Powered by Deep Web Technologies
Note: This page contains sample records for the topic "dl deltak ds" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


1

Deltak LLC | Open Energy Information  

Open Energy Info (EERE)

Deltak LLC Deltak LLC Jump to: navigation, search Name Deltak LLC Place Minneapolis, Minnesota Zip 55441 Product Supplier of custom designed heat recovery steam generators (HRSGs) for gas turbine combined-cycle power generation and specialty boilers for waste heat recovery applications Coordinates 44.979035°, -93.264929° Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"ROADMAP","zoom":14,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"350px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":44.979035,"lon":-93.264929,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}

2

DL-36361 UC-414 I  

NLE Websites -- All DOE Office Websites (Extended Search)

DL-36361 DL-36361 UC-414 I * Discovery of the Most Distant Supernovae and the Quest for L l Gerson Goldhaber and Saul Perlmutter Lawrence Berkeley Laboratory and Center for Particle Astrophysics University of California, Berkeley, CA 94720 Silvia Gabi, Ariel Goobar, Alex Kim, Mathew Kim, and Reynald Pain Lawrence Berkeley Laboratory, University of California Berkeley, CA 94720 Carl Pennypacker and Ivan Small Lawrence Berkeley Laboratory and Space Sciences Laboratory University of California, Berkeley, CA 94720 Brian Boyle, Richard Ellis, and Richard McMahon Institute of Astronomy, Cambridge, United Kingdom and Peter Bunclarlc, Dave Carter, and Roberto Terlevich Royal Greenwich Observatory, Cambridge, United Kingdom May 1994 T h i s work w a s supported in part by the U.S. Department of Energy under Contract No. DE-AC03-76SF00098,

3

Comprehensive Four-Quark Interpretation of Ds(2317), Ds(2457), and Ds(2632)  

Science Journals Connector (OSTI)

The recently observed new member of the charm-strange family Ds(2632), which has a surprisingly narrow width, is challenging our theory. Ds(2317) and Ds(2457), which were observed earlier, have similar behaviors and receive various theoretical explanations. Some authors use the heavy hadron chiral effective theory to evaluate heavy-light quark systems and obtain a reasonable evaluation on the masses of Ds(2317) and Ds(2457). An alternative picture is to interpret them as four-quark or molecular states. In this work, we are following the latter and propose a unitive description for all three new members, Ds(2632), Ds(2317), and Ds(2457), and, at least, so far our picture is consistent with the data.

Yu-Qi Chen and Xue-Qian Li

2004-12-01T23:59:59.000Z

4

Measurements of B?Ds(+)X decays  

E-Print Network (OSTI)

. THE B?DS ?*?1D ?*? DECAY RATES In the dominant process leading to a two-body decay of the type B!Ds(*)1D (*), shown in Fig. 1, the Ds(*)1 is pro- duced from the fragmentation of the W1. The analogous b!u transitions lead to final states like Ds1p2...*5280 MeV, Vcb50.038, tB51.52 ps , and ua1u51.07 @14#, which was derived from B0!D (*)1p2/r2 decays. The CLEO II values are the values of Table VIII with all of the errors added in quadrature. Model Ds 1D Ds* 1D Ds 1D* Ds* 1D* BSW @19# 1.69 0.99 0...

Baringer, Philip S.

1996-05-01T23:59:59.000Z

5

SolarDS | Open Energy Information  

Open Energy Info (EERE)

SolarDS SolarDS Jump to: navigation, search Tool Summary LAUNCH TOOL Name: SolarDS Agency/Company /Organization: National Renewable Energy Laboratory Sector: Energy Focus Area: Solar Phase: Evaluate Options, Develop Goals, Prepare a Plan Topics: Market analysis, Pathways analysis, Resource assessment Resource Type: Guide/manual, Training materials, Software/modeling tools Website: www.nrel.gov/analysis/analysis_tools_tech_sol.html Web Application Link: www.nrel.gov/docs/fy10osti/45832.pdf Language: English References: SolarDS[1] Logo: SolarDS The Solar Deployment System (SolarDS) model evaluates the potential market penetration of solar photovoltaic (PV) technology. SolarDS examines the market competitiveness of Solar PV technologies from the building user's

6

Observation of the isospin-violating decay Ds(*+) -> Ds(+) pi(0)  

E-Print Network (OSTI)

Using data collected with the CLEO II detector, we have observed the isospin-violating decay D-s(*+) --> D-s(+) pi(0). The decay rate for this mode, relative to the dominant radiative decay, is found to be Gamma(D-s(*+) --> D-s(+) pi(0))/Gamma...

Ammar, Raymond G.; Baringer, Philip S.; Bean, Alice; Besson, David Zeke; Coppage, Don; Copty, N.; Davis, Robin E. P.; Hancock, N.; Kotov, S.; Kravchenko, I.; Kwak, Nowhan

1995-10-01T23:59:59.000Z

7

Observation of the Dalitz Decay $D_{s}^{*+} \\to D_{s}^{+} e^{+} e^{-}$  

E-Print Network (OSTI)

Using 586 $\\textrm{pb}^{-1}$ of $e^{+}e^{-}$ collision data acquired at $\\sqrt{s}=4.170$ GeV with the CLEO-c detector at the Cornell Electron Storage Ring, we report the first observation of $D_{s}^{*+} \\to D_{s}^{+} e^{+} e^{-}$ with a significance of $5.3 \\sigma$. The ratio of branching fractions $\\calB(D_{s}^{*+} \\to D_{s}^{+} e^{+} e^{-}) / \\calB(D_{s}^{*+} \\to D_{s}^{+} \\gamma)$ is measured to be $[ 0.72^{+0.15}_{-0.13} (\\textrm{stat}) \\pm 0.10 (\\textrm{syst})]%$, which is consistent with theoretical expectations.

D. Cronin-Hennessy; J. Hietala; S. Dobbs; Z. Metreveli; K. K. Seth; A. Tomaradze; T. Xiao; L. Martin; A. Powell; G. Wilkinson; H. Mendez; J. Y. Ge; D. H. Miller; I. P. J. Shipsey; B. Xin; G. S. Adams; D. Hu; B. Moziak; J. Napolitano; K. M. Ecklund; J. Insler; H. Muramatsu; C. S. Park; L. J. Pearson; E. H. Thorndike; S. Ricciardi; C. Thomas; M. Artuso; S. Blusk; R. Mountain; T. Skwarnicki; S. Stone; L. M. Zhang; G. Bonvicini; D. Cinabro; A. Lincoln; M. J. Smith; P. Zhou; J. Zhu; P. Naik; J. Rademacker; D. M. Asner; K. W. Edwards; K. Randrianarivony; G. Tatishvili; R. A. Briere; H. Vogel; P. U. E. Onyisi; J. L. Rosner; J. P. Alexander; D. G. Cassel; S. Das; R. Ehrlich; L. Gibbons; S. W. Gray; D. L. Hartill; B. K. Heltsley; D. L. Kreinick; V. E. Kuznetsov; J. R. Patterson; D. Peterson; D. Riley; A. Ryd; A. J. Sadoff; X. Shi; W. M. Sun; J. Yelton; P. Rubin; N. Lowrey; S. Mehrabyan; M. Selen; J. Wiss; J. Libby; M. Kornicer; R. E. Mitchell; M. R. Shepherd; C. M. Tarbert; D. Besson; T. K. Pedlar

2011-04-16T23:59:59.000Z

8

Lesson 05 - Working with Autodesk 3ds Max  

Science Journals Connector (OSTI)

If you have completed the first four lessons, you have worked with Autodesk 3ds Max from modeling and animation to materials and rendering. Now is a good time to review some of the user interface concepts that you have used and introduce some new tools in order to provide a more complete overview of how 3ds Max works.

Autodesk

2008-01-01T23:59:59.000Z

9

Note on Evaluation of AWG Port Utilization Probabilities dl(1, j), j = 1, D, D -1, and  

E-Print Network (OSTI)

1 Note on Evaluation of AWG Port Utilization Probabilities dl(1, j), j = 1, D, D - 1, and dl(1, 1, D - 1 In this appendix we evaluate dl(1, j) for j = 1, D, D-1, i.e., the output port j is not a direct neighbor of sender port D, and note that the dl(1, j) are the same for these AWG ports j. We

Reisslein, Martin

10

Aggregation of n-octanoyl-dl-cysteine in aqueous solvent systems  

E-Print Network (OSTI)

indicated the predominant sites of interaction of thymine with the micellar n-octanoyl-dl-cysteine. At the lower pH ranges of 6. 0 and 7. 5 thymine primarily interacts with protons close to the sulfhydryl group of the surfactant while at the higher p... concentration Deoxyribonucleic acid n-Octanoyl-dl-cysteine Tetrahydrofuran Nuclear magnetic resonance Surfactant concentration Observed chemical shift of surfactant Micellar chemical shift of surfactant Monomeric chemical shift of surfactant Monomeric...

Shelley, Ralph Ray

2012-06-07T23:59:59.000Z

11

2011 CLOuDS Campaign | Princeton Plasma Physics Lab  

NLE Websites -- All DOE Office Websites (Extended Search)

CLOuDS Campaign (photo credits: NASA Johnson Space Center) View larger image 11 PR 0706 29 View larger image 11 PR 0706 31 View larger image 11 PR 0706 32 View larger image Jsc...

12

DS Deutsche Solargesellschaft mbH | Open Energy Information  

Open Energy Info (EERE)

DS Deutsche Solargesellschaft mbH DS Deutsche Solargesellschaft mbH Jump to: navigation, search Name DS Deutsche Solargesellschaft mbH Place Heilbronn, Germany Zip 74074 Sector Solar Product DS Deutsche Solargesellschaft markets PV installations in Spain to mostly German private investors. Coordinates 49.143145°, 9.219295° Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"ROADMAP","zoom":14,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"350px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":49.143145,"lon":9.219295,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}

13

MR-Trackable Intramyocardial Injection Catheter P.V. Karmarkar,1* D.L. Kraitchman,1  

E-Print Network (OSTI)

MR-Trackable Intramyocardial Injection Catheter P.V. Karmarkar,1* D.L. Kraitchman,1 I. Izbudak,1 L.V. Hofmann,1 L.C. Amado,2 D. Fritzges,1 R. Young,3 M. Pittenger,3 J.W.M. Bulte,1 and E. Atalar1 ventricular remodeling. MRI can be effectively used to differentiate in- farcted from healthy myocardium. MR

Atalar, Ergin

14

Kinetics of on Goethite: A Pressure Relaxation Study. P. G. GROSSL*, MJ. EICK, D.L.  

E-Print Network (OSTI)

I Kinetics of on Goethite: A Pressure Relaxation Study. P. G. GROSSL*, MJ. EICK, D.L. SPARKS, and C the adsorption/desorption of the oxyanions, chromate and arsenate, on goethite (a-FeOOH). Experimental conditions included equilibration of a 10 g L-l goethite (surface area 52 m2 g-l) suspension with initial total

Sparks, Donald L.

15

Cost Accounting Standards Board Disclosure Statement (Form DS-2)  

E-Print Network (OSTI)

Cost Accounting Standards Board Disclosure Statement (Form DS-2) University of California, Irvine Revision Number 2, Effective Date April 1, 2012 #12;i COST ACCOUNTING STANDARDS BOARD DISCLOSURE STATEMENT AND CERTIFICATION C-1 Part I General Information I-1 Part II Direct Costs II-1 Part III Indirect Costs III-1 Part IV

Loudon, Catherine

16

REDUCED RANK DETECTION SCHEMES FOR DS-CDMA COMMUNICATION SYSTEMS  

E-Print Network (OSTI)

REDUCED RANK DETECTION SCHEMES FOR DS-CDMA COMMUNICATION SYSTEMS Wanshi Chen Ericsson Wireless 90089­2565 e-mail: ubli@usc.edu Abstract -- Several reduced-rank detection schemes for direct- sequence to the multistage linear receiver scheme based on the Cayley Hamilton theorem. The analysis of the reduced rank

Southern California, University of

17

A Model for Structure and Thermodynamics of ssDNA and dsDNA Near...  

NLE Websites -- All DOE Office Websites (Extended Search)

Structure and Thermodynamics of ssDNA and dsDNA Near a Surface:A Coarse Grained Approach. A Model for Structure and Thermodynamics of ssDNA and dsDNA Near a Surface:A Coarse...

18

u.s. Dl1PARUIFNT OF ENERGY EERE PROJECT MAN AGEMENT CENTER NEPA DETERMINATION  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Dl1PARUIFNT OF ENERGY Dl1PARUIFNT OF ENERGY EERE PROJECT MAN AGEMENT CENTER NEPA DETERMINATION Page I of2 STATE: TX RECIPIENT:E1 Paso, TX PROJECT PV Solar Demonstration Project ARRA-EECBG-City of EI Paso, TX TITLE: Funding Opportunity Announcement Number Procurement Instrument Number NEPA Control Number CID Number DE-FOA-OOOOO13 DE-EEOOOO964 GFQ-0000964-OO3 G0964 Based on my review orlhe information concerning the proposed action, as NEPA Compliance Officer (authoriJ'£d under DOE Order 451.IA), I have made the rollowing determination: ex, EA, EIS APPENDIX AND NUMBER: Description: 85.16 Solar photovoltalc systems The installation, modification, operation, and removal of commercially available solar pholovoltaic systems located on a building or other structure (such as rooftop, parking lot or facility, and mounted to

19

Voltage Dependent Carrier Collection in CdTe Solar Cells D.L. Btzner1  

E-Print Network (OSTI)

Voltage Dependent Carrier Collection in CdTe Solar Cells D.L. Bätzner1 , Guido Agostinelli2 , A to 1000nm, i.e. the band edge region of CdTe. Region I is further divided in a `blue' part between 300 nm III is as well subdivided in region IIIa from about 800 nm to the band gap of CdTe (~850 nm

Romeo, Alessandro

20

Measurement of the branching ratios for the decays of D(+)(s) to ??(+), ???(+), ??(+), and ???(+)  

E-Print Network (OSTI)

PHYSICAL REVIEW D, VOLUME 58, 052002Measurement of the branching ratios for the decays of Ds1 to hp1, h8p1, hr1, and h8r1 C. P. Jessop, K. Lingel, H. Marsiske, M. L. Perl, S. F. Schaffner, D. Ugolini, R. Wang, and X. Zhou Stanford Linear Accelerator...-II detector at the Cornell Electron Storage Ring, we have measured the branching ratios for the decay modes Ds 1!(h ,h 8 )p1 and Ds1!(h ,h8)r1 relative to Ds1!fp1. These decay modes are among the most common hadronic decays of the Ds 1 , and can be related...

Baringer, Philip S.

1998-07-29T23:59:59.000Z

Note: This page contains sample records for the topic "dl deltak ds" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


21

Ebolavirus VP35 uses a bimodal strategy to bind dsRNA for innate immune suppression  

SciTech Connect

Ebolavirus causes a severe hemorrhagic fever and is divided into five distinct species, of which Reston ebolavirus is uniquely nonpathogenic to humans. Disease caused by ebolavirus is marked by early immunosuppression of innate immune signaling events, involving silencing and sequestration of double-stranded RNA (dsRNA) by the viral protein VP35. Here we present unbound and dsRNA-bound crystal structures of the dsRNA-binding domain of Reston ebolavirus VP35. The structures show that VP35 forms an unusual, asymmetric dimer on dsRNA binding, with each of the monomers binding dsRNA in a different way: one binds the backbone whereas the other caps the terminus. Additional SAXS, DXMS, and dsRNA-binding experiments presented here support a model of cooperative dsRNA recognition in which binding of the first monomer assists binding of the next monomer of the oligomeric VP35 protein. This work illustrates how ebolavirus VP35 could mask key recognition sites of molecules such as RIG-I, MDA-5, and Dicer to silence viral dsRNA in infection.

