mechanical and...

352

E-Print Network 3.0 - absolute negative resistance Sample Search...  

NLE Websites -- All DOE Office Websites (Extended Search)

31 March 1999 Abstract Apparent negative electrical resistance... .33 MPa), the apparent resistance was either positive or ... Source: Chung, Deborah D.L. - Department of...

353

Microsoft Word - Scott-CV2013Sept.docx  

NLE Websites -- All DOE Office Websites (Extended Search)

Center, Spartanburg, South Carolina. Recent Publications (2000-2013): Submitted (in review)- Soteropoulos DL, Lance SL, Flynn RW, and Scott DE. Effects of copper exposure on...

354

Physiological effects of dietary amaranth  

E-Print Network (OSTI)

? free control diet. After four weeks, total serum cholesterol, triglycerides, HDL, LDL, VLDL cholesterol and liver cholesterol and triglycezides were determined. Whole amaranth (WA) resulted in significantly lower serum cholesterol values compared... to the fiber-free control (FF) (WA 148 + -8 mg/dl, FF 195 " -17 mg/dl, P&0. 05) appazently by decreasing LDL cholesterol (WA 96 10 mg/dl, FF 146 -+ 18 mg/dl) since HDL cholesterol levels of amaranth-fed animals were similar to those of controls (WA 33 -+ 2...

Danz, Ruth Ann

2012-06-07T23:59:59.000Z

355

E-Print Network 3.0 - active carbon process Sample Search Results  

NLE Websites -- All DOE Office Websites (Extended Search)

; Activated carbon; Carbon fibers; D. Electrical (electronic) properties Electromagnetic interference (EMI... in the composites is typically that ... Source: Chung, Deborah D.L....

356

E-Print Network 3.0 - activated carbon chemically Sample Search...  

NLE Websites -- All DOE Office Websites (Extended Search)

; Activated carbon; Carbon fibers; D. Electrical (electronic) properties Electromagnetic interference (EMI... in the composites is typically that ... Source: Chung, Deborah D.L....

357

E-Print Network 3.0 - activated carbon treatment Sample Search...  

NLE Websites -- All DOE Office Websites (Extended Search)

; Activated carbon; Carbon fibers; D. Electrical (electronic) properties Electromagnetic interference (EMI... in the composites is typically that ... Source: Chung, Deborah D.L....

358

E-Print Network 3.0 - activated carbon particles Sample Search...  

NLE Websites -- All DOE Office Websites (Extended Search)

; Activated carbon; Carbon fibers; D. Electrical (electronic) properties Electromagnetic interference (EMI... in the composites is typically that ... Source: Chung, Deborah D.L....

359

E-Print Network 3.0 - activated carbon process Sample Search...  

NLE Websites -- All DOE Office Websites (Extended Search)

; Activated carbon; Carbon fibers; D. Electrical (electronic) properties Electromagnetic interference (EMI... in the composites is typically that ... Source: Chung, Deborah D.L....

360

1547.ps  

E-Print Network (OSTI)

Dec 18, 2006 ... tic; [objt,Xt,yt,Zt,info] = mysdps(blk,A,C,b); t = toc;. >> tic; [fL, Y, dl] = vsdplow(blk,A,

Note: This page contains sample records for the topic "dl dolomitic limestone" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


361

Association of Serum Phosphorus Concentration with Mortality in Elderly and Non-Elderly Hemodialysis Patients  

E-Print Network (OSTI)

between serum phosphorous levels (main predictor) with all-likely to have serum phosphorous levels <3.5 mg/dl, compared

2013-01-01T23:59:59.000Z

362

E-Print Network 3.0 - american scorpions arachnida Sample Search...  

NLE Websites -- All DOE Office Websites (Extended Search)

Sample search results for: american scorpions arachnida Page: << < 1 2 3 4 5 > >> 1 Johnson, D.L. 2004. The Northern Scorpion, Paruroctonus boreus, in southern Alberta,...

363

DISCLAIMER  

NLE Websites -- All DOE Office Websites (Extended Search)

level AMF ARM Mobile Facility AMFDL AMF Doppler Lidar ARM Atmospheric Radiation Measurement DL Doppler Lidar DMF Data Management Facility DOE U.S. Department of Energy DQO...

364

Sun Protocols in the ISO Open Systems Interconnect Model Application  

E-Print Network (OSTI)

. Technical Report, (1985). [6] J. M. Chang, "SunNet," USENIX (1985). [7] D.L. Presotto and D. M. Ritchie

California at Davis, University of

365

Advanced Organic Vapor Cycles for Improving Thermal Conversion Efficiency in Renewable Energy Systems  

E-Print Network (OSTI)

DL Chase and PT Kehoe, "GE Combined-Cycle Product Line andand W Stenze, "Combined Cycle Heat Recovery Optimization,"bottoming cycle FOR combined cycle power plants," Applied

Ho, Tony

2012-01-01T23:59:59.000Z

366

Combining multivariate analysis and monosaccharide composition modeling to identify plant cell wall variations by Fourier Transform Near Infrared spectroscopy.  

E-Print Network (OSTI)

19. Wetzel DL: Near-infrared reflectance analysis - sleepertreatments of raw near-infrared signal in the measurement ofusing transmittance near-infrared spectroscopy. J Agric Food

2011-01-01T23:59:59.000Z

367

Combining multivariate analysis and monosaccharide composition modeling to identify plant cell wall variations by Fourier Transform Near Infrared spectroscopy  

E-Print Network (OSTI)

19. Wetzel DL: Near-infrared reflectance analysis - sleepertreatments of raw near-infrared signal in the measurement ofusing transmittance near-infrared spectroscopy. J Agric Food

2011-01-01T23:59:59.000Z

368

Sub-crop geologic map of pre-Tertiary rocks in the Yucca Flat and northern Frenchman Flat areas, Nevada Test Site, southern Nevada  

SciTech Connect

This map displays interpreted structural and stratigraphic relations among the Paleozoic and older rocks of the Nevada Test Site region beneath the Miocene volcanic rocks and younger alluvium in the Yucca Flat and northern Frenchman Flat basins. These interpretations are based on a comprehensive examination and review of data for more than 77 drillholes that penetrated part of the pre-Tertiary basement beneath these post-middle Miocene structural basins. Biostratigraphic data from conodont fossils were newly obtained for 31 of these holes, and a thorough review of all prior microfossil paleontologic data is incorporated in the analysis. Subsurface relationships are interpreted in light of a revised regional geologic framework synthesized from detailed geologic mapping in the ranges surrounding Yucca Flat, from comprehensive stratigraphic studies in the region, and from additional detailed field studies on and around the Nevada Test Site. All available data indicate the subsurface geology of Yucca Flat is considerably more complicated than previous interpretations have suggested. The western part of the basin, in particular, is underlain by relics of the eastward-vergent Belted Range thrust system that are folded back toward the west and thrust by local, west-vergent contractional structures of the CP thrust system. Field evidence from the ranges surrounding the north end of Yucca Flat indicate that two significant strike-slip faults track southward beneath the post-middle Miocene basin fill, but their subsurface traces cannot be closely defined from the available evidence. In contrast, the eastern part of the Yucca Flat basin is interpreted to be underlain by a fairly simple north-trending, broad syncline in the pre-Tertiary units. Far fewer data are available for the northern Frenchman Flat basin, but regional analysis indicates the pre-Tertiary structure there should also be relatively simple and not affected by thrusting. This new interpretation has implications for ground water flow through pre-Tertiary rocks beneath the Yucca Flat and northern Frenchman Flat areas, and has consequences for ground water modeling and model validation. Our data indicate that the Mississippian Chainman Shale is not laterally extensive confining unit in the western part of the basin because it is folded back onto itself by the convergent structures of the Belted Range and CP thrust systems. Early and Middle Paleozoic limestone and dolomite are present beneath most of both basins and, regardless of structural complications, are interpreted to form a laterally continuous and extensive carbonate aquifer. Structural culmination that marks the French Peak accommodation zone along the topographic divide between the two basins provides a lateral pathway through highly fractured rock between the volcanic aquifers of Yucca Flat and the regional carbonate aquifer. This pathway may accelerate the migration of ground-water contaminants introduced by underground nuclear testing toward discharge areas beyond the Nevada Test Site boundaries. Predictive three-dimensional models of hydrostratigraphic units and ground-water flow in the pre-Tertiary rocks of subsurface Yucca Flat are likely to be unrealistic due to the extreme structural complexities. The interpretation of hydrologic and geochemical data obtained from monitoring wells will be difficult to extrapolate through the flow system until more is known about the continuity of hydrostratigraphic units. 1 plate

Cole, J.C.; Harris, A.G.; Wahl, R.R.

1997-10-02T23:59:59.000Z

369

Evaluating the Influence of Pore Architecture and Initial Saturation on Wettability and Relative Permeability in Heterogeneous, Shallow-Shelf Carbonates  

SciTech Connect

Thin (3-40 ft thick), heterogeneous, limestone and dolomite reservoirs, deposited in shallow-shelf environments, represent a significant fraction of the reservoirs in the U.S. midcontinent and worldwide. In Kansas, reservoirs of the Arbuckle, Mississippian, and Lansing-Kansas City formations account for over 73% of the 6.3 BBO cumulative oil produced over the last century. For these reservoirs basic petrophysical properties (e.g., porosity, absolute permeability, capillary pressure, residual oil saturation to waterflood, resistivity, and relative permeability) vary significantly horizontally, vertically, and with scale of measurement. Many of these reservoirs produce from structures of less than 30-60 ft, and being located in the capillary pressure transition zone, exhibit vertically variable initial saturations and relative permeability properties. Rather than being simpler to model because of their small size, these reservoirs challenge characterization and simulation methodology and illustrate issues that are less apparent in larger reservoirs where transition zone effects are minor and most of the reservoir is at saturations near S{sub wirr}. These issues are further augmented by the presence of variable moldic porosity and possible intermediate to mixed wettability and the influence of these on capillary pressure and relative permeability. Understanding how capillary-pressure properties change with rock lithology and, in turn, within transition zones, and how relative permeability and residual oil saturation to waterflood change through the transition zone is critical to successful reservoir management and as advanced waterflood and improved and enhanced recovery methods are planned and implemented. Major aspects of the proposed study involve a series of tasks to measure data to reveal the nature of how wettability and drainage and imbibition oil-water relative permeability change with pore architecture and initial water saturation. Focus is placed on carbonate reservoirs of widely varying moldic pore systems that represent the major of reservoirs in Kansas and are important nationally and worldwide. A goal of the project is to measure wettability, using representative oils from Kansas fields, on a wide range of moldic-porosity lithofacies that are representative of Kansas and midcontinent shallow-shelf carbonate reservoirs. This investigation will discern the relative influence of wetting and pore architecture. In the midcontinent, reservoir water saturations are frequently greater than 'irreducible' because many reservoirs are largely in the capillary transition zone. This can change the imbibition oil-water relative permeability relations. Ignoring wettability and transition-zone relative permeabilities in reservoir modeling can lead to over- and under-prediction of oil recovery and recovery rates, and less effective improved recovery management. A goal of this project is to measure drainage and imbibition oil-water relative permeabilities for a large representative range of lithofacies at differ ent initial water saturations to obtain relations that can be applied everywhere in the reservoir. The practical importance of these relative permeability and wettability models will be demonstrated by using reservoir simulation studies on theoretical/generic and actual reservoir architectures. The project further seeks to evaluate how input of these new models affects reservoir simulation results at varying scales. A principal goal is to obtain data that will allow us to create models that will show how to accurately simulate flow in the shallow-structure, complex carbonate reservoirs that lie in the transition zone. Tasks involved to meet the project objectives include collection and consolidation of available data into a publicly accessible relational digital database and collection of oil and rock samples from carbonate fields around the state (Task 1). Basic properties of these rocks and oils will be measured and used in wettability tests. Comparison will be performed between crude and synthetic oil wettability and

Alan P. Byrnes; Saibal Bhattacharya; John Victorine; Ken Stalder

2007-09-30T23:59:59.000Z

370

EXPLOITATION AND OPTIMIZATION OF RESERVOIR PERFORMANCE IN HUNTON FORMATION, OKLAHOMA  

SciTech Connect

This report presents the work done so far on Hunton Formation in West Carney Field in Lincoln County, Oklahoma. West Carney Field produces oil and gas from the Hunton Formation. The field was developed starting in 1995. Some of the unique characteristics of the field include decreasing water oil ratio over time, decreasing gas-oil ratio at the beginning of production, inability to calculate oil reserves in the field based on log data, and sustained oil rates over long periods of time. To understand the unique characteristics of the field, an integrated evaluation was undertaken. Production data from the field were meticulously collected, and over forty wells were cored and logged to better understand the petrophysical and engineering characteristics. Based on the work done in this budget period so far, some of the preliminary conclusions can be listed as follows: (1) Based on PVT analysis, the field most likely contains volatile oil with bubble point close to initial reservoir pressure of 1,900 psia. (2) The initial oil in place, which is contact with existing wells, can be determined by newly developed material balance technique. The oil in place, which is in communication, is significantly less than determined by volumetric analysis, indicating heterogeneous nature of the reservoir. The oil in place, determined by material balance, is greater than determined by decline curve analysis. This difference may lead to additional locations for in fill wells. (3) The core and log evaluation indicates that the intermediate pores (porosity between 2 and 6 %) are very important in determining production potential of the reservoir. These intermediate size pores contain high oil saturation. (4) The limestone part of the reservoir, although low in porosity (mostly less than 6 %) is much more prolific in terms of oil production than the dolomite portion of the reservoir. The reason for this difference is the higher oil saturation in low porosity region. As the average porosity increases, the remaining oil saturation decreases. This is evident from log and core analysis. (5) Using a compositional simulator, we are able to reproduce the important reservoir characteristics by assuming a two layer model. One layer is high permeability region containing water and the other layer is low permeability region containing mostly oil. The results are further verified by using a dual porosity model. Assuming that most of the volatile oil is contained in the matrix and the water is contained in the fractures, we are able to reproduce important reservoir performance characteristics. (6) Evaluation of secondary mechanisms indicates that CO{sub 2} flooding is potentially a viable option if CO{sub 2} is available at reasonable price. We have conducted detailed simulation studies to verify the effectiveness of CO{sub 2} huff-n-puff process. We are in the process of conducting additional lab tests to verify the efficacy of the same displacement. (7) Another possibility of improving the oil recovery is to inject surfactants to change the near well bore wettability of the rock from oil wet to water wet. By changing the wettability, we may be able to retard the water flow and hence improve the oil recovery as a percentage of total fluid produced. If surfactant is reasonably priced, other possibility is also to use huff-n-puff process using surfactants. Laboratory experiments are promising, and additional investigation continues. (8) Preliminary economic evaluation indicates that vertical wells outperform horizontal wells. Future work in the project would include: (1) Build multi-well numerical model to reproduce overall reservoir performance rather than individual well performance. Special emphasis will be placed on hydrodynamic connectivity between wells. (2) Collect data from adjacent Hunton reservoirs to validate our understanding of what makes it a productive reservoir. (3) Develop statistical methods to rank various reservoirs in Hunton formation. This will allow us to evaluate other Hunton formations based on old well logs, and determine, apriori, if

Mohan Kelkar

2003-10-01T23:59:59.000Z

371

Air gasification of dried sewage sludge in a two-stage gasifier: Part 1. The effects and reusability of additives on the removal of tar and hydrogen production  

Science Journals Connector (OSTI)

Air gasification of dried sewage sludge was conducted in a two-stage gasifier. In the experiments, natural occurring materials, such as natural zeolite, olivine and dolomite, as well as biomass-based and coal-based activated carbons, were applied to the upper reactor of a two-stage gasifier, while sand and calcined dolomite were used as the fluidized bed material in the lower reactor. The reusability of the spent coal-based activated carbon and spent calcined dolomite was also investigated. The combination of calcined dolomite as the bed material and coal-based activated carbon in the upper reactor produced the highest H2 (28 vol.%) and CO (21 vol.%) contents. Furthermore, total amount of tar generated with the combination was 91% less than that generated with no additive in the upper reactor and sand in the lower reactor. The H2 content and tar removal efficiencies in the experiments with the spent activated carbons and spent calcined dolomites were shown to be better than those without additives in the upper reactor.

Tae-Young Mun; Jin-Won Kim; Joo-Sik Kim

2013-01-01T23:59:59.000Z

372

Deposition and diagenesis of a cratonic Silurian platform reef, Pipe Creek Jr. , Indiana  

SciTech Connect

Petrographic and geochemical characteristics of the Pipe Creek Jr. paragenesis record the stratigraphic and burial evolution of the cratonic Silurian platform of Indiana during Late Silurian to Pennsylvanian. A variety of several diagenetic fluids acting over geological time affected the reef. The paragenetic sequence is as follows: (1) precipitation of turbid, fibrous, blotchy cathodoluminescent (CL) cement; (2) dolomitization of mud-rich facies; (3) precipitation of clear, zoned CL equant calcite cements; (4) fracturing and karst formation, partially filled by geopetal silt and sandstone; (5) precipitation of clear, dull CL, ferroan to nonferroan equant calcite cement, ferroan dolomite overgrowth and equant dolomite cement in moldic porosity, caves and fractures; (6) microdissolution and hydrocarbon emplacement; and (7) stylolitization. Carbonate grew and fibrous cements precipitated in an open marine environment. During Late Silurian an increasingly restricted environment stopped reef growth and dolomite replaced mud-rich faces. The reefs were then subaerially exposed and two meteoric cement sequences, non-luminescent to bright luminescent, precipitated prior to Mid-Devonian fracture-controlled karsting. Caves and fractures crosscut former cement stages and were filled by sandstones. Later, the platform was buried by the late Mid-Devonian organic-rich New Albany Shale, and clear, dull CL calcite cement and ferroan dolomite precipitated. Hydrocarbon migration postdates all cements and created minor moldic porosity and predates stylolitization.

Simo, A.; Lehmann, P.

1988-01-01T23:59:59.000Z

373

Analysis of the fluid-pressure responses of the Rustler Formation at H-16 to the construction of the air-intake shaft at the Waste Isolation Pilot Plant (WIPP) site  

SciTech Connect

The construction of the air-intake shaft (AIS) at the Waste Isolation Pilot Plant (WIPP) site in 1987 and 1988 initiated fluid-pressure responses which were used to estimate the hydrologic properties of the Culebra Dolomite, Magenta Dolomite, and Forty-niner Members of the Rustler Formation. Fluid-pressure responses were monitored with downhole transducers. The AIS pilot hole,remained open and draining to the underground facility for about three months. The pilot hole was then upreamed from the underground facility to land surface. The pilot hole was drilled and reamed using a bentonite-mud-based brine as a drilling fluid. The well-test simulator GTFM was used to analyze the fluid-pressure responses of the Culebra and Magenta dolomites and the Forty-niner claystone. A cement-invasion skin was used in simulating the Culebra dolomite's drilling/reaming period. A mud-filter-cake skin was used to create reduced wellbore pressures in simulating the pilot-hole drilling/reaming periods of the Magenta dolomite and Forty-niner claystone. 26 refs., 70 figs., 10 tabs.

Alvis, J.D.; Saulnier, G.J. Jr.

1990-03-01T23:59:59.000Z

374

Ground Motion Studies at NuMI  

SciTech Connect

Ground motion can cause significant deterioration in the luminosity of a linear collider. Vibration of numerous focusing magnets causes continuous misalignments, which makes the beam emittance grow. For this reason, understanding the seismic vibration of all potential LC sites is essential and related efforts in many sites are ongoing. In this document we summarize the results from the studies specific to Fermilab grounds as requested by the LC project leader at FNAL, Shekhar Mishra in FY04-FY06. The Northwestern group focused on how the ground motion effects vary with depth. Knowledge of depth dependence of the seismic activity is needed in order to decide how deep the LC tunnel should be at sites like Fermilab. The measurements were made in the NuMI tunnel, see Figure 1. We take advantage of the fact that from the beginning to the end of the tunnel there is a height difference of about 350 ft and that there are about five different types of dolomite layers. The support received allowed to pay for three months of salary of Michal Szleper. During this period he worked a 100% of his time in this project. That include one week of preparation: 2.5 months of data taking and data analysis during the full period of the project in order to guarantee that we were recording high quality data. We extended our previous work and made more systematic measurements, which included detailed studies on stability of the vibration amplitudes at different depths over long periods of time. As a consequence, a better control and more efficient averaging out of the daytime variation effects were possible, and a better study of other time dependences before the actual depth dependence was obtained. Those initial measurements were made at the surface and are summarized in Figure 2. All measurements are made with equipment that we already had (two broadband seismometers KS200 from GEOTECH and DL-24 portable data recorder). The offline data analysis took advantage of the full Fourier spectra information and the noise was properly subtracted. The basic formalism is summarized if Figure 3. The second objective was to make a measurement deeper under ground (Target hall, Absorber hall and Minos hall - 150 ft to 350 ft), which previous studies did not cover. All results are summarized in Figure 3 and 4. The measurements were covering a frequency range between 0.1 to 50 Hz. The data was taken continuously for at least a period of two weeks in each of the locations. We concluded that the dependence on depth is weak, if any, for frequencies above 1 Hz and not visible at all at lower frequencies. Most of the attenuation (factor of about 2-3) and damping of ground motion that is due to cultural activity at the surface is not detectable once we are below 150 ft underground. Therefore, accelerator currently under consideration can be build at the depth and there is no need to go deeper underground is built at Fermi National Laboratory.