Kimberlin, Christopher R.; Bornholdt, Zachary A.; Li, Sheng; Woods, Jr., Virgil L.; MacRae, Ian J.; Saphire, Erica Ollmann (Scripps); (UCSD)

2010-03-12T23:59:59.000Z

22

U.S. Dl1PARl'MENT OF ENERGY EERE PROJECT MAN AG EMENT CENTER  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

r-.u..~ r-.u..~ , U.S. Dl1PARl'MENT OF ENERGY EERE PROJECT MAN AG EMENT CENTER NEPA DEl'ElU.,nNAl'ION RECIPIENT:WA Dept. of Commerce PROJECT TITLE: Washington State Ferries Biodiesel Project· Phase II Page 1 of3 STATE: WA Funding Opportunity Announcement Number ProcuR'mentlnstrument Number NEPA Control Number em Number DE-FOA-OOOOO52 EEOOOO139 GF0-0000139-039 EE139 Based on my review orlhe Information concerning the propostd action, as NEPA Compliance Officer (authorized under DOE Order 45I.1A), I have made tbe rollowing determination: ex, EA, EIS APPENDIX AND NUMBER: Description: B5.22 Alternative fuel vehicle fueling stations The installation, modification, operation, and removal of alternative fuel vehicle fueling stations (such as for compressed

23

ANALYTICAL DATA SHEET ANALYTICAL DEPT. - HEALTH Al\rD SAFETY DlVlSlON  

Office of Legacy Management (LM)

em IVIL, u-3 em IVIL, u-3 1' 1L, I -' I ANALYTICAL DATA SHEET ANALYTICAL DEPT. - HEALTH Al\rD SAFETY DlVlSlON 1956 1. H.# fL22 Industrial Hygiene or Medical Dept. Sample Nor& 3 Date Collected- 5117 by --Route to CES CES r Location IQJKER-PEMJNS Co- Type of Sample-waternalyzed for F Alpha Remarks -&I GG -- u - Beta Samples of water discharged to river during Steam clean- No, Ra ing of equipment. Oil PH Be Th Sample No. Hour Sample Description (RT Please analyze for gm/U/gal. BP-1 P- RO-Kneader BP-2 K- N-Kneader BP-3 Omera Feeder - __-- .___ -- i ___- ------I - 1 I . ----.--- - ------ .-___ _- I I - 3" - 1 ' : i ' Nt! w-d Analytical Chemistry Section: - Date Received 5-21-56 bY %b. Date Reported 5-2 Z-56 by&b. Method of Analysis Fluorimeter

24

EERE PROJECT MANAGEMENT CDITER Nl!PA Dl!Tl!Rl\llNATION  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

... ... ~ . u.s DEPAR lENT OFl!NERG' EERE PROJECT MANAGEMENT CDITER Nl!PA Dl!Tl!Rl\llNATION Page 1 of2 RECIPIENT:Stanford University STATE: CA PROJECf TITLE: In·Situ X·Ray Analysis of Rapid Thermal Processing for Thin·FiI Solar Cells: Closing the Gap between Production and Laboratory Efficiency Funding Opportunity Announcement Number DE·FOA-0000654 Procurement Instrument Number DE·EE0005951 NEPA Control Number em Number GFQ-0005951·001 G05951 Based on my review of the information concerning the proposed action, as NEPA Compliance Officer (authorized under DOE Order 4SI.IA), I have made the following determination: CX, EA, EIS APP~:NDIX AND NUMBER: Description: A9 Information gathering, analysis, and dissemination 81.31 Installation or

25

Dl!PARThlENT OF ENERGY EERE PROJECT \1A~AGEMENT CENTER  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

~"'-'~' ~"'-'~' u.s. Dl!PARThlENT OF ENERGY EERE PROJECT \1A~AGEMENT CENTER NEPA DETEIU.llNATION Page 1 of2 REel PIENT:County of Somerset STATE: NJ PROJECT TITl.E : Somerset County Renewable Energy Initiative Funding Opportunity Announcement Number Procurement Instrument Number NEPA Control Number CID Number DE-EEOOO3199 GFOOOO3199-001 G03199 BaSC'd on my review o!tbe information concerning the proposed action, as NEPA Compliance Officrr (authorized under DOE Order 451.1A), I have made the following detenninatioo: ex, EA, [IS APPENDIX AND NUMBER: Description: 85.16 Solar photovoltaic systems The installation, modification , operation, and removal of commercially available solar photoyoltaic systems located on a building or other structure (such as rooftop. parking lot Of facility

26

Rvision par r-ensembles de bases de connaissances en DL-LiteR S. Benferhat1  

E-Print Network (OSTI)

2 E. Würbel3 1 Université d'Artois - Nord de France, CRIL-CNRS UMR 8188. 2 Université d- vision" for revising DL-Lite knowledge bases. Such stra- tegy of revision is based on inconsistency

Paris-Sud XI, Université de

27

Structural basis for dsRNA recognition and interferon antagonism by Ebola VP35  

SciTech Connect

Ebola viral protein 35 (VP35), encoded by the highly pathogenic Ebola virus, facilitates host immune evasion by antagonizing antiviral signaling pathways, including those initiated by RIG-I-like receptors. Here we report the crystal structure of the Ebola VP35 interferon inhibitory domain (IID) bound to short double-stranded RNA (dsRNA), which together with in vivo results reveals how VP35-dsRNA interactions contribute to immune evasion. Conserved basic residues in VP35 IID recognize the dsRNA backbone, whereas the dsRNA blunt ends are 'end-capped' by a pocket of hydrophobic residues that mimic RIG-I-like receptor recognition of blunt-end dsRNA. Residues critical for RNA binding are also important for interferon inhibition in vivo but not for viral polymerase cofactor function of VP35. These results suggest that simultaneous recognition of dsRNA backbone and blunt ends provides a mechanism by which Ebola VP35 antagonizes host dsRNA sensors and immune responses.

Leung, Daisy W.; Prins, Kathleen C.; Borek, Dominika M.; Farahbakhsh, Mina; Tufariello, JoAnn M.; Ramanan, Parameshwaran; Nix, Jay C.; Helgeson, Luke A.; Otwinowski, Zbyszek; Honzatko, Richard B.; Basler, Christopher F.; Amarasinghe, Gaya K. (Sinai); (Iowa State); (LBNL); (UTSMC)

2010-03-12T23:59:59.000Z

28

ANALYTICAL DATA SHEET ANALYTICAL DEPT. - HEALTH AhD SAFETY DlVlSlDN  

Office of Legacy Management (LM)

ANALYTICAL DEPT. - HEALTH AhD SAFETY DlVlSlDN I -. . Industrial Hygiene or Medical Dept. 1956 I. H.# 984 Sample Nos. l2 Date Collected- o/2g by&- Route to J" Location SSi4.X CUiTn! CXJitP. Type of Sample&-dust Analyzed for F Alpha x Remarks P~UXC~JGIi.' ON. 14lCI11~ U Beta - IIoll0Wi.n~ slucs - NO, Ra Oil PH Be Th Sample No. 7573p Hour Sample Description 1355 CZ Orxxator sets slul: into place, closes shield over machine S starts &ill. oil coolant flows through hollow drill ____ 3 is rebounded back through an openiq covers 1 cor.lp N9 8775 Analytical Chemistry Section: Date Received 7-2-66 by hb Date Reported 74X& bY IIR Method of Analysis Alpha sdntillation cam 2 % ' CJly Counting Data: BKGD .27 c/min GE0 4o% /min 1 I c- d/ill/M 3

29

DEPXRTMEKT OF ENV]RO~:MENTAL F'ROTECTION DlVklOh OF  

Office of Legacy Management (LM)

. * . * @.+<, .-- v 7, -e -5 u i' ;. - - : ,.:,, 4-.1M-4. a". : ' - l-1 &dp d 3-m 3jPr5Py DEPXRTMEKT OF ENV]RO~:MENTAL F'ROTECTION DlVklOh OF ~NVIR0N~Eh~A.L OUR' tiIn - . BUREAU OF R&DllmcN t=ROTE~lOH ' 1 ,_ jBD 5cOTCH ROAD. ~R~%~obi. fd. 1. 08628 .' - ._ -_ _ . . : S=_srterrjer 27, 1977 - ,. _ :.- ,_..I \ L . x=- a-. JEC): f' eust C--l L-9 ,c:c- -*r 2ze E&f&y _3=iz=Et=g cr;i\' ==Siq ' ---res"LE;, c2iiIps - de- ~-z7~~to3, Bew --d Jersey DE540 3ez' -- . w- Tecsk: i 25, 1577, A&=!= --t' -jD,r= of

30

The effect of double-stranded (DS) RNA on Monosporascus cannonballus culture morphology and virulence  

E-Print Network (OSTI)

Attempts to eliminate double-stranded (ds) RNA elements in Monosporascus cannonballus by subculturing on PDA amended with various concentrations of cycloheximide (O to 15 pg/ml) and incubating at elevated temperatures were partially effective...

Park, Yunjung

2012-06-07T23:59:59.000Z

31

DEPARTMENT OF ENERGY EERE PROJECT MANAGEMENT CENTER N1!PA Dl!1'ElU.llNATION  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

N1!PA Dl!1'ElU.llNATION N1!PA Dl!1'ElU.llNATION RECIPIENT:City of Perth Amboy PROJECT TITLE : Municipal Complex Solar Power Project Page 1 of2 STATE: NJ Funding Opportunity Announl::ement Number Procurement Instrument Number NEPA Control Number elD Number Congressionally Directed Project DE· EEOOO3172 GF0-0003172..Q01 EE3172 Based on my review of the information concerning the proposed action, as N[PA Compliance Officer (authoro.ed under DOE Order451.1A),1 have made tbe following determination: ex, EA, EIS APPENDIX AND NUMBER: Description: 8 5.1 Adions to oonserve energy, demonstrate potential energy conservation, and promote energy-efficiency that do not increase the indoor concentratIOns of potentially harmful substances. These actions may involve financial and technical

32

Recrystallization in CdTe/CdS A. Romeo, D.L. Batzner, H. Zogg, A.N. Tiwari*  

E-Print Network (OSTI)

Recrystallization in CdTe/CdS A. Romeo, D.L. Ba?tzner, H. Zogg, A.N. Tiwari* Thin Film Physics with HVE and CBD grown CdS window layers. q 2000 Elsevier Science S.A. All rights reserved. Keywords: Cd and to different deposition techniques of the window layer. Chemi- cal bath deposition (CBD) grown CdS is preferred

Romeo, Alessandro

33

Encoding of SRP packet types in the DS byte Werner Almesberger !Werner.Almesberger@epfl.ch? 1 ,  

E-Print Network (OSTI)

Encoding of SRP packet types in the DS byte Werner Almesberger !Werner.Almesberger@epfl.ch? 1 We propose an encoding of the packet types used by SRP (Scalable Reservation Protocol) in the DS byte under study by the Differentiated Services working group. 1 Introduction SRP [1] is a light

Almesberger, Werner

34

Multicarrier CDMA versus DS-CMDA : simulation and performance evaluation over a multipath Rayleigh fading channel  

E-Print Network (OSTI)

In this thesis, I have simulated and evaluated the performance of both a multicarrier CDMA (MC-CDMA) system employing a conventional maximum likelihood detector (MLD) and a direct sequence CDMA (DS-CDMA) system using a RAKE receiver over a six...

Apte, Pushkar R

2012-06-07T23:59:59.000Z

35

MERCURY PURIFICATION IN THE MEGAWATT LIQUID METAL SPALLATION TARGET OF EURISOL-DS Joerg Neuhausena  

E-Print Network (OSTI)

MERCURY PURIFICATION IN THE MEGAWATT LIQUID METAL SPALLATION TARGET OF EURISOL-DS Joerg Neuhausena. For the development of a purification procedure, knowledge about the chemical state of the different elements present-components are of different origin: Gaseous impurities include oxygen, nitrogen and water. The construction materials

McDonald, Kirk

36

MOBILE AGENTS | | | |DS HOME ARCHIVES ABOUT US SUBSCRIBE |SEARCH CART August 2002  

E-Print Network (OSTI)

MOBILE AGENTS | | | |DS HOME ARCHIVES ABOUT US SUBSCRIBE |SEARCH CART August 2002 Back to Article Future Directions for Mobile Agent Research David Kotz, Robert Gray, and Daniela Rus Dartmouth College· he field of mobile agents should shift its emphasis toward mobile code, in all its forms, rather than

Kotz, David

37

Definitions of Managed Objects for the DS1 and E1 Interface Types  

Science Journals Connector (OSTI)

This memo defines a portion of the Management Information Base (MIB) for use with network management protocols in TCP/IP-based internets. In particular, it defines objects for managing DS1 Interfaces -- including both T1 and E1 (a.k.a., CEPT 2 Mbit/s) ...

F. Baker; J. Watt

1993-01-01T23:59:59.000Z

38

DS+ DECAYS TO ETA-RHO+, ETA'RHO+, AND PHI-RHO+  

E-Print Network (OSTI)

We have observed the previously unseen eta-rho+ and eta'rho+ decay modes of the D(s)+, and measured branching ratios relative to the phi-pi+ mode of 2.86 +/- 0.38(-0.38)+0.36 and 3.44 +/-0.62(-0.46)+0.44, respectively. In addition, the relative...

Ammar, Raymond G.; Baringer, Philip S.; Coppage, Don; Davis, Robin E. P.; Kelly, M.; Kwak, Nowhan; Lam, H.; Ro, S.

1992-03-01T23:59:59.000Z

39

Nuclear emission microscopies B.L. Doyle a,*, D.S. Walsh a  

E-Print Network (OSTI)

Nuclear emission microscopies B.L. Doyle a,*, D.S. Walsh a , S.N. Renfrow a,b , G. Vizkelethy a,1 Abstract Alternatives to traditional nuclear microprobe analysis (NMA) emerged two years ago with the invention of ion electron emission microscopy (IEEM). With nuclear emission microscopy (NEM) the ion beam

40

The 19th international conference on Electronic Properties of Two-Dimensional Systems (EP2DS19) and the 15th  

E-Print Network (OSTI)

2010 The 19th international conference on Electronic Properties of Two-Dimensional Systems (EP2DS19) and the 15th conference on Modulated Semiconductor Structures (MSS 15). July 25-29, 2011 Tallahassee, FL EP2DS19/MSS15Scope of conferences EP2DS emphasizes the fundamental physics, including transport

Weston, Ken

Note: This page contains sample records for the topic "dl deltak ds" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


41

U.S. DEPARTIl1ENT OF ENERGY EERE PROJECT MANAGEMENT CENTER NEPA Dl!TFR1ITNATION  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

ENT OF ENERGY ENT OF ENERGY EERE PROJECT MANAGEMENT CENTER NEPA Dl!TFR1ITNATION RECIPIENT:Colorado School of Mines Page 1 on STATE: CO PROJECT TITLE: Time-lapse Joint Inversion of GEOphysical Data and its Application to Geothermal Prospecting GEODE Funding Opportunity Announcement Number DOE DE-FOA-OOOO522 Procurement Instrument Number OE-EEOOO5513 NEPA Control Number em Number GFO-o005513-Q01 0 Based on my review ofthe information concerning the proposed action, as NEPA Compliance Officer (authorized under DOE Order 451.IA), 1 have made the following determination: ex, EA, EIS APPENDIX AND NUMBER: Description: A9 1nformation ga thering, a nalysis, a nd d issem ination Information gathering (including, but not limited to, literature surveys, inventories, site visils, and audits), data analysis

42

PMC·Fr.. U.S. Dl?PARThIENT OFFNFRGY EERE PROJECT MANAGEMENT CE~TER  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Fr.. Fr.. U.S. Dl?PARThIENT OFFNFRGY EERE PROJECT MANAGEMENT CE~TER Nl!PA DF=llNATION RECIPIENT:Oregon Stale University-NNMREC PROJECT TITLE : Pacific Marine Energy Center FY2012 Funding Page 1 of3 STATE: OR Funding Opportunity Announcement Number Procurement Instrument Number NEPA Control Number CID Number G098030 DE-FG36-08GOI8179 GFO-GOI8179-004 G018179 Based on my review of the information concerning the proposed action, as NEPA Compliance Officer (authorized under DOE Order 451. 1A), I have made the following determination: ex, EA, EIS APPENDIX AND NUMBER: Description: A9 Inform ation gathering, analys is, and disseminatlon A1 1 Technical advice and assistance to organizations Information gathering (including, but not limited to, literature surveys, inventories, site visits, and

43

RECIPIENT:QDOE U.S. Dl1PARTlIIENT OF ENERGY EERE PROJECT MANAGEMENT CENTER  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

QDOE QDOE U.S. Dl1PARTlIIENT OF ENERGY EERE PROJECT MANAGEMENT CENTER Nl!PA DETERMINATION Page 1 of2 STATE: OR PROJECT TITL.E : SEP ARRA - Deployment of Innovative Energy Efficiency and Renewable Energy - Agriculture - Dufur & HanncrCantrell Funding Opportunity Announcement Number Pro<:uremeniinstruml.'nt Number NEPA Control Number elD Number OE-FOA-OOOOOS2 EEOOOO140 GF0-0000140-001 EE140 Based on my review of the Information concerning the proposed action, as NEPA Compliance Officer (authorized under DOE Order 4SUA), I have made the following determination: ex, EA, EIS APPENDIX AND NUMBER: De~cription: 85.1 Actions to conserve energy. demonstrate potential energy oonservalion, and promote energy-efficiency that do not increase the indoor concentrations o

44

DEPARThIENT OF ENERGY EERE PROJECT MANAGEMENT CENTER NEPA Dl!1'FIt1.fiNATION  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

DEPARThIENT OF ENERGY DEPARThIENT OF ENERGY EERE PROJECT MANAGEMENT CENTER NEPA Dl!1'FIt1.fiNATION RECIPIENT:Biomass Energy Resource Center PROJECf TITLE: Biomass Energy Resource Center - Core and Program Support Page 1 of2 STATE: VT Funding Opportunity Annoum:emenl Number Procu~ment Instrument Number NEPA Control Number CID Number COP DE-FG36-06G086103,AOO4 GFO-G086103-003 0 Based on my review oflhl' information concerning the proposed action, as NEPA Compliance Officer (aulhoru.ed under DOE Order 451.1A), I bne made the following determination: ex, EA, EIS APPF..NDIX AND NUMBER: Description: A9 Information gathering (including, but not limited 10, literature surveys, inventories, audits), data analysis (including computer modeling), document preparation (such as conceptual design or feasibility studies, analytical energy supply and

45

RECORD OF CATEGORICAL EXCLUSION DETERMINATION Project ID No. BH-DS-171  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

DS-171 DS-171 Title: Use RW Surge Line to BH Anhydrite Pond for RWIS Recycle Description: DOE M&O Contractor will cap the existing recycle line at the BH raw water intake structure for repair work and install a valve in place of the existing surge relief valve to serve as a recycle valve to control flow from the BH raw water intake pumps. The raw water surge line will discharge to the BH anhydrite pond while repairs are being made to the recycle line. Regulatory Requirements: NEPA Implementing Procedures (10 CFR 1021) 10 CFR 1021.410 (Application of Categorical Exclusions) (a) The actions listed in Appendices A and B of Subpart 0 are classes of actions that DOE has determined do not individually or cumulatively have a significant effect on the human environment

46

Solar Deployment System (SolarDS) Model: Documentation and Sample Results  

NLE Websites -- All DOE Office Websites (Extended Search)

2 2 September 2009 The Solar Deployment System (SolarDS) Model: Documentation and Sample Results Paul Denholm, Easan Drury, and Robert Margolis National Renewable Energy Laboratory 1617 Cole Boulevard, Golden, Colorado 80401-3393 303-275-3000 * www.nrel.gov NREL is a national laboratory of the U.S. Department of Energy Office of Energy Efficiency and Renewable Energy Operated by the Alliance for Sustainable Energy, LLC Contract No. DE-AC36-08-GO28308 Technical Report NREL/TP-6A2-45832 September 2009 The Solar Deployment System (SolarDS) Model: Documentation and Sample Results Paul Denholm, Easan Drury, and Robert Margolis Prepared under Task No. PVD9.1210 NOTICE This report was prepared as an account of work sponsored by an agency of the United States government.