Mayda M. Velasco; Michal Szleper

2012-02-20T23:59:59.000Z

375

Expression of Aurora A (but Not Aurora B) Is Predictive of Survival in Breast Cancer  

Science Journals Connector (OSTI)

...Lett 2007;247:266-72. 33 Camp RL, Dolled-Filhart M, King...Res 2003;63:1445-8. 34 Camp RL, Chung GG, Rimm DL. Automated...A, Giltnane J, Cregger M, Camp RL, Rimm DL. Quantitative...Tumor Female History, 17th Century Humans Image Processing, Computer-Assisted...

Yasmine Nadler; Robert L. Camp; Candice Schwartz; David L. Rimm; Harriet M. Kluger; and Yuval Kluger

2008-07-15T23:59:59.000Z

376

Interspecific audience effects on the alarm-calling behaviour of a kleptoparasitic bird  

Science Journals Connector (OSTI)

...anbe.2000.1636 Cheney, D.L , and R.M Seyfarth1990How...x Leavesley, A.J , and R.D Magrath2005Communicating about...508809 Seyfarth, R.M , and D.L Cheney2003Signalers and receivers...Fitzpatrick Institute, DST/NRF Centre of Excellence, University...

2007-01-01T23:59:59.000Z

377

Extraction abilities of methods used for estimating of different phosphorus fractions  

E-Print Network (OSTI)

readily available P (P CaCl2 ). Anion exchange (AE)methods (P ar =100%) P CaCl2 P ex P DL P M3 P in P org P M-for different methods P CaCl2 P ex P DL P M3 P in P org P

Kulhanek, Martin; Balik, Jiri; Cerny, Jindrich; Kozlovsky, Ondrej; Nedved, Vaclav

2009-01-01T23:59:59.000Z

378

Genes from Pseudomonas sp. Strain BS Involved in the Conversion of l-2-Amino-?2-Thiazolin-4-Carbonic Acid to l-Cysteine  

Science Journals Connector (OSTI)

...purified intermediate by two-dimensional 1H nuclear magnetic resonance indicated that the intermediate...amidohydrolase from Pseudomonas sp. strain BS, which is able to convert dl-ATC to...l-cysteine synthesis from dl-ATC in strain BS. The 2.6-kb insert DNA fragment in...

Toshikazu Shiba; Kohji Takeda; Misako Yajima; Makoto Tadano

2002-05-01T23:59:59.000Z

379

Similarity of genes horizontally acquired by Escherichia coli and Salmonella enterica is evidence of a supraspecies pangenome  

Science Journals Connector (OSTI)

...1073/pnas.1109451108 Katherine A. Karberg Gary J. Olsen James...Science 328 : 994 – 999 . 39 Wheeler DL ( 2007 ) Database...a supra-species pangenome Katherine A. Karberga,1, Gary J...Evol 27: 800 ZZQQhy810. 12. Wheeler, DL, et al. (2007) Database...

Katherine A. Karberg; Gary J. Olsen; James J. Davis

2011-01-01T23:59:59.000Z

380

Verrucomicrobia Are Candidates for Polysaccharide-Degrading Bacterioplankton in an Arctic Fjord of Svalbard  

Science Journals Connector (OSTI)

...DL Kirchman. 2011. Activity of abundant and rare bacteria in a coastal ocean. Proc. Natl. Acad. Sci. U. S. A. 108 :12776-12781. doi: 10.1073/pnas.1101405108 . 76. Landa, M , MT Cottrell, DL Kirchman, S Blain and I Obernosterer. 2013...

Z. Cardman; C. Arnosti; A. Durbin; K. Ziervogel; C. Cox; A. D. Steen; A. Teske

2014-04-11T23:59:59.000Z

Note: This page contains sample records for the topic "dl dolomitic limestone" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


381

NISF sub-group 04 March 2010  

E-Print Network (OSTI)

Woodland/ forest area (1(1--6)6) ·· Number of conifer species > 1% coverNumber of conifer species > 1% cover (21 NISF sub-group 04 March 2010 Belvoir Park Forest ­ Exhibition Room Chair: Dr Declan Looney (DL) Attendees (JL) Jon Lees -NIEA (DL) Declan Looney -NIEA (JG) John Griffin -Forest Service (DS) Richard

382

Carbon Nanotube Field-effect Transistors: AC Performance Capabilities.  

E-Print Network (OSTI)

Carbon Nanotube Field-effect Transistors: AC Performance Capabilities. D.L. Pulfrey, D.L. John-barrier carbon nanotube field-effect transistors are examined via simulations using a self-consistent Schrödinger is known about the DC capabilities of carbon nanotube field-effect transistors [1,2,3], and devices

Pulfrey, David L.

383

CARBON NANOTUBE TRANSISTORS: AN EVALUATION  

E-Print Network (OSTI)

CARBON NANOTUBE TRANSISTORS: AN EVALUATION L.C. Castro, D.L. John, and D.L. Pulfrey Department A simple, non-equilibrium model is used to evaluate the likely DC performance of carbon nanotube field and transcon- ductance close to the low-quantum-capacitance limit. Keywords: Carbon nanotubes, field

Pulfrey, David L.

384

Publications List Refereed: (78 Total)  

E-Print Network (OSTI)

. Southern pine volume equations and associated conversion factors for southwest Georgia. FL. Agr. Exp. Sta: 19 27. Frampton, LJ, Jr., and DL Rockwood. 1983. Genetic variation in traits important for energy Series Bull. No. 275, p. 28 39. Roeder, KR, and DL Rockwood. 1983. Potential stem biomass and energy

Hill, Jeffrey E.

385

Optimal Use of Groundwater and Surface Water to Reduce Land Subsidence  

E-Print Network (OSTI)

TR- 103 1980 Optimal Use of Groundwater and Surface Water to Reduce Land Subsidence G. Acosta-Gonzalez D.L. Reddell Texas Water Resources Institute Texas A&M University ...TR- 103 1980 Optimal Use of Groundwater and Surface Water to Reduce Land Subsidence G. Acosta-Gonzalez D.L. Reddell Texas Water Resources Institute Texas A&M University ...

Acosta-Gonzalez, G.; Reddell, D. L.

386

Bryozoan Tabulipora carbonaria in Wreford Megacyclothem (Lower Permian) of Kansas  

E-Print Network (OSTI)

and algal limestones formed; and it was either just barely able to survive or entirely absent where other rock types formed. T. carbonaria, therefore, is interpreted to have thrived most in waters which were relatively deep, far from shore, quiet...) Limestones. The facts that the chalky limestones of the upper Threemile occur only north of the area of this shoal and that the algal and algal-molluscan lime- stones at the top of the Threemile and in the upper Havensville occur largely south of the presumed...

Cuffey, Roger J.

1967-05-12T23:59:59.000Z

387

Dissepimental rugose corals of Upper Pennsylvanian (Missourian) rocks of Kansas  

E-Print Network (OSTI)

and facies distribution 6 N. tushanense (Chi, 1931) 32 Normal limestone belt 6 N. perplexum Cocke, n.sp. 34 Algal-mound-complex belt 8 N. acolumnatum Cocke, n.sp. 35 Clastic belt 9 N. variabile Cocke, n.sp. 36 Distribution of dissepimental..., n.sp., from the Bethany Falls Limestone at Loc. BF1 20 4. Serial transverse section of a badly abraded speci- men of Dibunophyllum valeriae Newell, 1935, from Plattsburg Limestone at Loc. Pb! 21 5. Serial transverse sections of Neokoninckophyl...

Cocke, J. M.

1970-10-13T23:59:59.000Z

388

Evaluation of drill cuttings in prediction of penetration rate by using coarseness index and mean particle size in percussive drilling  

Science Journals Connector (OSTI)

Penetration rate of rocks is influenced by geological parameters,...CI) and mean particle size (d) to evaluate the penetration rate (PR) in percussive drilling in a limestone and in a marl quarry. The coarseness ...

Ra??t Altindag

389

Initial Design of a Dual Fluidized Bed Reactor  

E-Print Network (OSTI)

from a steam hydro gasification and reforming process.study on biomass Air-steam gasification in a fluidized bed.limestone calcination on the gasification processes in a BFB

Yun, Minyoung

2014-01-01T23:59:59.000Z

390

Magneto-Telluric Experiments in Northern Ellesmere Island  

Science Journals Connector (OSTI)

......electromagneticinduction within an anisotropic plane sheet over a non-conductor...experiment. This inductive anisotropic model leads to approximate...mainly argillaceous limestone, shale and greywacke with minor but...is highly inhomogeneous or anisotropic and the electric field is......

K. Whitham; F. Andersen

1965-12-01T23:59:59.000Z

391

PUBLISHED QUARTBRLY BY THE UNIVERSITY OF NEVADA  

National Nuclear Security Administration (NNSA)

associated with lead and copper minerals a r e reported found here in metamorphosed shale and limestone. The workings consist of a 500-foot crosscut adit, a 75-foot adit and...

392

E-Print Network 3.0 - archean barite weak Sample Search Results  

NLE Websites -- All DOE Office Websites (Extended Search)

barite cement (e) at the contact between the cap dolostone and Hayhook limestone... at Shale Lake. The slender dark prisms growing off the tips of the barite fingers near the top...

393

Carbonation of Fly Ash in Oxy-fuel CFB Combustion  

Science Journals Connector (OSTI)

Oxy-fuel combustion of fossil fuel is one of the most promising methods to produce a stream of concentrated CO2 ready for sequestration. Oxy-fuel FBC (fluidized bed combustion) can use limestone as a sorbent for

Chunbo Wang; Lufei Jia; Yewen Tan…

2007-01-01T23:59:59.000Z

394

HELSINKI UNIVERSITY OF TECHNOLOGY ENE-47.153 NITROGEN #2NITROGEN #2  

E-Print Network (OSTI)

(BFB), (CFB) (BFB), (CFB) Fuel nitrogen content Excess air Air staging Limestone addition , - (BFB), (CFB) SO2 level SNCR ­ NH3 , - SNCR ­ urea SCR - Pressure , (but NO2 ) #12;HELSINKI

Zevenhoven, Ron

395

Sr isotope chemostratigraphy of Upper Jurassic carbonate rocks in the Demerdzhi Plateau (Crimean Mountains)  

Science Journals Connector (OSTI)

The first Sr chemostratigraphic data are obtained for the Upper Jurassic carbonate sections in the Demerdzhi Plateau of the Crimean Mountains. The oncoid, microbial, and organogenic-detrital limestone varietie...