47

Complete genome sequence of Parvibaculum lavamentivorans type strain (DS-1T)  

SciTech Connect

Parvibaculum lavamentivorans DS-1T is the type species of the novel genus Parvibaculum in the novel family Rhodobiaceae (formerly Phyllobacteriaceae) of the order Rhizobiales of Al- phaproteobacteria. Strain DS-1T is a non-pigmented, aerobic, heterotrophic bacterium and represents the first tier member of environmentally important bacterial communities that cata- lyze the complete degradation of synthetic laundry surfactants. Here we describe the features of this organism, together with the complete genome sequence and annotation. The 3,914,745 bp long genome with its predicted 3,654 protein coding genes is the first com- pleted genome sequence of the genus Parvibaculum, and the first genome sequence of a rep- resentative of the family Rhodobiaceae.

Schleheck, David [University of Konstanz, Konstanz, Germany; Weiss, Michael [University of Konstanz, Konstanz, Germany; Pitluck, Sam [U.S. Department of Energy, Joint Genome Institute; Bruce, David [Los Alamos National Laboratory (LANL); Land, Miriam L [ORNL; Han, Cliff [Los Alamos National Laboratory (LANL); Saunders, Elizabeth H [Los Alamos National Laboratory (LANL); Tapia, Roxanne [Los Alamos National Laboratory (LANL); Detter, J. Chris [U.S. Department of Energy, Joint Genome Institute; Brettin, Thomas S [ORNL; Han, James [U.S. Department of Energy, Joint Genome Institute; Woyke, Tanja [U.S. Department of Energy, Joint Genome Institute; Goodwin, Lynne A. [Los Alamos National Laboratory (LANL); Pennacchio, Len [U.S. Department of Energy, Joint Genome Institute; Nolan, Matt [U.S. Department of Energy, Joint Genome Institute; Cook, Alasdair M. [University of Konstanz, Konstanz, Germany; Kjelleberg, Staffan [University of New South Wales, Sydney, Australia; Thomas, Torsten [University of New South Wales

2011-01-01T23:59:59.000Z

48

Search for the decay B? D(+)(s1) (2536)X  

E-Print Network (OSTI)

. J. Thaler -Champaign, Illinois 61801 wards Ontario, Canada K1S 5B6 icle Physics, Canada MacFarlane, and P. M. Patel Quebec, Canada H3A 2T8 icle Physics, Canada doff , New York 14850 . Darling, R. Davis, S. Kotov, I. Kravchenko, N. Kwak, Zhou 57I et... stringent RK.0.9 requirement on the K1 with negligible loss of efficiency. The Ds1 1 candidates are required to have a scaled momentum xp5pD s1 1 / A Ebeam 2 2M D s1 1 2 ,0.45, which is the kinematic limit for B!Ds11 X decays. ~We ignore the negligible...

Ammar, Raymond G.; Baringer, Philip S.; Bean, Alice; Besson, David Zeke; Coppage, Don; Darling, C.; Davis, Robin E. P.; Kotov, S.; Kravchenko, I.; Kwak, Nowhan; Zhou, L.

1998-04-01T23:59:59.000Z

49

EURISOL-DS MULTI-MW TARGET ISSUES: BEAM WINDOW AND TRANSVERSE FILM TARGET  

E-Print Network (OSTI)

The analysis of the EURISOL-DS Multi_MW target precise geometry (Fig.1) has proved that large fission yields can be achieved with a 4 MW, providing a technically feasible design to evacuate the power deposited in the liquid mercury. Different designs for the mercury flow have been proposed, which maintain its temperature below the boiling point with moderate flow speeds (maximum 4 m/s).

Adonai Herrera-Martnez, Yacine Kadi

50

Cryogenic friction behavior of PTFE based solid lubricant composites N.L. McCook, D.L. Burris, P.L. Dickrell and W.G. Sawyer*  

E-Print Network (OSTI)

Cryogenic friction behavior of PTFE based solid lubricant composites N.L. McCook, D.L. Burris, P life [4,5], ability to operate from cryogenic temperature (4 K) to 500 K, and their relative that operate at cryogenic temperatures, there is a paucity of data available for friction coeffi- cients

Sawyer, Wallace

51

The feedback phase instability in the HBT-EP tokamak D.L. Nadle, C. Cates, H. Dahi, M.E. Mauel,  

E-Print Network (OSTI)

The feedback phase instability in the HBT-EP tokamak D.L. Nadle, C. Cates, H. Dahi, M.E. Mauel, D of a performance limiting feedback phase instability in the HBT-EP toka- mak are reported. The phase instability instability limits feedback performance in HBT-EP by decreasing the feedback loop's phase accuracy as gain

Mauel, Michael E.

52

Kinetics of Adsorption of Selenate and Selonite at the Goethite/Water InterfAce. p.e. ZHANG* and D.L. SPARKS.  

E-Print Network (OSTI)

Kinetics of Adsorption of Selenate and Selonite at the Goethite/Water InterfAce. p.e. ZHANG* and D.L. SPARKS. Univ. of Delaware. Mechanisms and kinetics of SeO, and Se~ at the goethite/water interface were

Sparks, Donald L.

53

Design, Implementation, and Evaluation of a Hybrid DS/FFH Spread-Spectrum Radio Transceiver  

SciTech Connect

In recent years there has been great interest in using hybrid spread-spectrum (HSS) techniques for commercial applications, particularly in the Smart Grid, in addition to their inherent uses in military communications. This is because HSS can accommodate high data rates with high link integrity, even in the presence of significant multipath effects and interfering signals. A highly useful form of this transmission technique for many types of command, control, and sensing applications is the specific code-related combination of standard direct-sequence modulation with "fast" frequency-hopping, denoted hybrid DS/FFH, wherein multiple frequency hops occur within a single data-bit time. In this paper, we present the efforts carried out at Oak Ridge National Laboratory toward exploring the design, implementation, and evaluation of a hybrid DS/FFH spread-spectrum radio transceiver using a single Field Programmable Gate Array (FPGA). The FPGA allows the various subsystems to quickly communicate with each other and thereby maintain tight synchronization. We also investigate various hopping sequences against robustness to interference and jamming. Experimental results are presented that show the receiver sensitivity, radio data-rate/bit-error evaluations, and jamming and interference rejection capabilities of the implemented hybrid DS/FFH spread-spectrum system under widely varying design parameters.

Olama, Mohammed M [ORNL; Killough, Stephen M [ORNL; Kuruganti, Teja [ORNL; Carroll, Thomas E. [Pacific Northwest National Laboratory (PNNL)

2014-01-01T23:59:59.000Z

54

Effect of Sequence-Dependent Rigidity on Plectoneme Localization in dsDNA  

E-Print Network (OSTI)

We use Monte-Carlo simulations to study the effect of variable rigidity on plectoneme formation and localization in supercoiled dsDNA. We show that the presence of soft sequences increases the number of plectoneme branches and that the edges of the branches tend to be localized at these sequences. We propose an experimental approach to test our results in vitro, and discuss the possible role played by plectoneme localization in the search process of transcription factors for their targets (promoter regions) on the bacterial genome.

Medalion, Shlomi

2015-01-01T23:59:59.000Z

55

DEVELOPMENT OF HIGH EFFICIENCY FLEXIBLE CdTe SOLAR CELLS A.Romeo, M. Arnold, D.L. Btzner, H. Zogg and A.N. Tiwari*  

E-Print Network (OSTI)

to the solar panel that can be adapted to any kind of shape and is easy to deploy in space. In the last yearsDEVELOPMENT OF HIGH EFFICIENCY FLEXIBLE CdTe SOLAR CELLS A.Romeo, M. Arnold, D.L. Bätzner, H. Zogg Telephone: +44-1509-227031 E-mail: a.n.tiwari@lboro.ac.uk ABSTRACT: Polycrystalline thin film solar cells

Romeo, Alessandro

56

Design Support for Distributed Systems: DSE4DS D.H.Akehurst, B.Bordbar, J.Derrick, A.G.Waters  

E-Print Network (OSTI)

Design Support for Distributed Systems: DSE4DS D.H.Akehurst, B.Bordbar, J.Derrick, A towards the provision of successful distributed system designs. The purpose of the DSE4DS project facilities for the design of multimedia distributed systems, to ensure that they can effectively meet

Kent, University of

57

EIS-0283DS Supplement to the Surplus Plutonium Disposition Draft Environmental Impact Statement, April 1999  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Sheet Sheet Responsible Agency: United States Department of Energy (DOE) Title: Supplement to the Surplus Plutonium Disposition Draft Environmental Impact Statement (Supplement) (DOE/EIS-0283-DS) Locations of Candidate Sites: Idaho, North Carolina, South Carolina, Texas, Virginia, and Washington Contacts: For further information on the Supplement contact: For further information on the DOE National Environmental Policy Act (NEPA) process contact: Mr. G. Bert Stevenson, NEPA Compliance Officer Office of Fissile Materials Disposition U.S. Department of Energy P.O. Box 23786 Washington, DC 20026-3786 Voice: (202) 586-5368 Ms. Carol Borgstrom, Director Office of NEPA Policy and Assistance Office of Environment, Safety and Health U.S. Department of Energy 1000 Independence Ave., SW

58

Two-Phase Steady Detonation Analysis J.M. Powers, D.S. Stewart, and H. Krier  

E-Print Network (OSTI)

Two-Phase Steady Detonation Analysis J.M. Powers, D.S. Stewart, and H. Krier Reprinted from-Phase Steady Detonation Analysis J.M. Powers,· D. S. Stewart,t and H. Krier:j: _ University of Illinois equations are studied to test the hypothesis that observed deviations from Chapman- Jouguet (C-J) detonation

59

Photophysics of DsRed, a Red Fluorescent Protein, from the Ensemble to the Single-Molecule Level  

E-Print Network (OSTI)

Photophysics of DsRed, a Red Fluorescent Protein, from the Ensemble to the Single-Molecule Level B-wavelength substitute for green fluorescent protein (GFP) mutants for in vivo protein labeling. Bulk and single-molecule is not an issue in physiological studies. Introduction Single-molecule spectroscopy (SMS) continues to play

Boxer, Steven G.

60

Implications to $c\\bar s$ assignments of $D_{s1}(2700)^\\pm$ and $D_{sJ}(2860)$  

E-Print Network (OSTI)

Possible assignments of $D_{s1}(2700)^\\pm$ and $D_{sJ}(2860)$ in the conventional quark model are analyzed. The study indicates that both the orbitally excited $c\\bar s$ and the radially excited $c\\bar s$ are possible. Some implications to these assignments are explored. If $D_{s1}(2700)^\\pm$ and $D_{sJ}(2860)$ are the orbitally excited D-wave $1^- (j^P={3\\over 2}^-)$ and $3^- (j^P={5\\over 2}^-)$, respectively, another orbitally excited D-wave $2^-$ $D_s$, $D_{s2}(2800)$, is expected. If $D_{s1}(2700)^\\pm$ and $D_{sJ}(2860)$ are the first radially excited $1^- (j^P={1\\over 2}^-)$ and $0^+ (j^P={1\\over 2}^+)$, respectively, other two radially excited $0^- D^\\prime_s(2582)$ and $1^+ D^\\prime_{s1}(2973)$ are expected. $D_{s2}(2800)$ and $D^\\prime_{s1}(2973)$ are mixing states. The chiral doubling relation may exist in radially excited $D_s$, the splitting between the parity partners(the $(0^-,1^-)$ and the $(0^+,1^+)$) is $\\approx 280$ MeV.

Ailin Zhang

2009-04-16T23:59:59.000Z

Note: This page contains sample records for the topic "dl deltak ds" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


61

Monosporascus root rot/vine decline: a study of double-stranded (DS) RNA and its role in the pathogenesis of Monosporascus cannonballus on muskmelon  

E-Print Network (OSTI)

Monosporascus Root Rot/Vine Decline: A Study of Double-Stranded (ds) RNA and Its Role in the Pathogenesis of Monosporascus cannonballus on Muskmelon. (May 1997) Jeffrey Samuel Batten, B. A. , Trinity University Co-Chairs of Advisory Committee: Dr. Raymond D... hybridization between cDNA clones (pJB14 and pJB38) and dsRNA from M 96+ cannonballus isolate, Ca91-17 55 IV-2 Agarose gel and corresponding northern blot showing hybridization between cDNA clones (pJB27, pJB28, pJB39, and pJB40) and dsRNA from M...

Batten, Jeffrey Samuel

2012-06-07T23:59:59.000Z

62

Measurements of the Branching fractions for $B_(s) -> D_(s)???$ and $?_b^0 -> ?_c^+???$  

E-Print Network (OSTI)

Branching fractions of the decays $H_b\\to H_c\\pi^-\\pi^+\\pi^-$ relative to $H_b\\to H_c\\pi^-$ are presented, where $H_b$ ($H_c$) represents B^0-bar($D^+$), $B^-$ ($D^0$), B_s^0-bar ($D_s^+$) and $\\Lambda_b^0$ ($\\Lambda_c^+$). The measurements are performed with the LHCb detector using 35${\\rm pb^{-1}}$ of data collected at $\\sqrt{s}=7$ TeV. The ratios of branching fractions are measured to be B(B^0-bar -> D^+\\pi^-\\pi^+\\pi^-)/ B(B^0-bar -> D^+\\pi^-) = 2.38\\pm0.11\\pm0.21 B(B^- -> D^0\\pi^-\\pi^+\\pi^-) / B(B^- -> D^0\\pi^-) = 1.27\\pm0.06\\pm0.11 B(B_s^0-bar -> D_s^+\\pi^-\\pi^+\\pi^-) / B(B_s^0-bar -> D_s^+\\pi^-) = 2.01\\pm0.37\\pm0.20 B(\\Lambda_b^0->\\Lambda_c^+\\pi^-\\pi^+\\pi^-) / B(\\Lambda_b^0 -> \\Lambda_c^+\\pi^-) = 1.43\\pm0.16\\pm0.13. We also report measurements of partial decay rates of these decays to excited charm hadrons. These results are of comparable or higher precision than existing measurements.

LHCb Collaboration; R. Aaij; B. Adeva; M. Adinolfi; C. Adrover; A. Affolder; Z. Ajaltouni; J. Albrecht; F. Alessio; M. Alexander; G. Alkhazov; P. Alvarez Cartelle; A. A. Alves Jr; S. Amato; Y. Amhis; J. Anderson; R. B. Appleby; O. Aquines Gutierrez; F. Archilli; L. Arrabito; A. Artamonov; M. Artuso; E. Aslanides; G. Auriemma; S. Bachmann; J. J. Back; D. S. Bailey; V. Balagura; W. Baldini; R. J. Barlow; C. Barschel; S. Barsuk; W. Barter; A. Bates; C. Bauer; Th. Bauer; A. Bay; I. Bediaga; K. Belous; I. Belyaev; E. Ben-Haim; M. Benayoun; G. Bencivenni; S. Benson; J. Benton; R. Bernet; M. -O. Bettler; M. van Beuzekom; A. Bien; S. Bifani; A. Bizzeti; P. M. Bjrnstad; T. Blake; F. Blanc; C. Blanks; J. Blouw; S. Blusk; A. Bobrov; V. Bocci; A. Bondar; N. Bondar; W. Bonivento; S. Borghi; A. Borgia; T. J. V. Bowcock; C. Bozzi; T. Brambach; J. van den Brand; J. Bressieux; D. Brett; S. Brisbane; M. Britsch; T. Britton; N. H. Brook; H. Brown; A. Bchler-Germann; I. Burducea; A. Bursche; J. Buytaert; S. Cadeddu; J. M. Caicedo Carvajal; O. Callot; M. Calvi; M. Calvo Gomez; A. Camboni; P. Campana; A. Carbone; G. Carboni; R. Cardinale; A. Cardini; L. Carson; K. Carvalho Akiba; G. Casse; M. Cattaneo; M. Charles; Ph. Charpentier; N. Chiapolini; K. Ciba; X. Cid Vidal; G. Ciezarek; P. E. L. Clarke; M. Clemencic; H. V. Cliff; J. Closier; C. Coca; V. Coco; J. Cogan; P. Collins; F. Constantin; G. Conti; A. Contu; A. Cook; M. Coombes; G. Corti; G. A. Cowan; R. Currie; B. D'Almagne; C. D'Ambrosio; P. David; I. De Bonis; S. De Capua; M. De Cian; F. De Lorenzi; J. M. De Miranda; L. De Paula; P. De Simone; D. Decamp; M. Deckenhoff; H. Degaudenzi; M. Deissenroth; L. Del Buono; C. Deplano; O. Deschamps; F. Dettori; J. Dickens; H. Dijkstra; P. Diniz Batista; S. Donleavy; A. Dosil Surez; D. Dossett; A. Dovbnya; F. Dupertuis; R. Dzhelyadin; C. Eames; S. Easo; U. Egede; V. Egorychev; S. Eidelman; D. van Eijk; F. Eisele; S. Eisenhardt; R. Ekelhof; L. Eklund; Ch. Elsasser; D. G. d'Enterria; D. Esperante Pereira; L. Estve; A. Falabella; E. Fanchini; C. Frber; G. Fardell; C. Farinelli; S. Farry; V. Fave; V. Fernandez Albor; M. Ferro-Luzzi; S. Filippov; C. Fitzpatrick; M. Fontana; F. Fontanelli; R. Forty; M. Frank; C. Frei; M. Frosini; S. Furcas; A. Gallas Torreira; D. Galli; M. Gandelman; P. Gandini; Y. Gao; J-C. Garnier; J. Garofoli; J. Garra Tico; L. Garrido; C. Gaspar; N. Gauvin; M. Gersabeck; T. Gershon; Ph. Ghez; V. Gibson; V. V. Gligorov; C. Gbel; D. Golubkov; A. Golutvin; A. Gomes; H. Gordon; M. Grabalosa Gndara; R. Graciani Diaz; L. A. Granado Cardoso; E. Graugs; G. Graziani; A. Grecu; S. Gregson; B. Gui; E. Gushchin; Yu. Guz; T. Gys; G. Haefeli; C. Haen; S. C. Haines; T. Hampson; S. Hansmann-Menzemer; R. Harji; N. Harnew; J. Harrison; P. F. Harrison; J. He; V. Heijne; K. Hennessy; P. Henrard; J. A. Hernando Morata; E. van Herwijnen; E. Hicks; W. Hofmann; K. Holubyev; P. Hopchev; W. Hulsbergen; P. Hunt; T. Huse; R. S. Huston; D. Hutchcroft; D. Hynds; V. Iakovenko; P. Ilten; J. Imong; R. Jacobsson; A. Jaeger; M. Jahjah Hussein; E. Jans; F. Jansen; P. Jaton; B. Jean-Marie; F. Jing; M. John; D. Johnson; C. R. Jones; B. Jost; S. Kandybei; M. Karacson; T. M. Karbach; J. Keaveney; U. Kerzel; T. Ketel; A. Keune; B. Khanji; Y. M. Kim; M. Knecht; S. Koblitz; P. Koppenburg; A. Kozlinskiy; L. Kravchuk; K. Kreplin; M. Kreps; G. Krocker; P. Krokovny; F. Kruse; K. Kruzelecki; M. Kucharczyk; S. Kukulak; R. Kumar; T. Kvaratskheliya; V. N. La Thi; D. Lacarrere; G. Lafferty; A. Lai; D. Lambert; R. W. Lambert; E. Lanciotti; G. Lanfranchi; C. Langenbruch; T. Latham; R. Le Gac; J. van Leerdam; J. -P. Lees; R. Lefvre; A. Leflat; J. Lefranois; O. Leroy; T. Lesiak; L. Li; L. Li Gioi; M. Lieng; M. Liles; R. Lindner; C. Linn; B. Liu; G. Liu; J. H. Lopes; E. Lopez Asamar; N. Lopez-March; J. Luisier; F. Machefert; I. V. Machikhiliyan; F. Maciuc; O. Maev; J. Magnin; S. Malde; R. M. D. Mamunur; G. Manca; G. Mancinelli; N. Mangiafave; U. Marconi; R. Mrki; J. Marks; G. Martellotti; A. Martens; L. Martin; A. Martn Snchez; D. Martinez Santos; A. Massafferri; Z. Mathe; C. Matteuzzi; M. Matveev; E. Maurice; B. Maynard; A. Mazurov; G. McGregor; R. McNulty; C. Mclean; M. Meissner; M. Merk; J. Merkel; R. Messi; S. Miglioranzi; D. A. Milanes; M. -N. Minard; S. Monteil; D. Moran; P. Morawski; R. Mountain; I. Mous; F. Muheim; K. Mller; R. Muresan; B. Muryn; M. Musy; J. Mylroie-Smith; P. Naik; T. Nakada; R. Nandakumar; J. Nardulli; I. Nasteva; M. Nedos; M. Needham; N. Neufeld; C. Nguyen-Mau; M. Nicol; S. Nies; V. Niess; N. Nikitin; A. Oblakowska-Mucha; V. Obraztsov; S. Oggero; S. Ogilvy; O. Okhrimenko; R. Oldeman; M. Orlandea; J. M. Otalora Goicochea; P. Owen; B. Pal; J. Palacios; M. Palutan; J. Panman; A. Papanestis; M. Pappagallo; C. Parkes; C. J. Parkinson; G. Passaleva; G. D. Patel; M. Patel; S. K. Paterson

2011-09-30T23:59:59.000Z

63

Designations of ds2p energy levels in neutral zirconium, hafnium, and rutherfordium (Z=104)  

Science Journals Connector (OSTI)

We have examined available data for the odd-parity energy-level structures in Zr and Hf, stimulated by the designations of four predicted 6d7s27p levels in the homologous atom rutherfordium (Rf, Z=104) by Eliav et al. [Phys. Rev. Lett. 74, 1079 (1995)]. We point out some errors and deficiencies in the Zr data and give the results of Hartree-Fock calculations for Hf 5d6s26p and Rf 6d7s27p levels. Configuration interactions within the (d+s)3p complexes were included. The resulting eigenvectors allow meaningful LS-coupling designations for most of the levels belonging mainly to Hf 5d6s26p and for most of the predicted Rf levels belonging mainly to 6d7s27p. Some changes in the designations assigned to these levels in the literature are suggested: in particular, the lowest level of both Hf 5d6s26p and Rf 6d7s27p is most appropriately designated F2o3. We point out the need for systematic whole-row studies of the low odd-parity configurations in 4d- and 5d-shell spectra. 1996 The American Physical Society.

W. C. Martin and Jack Sugar

1996-03-01T23:59:59.000Z

64

U.S. DI!PARThlENT OF ENERGY EERE PROJECT MANAGEMENT CENTER Nl!PA Dl1TImfiNATION  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

PARThlENT OF ENERGY PARThlENT OF ENERGY EERE PROJECT MANAGEMENT CENTER Nl!PA Dl1TImfiNATION RECIPIENT: BeIi Geospace, Inc Page 1 of2 STATE: TX PROJECT TITLE: Geothermal Technology Advancement for Rapid Development of Resources in the U.S. Funding OpportunUy Announcement Number Procurement Instrument Number NEPA Control Number em Number DE·FQA'()()()()S22 OE-EEOOO5515 GF0-0005515-001 G05515 Bued on my review oftbe information concerning the proposro action, as NEPA Compliance Officer (authorized under DOE Ordtr 4SI.IA), I have made the following determination: ex, EA, EIS APPENDIX AND NUMBER: Description : A9 Information gathering, analysis, and dissemination Information gathering (induding, but not limited to, literature surveys, inventories, site visits. and audits), data analysis

65

173. NICKEL SORPTION KINETICS ON THE CLAY FRACTION OF A SOIL. D.R. Roberts and D.L. Sparks, Department of Plant and Soil Sciences, University of Delaware, Newark,  

E-Print Network (OSTI)

173. NICKEL SORPTION KINETICS ON THE CLAY FRACTION OF A SOIL. D.R. Roberts and D.L. Sparks the fate of heavy metal contaminants in the soil environment. Past studies of heavy metal sorption kinetics. This study exannines Ni(II) sorption and desorption kinetics on the clay fraction (

Sparks, Donald L.

66

[1] DS/EN 61400-1: 2005. Wind turbines, part 1: Design requirements, 2005. [2] Andrew Delaney. Blowing up a storm. European Power News, 31, 2006.  

E-Print Network (OSTI)

[1] DS/EN 61400-1: 2005. Wind turbines, part 1: Design requirements, 2005. [2] Andrew Delaney loads of wind turbines. In Proceedings of the American Control Conference, Philadelphia, Pennsylvania, Fernando D. Bianchi, Hernán De Battista. Wind Turbine Control Systems. Springer, 2007. [6] H. Ganander

Pedersen, Henrik C.

67

Winter 2012 FOr ALUMni, PArentS, AnD FrienDS OF tHe eAStMAn SCHOOL OF MUSiC Playinginside  

E-Print Network (OSTI)

Winter 2012 FOr ALUMni, PArentS, AnD FrienDS OF tHe eAStMAn SCHOOL OF MUSiC Playinginside &outside" grapples with the perception that it has lost precious ground in the fight to keep music in our schools, I

Portman, Douglas

68

Performance Study of Hybrid DS/FFH Spread-Spectrum Systems in the Presence of Frequency-Selective Fading and Multiple-Access Interference  

SciTech Connect

Hybrid spread-spectrum (HSS) systems have recently received considerable interest in commercial, Smart Grid, and military communication systems because they accommodate high data rates with high link integrity, even in the presence of significant multipath effects and interfering signals. A highly useful form of this modulation scheme is the specific code-related combination of standard direct-sequence spread spectrum (DSSS) with fast frequency-hopping (FFH) spread spectrum, denoted hybrid DS/FFH, wherein multiple frequency hops occur within a single data-bit time. In this paper we perform a simulation-based study of the DS/FFH performance as compared to the existing standard DSSS and FHSS wireless networks. The performance metrics are bit-error probability and multiple-access capability. The parameter space of DS/FFH, including the DS spreading rate, frequency hopping rate, carrier frequencies, and numbers of users, is explored to show its performance under frequency-selective Rayleigh fading environments and multiuser interference. Direct digital synthesizers to achieve fast hopping speeds are also considered in our study.

Olama, Mohammed M [ORNL; Smith, Stephen Fulton [ORNL; Kuruganti, Phani Teja [ORNL; Ma, Xiao [ORNL

2012-01-01T23:59:59.000Z

69

Effect of H on Ds ? and Ds  

Science Journals Connector (OSTI)

......investigate the effect of a charged Higgs boson (H ) on the decays D s munumu...investigate the effect of a charged Higgs boson (H ) on the decays D s and D s...One such example is a charged Higgs boson H , and in this paper we consider......

A. G. Akeroyd

2004-02-01T23:59:59.000Z

70

arXiv:0804.3902v1[cs.DS]24Apr2008 Minimum-energy broadcast in random-grid ad-hoc  

E-Print Network (OSTI)

arXiv:0804.3902v1[cs.DS]24Apr2008 Minimum-energy broadcast in random-grid ad-hoc networks ranges to the nodes of an ad-hoc network in order to guarantee a directed spanning tree from a given in ad-hoc networks. In ad-hoc net- works, nodes are able to vary their transmission ranges in order

Rossi, Gianluca

71

Harry Potter, ange ou dmon ?, ds. I. Smadja et P. Bruno, P.U.F., octobre 2007, pp. 140-149 Nicole BIAGIOLI  

E-Print Network (OSTI)

les élèves lecteurs d'Harry Potter. Résumé La série de J. K. Rowling est un parfait exemple desHarry Potter, ange ou démon ?, éds. I. Smadja et P. Bruno, P.U.F., octobre 2007, pp. 140-149 1, Université de Nice-Sophia Antipolis, U.F.R. Lettres, Arts et Sciences humaines, 98 Bd. Edouard Herriot, B

Boyer, Edmond

72

DOE/EIS-0357D-S1: Supplement to the Draft Environmental Impact Statement for the Gilberton Coal-to-Clean Fuels and Power Project (12/26/06)  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

EIS-0357D-S1 EIS-0357D-S1 SUPPLEMENT TO THE DRAFT ENVIRONMENTAL IMPACT STATEMENT FOR THE GILBERTON COAL-TO-CLEAN FUELS AND POWER PROJECT GILBERTON, PENNSYLVANIA December 2006 U.S. DEPARTMENT OF ENERGY i COVER SHEET December 2006 RESPONSIBLE AGENCY U.S. Department of Energy (DOE) TITLE Supplement to the Draft Environmental Impact Statement for the Gilberton Coal -to-Clean Fuels and Power Project (DOE/EIS-0357D-S1) LOCATION Gilberton, Pennsylvania CONTACTS Additional copies or information concerning this Supplement to the Draft Environmental Impact Statement (EIS) can be obtained from Ms. Janice L. Bell, National Environmental Policy Act (NEPA) Document Manager, U.S. Department of Energy, National Energy Technology Laboratory, 626 Cochrans Mill Road, P.O. Box 10940, Pittsburgh, PA 15236-0940. Telephone: 412-386-4512.

73

Mann, C.P., Stix, J., Vallance, J.W., and Richer, M., 2004, Subaqueous intracaldera volcanism, Ilopango Caldera, El Salvador, Central America, in Rose, W.I., Bommer, J.J., Lpez, D.L., Carr, M.J., and Major, J.J., eds., Natural hazards in El Salvador: Boul  

E-Print Network (OSTI)

, Ilopango Caldera, El Salvador, Central America, in Rose, W.I., Bommer, J.J., López, D.L., Carr, M.J., and Major, J.J., eds., Natural hazards in El Salvador: Boulder, Colorado, Geological Society of America of America Special Paper 375 2004 Subaqueous intracaldera volcanism, Ilopango Caldera, El Salvador, Central

Long, Bernard

74

Microsoft Word - mitchell-dl.doc  

NLE Websites -- All DOE Office Websites (Extended Search)

Characterizing Particle Size, Water Path and Photon Characterizing Particle Size, Water Path and Photon Tunneling in Ice and Water Clouds David L. Mitchell Atmospheric Sciences Division Desert Research Institute Reno, Nevada Robert P. d'Entremont Satellite Meteorology Group Atmospheric and Environmental Research, Inc. Lexington, Massachusetts Abstract Global information of ice water path (IWP) in ice clouds is urgently needed for testing of global climate models (GCMs) and other applications, but satellite retrievals of IWP are still in the developing stages, and tend to have large uncertainties (e.g. factor of 3 or more). Results of a new retrieval method are presented here that may have relatively low uncertainties, using several thermal-radiance channels. Recent research indicates that ice-cloud radiative properties depend on more than effective diameter

75

CM200DL-Final.doc  

NLE Websites -- All DOE Office Websites (Extended Search)

CM200 CM200 Core Status: new users must complete 2 trouble free training sessions and pass the drivers test to work independently during Core sessions. Flex Status: core users must complete 5 trouble free sessions to work during Flex sessions. To reserve a CM200 session, go to www/ncem.lbl.gov, click on "Microscope Scheduling", use proposal number and password to log in. You may only sign up for one Core session at a time. To cancel a session, email your request to the technical staff in charge of the microscope. CORE LICENSE TEST Safety  Understand emergency shut down procedure  Know emergency contact numbers  Know where LN protective equipment is  Find updated operating instruction and notice (?) Instrument Preparation  Check V7 closed and SSC on and in cooling

76

TEAM0.5DL.doc  

NLE Websites -- All DOE Office Websites (Extended Search)

0.5 0.5 Core Status: new users must complete 2 training sessions and pass a sample exchange exam to work independently during Core sessions (regular work hours). Flex Status: core users must complete 5 Core sessions and pass a driving test to work during Flex sessions (evening and weekend hours). All TEAM 0.5 scheduling must be coordinated through Peter Ercius at Percius@lbl.gov. You may be assigned only two sessions per month. CORE LICENSE Safety  Understand emergency shut-down procedure  Demonstrate handling of the column valves  Point out where emergency contact numbers are posted  Know how to contact NCEM staff for support Instrument preparation  Show how to check basic vacuum functionality and target pressure values  (Gun: 1, Liner: 18-20 and Octagon: < 10)

77

Uncatalyzed assembly of spherical particles from SV40 VP1 pentamers and linear dsDNA incorporates both low and high cooperativity elements  

SciTech Connect

The capsid of SV40 virion is comprised of 72 pentamers of the major capsid protein, VP1. We examined the synergism between pentamer-pentamer interaction and pentamer-DNA interaction using a minimal system of purified VP1 and a linear dsDNA 600-mer, comparing electrophoresis with electron microscopy and size exclusion chromatography. At low VP1/DNA ratios, large tubes were observed that apparently did not survive native agarose gel electrophoresis. As the VP1 concentration increased, electrophoretic migration was slower and tubes were replaced by 200 A diameter particles and excess free pentamer. At high VP1/DNA ratios, a progressively larger fraction of particles was similar to 450 A diameter virions. VP1 association with DNA is very strong compared to the concentrations in these experiments yet, paradoxically, stable complexes appear only at high ratios of VP1 to DNA. These data suggest a DNA saturation-dependent nucleation event based on non-specific pentamer-DNA interaction that controls assembly and the ultimate capsid geometry.

Mukherjee, Santanu [Department of Biochemistry and Molecular Biology, University of Oklahoma Health Sciences Center, Oklahoma City, OK 73104 (United States); Kler, Stanislav; Oppenheim, Ariella [Department of Hematology, Hebrew University-Hadassah Medical School, 91120 Jerusalem (Israel); Zlotnick, Adam, E-mail: azlotnic@indiana.ed [Department of Biochemistry and Molecular Biology, University of Oklahoma Health Sciences Center, Oklahoma City, OK 73104 (United States); Department of Molecular and Cellular Biochemistry, Indiana University, Bloomington, IN 47401 (United States)

2010-02-05T23:59:59.000Z

78

Search for the Rare Decays $J/\\psi \\to D_{S}^{-} \\pi^{+}$, $J/\\psi \\to D^{-} \\pi^{+}$, and $J/\\psi \\to \\bar D^{0} \\bar K^{0}$  

E-Print Network (OSTI)

Rare decay modes $J/\\psi \\to D_{S}^{-} \\pi^{+} + c.c.$, $J/\\psi \\to D^{-} \\pi^{+} + c.c.$, and $J/\\psi \\to \\bar D^{0} \\bar K^{0} + c.c.$ are searched for using 5.77$\\times 10^{7}$ $J/\\psi$ events collected with the BESII detector at the BEPC. No signal above background is observed. We present upper limits on the branching fractions $B(J/\\psi \\to D_{S}^{-} \\pi^{+})$ $<$ 1.4$\\times10^{-4}$, $B(J/\\psi \\to D^{-} \\pi^{+})$ $<7.5\\times10^{-5}$, and $B(J/\\psi \\to \\bar D^{0} \\bar K^{0})$ $<$ 1.7$\\times10^{-4}$ at the 90% confidence level.