S. V. Rud’ko; A. B. Kuznetsov; V. K. Piskunov

2014-09-01T23:59:59.000Z

396

E-Print Network 3.0 - ash dosage du Sample Search Results  

NLE Websites -- All DOE Office Websites (Extended Search)

Summary: ash and iron-foundry baghouse dust in the manufacturing of economical self-compacting concrete... . CONCLUSIONS: The limestone-quarry fines and Class C fly ash showed...

397

E-Print Network 3.0 - ash quality characterization Sample Search...  

NLE Websites -- All DOE Office Websites (Extended Search)

Summary: ash and iron-foundry baghouse dust in the manufacturing of economical self-compacting concrete... . CONCLUSIONS: The limestone-quarry fines and Class C fly ash showed...

398

Mining Regulations (Missouri)  

Energy.gov (U.S. Department of Energy (DOE))

This legislation applies to all mines in this state engaged in the mining or extraction of minerals for commercial purposes, except barite, marble, limestone, and sand and gravel, or the...

399

Influence of Substrate Mineralogy on Bacterial Mineralization of Calcium Carbonate: Implications for Stone Conservation  

Science Journals Connector (OSTI)

...limestone and sandstone with their...reduction of the porosity and/or permeability of geological...optical-quality Iceland spar...intergranular porosity (up to 1...slabs of sandstone (from Prague...large air reservoir in the tubes...

Carlos Rodriguez-Navarro; Fadwa Jroundi; Mara Schiro; Encarnación Ruiz-Agudo; María Teresa González-Muńoz

2012-03-23T23:59:59.000Z

400

Water-inrush Assessment Using a GIS-based Bayesian Network for the 12-2 Coal Seam of the Kailuan Donghuantuo Coal Mine in China  

Science Journals Connector (OSTI)

The Donghuantuo coal mine is geologically unusual, with 60 normal ... 18 reverse faults, and 1 syncline. The coal seam floor is highly fractured and the ... Ordina limestone aquifer into the no. 12 coal seam. Fro...

Dong Donglin; Sun Wenjie; Xi Sha

2012-06-01T23:59:59.000Z

Note: This page contains sample records for the topic "dl dolomitic limestone" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


401

A morphotectonic study of environmental impact on ground water in Southern Iran and under the Persian Gulf  

Science Journals Connector (OSTI)

The Zagros Mountain Ranges (ZMR) in southern and southwestern Iran consisting mainly of limestone are a large and very valuable catchment area, which recharges the aquifers in vast areas of Iran and of the Gulf S...

Prof. Dr. Ing. Godratollah Farhoudi; Prof. Dr. Kurt Poll

1992-01-01T23:59:59.000Z

402

PEOPLE RESEARCH NEWS Faculty named Sloan fellows  

E-Print Network (OSTI)

focusing on the broad efforts to improve energy efficiency on campus. The limestone and glass walls of MIT- tially build better biofuels as well as biodegrad- able plastics and textiles. "We're trying to ask what

Entekhabi, Dara

403

1  

Energy Savers (EERE)

10 wells are completed in the San Andres Limestone-Glorieta Sandstone hydrogeologic unit, which is the uppermost bedrock aquifer at the site. The bedrock wells are I(SG),...

404

Application of encapsulation (pH-sensitive polymer and phosphate buffer macrocapsules): A novel approach to remediation of acidic ground water  

Science Journals Connector (OSTI)

Macrocapsules, composed of a pH-sensitive polymer and phosphate buffer, offer a novel remediation alternative for acidic ground waters. To test their potential effectiveness, laboratory experiments were carried out followed by a field trial within a coal pile runoff (CPR) acidic contaminant plume. Results of traditional limestone and macrocapsule treatments were compared in both laboratory and field experiments. Macrocapsules were more effective than limestone as a passive treatment for raising pH in well water from 2.5 to 6 in both laboratory and field experiments. The limestone treatments had limited impact on pH, only increasing pH as high as 3.3, and armoring by iron was evident in the field trial. Aluminum, iron and sulfate concentrations remained relatively constant throughout the experiments, but phosphate increased (0.15–32 mg/L), indicating macrocapsule release. This research confirmed that macrocapsules may be an effective alternative to limestone to treat highly acidic ground water.

C. Marjorie Aelion; Harley T. Davis; Joseph R.V. Flora; Brian C. Kirtland; Mark B. Amidon

2009-01-01T23:59:59.000Z

405

An overview of reservoir quality in producing Cretaceous strata of the Middle East  

Science Journals Connector (OSTI)

...geochemical studies of Cretaceous carbonate rocks, Ain Zalah oilfield, north Iraq. Journal of...Middle East models of Jurassic/Cretaceous carbonate systems. SEPM...Limestone, greater Burgan oilfield, Kuwait. Geologische Rundschau...

Stephen N. Ehrenberg; Adnan A. M. Aqrawi; Paul H. Nadeau

406

An overview of reservoir quality in producing Cretaceous strata of the Middle East  

Science Journals Connector (OSTI)

...Cretaceous carbonate rocks, Ain Zalah oilfield, north Iraq. Journal of Petroleum...Mauddud Limestone, greater Burgan oilfield, Kuwait. Geologische Rundschau...examples from Abu Dhabi and the Amu Darya Basin. Marine and Petroleum Geology...

Stephen N. Ehrenberg; Adnan A. M. Aqrawi; Paul H. Nadeau

407

42nd Annual Virginia Geological Field Conference, September 28-29, 2012  

E-Print Network (OSTI)

Geology of Page Valley: Stratigraphy, Structure, and Landscape Evolution #12;Luray Elkton Shenandoah 0 2/ Swift Run Formations Cambrian Chilhowee Group Cambrian - Ordovician carbonates undivided Ordovician Beekmantown Group Ordovician Edinburg Formation, Lincolnshire, New Market Limestones Ordovician Martinsburg

Whitmeyer, Steven J.

408

Neutron Diffraction Texture Analysis  

Science Journals Connector (OSTI)

...conducted at Chalk River (Canada), Geesthacht (Germany), LLB (France) and NIST...deformed limestone that was measured at Geesthacht with this method. It is also possible...with monochromatic neutrons at GKSS, Geesthacht. Equal area projection, linear contours...

Hans-Rudolf Wenk

409

UPPER CAMBRIAN STRATIGRAPHY IN THE CENTRAL APPALACHIANS  

Science Journals Connector (OSTI)

...conglomerate with crystal- line matrix grading up into lime- stone 1 9. Black finely crystalline to aphanitic limestone weathering steel blue and with yellow mottling 2 47-1lw.2, float at approximately this position, primitive orthoid, Taeni...

410

Kyrgyzstan  

Science Journals Connector (OSTI)

Uranium deposits of three types occur in the eastern Kara-mazar and northeastern Fergana region in central-western Kyrgyzstan: bituminous carbonate-type hosted in Paleogene limestone, sandstone-type in Neogene sa...

Franz J. Dahlkamp

2009-01-01T23:59:59.000Z

411

Purdue extension Hardwood Lumber  

E-Print Network (OSTI)

found in ravines and coves, but it can also grow on drier, rocky soil, especially of limestone origin on flat surfaces that will receive heavy use. Only small quantities of the wood are available today

412

A Preliminary Study of the Marine Biota at Navassa Island, Caribbean Sea  

E-Print Network (OSTI)

which issued a gener al research permit to NMFS to conduct the 1998 survey. Navassa Island is a flat limestone cliffs with a small area along the north coast consisting of a steep rocky beach with some sand

413

TECHNICAL REPORT  

Office of Scientific and Technical Information (OSTI)

that use limestone as a scrubber for SOz and produce gypsum as a by-product, are advanced pollution control technologies that will remain preferred choices for Phase-I1 compliance...

414

Colorado Plateau  

Science Journals Connector (OSTI)

Stage 4...is characterized by supergene minerals formed by oxidation and remobilization. Locally, as in a breccia pipe exposed in the Mooney Falls Member of the Redwall Limestone west of Peach Spri...

2010-01-01T23:59:59.000Z

415

PRELIMINARY GEOLOGIC MAP OF THE FERNLEY EAST QUADRANGLE, LYON AND WASHOE COUNTIES, NEVADA  

E-Print Network (OSTI)

deposits Qrl Reclaimed landfill Qm Mine waste from limestone quarries Qt Terrace deposits Qt1 Qt2 Qfy Young of this map. Detailed Map of Nevada Cement Quarries (1:18,000) #12;

Tingley, Joseph V.

416

African Studies Centre African Studies Collection, vol. 20  

E-Print Network (OSTI)

performance of ecosystem restoration projects ­ the case of Bamburi limestone quarry 209 P. Kahumbu 16. Tick species, distribution, and control in rehabilitated quarries in Bamburi, Mombasa 222 S. Okanga 17

Mencuccini, Maurizio

417

Measurements of moisture suction in hot mix asphalt mixes  

E-Print Network (OSTI)

is to relate suction measurements to physical and chemical properties of the mixtures. The objectives were achieved in two phases. In the first phase, the total suction was measured in HMA specimens with different types of aggregates (limestone and granite...

Kassem, Emad Abdel-Rahman

2006-10-30T23:59:59.000Z

418

Urban Form Energy Use and Emissions in China: Preliminary Findings and Model Proof of Concept  

E-Print Network (OSTI)

producing building materials, but it does not include upstream requirements of energyenergy required for producing the water, limestone, sandstone, gypsum, and clay typically used for cement production. The building

Aden, Nathaniel

2011-01-01T23:59:59.000Z

419

A New Species of an Enigmatic Fossil Taxon: Ischadites n. sp., a Middle Ordovician Receptaculitid From the Great Basin, Western USA  

E-Print Network (OSTI)

Limestone, Central Nevada, USA: Carbonates and Evaporites,Basin Ranges of Western U.S.A. , p. 167-185, in P.D.Range, Clark County, Nevada, USA. : Bulletin du Centre de

Henry, Sara Elizabeth

2014-01-01T23:59:59.000Z

420

Experimental deformation of multilithologic specimens simulating sedimentary facies changes  

E-Print Network (OSTI)

in controlling the location of deformation. To investigate this problem, three-layered specimens of Coconino Sandstone (11 by 3 by 3 cm. , 1 cm. layer thickness), each containing a block inclusion of Indiana Limestone, polycrystalline halite, modeling clay... the stages 17 (1, 2, 3) of shortening referred to in the text. Curves are labeled according to confining pressure. Representative force-displacement curves for specimens. 18 a. Limestone inclusion, 1. 0 kb confining pressure; b. halite inclusion, 1. 0 kb...