Bai, J Z; Cai, X; Chen, H F; Chen, H S; Chen, H X; Chen, J C; Chen, Jin; Chen, Y B; Chu, Y P; Dai, Y S; Diao, L Y; Deng, Z Y; Dong, Q F; Du, S X; Fang, J; Fang, S S; Fu, C D; Gao, C S; Gao, Y N; Gu, S D; Gu, Y T; Guo, Y N; Guo, Z J; Harris, F A; He, K L; He, M; Heng, Y K; Hou, J; Hu, H M; Hu, J H; Hu, T; Huang, G S; Huang, X T; Ji, X B; Jiang, X S; Jiang, X Y; Jiao, J B; Jin, D P; Jin, S; Lai, Y F; Li, G; Li, H B; Li, J; Li, R Y; Li, S M; Li, W D; Li, W G; Li, X L; Li, X N; Li, X Q; Liang, Y F; Liao, H B; Liu, B J; Liu, C X; Liu, F; Liu, Fang; Liu, H H; Liu, H M; Liu, J; Liu, J B; Liu, J P; Liu, Jian; Liu, Q; Liu, R G; Liu, Z A; Lou, Y C; Lu, F; Lu, G R; Lu, J G; Luo, C L; Ma, F C; Ma, H L; Ma, L L; Ma, Q M; Mao, Z P; Mo, X H; Nie, J; Olsen, S L; Ping, R G; Qi, N D; Qin, H; Qiu, J F; Ren, Z Y; Rong, G; Ruan, X D; Shan, L Y; Shang, L; Shen, C P; Shen, D L; Shen, X Y; Sheng, H Y; Sun, H S; Sun, S S; Sun, Y Z; Sun, Z J; Tang, X; Tong, G L; Varner, G S; Wang, D Y; Wang, L; Wang, L L; Wang, L S; Wang, M; Wang, P; Wang, P L; Wang, W F; Wang, Y F; Wang, Z; Wang, Z Y; Wang, Zheng; Wei, C L; Wei, D H; Weng, Y; Wu, N; Xia, X M; Xie, X X; Xu, G F; Xu, X P; Xu, Y; Yan, M L; Yang, H X; Yang, Y X; Ye, M H; Ye, Y X; Yu, G W; Yuan, C Z; Yuan, Y; Zang, S L; Zeng, Y; Zhang, B X; Zhang, B Y; Zhang, C C; Zhang, D H; Zhang, H Q; Zhang, H Y; Zhang, J W; Zhang, J Y; Zhang, S H; Zhang, X Y; Zhang, Yiyun; Zhang, Z X; Zhang, Z P; Zhao, D X; Zhao, J W; Zhao, M G; Zhao, P P; Zhao, W R; Zhao, Z G; Zheng, H Q; Zheng, J P; Zheng, Z P; Zhou, L; Zhu, K J; Zhu, Q M; Zhu, Y C; Zhu, Y S; Zhu, Z A; Zhuang, B A; Zhuang, X A; Zou, B S

2007-01-01T23:59:59.000Z

79

Remaining Sites Verification Package for the 100-B-21:2 Subsite (100-B/C Discovery Pipeline DS-100BC-002), Waste Site Reclassification Form 2008-003  

SciTech Connect

The 100-B-21:2 waste site consists of the immediate area of the DS-100BC-02 pipeline. In accordance with this evaluation, the confirmatory and verification sampling results support a reclassification of this site to Interim Closed Out. The results of verification sampling show that residual contaminant concentrations do not preclude any future uses and allow for unrestricted use of shallow zone soils. The results also demonstrate that residual contaminant concentrations are protective of groundwater and the Columbia River.

J. M. Capron

2008-06-16T23:59:59.000Z

80

ds-branching-web.dvi  

NLE Websites -- All DOE Office Websites (Extended Search)

This This note will be revised after the new CLEO measurements of thirteen D + s branching fractions (P.U.E. Onyisi et al., Phys. Rev. D88, 032009 (2013)) are added to the Particle Listings. More than a dozen papers on the D + s , most of them from the CLEO experiment, have been published since the 2008 Review. We now know enough to attempt an overview of the branching fractions. Figure 1 shows a partial breakdown of the fractions. The rest of this note is about how the figure was constructed. The values shown make heavy use of CLEO measurements of inclusive branching fractions [1] For other data and references cited in the following, see the Listings. Modes with leptons: The bottom (20.0 ± 0.9)% of Fig. 1 shows the fractions for the exclusive modes that include leptons. Measured e + ν e fractions have been doubled to get the semileptonic ℓ + ν fractions. The sum of the exclusive e + ν e fractions is (6.9

Note: This page contains sample records for the topic "dl deltak ds" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


81

DS-0001 Deputy Secretary Decision  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

RONALD A. SORRI, Complainant v. L&M TECHNOLOGIES INC. AND SANDIA NATIONAL LABORATORIES, Respondents. OHA Case No. LWA-0001 FINAL DECISION AND ORDER On December 16, 1993, the Office...

82

Measurement of the Bs0 Lifetime in Fully and Partially Reconstructed Bs0 -> Ds- (phi pi-)X Decays in pp? Collisions at ?s = 1.96 TeV  

The authors present a measurement of the Bs0 lifetime in fully and partially reconstructed Bs0 = Ds0(??-)X decays in 1.3 fb-1 collected in pp? collisions at ?s = 1.96 Tev by the CDF II detector at the Fermilab Tevatron. They measure ?(Bs0) = 1.518 0.041 (stat.) 0.027 (syst.) ps. The ratio of this result and the world average B0 lifetime yields ?(Bs0)/?(B0) = 0.99 0.03, which is in agreement with recent theoretical predictions.

Aaltonen, T.; Gonzalez, B Alvarez; Amerio, S.; Amidei, D.; Anastassov, A.; Annovi, A.; Antos, J.; Apollinari, G.; Appel, J.A.; Apresyan, A.; Arisawa, T.

2011-12-29T23:59:59.000Z

83

NISF sub-group 04 March 2010  

E-Print Network (OSTI)

Woodland/ forest area (1(1--6)6) ·· Number of conifer species > 1% coverNumber of conifer species > 1% cover (21 NISF sub-group 04 March 2010 Belvoir Park Forest ­ Exhibition Room Chair: Dr Declan Looney (DL) Attendees (JL) Jon Lees -NIEA (DL) Declan Looney -NIEA (JG) John Griffin -Forest Service (DS) Richard

84

DOE Notice of Availability of the Supplement to the Draft Environmental Impact Statement for the Gilberton Coal-to-Clean Fuels and Power Project (DOE/EIS-0357D-S1)(01/16/07)  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

0 Federal Register 0 Federal Register / Vol. 72, No. 9 / Tuesday, January 16, 2007 / Notices Dated: December 19, 2006. M. A. Harvison, Lieutenant Commander, Judge Advocate General's Corps, U.S. Navy, Federal Register Liaison Officer. [FR Doc. 07-115 Filed 1-12-07; 8:45 am] BILLING CODE 3810-FF-M DEPARTMENT OF ENERGY Notice of Availability of the Supplement to the Draft Environmental Impact Statement for the Gilberton Coal-to-Clean Fuels and Power Project AGENCY: Department of Energy. ACTION: Notice of availability. SUMMARY: The U.S. Department of Energy (DOE) announces the availability for public comment of a Supplement to the Draft Environmental Impact Statement for the Gilberton Coal-to- Clean Fuels and Power Project (DOE/ EIS-0357D-S1), prepared in response to comments on the original Draft

85

dlCC Opt: Optimization Software for Renewable Energy Projects...  

NLE Websites -- All DOE Office Websites (Extended Search)

indicators of project opportunities. Many existing programs require the user to enter the size (kW) of the renewable energy system in order to start calculations. However,...

86

DL-940 1/08 Animal Health Diagnostic Center  

E-Print Network (OSTI)

These are instructions for collecting specimens for Campylobacter fetus culture fluorescent antibody and Tritrichomonas with protective sheath 5. Sterile rubber bulb (return to lab for credit to your account) Needed but not supplied by the AHDC 6. Syringe (3cc) and needle Procedures 1. Attach rubber bulb to collection catheter 2

Keinan, Alon

87

SSC-DL Version 1.0 SIRTF Science Center  

E-Print Network (OSTI)

-SED 6741 Code walk-through fixes/updates to "LoadIrsaPtgMetaData" perl subroutine. 6735 New module-masked pixels are NaN'd in final mips24 BCD products.. 6710 Update GenSBPHFsForCampaign.pl following comments from code walk-thru.. 6679 Update w_po

Masci, Frank

88

18 Modeling high-performance HBTs D.L. Pulfrey  

E-Print Network (OSTI)

an acceptable base resistance. A short base width leads directly to an improved cut-off frequency, fT , which, when coupled with the lower base resistance, leads to an improved oscillation frequency, fmax. These consideration is also given to the incorporation of the compact model for JC into a large-signal equivalent

Pulfrey, David L.

89

HyDS Modeling Environment (Presentation)  

SciTech Connect

Presented at the 2006 DOE Hydrogen, Fuel Cells & Infrastructure Technologies Program Annual Merit Review in Washington, D.C., May 16-19, 2006.

Parks, K.

2006-05-01T23:59:59.000Z

90

Measurement of the Ds(+) -> eta l(+)nu and Ds(+) ? eta'l(+)nu branching ratios  

E-Print Network (OSTI)

Using the CLEO II detector we measure B(D-s(+) --> eta e(+)nu)/B(D-s(+) --> phi e(+)nu) = 1.24 +/- 0.12 +/- 0.15, B(D-s(+) --> eta'e(+)nu)/B(D-s(+) --> phi e(+)nu) = 0.43 +/- 0.11 +/- 0.07, and B(D-s(+) --> eta'e(+)nu)/B(D-s(+) --> eta e(+)nu) = 0...

Ammar, Raymond G.; Baringer, Philip S.; Bean, Alice; Besson, David Zeke; Coppage, Don; Copty, N.; Davis, Robin E. P.; Hancock, N.; Kotov, S.; Kravchenko, I.; Kwak, Nowhan

1995-11-01T23:59:59.000Z

91

Roadmap: Digital Sciences Digital Systems Analysis Bachelor of Science [DS-BS-DS-DSA  

E-Print Network (OSTI)

writing-intensive course requirement; offered in spring only TECH 36411 Requirements Engineering Responsibility 3 Offered in spring only DSCI 13210 Design Processes and Principles 3 Offered in spring only MIS Management and Processing 3 Offered in spring only DSCI 15310 Computational Thinking and Programming 3 DSCI

Sheridan, Scott

92

Roadmap: Digital Sciences Enterprise Architecture Bachelor of Science [DS-BS-DS-ENAR  

E-Print Network (OSTI)

Fulfills writing-intensive course requirement; offered in spring only TECH 36411 Requirements Engineering Responsibility 3 Offered in spring only DSCI 13210 Design Processes and Principles 3 Offered in spring only MIS Management and Processing 3 Offered in spring only CS 23001 Computer Science II-Data Structures

Sheridan, Scott

93

Matrix-Free Interior Point Method  

E-Print Network (OSTI)

Oct 5, 2009 ... while [10] regularizes the Hessian matrix (what in our terms would correspond ...... path following algorithm in which the Newton search directions are com- ... element in DS is selected to be the next pivot to enter DL, then the...

2009-10-07T23:59:59.000Z

94

Measurement of the Branching Fractions of the Rare Decays B0 to Ds(*)+pi-,B0 to Ds(*)+rho-, and B0 to Ds(*)-K(*)+  

SciTech Connect

The authors report the measurement of the branching fractions of the rare decays B{sup 0} {yields} D{sub s}{sup (*)+} {pi}{sup -}, B{sup 0} {yields} D{sub s}{sup (*)+} {rho}{sup -}, and B{sup 0} {yields} D{sub s}{sup (*)-} K{sup (*)+} in a sample of 381 x 10{sup 6} {Upsilon}(4S) decays into B{bar B} pairs collected with the BABAR detector at the PEP-II asymmetric-energy e{sup +}e{sup -} storage ring. They present evidence for the decay B{sup 0} {yields} D{sub s}{sup -} K*{sup +} and the vector-vector decays B{sup 0} {yields} D{sub s}{sup *+} {rho}{sup -} and B{sup 0} {yields} D{sub s}{sup *-} K{sup *+}, as well as the first measurement of the vector meson polarization in these decays. They also determine the ratios of the CM-suppressed to CKM-favored amplitudes r(D{sup (*)}{pi}) and r(D{sup (*)}{rho}) in decays B{sup 0} {yields} D{sup (*)}{sup {+-}}{pi}{sup {-+}} and B{sup 0} {yields} D{sup (*)}{sup {+-}}{rho}{sup {-+}}, and comment on the prospects for measuring the Cp observable sin(2{beta} + {gamma}).

Aubert, B.; Bona, M.; Karyotakis, Y.; Lees, J.P.; Poireau, V.; Prencipe, E.; Prudent, X.; Tisserand, V.; /Annecy, LAPP; Garra Tico, J.; Grauges, E.; /Barcelona U., ECM; Lopez, L.; Palano, A.; Pappagallo, M.; /Bari U.; Eigen, G.; Stugu, B.; Sun, L.; /Bergen U.; Abrams, G.S.; Battaglia, M.; Brown, D.N.; Button-Shafer, J.; Cahn, R.N.; /Energy Sci. Network /Birmingham U. /Ruhr U., Bochum /Bristol U. /British Columbia U. /Brunel U. /Novosibirsk, IYF /UC, Irvine /UCLA /UC, Riverside /UC, San Diego /UC, Santa Barbara /UC, Santa Cruz /Caltech /Cincinnati U. /Colorado U. /Colorado State U. /Dortmund U. /Dresden, Tech. U. /Ecole Polytechnique /Edinburgh U. /Ferrara U. /Frascati /Genoa U. /Harvard U. /Heidelberg U. /Imperial Coll., London /Iowa U. /Iowa State U. /Johns Hopkins U. /Karlsruhe U. /Orsay, LAL /LLNL, Livermore /Liverpool U. /Queen Mary, U. of London /Royal Holloway, U. of London /Louisville U. /Manchester U. /Maryland U. /Massachusetts U., Amherst /MIT, LNS /McGill U. /Milan U. /INFN, Milan /Mississippi U. /Montreal U. /Mt. Holyoke Coll. /Naples U. /NIKHEF, Amsterdam /Notre Dame U. /Ohio State U. /Oregon U. /Padua U. /Paris U., VI-VII /Pennsylvania U. /Perugia U. /Pisa U. /Princeton U. /INFN, Rome /Rostock U. /Rutherford /DSM, DAPNIA, Saclay /South Carolina U. /SLAC /Stanford U., Phys. Dept. /SUNY, Albany /Tennessee U. /Texas U. /Texas U., Dallas /Turin U. /INFN, Turin /Trieste U. /Valencia U., IFIC /Victoria U. /Warwick U. /Wisconsin U., Madison

2008-04-16T23:59:59.000Z

95

ds_branching_s034dsb-web.dvi  

NLE Websites -- All DOE Office Websites (Extended Search)

More More than a dozen papers on the D + s , most of them from the CLEO experiment, have been published since the 2008 Review. We now know enough to attempt an overview of the branching fractions. Figure 1 shows a partial breakdown of the fractions. The rest of this note is about how the figure was constructed. The values shown make heavy use of CLEO measurements of inclusive branching fractions [1] For other data and references cited in the following, see the Listings. Modes with leptons: The bottom (20.0 ± 0.9)% of Fig. 1 shows the fractions for the exclusive modes that include lep- tons. Measured e + ν e fractions have been doubled to get the semileptonic ℓ + ν fractions. The sum of the exclusive e + ν e frac- tions is (6.9 ± 0.4)%, consistent with an inclusive semileptonic e + ν e measurement of (6.5 ± 0.4)%. There seems to be little missing here. Inclusive hadronic KK fractions: The Cabibbo-favored

96

H:\B\FINALS\ds-subtask2.3.wpd  

Office of Scientific and Technical Information (OSTI)

SUBTASK 2.3 - CARBON DIOXIDE SUBTASK 2.3 - CARBON DIOXIDE SEQUESTERING USING MICROALGAL SYSTEMS Final Report (For the period April 15, 1998, through November 30, 2001) Prepared for: AAD Document Control U.S. Department of Energy National Energy Technology Laboratory 626 Cochrans Mill Road, MS 921-107 Pittsburgh, PA 15236-0940 Cooperative Agreement No. DE-FC26-98FT40320 Performance Monitor: Dr. Heino Beckert Prepared by: Daniel J. Stepan Richard E. Shockey Thomas A. Moe Ryan Dorn Energy & Environmental Research Center University of North Dakota PO Box 9018 Grand Forks, ND 58202-9018 2002-EERC-02-03 February 2002 DISCLAIMER This report was prepared as an account of work sponsored by an agency of the United States Government. Neither the United States Government, nor any agency thereof, nor any of their

97

Gauss-Bonnet black holes in dS spaces  

Science Journals Connector (OSTI)

We study the thermodynamic properties associated with the black hole horizon and cosmological horizon for the Gauss-Bonnet solution in de Sitter space. When the Gauss-Bonnet coefficient is positive, a locally stable small black hole appears in the case of spacetime dimension d=5, the stable small black hole disappears, and the Gauss-Bonnet black hole is always unstable quantum mechanically when d>~6. On the other hand, the cosmological horizon is found to be always locally stable independent of the spacetime dimension. But the solution is not globally preferred; instead, the pure de Sitter space is globally preferred. When the Gauss-Bonnet coefficient is negative, there is a constraint on the value of the coefficient, beyond which the gravity theory is not well defined. As a result, there is not only an upper bound on the size of black hole horizon radius at which the black hole horizon and cosmological horizon coincide with each other, but also a lower bound depending on the Gauss-Bonnet coefficient and spacetime dimension. Within the physical phase space, the black hole horizon is always thermodynamically unstable and the cosmological horizon is always stable; furthermore, as in the case of the positive coefficient, the pure de Sitter space is still globally preferred. This result is consistent with the argument that the pure de Sitter space corresponds to an UV fixed point of dual field theory.

Rong-Gen Cai and Qi Guo

2004-05-26T23:59:59.000Z

98

HAI\\DS-ONMETEOROLOGY Stories,Theories,and Simple Experiments  

E-Print Network (OSTI)

were drafts ftom the ave of drc Creek god Aeolu. In Sicyon, an altar wd raised to praGe winds, md many particles (atoms) in a small space. When the space was large and the nlmbo of partides was snall

Short, Daniel

99

Young PhDs in Physics | Jefferson Lab  

NLE Websites -- All DOE Office Websites (Extended Search)

that explored matter through science. The students conducted an experiment studying the insulation properties of different materials and, firsthand, saw how ultraviolet (UV)...

100

Leptonic $D_s$ decays at $B$-factories  

E-Print Network (OSTI)

We review recent measurements of leptonic $D_s$-meson decays performed by Belle and BaBar collaborations. Described measurements enable experimental extraction of the $D_s$-meson decay constant which can be compared with lattice QCD calculations.

A. Zupanc

2013-01-30T23:59:59.000Z

Note: This page contains sample records for the topic "dl deltak ds" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


101

SUMMER SCHOOL CLASS OF INTEREST --2012 DS 501 Special Topics  

E-Print Network (OSTI)

, leapfrogging and emotionally sustainable design. We will build a holistic model of sustainable fashion; look (Sustainability) Issues AKA "I Want to Change the World" Meets MTWR evenings, 5:30-8:00 June 25-July 19 (3 credits designers are emerging as visionaries for the future; they are working to solve everyday sustainability

Sheridan, Jennifer

102

Evidence for the Rare Decay B+ to Ds+ pi0  

SciTech Connect

The authors have searched for the rare decay B{sup +} {yields} D{sub s}{sup +}{pi}{sup 0}. The analysis is based on a sample of 232 million {Upsilon}(4S) {yields} B{bar B} decays collected with the BABAR detector at the PEP-II e{sup +}e{sup -} storage ring. They find 19.6 signal events, corresponding to a significance of 4.7 {sigma}. The extracted signal yield including statistical and systematic uncertainties is 20.1{sub -6.0-1.5}{sup +6.8+0.4}, and they measure {Beta}(B{sup +} {yields} D{sub s}{sup +}{pi}{sup 0}) = (1.5{sub -0.4}{sup +0.5} {+-} 0.1 {+-} 0.2) x 10{sup -5}, where the first uncertainty is statistical, the second is systematic, and the last is due to the uncertainty on the D{sub s}{sup +} decay and its daughter decay branching fractions.

Aubert, B.

2006-11-17T23:59:59.000Z

103

u.s. Dl!PARThIENT OF ENERGY EERE PROJECT MANAGEMENT CENTER NEPA DETERMINATION  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

PARThIENT OF ENERGY PARThIENT OF ENERGY EERE PROJECT MANAGEMENT CENTER NEPA DETERMINATION Page 1 of2 RECIPIENT: University of Oregon STATE: OR PROJECT TITLE: Vapor Transport Deposition for Thin Film III-V Photovoltaics fo'unding Opportunity Announcement Number Procurement Instrument Number NEPA Control Number CID Number DE-FOA..()()()()654 DE-EEOOO5957 GF0-0005957·0Q1 Based on my review of the information concerning the proposed action, as NI<:PA Compliance Officer (authorized under DOE Order 451.1A), I have made the following determination : ex, EA, EIS APPENDIX AND NUMBER: Description: A9 Information gathering, analysis, and dissemination Information gathering (including, but not limited to, literature surveys, inventories, site visits, and audits). data analysis (including, but not limited to, computer modeling), document preparation

104

u.s. Dl!PAR1'M:ENT OF ENERGY EERE PROJECT MANAGEMENT CENTER  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

PAR1'M:ENT OF ENERGY PAR1'M:ENT OF ENERGY EERE PROJECT MANAGEMENT CENTER NEPA DETERlIIINATION RECIPIENT :University of California San Diego PROJECT TITL.E: San Diego Center for Algae Biotechnology Page 1 of2 STATE: CA Funding Opportunity Announcement Number Procurement Instnlment Number NEPA Control Number em Number EEOOO3142 GF0-10-582 EE3142 Based on my review ortbe information concerning the proposed action, as NEPA Compliance Officer (authorukd under DOE Order 451.1A), I have made the following determination: ex, EA, EIS APPENDIX AND NUMBER: Description: 83.6 Siting . construction (or modification), operation, and deoommissioning of facilities for indoor bench-scale research projects and conventional laboratory operations (for example. preparation of chemical standards and sample analYSIS):

105

u.s. Dl!PARTMENT OF ENERGY EERE PROJECT MANAGEMENT CENTER Nl!PA DETERMINATION  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

PARTMENT OF ENERGY PARTMENT OF ENERGY EERE PROJECT MANAGEMENT CENTER Nl!PA DETERMINATION RECIPIENT:WA Dept of Commerce Page 1 of3 STATE: WA PROJECT TITLE: SEP ARRA · WSU Anaerobic Digester - Nutrient Recovery Technology - Vander Haak Dairy Funding Opportunity Announcement Number Procurement Instrument Number NEPA Control Number CID Number EEOOOO139 GF0-0000139-040 0 Based on my review of the Information concerning the proposed action, as NEPA Compliance Officer (authorized under DOE Order 4S1.1A), I have made tbe following determination: ex, EA, EIS APPENDIX AND NUMBER: Description: A9 Information gathering, analysis, and dissemination Information gathering (including, but not limited to, literature surveys, inventories, site visils, and audits), data analysis (including

106

Data Compression and Harmonic Analysis D.L. Donoho, M. Vetterli,  

E-Print Network (OSTI)

, Littlewood­Paley theory, Sampling Theorem. ``Like the vague sighings of a wind at even, That wakes perhaps less familiar to the Information Theory community, growing out of the field of harmonic analysis analysis in this century. Typically, the problems and achievements of this field have involved goals

Donoho, David

107

Data Compression and Harmonic Analysis D.L. Donoho, M. Vetterli,  

E-Print Network (OSTI)

, Littlewood-Paley theory, Sampling Theorem. "Like the vague sighings of a wind at even, That wakes perhaps less familiar to the Information Theory community, growing out of the field of harmonic analysis analysis in this century. Typically, the problems and achievements of this field have involved goals

Donoho, David

108

TFI: RTEfuST, T{ ftd rDl-.I: 91.1.1.41493997  

E-Print Network (OSTI)

, windows, ventilators and partitions with extruded built up standard tubular sections/ appropriate Z for glazing I paneling, C.p. Oiass / stainless steel screws, all complete as per archjtectural drawings in aluminum doors, windows shutters and partition frames with C.p. brass / stainless steel screws etc

Bandyopadhyay, Antar

109

TRIAC: A code for track measurements using image analysis tools D.L. Patiris a  

E-Print Network (OSTI)

.G. Ioannides a,* a Nuclear Physics Laboratory, Department of Physics, University of Ioannina, 451 10 Ioannina State Nuclear Track Detectors CR39. The program using image analysis tools counts the number of tracks for dosimetry proposes and classifies the tracks according to their radii for the spectrometry of alpha

Blekas, Konstantinos

110

A. E. K.Ris Ris-M-Dl^ Title and author(s)  

E-Print Network (OSTI)

Mechanics to Prer.oure Vocicel Reliability Analysis ty P.E. Becher and Arne Pedersen pages + tables -f- 16 OF STATISTICAL LINEAR ELASTIC FRACTURE MECHANICS TO PRESSURE VESSEL RELIABILITY ANALYSIS P.E. BECHER, A. PEDERSEN sampling. Copies to Library Reactor 100 50 Abstract to Available on request from the Library of the Danish

111

The foundational inequalities of D.L. Burkholder and some of their ...  

E-Print Network (OSTI)

Aug 3, 2011 ... multipliers obtained by projections (conditional expectations) of trans- formations of ...... of conformally invariant energy functionals and regularity of solutions to the generalized .... The Poisson process ??(t) of intensity ? arises from (0,0, ??1), where ?1 is the Dirac ...... other techniques, in the near future.

2011-08-03T23:59:59.000Z

112

Measurement of the B -> Dl nu branching fractions and form factor  

E-Print Network (OSTI)

J. Lee, 19 H. Schwarthoff, 19 A. Wolf, 19 M.M. Zoeller, 19 S.J. Richichi, 20 H. Severini, 20 P. Skubic, 20 A. Undrus, 20 M. Bishai, 21 S. Chen, 21 J. Fast, 21 J.W. Hinson, 21 N. Menon, 21 D.H. Miller, 21 E.I. Shibata, 21 I.P.J. Shipsey, 21 S. Glenn... efficiency and the smearing in ?w. The fraction of D 0 , 2 ?n decays in each w bin that is recon- structed is 17% to 21% and the average ?w resolution is 0.026, about one-half the bin width. The small statistical uncertainty in e ij is represented by s 2 e ij...

Ammar, Raymond G.; Baringer, Philip S.; Bean, Alice; Besson, David Zeke; Coppage, Don; Darling, C.; Davis, Robin E. P.; Kotov, S.; Kravchenko, I.; Kwak, Nowhan; Zhou, L.

1999-05-01T23:59:59.000Z

113

Transitional Cell Hyperplasia in the Bladders of Dogs Fed dl-Tryptophan  

Science Journals Connector (OSTI)

...these experiments add further fuel to the concept that tryptophan...available at a more resonable price, and a feeding experiment designed...REFERENCES 1. Brown, R. R., Price, J. M., Friedell, G. H...T., Brown, R. R., and Price, J. M. Incidence of Mouse...

J. L. Radomski; E. M. Glass; and William B. Deichmann

1971-11-01T23:59:59.000Z

114

Matematik Dnyas>, 2003 K>fl Tbitak Bilim dl (1979) sahibi, k>rk do-  

E-Print Network (OSTI)

> ayn> üniversiteden 1953'te ald>. 1960'da Ege ?niversitesi T>p Fakültesi'nde "yabanc> ma- tematik ve- l>flt>. Ege ?niversitesi'nde doçent (1965) ve profe- sör (1967) oldu. 1969-76 y>llar> aras>nda OD>rma Merke- zi'nde, 1995-97'de Gebze'de, Elektronik ve Krip- toloji Araflt>rma Merkezi'nde görev ald>. 1997

Sertöz, Ali Sinan

115

ISSN:1575-6807 D.L.: GC-1317-1999  

E-Print Network (OSTI)

Universitario de Ciencias y Tecnologías Cibernéticas Universidad de Las Palmas de Gran Canaria Campus de Tafira) Universidad de Las Palmas de Gran Canaria (ULPGC) Las Palmas de Gran Canaria December 4-6, 2003 Organized Editorial Commite in alphabetic order · Alvarez Luis (Universidad de Las Palmas de Gran Canaria) · Baumela

Granada, Universidad de

116

DOE/SC-ARM-13-003 ARM Lead Mentor Selection Process DL Sisterson  

NLE Websites -- All DOE Office Websites (Extended Search)

of the instrument system in a timely manner. * Use the Data Quality Problem Report (DQPR) process to alert the Site Scientist Team and Site Operations Team to problems with the...

117

Publications for T.G. Caldwell My ResearcherID: H51292011 at http://www.researcherid.com/rid/H51292011  

E-Print Network (OSTI)

shrublands: Biotic and abiotic processes. Water Resources Research 48, W09551, doi:10.1029/2012WR011963, D.L. Hughson, E.V. McDonald, and D.M. Miller (eds.) The Mojave Desert: Ecosystem Processes, Nottingham, UK. Shafer, D.S., M.H. Young, S.F. Zitzer, T.G. Caldwell and E.V. McDonald (2007), Interrelated

Yang, Zong-Liang

118

A study of the back contacts on CdTe/CdS solar cells D.L. Batznera  

E-Print Network (OSTI)

Institute of Technology, Zu?rich, Technoparkstr. 1, 8005 Zu?rich, Switzerland b ANTEC GmbH, Industriestrasse 2-4, 65779 Kelkheim, Germany Abstract Conventional back contacts on CdTe/CdS solar cells layer thickness and stability issues have been studied. Different etchants not only clean the Cd

Romeo, Alessandro

119

Frank Masci (1)MIPS D/L Review (S6), August 7, 2001 Optical Distortion and its Representation  

E-Print Network (OSTI)

-imaged focal planes. l Distortion is significant. Code-V optical ray trace models: 4.7% (24µm), 7.9% (70µm No re-gridding is done to make the BCD and correct for distortion. Instead, the distortion

Masci, Frank

120

G. B. Shaw's conception of the heroic character as related to his theory of Creative Evolution  

E-Print Network (OSTI)

, respectively, upon the characterization of the following major figures: Eugene Marchbanks in Candida, Julius Caesar in Caesar dolt, Jh T M d~S*, Ad 1th Cusins in M~a'or Barbara, and Joan of Arc in Saint Joan. In addition, these chapters stress the highly... of major characters in five of Shaw's most influential plays--Eugene Marchbanks in Cd'd, J1C*'C*d~dl* t, Jk 1 t ' M d~d*AMA, Ad Jpt C ' ' M~ Barbara, and Joan of Arc in Saint Joan--it is my aim to emphasize that each of these dramatic personages illus...

Rodriguez, Katherine Ann Steele

1972-01-01T23:59:59.000Z

Note: This page contains sample records for the topic "dl deltak ds" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


121

C:\DS\97-2238, Rev. 8 - Final.wpd  

NLE Websites -- All DOE Office Websites (Extended Search)

WIPP-97-2238 WIPP-97-2238 Periodic Confirmatory Measurement Protocol for the Waste Isolation Pilot Plant United States Department of Energy Waste Isolation Pilot Plant Carlsbad Field Office Carlsbad, New Mexico Revision 8 August 2008 This document supersedes DOE/WIPP-97-2238, Revision 7. Working Copy Periodic Confirmatory Measurement Protocol for the Waste Isolation Pilot Plant DOE/WIPP-97-2238, Rev. 8 TABLE OF CONTENTS 1.0 INTRODUCTION . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 4 2.0 CLASSIFICATION OF RELEASE POINTS . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 4 3.0 MEASUREMENT PROTOCOL . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 5 4.0 EFFLUENT MONITORING DURING NORMAL ACTIVITIES . . . . . . . . . . . . . . . 6 5.0 EFFLUENT MONITORING DURING KNOWN OR SUSPECTED RELEASES . . 6 6.0 FLOW RATE MEASUREMENTS . . . . . . . . . . . . . . .

122

C:\DS\99-3119, Rev. 5 - Final.wpd  

NLE Websites -- All DOE Office Websites (Extended Search)

WIPP 99-3119 WIPP 99-3119 Compliance Monitoring Implementation Plan for 40 CFR §191.14(b), Assurance Requirement U.S. Department of Energy Revision 5 December 2007 This document supersedes Revision 4.1 of DOE/WIPP 99-3119. Working Copy Compliance Monitoring Implementation Plan DOE/WIPP 99-3119, Rev. 5 This document has been submitted as required to: Office of Scientific and Technical Information P.O. Box 62 Oak Ridge, TN 37831 (865) 576-8401 Additional information about this document may be obtained by calling 1-800-336-9477. Copies may be obtained by contacting the National Technical Information Service, U.S. Department of Commerce, 5285 Port Royal Road, Springfield, VA 22101. Working Copy Compliance Monitoring Implementation Plan DOE/WIPP 99-3119, Rev. 5 TABLE OF CONTENTS ABBREVIATIONS AND ACRONYMS

123

C:\DS\09-2225 Final with Errata Page.wpd  

NLE Websites -- All DOE Office Websites (Extended Search)

9-2225 9-2225 Waste Isolation Pilot Plant Annual Site Environmental Report for 2008 U.S. Department of Energy September 2009 Waste Isolation Pilot Plant Annual Site Environmental Report for 2008 DOE/WIPP-09-2225 This document has been submitted as required to: Office of Scientific and Technical Information P.O. Box 62 Oak Ridge, TN 37831 Prices available from (865) 576-8401 Additional information about this document may be obtained by calling (800) 336-9477. Copies may be obtained by contacting the National Technical Information Service, U.S. Department of Commerce, 5285 Port Royal Road, Springfield, VA 22161 Processing and final preparation of this report was performed by the Waste Isolation Pilot Plant Management and Operating Contractor for the U.S. Department of Energy

124

Supporting a scholars online identity with VIVO and ORCiDs  

E-Print Network (OSTI)

- External sources (e.g., Scopus, PubMed...) Provides a review and editing interface - Single sign-on for self-editing or by proxy Provides integrated, filterable feeds to other websites Introduction to VIVO. Jon Corson-Rikert, Kristi Holmes, Brian...-Rikert, Kristi Holmes, Brian Lowe, Julia Trimmer, and Alex Viggio, VIVO 2013, St. Louis, Missouri July 17, 2014 VIVO models: People and more - Organizations, grants, programs, projects, publications, events, facilities, and research resources...

Ilik, Violeta

2014-07-22T23:59:59.000Z

125

2004 Microchip Technology Inc. DS00907A-page 1 INTRODUCTION  

E-Print Network (OSTI)

OF STEPPING MOTORS There are three basic types of stepping motors: permanent magnet, variable reluctance and hybrid. This application note covers all three types. Permanent magnet motors have a magnetized rotor of both permanent magnet and variable reluctance technology. The stator, or stationary part

Jones, Douglas W.

126

R.H. Shumway and D.S. Stoffer Time Series Analysis and Its Applications  

E-Print Network (OSTI)

.1) and below: Write wti instead of wit, and write cov(wti, wtj) instead of cov(wit, wjt) for consistency. · p

127

10. Practice sheet for the lecture: Felsner/Heldt, Knauer Combinatorics (DS I) 10. June  

E-Print Network (OSTI)

in t. (a) Give an interpretation for fk. (Hint: Consider the action of G on D k and the CFB Lemma) (b are there, such that no rook can attack another one? (Hint: Use the CFB Lemma) How many distinct

Felsner, Stefan

128

The Capsid Proteins of a Large, Icosahedral dsDNA Virus  

E-Print Network (OSTI)

Paramecium bursaria chlorella virus 1 Vp54 MCP. This model was fitted into the cryoEM density for eachEM, cryoelectron microscopy; MCP, major capsid protein; PBCV-1, Paramecium bursaria chlorella virus type 1; PpV01

Baker, Timothy S.

129

2000 Fairchild Semiconductor Corporation DS009553 www.fairchildsemi.com Revised October 2000  

E-Print Network (OSTI)

/IIL HIGH/LOW Output IOH/IOL OE1, OE2 3-STATE Output Enable Input (Active LOW) 1.0/1.0 20 µA/-0.6 mA In Inputs 1.0/1.0 20 µA/-0.6 mA On, On Outputs 600/106.6 (80) -12 mA/64 mA (48 mA) Inputs Outputs OE1 OE2 I Pin -0.5V to +7.0V Input Voltage (Note 2) -0.5V to +7.0V Input Current (Note 2) -30 mA to +5.0 mA

Jain, Amit

130

AT2 DS II - Accelerator System Design (Part II) - CCC Video Conference  

SciTech Connect

Discussion Session - Accelerator System Design (Part II) Tutors: C. Darve, J. Weisend II, Ph. Lebrun, A. Dabrowski, U. Raich Video Conference with the CERN Control Center. Experts in the field of Accelerator science will be available to answer the students questions. This session will link the CCC and SA (using Codec VC).