Dyke, Lawrence Dana

2012-06-07T23:59:59.000Z

Note: This page contains sample records for the topic "dl dolomitic limestone" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


421

Trace fossils and depositional environment of four clastic units, Upper Pennsylvanian megacyclothems, northeast Kansas  

E-Print Network (OSTI)

Purpose 6 Acknowledgments 6 PREVIOUS WORK 6 PALLOGEOGRAPHIC SETTING 8 STRATIGRAPIIIC DESCRIPTIONS 8 Rock Lake Shale and South Bend Limestone 8 Stull Shale Member 10 Tecumseh Shale 11 DISCUSSION 12 Bathymetry of trace fossils... 12 Cyclothems 13 Absence of body fossils 13 Distribution of trace fossils 14 PAGE INTERPRETATION 16 Rock Lake Shale and South Bend Limestone Members 16 Stull Shale Member 17 Tecumseh Shale 18 CONCLUSIONS 19 PALEONTOLOGIC...

Hakes, W. G.

1976-04-29T23:59:59.000Z

422

The effects of juniper removal on rainfall partitioning in the Edwards Aquifer region: large-scale rainfall simulation experiments  

E-Print Network (OSTI)

fault zone, and a confined area of both fresh and saline water zones. The Edwards Aquifer is also one of the most productive carbonate aquifers in the United States, with large porosity and high permeability due to limestone dissolution... fault zone, and a confined area of both fresh and saline water zones. The Edwards Aquifer is also one of the most productive carbonate aquifers in the United States, with large porosity and high permeability due to limestone dissolution...

Taucer, Philip Isaiah

2006-08-16T23:59:59.000Z

423

Structural geology of the northern termination of the Crawford Thrust, western Wyoming  

E-Print Network (OSTI)

descriptions and measured sections ot which provide excellent control on identifying units and determining the thicknesses. The Jurassic Twin Creek Limestone has been discussed by lmlay (1967), the Jurassic Preuss, Stump, and Jurass c-Cretaceous Ganne... Formation Sandstone and the Twin Creek Limestone. The upper Jurassic and Cretaceous sediments are markedly d1fferent. from the sediments beneath them. The Preuss and Stump Formations of the Upper Jurassic are marine shales and sandstones which Jordan (lg...

Evans, James Paul

2012-06-07T23:59:59.000Z

424

Geology of the South Mason County area, Texas  

E-Print Network (OSTI)

sandstone ~. . . . . . . . . . . . . . " fo11ow1ng page 32 X1V, Dense vegetation on middle Hickory . . . . , . . . . following page 32 Ffg. 1: Cap Nountain limestone ~. . . . . . " ~" following Fig. 2 ~ Honeycombed weathered surface of Cap Mountain... toward a very gentle folding of the Paleosoic rocks, Ground water is a very important natural resource of the area~ The most important aquifers in the Gentral KLneral region are the Hickory sandstone and the Kllenbuzger limestone. Weathered granite...

Alexander, William Luther

2012-06-07T23:59:59.000Z

425

Geology of the West Mason area, Texas  

E-Print Network (OSTI)

" following page 29 XIV. Fig. 1: Point Peak bioherrn and bedding. . . following page 29 Fig. 2: Point Peak weathered out bioherrns XV. Point Peak shale bench. . following page 29 XVI. Fig. 1; San Saba limestone bedding on weathered slope. Fig. 2: San... Saba coarse, glauconitic lime- stone bedding . following page 30 XVII. San Saba beds showing ripple marks. . following page 31 XVIII. Fig. 1: San Saba honeycombed weathered surface. Fig. 2: San Saba slabby limestone on weathered surface...

Polk, Ted Pritchard

2012-06-07T23:59:59.000Z

426

New synchronous compensators for the Nelson River HVDC system; Planning requirements and specifications  

SciTech Connect

The first units of Limestone Generating Station, the third plant on the Lower Nelson River in northern Manitoba, will come into service in the fall of 1990. Additional var compensation equipment is required at the inverter end of the Nelson River HVdc system to accommodate power from Limestone. This paper describes the system requirements of and the overall specification for the synchronous compensators selected to supply the reactive power and voltage support.

Thio, C.V.; Davies, J.B. (Manitoba Hydro, Winnipeg, Manitoba (CA))

1991-04-01T23:59:59.000Z

427

Double layer created by electron cyclotron resonance heating in an inhomogeneously magnetized plasma with high-speed ion flow  

SciTech Connect

A potential jump, i.e., an electric double layer (DL) is formed near an electron cyclotron resonance (ECR) point when an electron cyclotron wave is injected into an inhomogeneously magnetized plasma with high-speed ion flow. A charge separation is caused by an electron reflection due to -{mu}{nabla}B{sub z} force enhanced by ECR heating and ion inertia. It is clearly demonstrated in the experiment that the potential height of the DL is almost proportional to the field-aligned ion flow energy; the DL is found to be self-consistently formed for maintaining charge neutrality by reflecting a part of the flowing ions.

Takahashi, K.; Kaneko, T.; Hatakeyama, R. [Department of Electronic Engineering, Tohoku University, Sendai, 980-8579 (Japan)

2008-07-15T23:59:59.000Z

428

Jasperoid as a Guide to Mineralization in the Taylor Mining District and Vicinity near Ely, Nevada  

Science Journals Connector (OSTI)

...Formation DIc, m, c DIb, m m r b Dla, me'm e 'a Simon on Dolomite...Chemicalanalysesweremadefor silver, gold,mercury,andtellurium;silverwasdetermined...000 10 30 30 20 2 Mercury 380 5.2 3.2 0.4 0.07...tionsof silver,gold,copper,mercury,lead,antimony, and zinc...

T. G. Lovering; A. V. Heyl

429

Siliceous Microfossils from the Lower Cambrian of Northwest Canada: Possible Source for Biogenic Chert  

Science Journals Connector (OSTI)

...downward into dolo-mitic sandstones and shales that in turn grade downward into maroon shales and glacial mixtites of the lower Upper Tin-dir...plate is com-posed ofa single crystal ofan anisotropic mineral with moderate to low relief. Al-though...

CAROL WAGNER ALLISON

1981-01-02T23:59:59.000Z

430

1-6 Figure 1.3. View of the field area, looking south-southwest. Left side of the picture shows the  

E-Print Network (OSTI)

Mountain massif. The Vermont Valley and the Tinmouth Valley are separated by a ridge along a fault (Pine of the Taconic Allochthon, with Dorset Mountains truncating the Valley. The base of Dorset Mountain contains. It is a gray weathering, medium bedded dolomite. (looking west) #12;#12;#12;#12;#12;#12;2-27 Figure 2

Kidd, William S. F.

431

The Investigation on Fibrous Veins and Their Host from Mt. Ida, Ouachita Mountains, Arkansas  

E-Print Network (OSTI)

I have studied syntectonic veins from shales and coarse calcareous sands of the Ordovician Womble Shale, Benton uplift, Arkansas. All veins are composed of calcite with minor quartz and trace feldspar and dolomite or high-Mg calcite in the coarser...

Chung, Jae Won

2004-09-30T23:59:59.000Z

432

Optimization of a CO2 flood design Wesson Field - west Texas  

E-Print Network (OSTI)

The Denver Unit of Wasson Field, located in Gaines and Yoakum Counties in west Texas, produces oil from the San Andres dolomite at a depth of 5,000 ft. Wasson Field is part of the Permian Basin and is one of the largest petroleum-producing basins...

Garcia Quijada, Marylena

2006-10-30T23:59:59.000Z

433

Tar Reduction by Primary Measures in an Autothermal Air-Blown Fluidized Bed Biomass Gasifier  

Science Journals Connector (OSTI)

mean size (?m) ... When some calcined dolomite (CaO·MgO) is used in the bed of a biomass gasifier of fluidized bed type the raw gas produced is cleaner than when only silica sand is used in it as fluidizing medium. ...

Manuel Campoy; Alberto Go?mez-Barea; Diego Fuentes-Cano; Pedro Ollero

2010-10-01T23:59:59.000Z

434

Ground vibration measurements for Fermilab future collider projects  

Science Journals Connector (OSTI)

This article presents results of wideband seismic measurements at the Fermilab site, namely, in the tunnel of the Tevatron and on the surface nearby, as well as in two deep tunnels in the Illinois dolomite, thought to be a possible geological environment of the Fermilab future accelerators.

B. Baklakov; T. Bolshakov; A. Chupyra; A. Erokhin; P. Lebedev; V. Parkhomchuk; Sh. Singatulin; J. Lach; V. Shiltsev

1998-07-13T23:59:59.000Z

435

Goldschmidt 2012 Conference Abstracts  

Science Journals Connector (OSTI)

...the chemical weathering rates and CO2 comsumption fluxes in the soil zones. The dissolution...Biomass Tars with Dolomites. Energy & Fuels, Volume 23, Issue 4, Pages 2264-2272...Geneva, Switzerland. 3 Swedish Nuclear Fuel and Waste Management Co, Blekholmstorget...

436

Fossil evidence of Archaean life  

Science Journals Connector (OSTI)

...2560Myr, Ghaap Plateau Dolomite (Lime Acres Member), Campbell Group...101130598 . Brasier, M.D , Green, O.R, Jephcoat, A.P...416076a . Brasier, M.D , Green, O.R, Lindsay, J.F...evaporite-derived boron. Contrib. Mineral. Petrol. 107, 387-402...

2006-01-01T23:59:59.000Z

437

PREFERRED ORIENTATION OF QUARTZ IN A CHERT BRECCIA  

Science Journals Connector (OSTI)

...Preferred orientation of minerals hitherto has been studied...phosphorite, chalk, marl, lime- stone, and dolomite...fabrics ob- tained by H. Green in artificial deformation...Christie, H. W. Green, D. T. Griggs, W...manuscript. H. W. Green kindly let us use some...

Hans-Rudolf Wenk; Yehoshua Kolodny

1968-01-01T23:59:59.000Z

438

GEOCHEMICAL ASPECTS OF ATMOSPHERIC EVOLUTION  

Science Journals Connector (OSTI)

...red-beds and continental grey-green beds are often demonstrably...formations are at least in the green schist facies of metamorphism...stratified dolomites are replaced lime- stones, formed under a variety...Proterozoic strata is due to the mineral being of postlithification metasomatic...

Charles F. Davidson

1965-01-01T23:59:59.000Z

439

Meetings and Societies  

Science Journals Connector (OSTI)

...Fair-bridge; Dolomite in the Florena Shale of Kansas, John Imbrie, Columbia Uni-versity...ders of the heavens. Based on STATIC ELECTRICITY slame principles as world's giant telescopes...selection of lenses, prismss surples optical electricity, storeitin the Leyden jar type condenser...

1956-11-23T23:59:59.000Z

440

Computed 3D visualisation of an extinct cephalopod using computer tomographs  

Science Journals Connector (OSTI)

The first 3D visualisation of a heteromorph cephalopod species from the Southern Alps (Dolomites, northern Italy) is presented. Computed tomography, palaeontological data and 3D reconstructions were included in the production of a movie, which shows ... Keywords: 3D visualisation, Cephalopods, Computer tomography, Cretaceous, Palaeontology

Alexander Lukeneder

2012-08-01T23:59:59.000Z

Note: This page contains sample records for the topic "dl dolomitic limestone" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


441

A whole-forest 14C pulse-label study of microbial dynamics and root turnover (EBIS*)  

E-Print Network (OSTI)

BIOMASS 14C Trees near the incinerator (enriched sites, Western OR in Figure 2) were more labeled with 14C weathered dolomite. METHODS Microbial Biomass. To isolate microbial biomass carbon from soil, we fumigated to be microbial. The extracts were freeze-dried prior to combustion for graphitization. Soils collected in 2002

442

A spatial agent-based model for assessing strategies of adaptation to climate and tourism demand changes in an alpine tourism destination  

Science Journals Connector (OSTI)

A vast body of literature suggests that the European Alpine Region is amongst the most sensitive socio-ecosystems to climate change impacts. Our model represents the winter tourism socio-ecosystem of Auronzo di Cadore, located in the Dolomites (Italy), ... Keywords: Adaptation strategies, Alpine tourism, Climate change, Social simulation, Spatial agent-based model

Stefano Balbi; Carlo Giupponi; Pascal Perez; Marco Alberti

2013-07-01T23:59:59.000Z

443

Removing of Formation Damage and Enhancement of Formation Productivity Using Environmentally Friendly Chemicals  

E-Print Network (OSTI)

(GLDA) a newly developed environmentally friendly chelate was examined as stand-alone stimulation fluid in deep oil and gas wells. In this study we used GLDA to stimulate carbonate cores (calcite and dolomite). GLDA was also used to stimulate and remove...

Mahmoud, Mohamed Ahmed Nasr Eldin

2012-07-16T23:59:59.000Z

444

Secondary recovery from a stromatoporoid buildup: Devonian Duperow Formation, Ridgelawn field, Montana  

SciTech Connect

Ridgelawn field is located in Richland County, Montana, in the western part of the Williston basin. It is a multiple-pay field, with production from ordovician, Devonian, and Mississippian carbonates. Discovered in 1980, the field was recently unitized in the Devonian Duperow Formation for purposes of secondary recovery by waterflood. In this part of the Williston, the Duperow consists of a repetitive succession of shoaling-upward carbonate cycles, each deposited under increasingly restricted conditions on a shallow marine shelf. Production at Ridgelaw occurs from dolomites within one of these cycles, cycle IIIa. Three separate, laterally continuous porosity zones (here termed a, b, and c, from lowest to highest) are recognized and mapped individually in the field. The reservoir has a lensoidal geometry; porous dolomite thins and grades laterally into tight carbonate. The Duperow pool at Ridgelawn is a solution gas drive reservoir. Computer log analysis of the Duperow pay interval indicates an average true porosity of 11.8% and an average initial water saturation of 17.7%. Net pay, defined as greater than 5% crossplot porosity, averages 16.6 ft across the field. Petrographic analysis and log calibration suggests that different facies in each of the three porosity zones were preferentially dolomitized to create reservoir-quality rock; each is now a sucrosic dolomite with intercrystalline porosity. Porosity can be occluded (most often in the upper two zones b and c) by both calcite and anhydrite cements. The lowermost zone, a, is related to a stromatoporoid/coralline bank, and has excellent but highly variable porosity and permeability. The two upper zones, b and c, are more finely crystalline dolomite and represent shallower water depositional facies. Maps for each zone, including porosity, porosity-feet, net pay, and water saturation were constructed and used for equity determination in the unit.

Little, L.D. (Conoco Inc., Casper, WY (USA))

1990-05-01T23:59:59.000Z

445

Voxel-based T2 relaxation rate measurements in temporal lobe epilepsy (TLE) with and without mesial temporal sclerosis  

E-Print Network (OSTI)

Voxel-based T2 Relaxation Rate Measurements in Temporal LobeD, Pike BG, Arnold DL. T2 relaxometry can lateralize mesialC, Grucker D. Contribution of T2 relaxation time mapping in

Mueller, S G; Laxer, K D; Schuff, N; Weiner, Michael W

2007-01-01T23:59:59.000Z

446

Enzymes of the shikimic acid pathway encoded in the genome of a basal metazoan, Nematostella vectensis, have microbial origins  

Science Journals Connector (OSTI)

...VDQHIKGLQAMGAEVRVEHGYVQAQVPRLKGARLFTDMVTVTGTENLMMAACLAQGETVI 182 Query 181 ENAAMEAEIDDLVCMLRKMGAQIDKNRDTKTWFITGVSSLHGADHGVVPDRIVAGTYAVA 240 ENAA E E+ DL L MGAQI T I GV +LHGA H ++PDRI GTY A Sbjct 183 ENAAREPEVVDLANCLVAMGAQI-SGAGTDVIRIRGVDALHGATHRIMPDRIETGTYLCA 241 Query 241 AVMTGGELTLT-LGPCPVPALMGCVLTCLRAAGAEVMELAEGIRVRGGRRPRSVSITTSP...

Antonio Starcevic; Shamima Akthar; Walter C. Dunlap; J. Malcolm Shick; Daslav Hranueli; John Cullum; Paul F. Long

2008-01-01T23:59:59.000Z

447

An empirical evaluation of live cattle futures and options for short hedging slaughter cattle in the Texas Panhandle  

E-Print Network (OSTI)

were able to derive the model: W(X, T) = XN(dl) ? Ce N(d2), ln X/C + (R + I/2V )(T) (10) dl = v Tl/2 sTI/2 2 1 where W(X, T) is the premium for a call stock option with an exercise 20 price of C and time T until expiration, the underlying stock... the necessary modifications, Black derived the commod- ity contract pricing model: CP(Z T) e [ZN(dl) CN(d2) ] X S (12) dl = [ln ? + ? (T)]ST C 2 d d uTI/2 2 1 This formula is identical to the Black-Scholes model if Ze is substi- tuted for X everywhere...

Winder, Jim R.

2012-06-07T23:59:59.000Z

448

ACM Reference Format Wei, X., Zhang, P., Chai, J. 2012. Accurate Realtime Full-body Motion Capture Using a Single Depth Cam-  

E-Print Network (OSTI)

-based animation, human motion tracking, 3D pose detection, vision-based motion modeling Links: DL PDF e-mail: xwei parallel and is therefore easily implemented on a GPU. We demonstrate the power of our approach

Chai, Jinxiang

449

Download Full-text PDF  

Science Journals Connector (OSTI)

types of sedimentary environments in the southern and eastern North Sea in August 1991 and ..... fusion (D,) coefficients (both in units of m2 d-l), the sedi-.

450

Communications mensuelles de l'lnstitut International dela Potasse, Berne (Suisse) Science du sol N 5/1981  

E-Print Network (OSTI)

sciences vc!igc!itales, Universitc!i de Delaware, Newark, Delaware 19711, USA Resume condense des publications suivantes: Sparks D.L., Martens D.C., Zelazny L. W.: Plant Uptake and Leaching of applied

Sparks, Donald L.

451

LCLS CDR Chapter 11 - Controls  

NLE Websites -- All DOE Office Websites (Extended Search)

will be EPICS-based. These systems include: (1) The LCLS Injector systems, such as, the gun, the gun laser, the injector linac and the DL1 beamline. (2) The undulator segments,...

452

E-Print Network 3.0 - anemia status hemoglobin Sample Search...  

NLE Websites -- All DOE Office Websites (Extended Search)

Sargent, MD Summary: dL after adjustments for children's age, hemoglobin level, and insurance status (12). The second, a study... Test children at risk for anemia (e.g., those...

453

The Personalized, Collaborative Digital Library Environment CYCLADES and Its Collections Management  

Science Journals Connector (OSTI)

Usually, a Digital Library (DL) is an information resource where ... additionally as a personalized collaborative working and meeting space of people sharing common interests, where users...i may organize the inf...

Leonardo Candela; Umberto Straccia

2004-01-01T23:59:59.000Z

454

Effects of Physical Activity and Restricted Energy Intake on Chemically Induced Mammary Carcinogenesis  

Science Journals Connector (OSTI)

...induces a greater flux of energy through the system that could...stress, whereas restricted energy intake (RE) reduces oxidative...maltodextrin, cornstarch, corn oil, cellulose, minerals...and dl-methionine. The energy distribution was protein (20...

Weiqin Jiang; Zongjian Zhu; and Henry J. Thompson

2009-04-01T23:59:59.000Z

455

Sources of CAM3 temperature bias during northern winter from diagnostic study of the temperature bias equation  

E-Print Network (OSTI)

References Boville BA, Rasch PJ, Hack JJ, McCaa JR (2006)WD, Rasch PJ, Boville BA, Hack JJ, McCaa JR, Williamson DL,602. doi:10.1002/joc.1423 Hack JJ, Kiehl JT, Hurrell JW (

Pan, Lin-Lin; Grotjahn, Richard; Tribbia, Joe

2010-01-01T23:59:59.000Z

456

1  

NLE Websites -- All DOE Office Websites (Extended Search)

Spectroscopy and Radiative Transfer 91:233-244. Collins, WD, PJ Rasch, BA Boville, JJ Hack, JR McCaa, DL Williamson, BP Briegleb, CM Bitz, S-J Lin, and M Zhang 2006. "The...

457

1  

NLE Websites -- All DOE Office Websites (Extended Search)

absorption of radiation." Contributions to Atmospheric Physics, 52, 1-16. Kiehl, JT, JJ Hack, GB Bonan, BA Boville, BP Briegleb, DL Williamson, and PJ Rasch. 1996. Description of...

458

Effectiveness of Employing Multimedia Principles in The Design of Computer-Based Math Tutorials for Students with Learning Disabilities  

E-Print Network (OSTI)

DL). The animated tutorial prototype, which was studied as part of this project, was for young children. The study evaluated a prototype of online instructional tutorial in mathematics designed for students with disabilities. The tutorial prototype was instructional...