None

2010-12-17T23:59:59.000Z

131

Goal Seek pamphlet for VIDRA - DLID using Microsoft Excel 200[DS1]7  

E-Print Network (OSTI)

obtained at http://www.experts-exchange.com and http://www.dslimited.biz/excel_tutorials/goalseek.html using Google? Images at http://images.google.com/imghp Cover page graphic obtained at http://pubs.usgs.gov/fs/1997/fs-098-97/fig1.htm using Google...

Sturdivant, A. W.; Rister, M.; Lacewell, R. D.; Rogers, C.

132

The Garching-Bonn Deep Survey (GaBoDS) Wide-Field-Imaging Reduction Pipeline  

E-Print Network (OSTI)

We introduce our publicly available Wide-Field-Imaging reduction pipeline THELI. The procedures applied for the efficient pre-reduction and astrometric calibration are presented. A special emphasis is put on the methods applied to the photometric calibration. As a test case the reduction of optical data from the ESO Deep Public Survey including the WFI-GOODS data is described. The end-products of this project are now available via the ESO archive Advanced Data Products section.

H. Hildebrandt; T. Erben; M. Schirmer; J. P. Dietrich; P. Schneider

2007-05-03T23:59:59.000Z

133

SAR Endolysin Regulation in dsDNA Phage Lysis of Gram-Negative Hosts  

E-Print Network (OSTI)

.......................................................................... 2 S hole formation ............................................................................. 4 Endolysins ...................................................................................... 6 T4 lysozyme mechanism... ....................................................................... 90 DUF847 superfamily ..................................................... 91 Amidases ........................................................................ 91 Peptidases...

Kuty, Gabriel

2012-02-14T23:59:59.000Z

134

CODE-TIMING SYNCHRONIZATION IN DS-CDMA SYSTEMS USING SPACE-TIME DIVERSITY  

E-Print Network (OSTI)

: 1997FI 00755 APDT, TIC96-0500-C10- 01, TIC98-0412, TIC98-0703, , CIRIT 1998SGR-00081. of the other

Swindlehurst, A. Lee

135

DECLARACION DE PATRIMONIO PARA FUNCIONARIOS Y AUTORIDADES FORMULARIO DEL DS. N0 45, DE 2006,  

E-Print Network (OSTI)

Automovil ANO DEFABRlCACION Jepo 0 carmonete 1980vehkuto de carga vehiculo de trensporte de pasajeros NUMERO

Rapaport, Iván

136

Generalizing the DS-Methods for Testing Non-Deterministic FSMs  

Science Journals Connector (OSTI)

......of work devoted to so-called complete tests which guarantee the detection of all the...Several methods for generating complete tests for finite state machines (FSMs) which...extended to non-deterministic FSMs to test for trace inclusion. In this paper, we......

Alexandre Petrenko; Adenilso Simao

2014-11-01T23:59:59.000Z

137

CROSS-LAYER OPTIMIZATION WITH POWER CONTROL IN DS-CDMA VISUAL SENSOR NETWORKS  

E-Print Network (OSTI)

There has been a rapidly increasing demand for real-time video transmission over wireless networks. Sensor con- straints required for video transmission. These networks are com- prised of typically low in order to request changes in transmission parameters, such as source coding rate, channel coding rate

Kondis, Lisimachos Paul

138

2000 Fairchild Semiconductor Corporation DS006381 www.fairchildsemi.com August 1986  

E-Print Network (OSTI)

for use in BCD nine's complement applications. To use their maximum count length (decade or four bit 45 mW s Count frequency 42 MHz Ordering Code: Devices also available in Tape and Reel. Specify by appending the suffix letter "X" to the ordering code. Connection Diagram Reset/Count Truth Table Order

Ravikumar, B.

139

3. Practice sheet for the lecture: Felsner/ Tiwary, Heldt Combinatorics (DS I) 06. Mai  

E-Print Network (OSTI)

. With each step she moves up one or two stairs. Give a generating function for the number of ways to reach start at (0, 0) and in each step you either go one unit up, down, left or right. So for example from (2, -3) you can reach (2, -2), (2, 4), (1, -3) and (3, -3) with one step. How many different tours can

Felsner, Stefan

140

3. Practice sheet for the lecture: Felsner/ Tiwary, Heldt Combinatorics (DS I) 06. Mai  

E-Print Network (OSTI)

start at (0, 0) and in each step you either go one unit up, down, left or right. So for example from (2 # # i=0 b i z i in terms of # # j=0 a j z j . (b) A child walks up a staircase. With each step she moves up one or two stairs. Give a generating function for the number of ways to reach the n­th stair. How

Felsner, Stefan

Note: This page contains sample records for the topic "dl deltak ds" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


141

The University of Glasgow, charity number SC004401 DS/SREP 27/08/2010  

E-Print Network (OSTI)

Courtial) 5 Radiation Protection Supervisor (Mr. P. T. Barbour) 6 Fire Prevention 6 Fire Alarm Testing 7 AND EMERGENCY PLAN Twelfth Edition ­ 2010 The regulations contained in this document supersede all earlier Working Outwith Normal Hours 7 General Safety 8 Use of Display Screen Equipment 9 Emergency Plan 11

Glasgow, University of

142

Burst Mode Operation of a DS-DBR Widely Tunable Laser for Wavelength Agile System Applications  

Science Journals Connector (OSTI)

Novel measurements of signal Q-factor as a function of time across an optical burst and implementation of a fast control system, giving 3 orders of magnitude switching speed and...

Puttnam, Ben; Bianciotto, Alessandro; Dueser, Michael; Thomsen, Benn C; Gaudino, Roberto; Bayvel, Polina; Busico, Giacinto; Ponnampalam, Lalitha; Robbins, David; Whitbread, Neil

143

Penetration tests on the DS-2 Mars microprobes: penetration depth and impact accelerometry  

E-Print Network (OSTI)

terminal ballistics of projectiles has been a subject of investigation for centuries and some crude Materials Research and Test Center (EMRTC) operated by New Mexico Tech in Socorro, New Mexico. The evolution

Lorenz, Ralph D.

144

Epoxy, ZnO, and PTFE nanocomposite: friction and wear optimization N.L. McCook, B. Boesl, D.L. Burris and W.G. Sawyer*  

E-Print Network (OSTI)

Epoxy, ZnO, and PTFE nanocomposite: friction and wear optimization N.L. McCook, B. Boesl, D and increase the wear resistance of epoxy, nanoparticles of zinc oxide and polytetrafluoro- ethylene (PTFE procedure in order to find a volume percent for optimized wear resistance and friction coefficient

Sawyer, Wallace

145

de la pression de l'air (entre zero et 75 millimtres), et restent les mmes quc les surfaces dl'S ballons soient noircies ou non, ce qui  

E-Print Network (OSTI)

galvamscher Combinationen durch die Wärme (Changements qu'eprouve la force électromotrice des combinaisons

Boyer, Edmond

146

Effects of d,l-2-Difluoromethylornithine and Indomethacin on Mammary Tumor Promotion in Rats Fed High n-3 and/or n-6 Fat Diets  

Science Journals Connector (OSTI)

...522:5 n-3OthersCorn oil"11.22.125.059...respectively. The menhaden oil was provided by Dr. Tony...Chemical Co., St. Louis, Missouri. Corn oil was purchased from Seaway...were killed using CO: gas. A complete necropsy examination...

Soad H. Abou-El-Ela; Keith W. Prasse; Robert L. Farrell; Richard W. Carroll; Adelbert E. Wade; and Opal R. Bunce

1989-03-15T23:59:59.000Z

147

Theoretical Analysis of Microscopic Ohmic Drop Effects on Steady-State and Transient Voltammetry at the Disk Microelectrode: A Quasi-Conformal Mapping Modeling and Simulation  

Science Journals Connector (OSTI)

It has been shown that microscopic distributions of electric potential and current density at a disk microelectrode affect the voltammetric waves at different degrees across the electrode surface due to the variation of elementary resistances and elementary current fluxes over the electrode surface which leads to nonlinear effects that have not been discussed in existing theoretical treatments of ohmic drop at microelectrodes. ... Thus where ? is the conductivity of the medium; cl is a current line issued from an elementary surface element of area ds1 located onto the microelectrode surface; dl is the differential length along this current line cl; ds is the elementary area of the cross-section (i.e., made along electrical isopotentials) of the current tube issued from the elementary surface ds1 at any value of l (l = 0 on the electrode surface and l ? ? when the reference equipotential is reached). ... All differential ring elements act in parallel and the overall resistance of the system of parallel resistances is given by: ...

Christian Amatore; Alexander Oleinick; Irina Svir

2008-10-01T23:59:59.000Z

148

Measurement of the B0(s) semileptonic branching ratio to an orbitally excited D**(s) state, Br(B0(s) ---> D-(s1)(2536) mu+ nu X)  

SciTech Connect

In a data sample of approximately 1.3 fb{sup -1} collected with the D0 detector between 2002 and 2006, the orbitally excited charm state D{sub s1}{sup {+-}}(2536) has been observed with a measured mass of 2535.7 {+-} 0.6(stat) {+-} 0.5(syst) MeV/c{sup 2} via the decay mode B{sub s}{sup 0} {yields} D{sub s1}{sup -}(2536){mu}{sup +} {nu}X. A first measurement is made of the branching ratio product Br({bar B} {yields} D{sub s1}{sup -}(2536){mu}{sup +}{nu}X) {center_dot} Br(D{sub s1}{sup -} {yields} D*{sup -} K{sub S}{sup 0}). Assuming that D{sub s1}{sup -}(2536) production in semileptonic decay is entirely from B{sub s}{sup 0}, an extraction of the semileptonic branching ratio Br(B{sub s}{sup 0} {yields} D{sub s1}{sup -}(2536){mu}{sup +}{nu}X) is made.

Abazov, V.M.; Abbott, B.; Abolins, M.; Acharya, B.S.; Adams, M.; Adams, T.; Aguilo, E.; Ahn, S.H.; Ahsan, M.; Alexeev, G.D.; Alkhazov, G.; /Buenos Aires U. /Rio de Janeiro, CBPF /Rio de Janeiro State U. /ABC Federal U. /Sao Paulo, IFT /Alberta U. /Simon Fraser U. /York U., Canada /McGill U. /Hefei, CUST /Andes U., Bogota

2007-12-01T23:59:59.000Z

149

C:\DS\2006 ASER\Working Copy\07-2225 for CBFO - 9-20-07.wpd  

NLE Websites -- All DOE Office Websites (Extended Search)

7-2225 7-2225 Waste Isolation Pilot Plant Annual Site Environmental Report for 2006 September 2007 United States Department of Energy Carlsbad Field Office Carlsbad, New Mexico Waste Isolation Pilot Plant Annual Site Environmental Report for 2006 DOE/WIPP-07-2225 This document has been submitted as required to: Office of Scientific and Technical Information P.O. Box 62 Oak Ridge, TN 37831 Prices available from (865) 576-1188 Additional information about this document may be obtained by calling (800) 336-9477. Copies may be obtained by contacting the National Technical Information Service, U.S. Department of Commerce, 5285 Port Royal Road, Springfield, VA 22161 Processing and final preparation of this report was performed by the Waste Isolation Pilot Plant Management and Operating Contractor for the U.S. Department of Energy

150

Suppression of the Barley uroporphyrinogen III synthase Gene by a Ds Activation Tagging Element Generates Developmental Photosensitivity  

Science Journals Connector (OSTI)

...D., Kessler, F., op den Camp, R., and Apel, K. (2001...Physiol. 45: 579-582. op den Camp, R.G.L., Przybyla, D...D., Przybla, D., Opden Camp, R., Kim, C., Landgraf...herbicides: entering the 21st century. Pest Manag. Sci. 58: 1149-1154...

Michael A. Ayliffe; Anthony Agostino; Bryan C. Clarke; Robert Furbank; Susanne von Caemmerer; Anthony J. Pryor

2009-03-31T23:59:59.000Z

151

Comparative Evaluation of Stroke Triage Algorithms for Emergency Medical Dispatchers(MeDS): Prospective Cohort Study Protocol  

E-Print Network (OSTI)

1. Heart Disease and Stroke Statistics 2010 Update.Coverdell National Acute Stroke Registry Surveillance - fourmedical services for acute stroke: a study of 9-1-1 tapes.

Govindarajan, Prasanthi; Ghilarducci, David; McCulloch, Charles; Pierog, Jessica; Bloom, Evan; Johnston, Claiborne

2011-01-01T23:59:59.000Z

152

D.-S. Huang et al. (Eds.): ICIC 2008, LNCS 5226, pp. 146158, 2008. Springer-Verlag Berlin Heidelberg 2008  

E-Print Network (OSTI)

, which adopts Kruskal-Wallis rank sum test to rank all genes and then apply an algorithm based to the multi-subtype tumor dataset, which firstly adopts Kruskal-Wallis rank sum test to rank all genes and th

Hefei Institute of Intelligent Machines

153

High temperature (600 to 800/sup 0/C) thermally activated deformation behavior of. cap alpha. -Zircaloy-4-oxygen alloys. [DS  

SciTech Connect

The high temperature thermally activated deformation behavior of Zircaloy-4-oxygen alloys containing oxygen up to 1 wt % has been investigated. Decremental unloading technique (Dip technique) was employed to determine the internal stress (tau/sub ..mu../) and thus the effective stress (tau*). Strain rate change tests were done to determine strain rate sensitivity (m) and activation volume (V*). Activation energy (..delta..G/sup ..mu../) was calculated from the above data. Oxygen was found to produce an increase in y.s. (0.2%), tau* and ..delta..G/sub 0//sup ..mu../ and a decrease in m and V* while tau/sub ..mu../ was not affected significantly. These experimental results support the view that the predominant rate controlling mechanism for deformation in this temperature regime is the thermally activated breaking of attractive junctions for these alloys. Oxygen atoms, pairs or clusters of oxygen atoms, are ruled out as barriers, instead the strengthening is attributed to an increase in the core width of the dislocations due to the presence of oxygen. This in turn results in a more stable attractive junction, which is reflected in the increasing values of ..delta..G/sub 0//sup ..mu../ with the increase in oxygen. Finally it is suggested that the atypical temperature dependence of tau/sub ..mu..//..mu.. and ..delta..G/sup ..mu../ is a direct consequence of dynamic recovery.

Mehrotra, B.N.; Tangri, K.

1980-10-01T23:59:59.000Z

154

IMPACT Vol. 5 No. 1 | Spring 2010 CLeAn eneRGy DeMAnDS  

E-Print Network (OSTI)

and development are vital if America is to decrease greenhouse gas emissions at lower cost, reduce dependence and reduce environ- mental risks. The University of Maryland Energy Research Center, or UMERC, coordinates of Science and Technology Policy. Many of the major federal grants related to energy research, including

Hill, Wendell T.

155

Core Technology Ventures Services CTV | Open Energy Information  

Open Energy Info (EERE)

Technology Ventures Services CTV Technology Ventures Services CTV Jump to: navigation, search Name Core Technology Ventures Services (CTV) Place Co Durham, United Kingdom Zip DL13 3DS Sector Hydro, Hydrogen Product An independent advisory team focused on seed and early stage companies developing fuel cell systems and hydrogen storage technologies. References Core Technology Ventures Services (CTV)[1] LinkedIn Connections CrunchBase Profile No CrunchBase profile. Create one now! This article is a stub. You can help OpenEI by expanding it. Core Technology Ventures Services (CTV) is a company located in Co Durham, United Kingdom . References ↑ "Core Technology Ventures Services (CTV)" Retrieved from "http://en.openei.org/w/index.php?title=Core_Technology_Ventures_Services_CTV&oldid=34391

156

A Novel Assay to Assess Primary Human Cancer Infectibility by Replication-Selective Oncolytic Adenoviruses  

Science Journals Connector (OSTI)

...dl922-947) and replication-defective (dl312) adenoviruses...adenovirus receptor (CAR) and tissue viability...dl922-947) and replication-defective (dl312) adenoviruses...adenovirus receptor (CAR) and tissue viability...predicted, the replication-defective adenovirus dl312 was...

Yaohe Wang; Stephen Thorne; Joseph Hannock; Jennelle Francis; Tina Au; Tony Reid; Nick Lemoine; David Kirn; and Gunnel Halldn

2005-01-01T23:59:59.000Z

157

spe438-20 page 1 Garrison, N.J., Busby, C.J., Gans, P.B., Putirka, K., and Wagner, D.L., 2008, A mantle plume beneath California? The mid-Miocene Lovejoy flood basalt, northern  

E-Print Network (OSTI)

-Miocene Lovejoy flood basalt, northern California Noah J. Garrison Cathy J. Busby Phillip B. Gans Department the eastern Snake River Plain toward the Yellowstone caldera (Armstrong et al., 1975; Rodgers et al., 1990

Busby, Cathy

158

174. THE EFFECTS OF RESIDENCE TIME ON THE RETENTION OF ARSENATE BY GOETHITE. S.E. O'Reilly and D.L. Sparks, Department of Plant and Soil Sciences, University  

E-Print Network (OSTI)

174. THE EFFECTS OF RESIDENCE TIME ON THE RETENTION OF ARSENATE BY GOETHITE. S.E. O'Reilly and D on goethite. Batch sorption and desorption studies were conducted at pH 6 for periods up to 2 months. Arsenate sorption increased slowly with time. As residence time between arsenate and goethite increased

Sparks, Donald L.