Kanitkar, Anjali Shridhar

2010-04-28T23:59:59.000Z

459

EROSION-CORROSION-WEAR PROGRAM  

E-Print Network (OSTI)

MD, Oct. 1979. dl. Oil Shale Retort Components" A. Levy andCorrosion of Metals in Oil Shale Retorts,'' AS! v! WESTEC 'of metals in coal and oil shale conver- sion environments

Levy, Alan V.

2013-01-01T23:59:59.000Z

460

October 1992 ISOLATOR-10  

E-Print Network (OSTI)

Suggested Reading Material A-1 CIRCUIT DIAGRAMS B-1 WARRANTY C-1 WARNING D-l RETURN MERCHANDISE be handled at all times with caution. ISOLATOR-10, COPYRIGHT OCTOBER 1992, AXON INSTRUMENTS, INC. #12;Page V

Kleinfeld, David

Note: This page contains sample records for the topic "dl dolomitic limestone" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


461

EROSION-CORROSION-WEAR PROGRAM  

E-Print Network (OSTI)

will also be conducted in shale oil product material. 1979MD, Oct. 1979. dl. Oil Shale Retort Components" A. Levy andof metals in coal and oil shale conver- sion environments

Levy, Alan V.

2013-01-01T23:59:59.000Z

462

Manufacturability Study and Scale-Up for Large Format Lithium...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

contributions out of over 40 in FY1314 * Selected publications 1. J. Li, B.L. Armstrong, J. Kiggans, C. Daniel, and D.L. Wood, "Lithium Ion Cell Performance Enhancement...

463

[)r PAR1 rMF.Nr o Dr (.FIrMr( A .IF]CNC)I,OGIi,  

E-Print Network (OSTI)

[)r PAR1 rMF.Nr o Dr (.FIrMr( A E .IF]CNC)I,OGIi, f)Ă?]I I-ARMACo @ ;^.*r.l-EN,.m BANDO Dl SELEZIONE

Guidoni, Leonardo

464

Sustained fecundity when phytoplankton resources are in short supply  

Science Journals Connector (OSTI)

rates of egg production (1 l-45 eggs female 1 d-l) in the open waters of the Gulf of St. Lawrence in late. June-early July. These rates were comparable to egg ...

1999-12-19T23:59:59.000Z

465

Science in support of the Deepwater Horizon response  

Science Journals Connector (OSTI)

...are total discharge: oil plus liquid natural gas. The total discharge (oil + liquid...science and views. Protecting intellectual capital is also important. However, some scientists...48 Redmond MC Valentine DL ( 2012 ) Natural gas and temperature structured...

Jane Lubchenco; Marcia K. McNutt; Gabrielle Dreyfus; Steven A. Murawski; David M. Kennedy; Paul T. Anastas; Steven Chu; Tom Hunter

2012-01-01T23:59:59.000Z

466

Structure of the rare archaeal biosphere and seasonal dynamics of active ecotypes in surface coastal waters  

Science Journals Connector (OSTI)

...Heidelberg JF Kirchman DL ( 2011 ) Activity of abundant and rare bacteria in a coastal ocean . Proc Natl Acad Sci USA 108 : 12776 – 12781 . 5 Lennon JT Jones SE ( 2011 ) Microbial seed banks: The ecological and evolutionary implications of dormancy...

Mylène Hugoni; Najwa Taib; Didier Debroas; Isabelle Domaizon; Isabelle Jouan Dufournel; Gisèle Bronner; Ian Salter; Hélène Agogué; Isabelle Mary; Pierre E. Galand

2013-01-01T23:59:59.000Z

467

Single bacterial strain capable of significant contribution to carbon cycling in the surface ocean  

Science Journals Connector (OSTI)

...Heidelberg JF Kirchman DL ( 2011 ) Activity of abundant and rare bacteria in a coastal ocean . Proc Natl Acad Sci USA 108 ( 31 ): 12776 – 12781 . 52 Hunt DE ( 2013 ) Relationship between abundance and specific activity of bacterioplankton in open ocean surface...

Byron E. Pedler; Lihini I. Aluwihare; Farooq Azam

2014-01-01T23:59:59.000Z

468

Licensing stop place before laterals : a study of acoustic cues relevant to the perception of stop-lateral sequences  

E-Print Network (OSTI)

In phonological analyses of both adult and child language, a *dl constraint has frequently been used as a shorthand to indicate that coronal stops are dispreferred before laterals (Dinnsen et al. 2001). This dispreference ...

Michaels, Jennifer M. (Jennifer Marie)

2011-01-01T23:59:59.000Z

469

E-Print Network 3.0 - arterial blood gas Sample Search Results  

NLE Websites -- All DOE Office Websites (Extended Search)

54 ml CO2 dL blood The total CO2 content of blood in any systemic artery 49 ml CO2 d... of gas exchange with environment Difference in blood respiratory gas after...

470

A Unique Set of 11,008 Onion Expressed Sequence Tags Reveals Expressed Sequence and Genomic Differences between the Monocot Orders Asparagales and Poales  

Science Journals Connector (OSTI)

...Applied Biosystems, Foster City, CA). Analyses...the Entrez retrieval system to specify plant sequences...Food and Agricultural Systems Grant 2001-04434...Ostell, J., and Wheeler, D.L. (2003...Monocotyledons: A Comparative Study. (London: Academic...

Joseph C. Kuhl; Foo Cheung; Qiaoping Yuan; William Martin; Yayeh Zewdie; John McCallum; Andrew Catanach; Paul Rutherford; Kenneth C. Sink; Maria Jenderek; James P. Prince; Christopher D. Town; Michael J. Havey

2003-12-11T23:59:59.000Z

471

Reciprocal feeding facilitation between above- and below-ground herbivores  

Science Journals Connector (OSTI)

...potential mechanisms are induction of ethylene or abscisic acid in leaves by root...153-170. Wallingford, UK: CABI. 4 Price, PW , RF Denno, MD Eubanks, DL...Bhattarai, and I Kaloshian. 2009 Ethylene contributes to potato aphid susceptability...

2013-01-01T23:59:59.000Z

472

Improvement of epidemiological data analysis by unbiased estimates of log-normal dose distribution  

Science Journals Connector (OSTI)

The effects of radiation on population and risk assessment are studied through epidemiological studies that are heavily dependent on dose distribution. Radiation doses to individual workers follow a log-normal distribution. Computation of the collective dose with the minimum detectable values (Detection Limit or DL) as zero is biased. Hence the expectation value of the 'missed' doses is computed as the ratio of the collective dose of all dosimeters with DL to the product of the total number of dosimeters. So far, in all epidemiological studies, doses below DL are set equal to the DL itself and yield a positive bias in the dose-response relation. This paper presents an enhanced method by removing the bias with the help of the Expectation Maximisation (EM) algorithm. This algorithm, along with unbiased characteristic estimates of log-normal distribution, significantly improves the estimation of confounders by 95%, and improves the dose-response relationship.

Joyeeta Mukhopadhyaya; D. Datta; H.S. Kushwaha

2007-01-01T23:59:59.000Z

473

2007/08/1747  

E-Print Network (OSTI)

[6] Ian Porteous. Topological ... as a subgroup of U(n) decomposes into irreducible representations R1,...,Rl of dimensions d1,...,dl and with multiplicities m1,...,ml ...

2008-10-06T23:59:59.000Z

474

RFP_WhitePaper_v4  

NLE Websites -- All DOE Office Websites (Extended Search)

White paper for 2014 FESAC Strategic Planning Aug. 2014 1 Opportunities and Context for Reversed Field Pinch Research J.S. Sarff 1 , A.F. Almagri, J.K. Anderson, D.L. Brower, B.E....

475

viennaking.PDF  

NLE Websites -- All DOE Office Websites (Extended Search)

IMPROVED ACCURACY FOR LOW-COST SOLAR IRRADIANCE SENSORS D.L. King, W.E. Boyson, B.R. Hansen, and W.I. Bower, Sandia National Laboratories Presented at the 2 nd World Conference and...

476

Rate-limiting Factors in Glycolysis and Transport of Inorganic Phosphate in DBAH1 Tumor, DBAG Tumor, Novikoff Hepatoma, and Novikoff Ascites Tumor  

Science Journals Connector (OSTI)

...are in SI units. The conversion factor for glucose is mg/dl...High-risk lifestyle factors may lead to insulin resistance...circulating levels of energy substrates, insulin, and insulin-like growth factor-1, may promote the...

Ray Wu; Helen Power; and David Hamerman

1965-11-01T23:59:59.000Z

477

Enhanced killing of pancreatic cancer cells by expression of fusogenic membrane glycoproteins in combination with chemotherapy  

Science Journals Connector (OSTI)

...and Medical Virology, Institute of Microbiology and Hygiene, Ruhr-University Bochum...Freytag SO, Rogulski KR, Paielli DL, Gilbert JD, Kim JH. A novel three-pronged...and Medical Virology, Institute of Microbiology and Hygiene, Ruhr-University Bochum...

Dennis Hoffmann and Oliver Wildner

2006-08-01T23:59:59.000Z

478

LU Surface Chemistry 17 STM of (2222)R45-Ti5O8/Pt(100)  

E-Print Network (OSTI)

absorption with an evacuated FTIR spectrometer. RMS signal to noise ratios of over a million to one have been.bath.ac.uk/~chsacf/solartron/electro/html/dl.htm #12;LU Surface Chemistry 32 Exemplary Electrochemical Problems Requ

Gilchrist, James F.

479

Mycorrhizal fungi in roots of Texas crops  

E-Print Network (OSTI)

~h, 1 f d ' d with peanuts grown at Stephenville, Texas. In watermelon material, five different kinds of mycorrhiza1 ~ p ly d, ' 1 d' S h* G~ p G~t 11 'd, G. ~l d G. ~h, d p ' f S~ltt, S. Slf 1 d S. ~tfd . 1'h ~dl ' p 1 *1 f d ' h ll p t ~dl... ~h, 1 f d ' d with peanuts grown at Stephenville, Texas. In watermelon material, five different kinds of mycorrhiza1 ~ p ly d, ' 1 d' S h* G~ p G~t 11 'd, G. ~l d G. ~h, d p ' f S~ltt, S. Slf 1 d S. ~tfd . 1'h ~dl ' p 1 *1 f d ' h ll p t ~dl...

Yeh, May-Wei Mavix

2012-06-07T23:59:59.000Z

480

Modeling of Energy Production Decisions: An Alaska Oil Case Study  

E-Print Network (OSTI)

and Weimer, D.L. (1984) Oil prices shock, market response,OPEC behavior and world oil prices (pp. 175-185) London:many decades. Recent high oil prices have caused oil-holding

Leighty, Wayne

2008-01-01T23:59:59.000Z

Note: This page contains sample records for the topic "dl dolomitic limestone" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


481

Bilevel Direct Search Method for Leader-Follower Equilibrium ...  

E-Print Network (OSTI)

electricity markets [42, 46, 16], Nash equilibrium model in transportation [27] and signal trans- mission in wireless ...... Private market share (DH,DL). (0.62, 0.41) ...

2012-02-12T23:59:59.000Z

482

The Very Large Telescope Interferometer: an update Pierre Haguenauer*a  

E-Print Network (OSTI)

, Casilla 19001, Santiago, Chile; b European Southern Observatory, Karl-Schwarzschild-Str. 2, 85748 Garching long tunnel. A system of movable mirrors allows sending the light from each DL to any of the sixteen

Liske, Jochen

483

E-Print Network 3.0 - area electron beam Sample Search Results  

NLE Websites -- All DOE Office Websites (Extended Search)

D.L. Summary: , Ann Arbor, MI 48109, USA Abstract We have used electron and photon beams from the 50 MV electron... the magnetic confinement of HE electron and photon...

484

Composition of Dioxin-like PCBs in Fish: An Application for Risk  

E-Print Network (OSTI)

Composition of Dioxin-like PCBs in Fish: An Application for Risk Assessment S A T Y E N D R A P . B in Aroclors and that toxicity varies considerably among the congeners with dioxin-like PCBs (dl

Jackson, Don

485

Carbohydrate-like composition of submicron atmospheric particles and their production from ocean bubble bursting  

Science Journals Connector (OSTI)

...much of the International Chemistry...trajectories and radon concentrations...campaign, with project averages...these two projects, two coastal [International Consortium...0.91) Radon (mBq m-3...the ICEALOT project. "<DL...

Lynn M. Russell; Lelia N. Hawkins; Amanda A. Frossard; Patricia K. Quinn; Tim S. Bates

2010-01-01T23:59:59.000Z

486

Modern Methods of Monosaccharide Synthesis from Non-Carbohydrate Tomas Hudlicky,* David A. Entwistle, Kevin K. Pitzer, and Andrew J. Thorpe  

E-Print Network (OSTI)

and Tafel to consist of a mixture of carbo- hydrates, two of which were identified as DL-arabino- hexulose, and propagation. Figure 1. Fischer and Tafel's synthesis of nonracemic sugars from formose. Figure 2. The first

Hudlicky, Tomas

487

KRAGER, CLINTON D., AND SARAH ANN WOODIN. Spatial ...  

Science Journals Connector (OSTI)

Exposure times for all quadrats ranged from 6 to 9 h d-l ... quadrats were started on 25 June and ended ...... morphology of the alimentary tract, food and feeding.

1999-12-22T23:59:59.000Z

488

ILDS  

Energy Science and Technology Software Center (OSTI)

003176IBMPC00 Intelligent Leak Detection System  https://www.dropbox.com/sh/aycss2bffzmur10/AAAJvqH8IKmrA93kngsAy45qa?dl=0 

489

EFFECT OF NITROGEN OXIDE PRETREATMENTS ON ENZYMATIC HYDROLYSIS OF CELLULOSE  

E-Print Network (OSTI)

Jerusalem, loR. Parkinson, Tappi, Meller, Holzforschung,L.L. Schaleger and D.L. Brink, Tappi, No.4, 65 ( 1978). N.I.Holocellulose in Wood," Tappi Standard T9 m-54. C.R.

Borrevik, R.K.

2011-01-01T23:59:59.000Z

490

Potassium-Calcium Exchange in a Multireactive Soil System: II. Thermodynamics1 P. M. JARDINE ANDD. L. SPARKS2  

E-Print Network (OSTI)

ions and sup- ports the hypothesis of the multireactive natureof the soil. Although K was selectively energy of ex- change, enthalpy of exchange, entropy of exchange. Jardine, P.M., and D.L. Sparks. 1984

Sparks, Donald L.

491

Memory, brain and aging: The good, the bad and the promising  

E-Print Network (OSTI)

temporal region — endur- ing memory impairment following aE. 1994. What are the memory systems of 1994? In: SchacterDL, Tulving E (eds. ). Memory Systems 1994. Cambridge, MA:

Ober, Beth A.

2010-01-01T23:59:59.000Z

492

HUTCHINS, DA, GR DITULLIO, Y. ZHANG, AND KW BRULAND. An ...  

Science Journals Connector (OSTI)

organic Fe was added as a 26 ”M stock in 0.01 N Ultrex .... Results. In keeping with the large heterogeneity in Fe supplies along the ..... expressed in units of d-l.

493

Borehole geophysics evaluation of the Raft River geothermal reservoir...  

Open Energy Info (EERE)

GEOTHERMAL SYSTEMS; HYDROTHERMAL SYSTEMS; NORTH AMERICA; PACIFIC NORTHWEST REGION; USA Authors Applegate, J.K.; Donaldson, P.R.; Hinkley, D.L.; Wallace and T.L. Published...

494

A DNA Nanostructure Platform for Directed Assembly of Synthetic Vaccines  

Science Journals Connector (OSTI)

A DNA Nanostructure Platform for Directed Assembly of Synthetic Vaccines ... Here we report the design and synthesis of a 1,669-nucleotide, single-stranded DNA mol. ... These DL-DNAs induced greater amts. of tumor necrosis factor-? and interleukin-6 from RAW264.7 macrophage-like cells than did a mixt. of Y-DNA with the same sequences as the corresponding DL-DNA. ...

Xiaowei Liu; Yang Xu; Tao Yu; Craig Clifford; Yan Liu; Hao Yan; Yung Chang

2012-07-03T23:59:59.000Z

495

Shock-induced hyperalgesia: the role of the gaba and glutamate systems of the dorsolateral periaqueductal gray  

E-Print Network (OSTI)

sensitization bears similarities to the sensitization of acoustic startle. Both forms of sensitization can be induced by moderate shock and have a similar time course (approximately 30 min; Illich et al. , 1995). Recent This thesis follows the format... of the Journal of Neuroscience. evidence has implicated the dorsolateral PAG (dlPAG) in both forms of environmentally-induced sensitization. Lesions of the dlPAG eliminate shock- induced sensitization of acoustic startle, shock-induced hyperalgesia...

Sieve, Amy Nicole

2012-06-07T23:59:59.000Z

496

Final_Tech_Session_Schedule_and_Location.xls  

NLE Websites -- All DOE Office Websites (Extended Search)

in-Water Emulsion Stabilized by Pulverized Limestone for Benign in-Water Emulsion Stabilized by Pulverized Limestone for Benign Ocean Storage D. Golomb, * E. Barry, D. Ryan, C. Lawton, P. Swett University of Massachusetts Lowell R. Warzinski, R. Lynn US Department of Energy, National Energy Technology Laboratory Abstract When ordinary seawater and liquid carbon dioxide are mixed in the presence of pulverized limestone (CaCO 3 ), a macro-emulsion is formed. The emulsion consists of liquid CO 2 droplets sheathed with a monolayer of calcite crystals dispersed in water. The sheath of crystals prevents the coalescence of the CO 2 droplets. The emulsion has a gross density that is greater than seawater, therefore upon release from a pipe the emulsion plume will sink deeper into the density-stratified ocean while entraining ambient

497

NETL: Oil & Natural Gas Projects  

NLE Websites -- All DOE Office Websites (Extended Search)

The Mississippi Leadville Limestone Exploration Play of Utah and Colorado-Exploration Techniques and Studies for Independents The Mississippi Leadville Limestone Exploration Play of Utah and Colorado-Exploration Techniques and Studies for Independents DE-FC26-03NT15424 Project Goal The overall goals of this study are to 1) develop and demonstrate techniques and exploration methods never tried on the Leadville Limestone; 2) target areas for exploration; 3) increase deliverability from new and old Leadville fields through detailed reservoir characterization; 4) reduce exploration costs and risk, especially in environmentally sensitive areas; and 5) add new oil discoveries and reserves. The project is being conducted in two phases, each with specific objectives. The objective of Phase 1 (Budget Period I) is to conduct a case study of the Leadville reservoir at Lisbon field (the largest Leadville producer) in San Juan County, UT, in order understand the reservoir characteristics and facies that can be applied regionally.

498

Electric utility engineer`s FGD manual -- Volume 1: FGD process design. Final report  

SciTech Connect

Part 1 of the Electric Utility Engineer`s Flue Gas Desulfurization (FGD) Manual emphasizes the chemical and physical processes that form the basis for design and operation of lime- and limestone-based FGD systems applied to coal- or oil-fired steam electric generating stations. The objectives of Part 1 are: to provide a description of the chemical and physical design basis for lime- and limestone-based wet FGD systems; to identify and discuss the various process design parameters and process options that must be considered in developing a specification for a new FGD system; and to provide utility engineers with process knowledge useful for operating and optimizing a lime- or limestone-based wet FGD system.

NONE

1996-03-04T23:59:59.000Z

499

Lithostratigraphy and environmental considerations of Cenomanian-Early Turonian shelf carbonates (Rumaila and Mishrif Formations) of Mesopotamian basin, middle and southern Iraq  

SciTech Connect

Rumaila and Mishrif Formations form the major part of the Cenomanian early Turonian deposits of middle and southern Iraq. The Rumaila Formation consists of lithographic chalky limestone at the lower part and marly limestone and marl at the upper part. The formation represents deep off-shelf deposits, whereas the overlying Mishrif Formation is composed of various types of shallow-shelf carbonates such as rudist-bearing patchy reefs and lagoonal and off-shelf limestones. An environmental model is suggested to delineate the stratigraphic relationships between the above mentioned two formations and to correlate them with their equivalents in central Iraq (i.e., Mahilban, Fahad, and Maotsi Formations). The gradational contact between the two formations and the intertonguing with their equivalents are considered to be the most important stratigraphic phenomena.

Sherwani, G.H.M.; Aqrawi, A.A.M.

1987-05-01T23:59:59.000Z

500

Geology of the Voca-North area, McCulloch County, Texas  

E-Print Network (OSTI)

Peak Shale IIember. The nomenclature at the present time is Welge Sandstone, Morgan Creek Limestone, Point Peak and San Saba membered' in ascending order. The Wilberns Formation ranges from 540 feet in McCulloch County to 619 feet along the James... Peak Shale IIember. The nomenclature at the present time is Welge Sandstone, Morgan Creek Limestone, Point Peak and San Saba membered' in ascending order. The Wilberns Formation ranges from 540 feet in McCulloch County to 619 feet along the James...

Sealy, Brian Edmund

2012-06-07T23:59:59.000Z