159

E-Print Network 3.0 - arthrobacter sp 32c Sample Search Results  

NLE Websites -- All DOE Office Websites (Extended Search)

DL149 GGS dilution 1 Actino Arthrobacter DL150 GGS dilution 1 Actino Subtercola Source: Colorado at Boulder, University of - Alpine Microbial Observatory Collection:...

160

Dilute Acid Hydrolysis of Oligomers in Hydrothermal Pretreatment Hydrolyzate into Monomers with High Yields  

E-Print Network (OSTI)

Klass DL. 1998. Biomass for renewable energy, fuels, andNational Renewable Energy Laboratory.2003, Biomass feedstockKlass DL. 1998. Biomass for Renewable Energy, Fuels and

Tsai, Yueh-Du

2012-01-01T23:59:59.000Z

Note: This page contains sample records for the topic "dl deltak ds" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


161

Search for the rare decays $J/?\\to D_s^-?^+$ and $J/?\\to \\overline{D}{}^0\\overline{K}{}^{\\ast0}$  

E-Print Network (OSTI)

A search for the rare decays of $J/\\psi \\to D_s^-\\rho^+ + c.c.$ and $J/\\psi \\to \\overline{D}{}^0\\overline{K}{}^{\\ast0} + c.c.$ is performed with a data sample of 225.3 million $J/\\psi$ events collected with the BESIII detector. No evident signal is observed. Upper limits on the branching fractions are determined to be $\\mathcal{B}(J/\\psi \\to D_s^-\\rho^+ + c.c.) < 1.3 \\times 10^{-5}$ and $\\mathcal{B}(J/\\psi \\to \\overline{D}{}^0\\overline{K}{}^{\\ast0} + c.c.) < 2.5 \\times 10^{-6}$ at the $90\\%$ confidence level.

BESIII Collaboration; M. Ablikim; M. N. Achasov; X. C. Ai; O. Albayrak; M. Albrecht; D. J. Ambrose; F. F. An; Q. An; J. Z. Bai; R. Baldini Ferroli; Y. Ban; J. V. Bennett; M. Bertani; J. M. Bian; E. Boger; O. Bondarenko; I. Boyko; S. Braun; R. A. Briere; H. Cai; X. Cai; O. Cakir; A. Calcaterra; G. F. Cao; S. A. Cetin; J. F. Chang; G. Chelkov; G. Chen; H. S. Chen; J. C. Chen; M. L. Chen; S. J. Chen; X. Chen; X. R. Chen; Y. B. Chen; H. P. Cheng; X. K. Chu; Y. P. Chu; D. Cronin-Hennessy; H. L. Dai; J. P. Dai; D. Dedovich; Z. Y. Deng; A. Denig; I. Denysenko; M. Destefanis; W. M. Ding; Y. Ding; C. Dong; J. Dong; L. Y. Dong; M. Y. Dong; S. X. Du; J. Z. Fan; J. Fang; S. S. Fang; Y. Fang; L. Fava; C. Q. Feng; C. D. Fu; O. Fuks; Q. Gao; Y. Gao; C. Geng; K. Goetzen; W. X. Gong; W. Gradl; M. Greco; M. H. Gu; Y. T. Gu; Y. H. Guan; A. Q. Guo; L. B. Guo; T. Guo; Y. P. Guo; Y. L. Han; F. A. Harris; K. L. He; M. He; Z. Y. He; T. Held; Y. K. Heng; Z. L. Hou; C. Hu; H. M. Hu; J. F. Hu; T. Hu; G. M. Huang; G. S. Huang; H. P. Huang; J. S. Huang; L. Huang; X. T. Huang; Y. Huang; T. Hussain; C. S. Ji; Q. Ji; Q. P. Ji; X. B. Ji; X. L. Ji; L. L. Jiang; L. W. Jiang; X. S. Jiang; J. B. Jiao; Z. Jiao; D. P. Jin; S. Jin; T. Johansson; N. Kalantar-Nayestanaki; X. L. Kang; X. S. Kang; M. Kavatsyuk; B. Kloss; B. Kopf; M. Kornicer; W. Kuehn; A. Kupsc; W. Lai; J. S. Lange; M. Lara; P. Larin; M. Leyhe; C. H. Li; Cheng Li; Cui Li; D. Li; D. M. Li; F. Li; G. Li; H. B. Li; J. C. Li; K. Li; K. Li; Lei Li; P. R. Li; Q. J. Li; T. Li; W. D. Li; W. G. Li; X. L. Li; X. N. Li; X. Q. Li; Z. B. Li; H. Liang; Y. F. Liang; Y. T. Liang; D. X. Lin; B. J. Liu; C. L. Liu; C. X. Liu; F. H. Liu; Fang Liu; Feng Liu; H. B. Liu; H. H. Liu; H. M. Liu; J. Liu; J. P. Liu; K. Liu; K. Y. Liu; P. L. Liu; Q. Liu; S. B. Liu; X. Liu; Y. B. Liu; Z. A. Liu; Zhiqiang Liu; Zhiqing Liu; H. Loehner; X. C. Lou; G. R. Lu; H. J. Lu; H. L. Lu; J. G. Lu; X. R. Lu; Y. Lu; Y. P. Lu; C. L. Luo; M. X. Luo; T. Luo; X. L. Luo; M. Lv; F. C. Ma; H. L. Ma; Q. M. Ma; S. Ma; T. Ma; X. Y. Ma; F. E. Maas; M. Maggiora; Q. A. Malik; Y. J. Mao; Z. P. Mao; J. G. Messchendorp; J. Min; T. J. Min; R. E. Mitchell; X. H. Mo; Y. J. Mo; H. Moeini; C. Morales Morales; K. Moriya; N. Yu. Muchnoi; H. Muramatsu; Y. Nefedov; I. B. Nikolaev; Z. Ning; S. Nisar; X. Y. Niu; S. L. Olsen; Q. Ouyang; S. Pacetti; M. Pelizaeus; H. P. Peng; K. Peters; J. L. Ping; R. G. Ping; R. Poling; N. Q.; M. Qi; S. Qian; C. F. Qiao; L. Q. Qin; X. S. Qin; Y. Qin; Z. H. Qin; J. F. Qiu; K. H. Rashid; C. F. Redmer; M. Ripka; G. Rong; X. D. Ruan; A. Sarantsev; K. Schoenning; S. Schumann; W. Shan; M. Shao; C. P. Shen; X. Y. Shen; H. Y. Sheng; M. R. Shepherd; W. M. Song; X. Y. Song; S. Spataro; B. Spruck; G. X. Sun; J. F. Sun; S. S. Sun; Y. J. Sun; Y. Z. Sun; Z. J. Sun; Z. T. Sun; C. J. Tang; X. Tang; I. Tapan; E. H. Thorndike; D. Toth; M. Ullrich; I. Uman; G. S. Varner; B. Wang; D. Wang; D. Y. Wang; K. Wang; L. L. Wang; L. S. Wang; M. Wang; P. Wang; P. L. Wang; Q. J. Wang; S. G. Wang; W. Wang; X. F. Wang; Y. D. Wang; Y. F. Wang; Y. Q. Wang; Z. Wang; Z. G. Wang; Z. H. Wang; Z. Y. Wang; D. H. Wei; J. B. Wei; P. Weidenkaff; S. P. Wen; M. Werner; U. Wiedner; M. Wolke; L. H. Wu; N. Wu; Z. Wu; L. G. Xia; Y. Xia; D. Xiao; Z. J. Xiao; Y. G. Xie; Q. L. Xiu; G. F. Xu; L. Xu; Q. J. Xu; Q. N. Xu; X. P. Xu; Z. Xue; L. Yan; W. B. Yan; W. C. Yan; Y. H. Yan; H. X. Yang; L. Yang; Y. Yang; Y. X. Yang; H. Ye; M. Ye; M. H. Ye; B. X. Yu; C. X. Yu; H. W. Yu; J. S. Yu; S. P. Yu; C. Z. Yuan; W. L. Yuan; Y. Yuan; A. Yuncu; A. A. Zafar; A. Zallo; S. L. Zang; Y. Zeng; B. X. Zhang; B. Y. Zhang; C. Zhang; C. B. Zhang; C. C. Zhang; D. H. Zhang; H. H. Zhang; H. Y. Zhang; J. J. Zhang; J. Q. Zhang; J. W. Zhang; J. Y. Zhang; J. Z. Zhang; S. H. Zhang; X. J. Zhang; X. Y. Zhang; Y. Zhang; Y. H. Zhang; Z. H. Zhang; Z. P. Zhang; Z. Y. Zhang; G. Zhao; J. W. Zhao; Lei Zhao; Ling Zhao; M. G. Zhao; Q. Zhao; Q. W. Zhao; S. J. Zhao; T. C. Zhao; X. H. Zhao; Y. B. Zhao; Z. G. Zhao; A. Zhemchugov; B. Zheng; J. P. Zheng; Y. H. Zheng; B. Zhong; L. Zhou; Li Zhou; X. Zhou; X. K. Zhou; X. R. Zhou; X. Y. Zhou; K. Zhu; K. J. Zhu; X. L. Zhu; Y. C. Zhu; Y. S. Zhu; Z. A. Zhu; J. Zhuang; B. S. Zou; J. H. Zou

2014-02-17T23:59:59.000Z

162

Paper DS-14-1028 to appear in the Special Issue on Stochastic Models, Control and Algorithms in Robotics, ASME Journal of Dynamic Systems, Measurement and Control  

E-Print Network (OSTI)

in Robotics, ASME Journal of Dynamic Systems, Measurement and Control Robot Path Planning in Uncertain the problem of goal-directed robot path-planning in the presence of uncertainties that are induced by bounded) in the presence of uncertainties. 1. MOTIVATION AND INTRODUCTION In general, path planning of robots (e

Ray, Asok

163

GLOBAL EMISSIONS INVENTORIES OF ACID-RELATED COMPOUNDS T.E. GRAEDEL t , C.M. BENKOVITZ 2, W.C. KEENE 3, D.S. LEE 4,  

E-Print Network (OSTI)

GLOBAL EMISSIONS INVENTORIES OF ACID-RELATED COMPOUNDS T.E. GRAEDEL t , C.M. BENKOVITZ 2, W, and future rely in part on inventories of emissions constructed on appropriate spatial and temporal scales and the regulatory and policy communities. The production of global emissions inventories is the task of the GlobalEmissions

164

IlT Bombay has seen significant growth in R & D funding, Ph.Ds, patents and publications in the last R & D Indicators  

E-Print Network (OSTI)

object manufacturing- rapid prototyping process n Novel 3-in-1 heat pump for AC, hot water and potable analysis and simulation of batch distillation and pressure swing adsorption units n Electro-Slag Refining

Narayanan, H.

165

It All DepenDs Editors: Mohamed Kaniche, mohamed.kaaniche@laas.fr | Aad van Moorsel, aad.vanmoorsel@ncl.ac.uk  

E-Print Network (OSTI)

Mellon University Many embedded systems, such as in cars, use a net- work to coordinate control actions are ubiquitous in cars (for instance, the diagnostic port in recent cars runs CAN). Because high automotive attackers and simple software defects that accidentally send an unsafe command. Although it would be nice

Koopman, Philip

166

REcuRsiVE TRust-REGion MEthoDs FoR MuLtiLEVEL NonLinEAR ...  

E-Print Network (OSTI)

Aug 11, 2004 ... reasonable performance, more elaborate strategies exist for choosing it in ...... ould like to thank Arnaud FrPseville and the Nord-Pas-de-Calais.

2004-08-11T23:59:59.000Z

167

N. Lavrac, L. Todorovski, and K.P. Jantke (Eds.): DS 2006, LNAI 4265, pp. 321 325, 2006. Springer-Verlag Berlin Heidelberg 2006  

E-Print Network (OSTI)

profiles, with the functional annotations of the genes obtained by the genome-wide information sources of genomic information. These sources of information, constantly growing by an ever-increasingly volume.) and nomenclature databases (HUGO: human, Flybase: fruit fly, SGD: yeast...). 1 Gene Ontology project: http

Paris-Sud XI, Université de

168

C. Severi & J. Bonhomme (ds.) Paroles en actes, Paris, L'Herne (Cahiers d'anthropologie sociale 5) Alerte aux voleurs de sexe !  

E-Print Network (OSTI)

dernièrement au Togo. Au Gabon, il semble que l'épisode du marché d'Akébé Plaine ne soit pas le seul. Au Lycée, Mauritanie, Gabon, Congo, RDC. La rumeur des vols de sexe (1975-2009) Concernant les vols de sexe au Gabon, j

Paris-Sud XI, Université de

169

Vra Molnar : atlas gnratif et stitch up graphique Lorsque qu'Edmond Couchot prsente ds le milieu des annes 80 tout le potentiel de l'image  

E-Print Network (OSTI)

Véra Molnar : atlas génératif et stitch up graphique Lorsque qu'Edmond Couchot présente dès le'une ontologie de la trace tout en créant de véritables corpus d'images. Cette écriture générative est

Paris-Sud XI, Université de

170

AUREOCHROME1a-Mediated Induction of the Diatom-Specific Cyclin dsCYC2 Controls the Onset of Cell Division in Diatoms (Phaeodactylum tricornutum)  

Science Journals Connector (OSTI)

...chlorophyll a mL1 as calculated according to Gilbert et al. (2000). All cultures were...cells. Nucleic Acids Res. 20 : 1425. Gilbert, M. , Wilhelm, C., and Richter...rhodophyte Cyanidioschyzon merolae. Microbiology 156 : 1730-1737. Mouget, J.-L...

Marie J.J. Huysman; Antonio E. Fortunato; Michiel Matthijs; Benjamin Schellenberger Costa; Rudy Vanderhaeghen; Hilde Van den Daele; Matthias Sachse; Dirk Inzé; Chris Bowler; Peter G. Kroth; Christian Wilhelm; Angela Falciatore; Wim Vyverman; Lieven De Veylder

2013-01-04T23:59:59.000Z

171

Measurement of the Ratio of Branching Fractions Br(Bs -> Ds- pi+)/Br(B -> D- pi+) at CDF-II  

SciTech Connect

The measurement of B{sub s}{sup 0} mixing is one of the flagship analyses for the Run II B physics program. The sensitivity of the measurement to the frequency of B{sub s}{sup 0} oscillations strongly depends on the number of reconstructed B{sub s}{sup 0} mesons. They present the measurement of the ratio of branching fractions Br(B{sub s}{sup 0} {yields} D{sub s}{sup -}{pi}{sup +})/Br(B{sup 0} {yields} D{sup -}{pi}{sup +}), which directly influences the number of B{sub s}{sup 0} events available for the measurement of B{sub s}{sup 0} mixing at CDF-II. They analyze 115 pb{sup -1} of data collected with the CDF-II detector in p{bar p} collisions at {radical}s = 1.96 TeV using a novel displaced track trigger. They reconstruct 78 {+-} 11 B{sub s}{sup 0} {yields} D{sub s}{sup -}{pi}{sup +} decays at 1153 {+-} 45 B{sup 0} {yields} D{sup -}{pi}{sup +} decays with good signal to background ratio. This is the world's largest sample of fully reconstructed B{sub s}{sup 0} {yields} D{sub s}{sup -}{pi}{sup +} decays. They find the ratio of production fractions multiplied by the ratio of branching fractions to be: f{sub s}/f{sub d} {center_dot} Br(B{sub s}{sup 0} {yields} D{sub s}{sup -}{pi}{sup +})/Br(B{sup 0} {yields} D{sup -}{pi}{sup +}) = 0.325 {+-} 0.046(stat) {+-} 0.034(syst) {+-} 0.084 (BR). Using the world average value of f{sub s}/f{sub d} = 0.26 {+-} 0.03, we infer that the ratio of branching fractions is: Br(B{sub s}{sup 0} {yields} D{sub s}{sup -}{pi}{sup +})/Br(B{sup 0} {yields} D{sup -}{pi}{sup +}) = 1.25 {+-} 0.18(stat) {+-} 0.13(syst) {+-} 0.32(BR) {+-} 0.14(PR) where the last uncertainty is due to the uncertainty on the world average measurement of the ratio of B{sub s}{sup 0} to B{sup 0} production rates, f{sub s}/f{sub d}.

Furic, Ivan Kresimir; /MIT

2004-03-01T23:59:59.000Z

172

% &'(& '##)0%1$% &'(& '##)0%1$ 78 9@A B C@@DEF9C8G HIPH Q8R@DS  

E-Print Network (OSTI)

FEASIBILITY CONTENTS ADDITIONAL REQUIREMENTS (returned) UNACCEPTABLE (rejected) ACCEPTABLE METHODOLOGICAL Other Menstrual cycle Fertility Oral contracept. RISK Cancerog. exposure Fertility duration Reg R-28 high risk 2 long R-28 high risk 3 long R29+ high risk 4 long N high risk 5 short R-28 moderate

Bohanec, Marko

173

% &'(& '##)0%1$% &'(& '##)0%1$ 78 9@A B C@@DEF9C8G HIPH Q8R@DS  

E-Print Network (OSTI)

(rejected) ACCEPTABLE METHODOLOGICAL "STARS" TRANSITIONAL §¨ ©ª«¬®¯° ¶¨ ·¬¸µª¹´c° ©¨ ä®åª¼´c° ¾¨ æª?¬c ´µç circumstances Personal characteristics Other Menstrual cycle Fertility Oral contracept. RISK Cancerog. exposure. of menstruation Menstrual cycle 1 average R-28 high risk 2 long R-28 high risk 3 long R29+ high risk 4 long N high

Bohanec, Marko

174

BOILDDlG Ol'ILI'rDS PaR 7 GeV ADVABCED PlO1'OII SOURCE BASED...  

NLE Websites -- All DOE Office Websites (Extended Search)

line inside and outside the storage ring tunnel. This was then used to esti- mate the heat loss to the cooling water system and the heat loss to the air. The estimate of power,...

175

Interactions of Charmed Mesons with Light Pseudoscalar Mesons from Lattice QCD and Implications on the Nature of the D?s0(2317)  

SciTech Connect

We study the scattering of light pseudoscalar mesons ( p , K ) off charmed mesons ( D , D s ) in full lattice QCD. The S -wave scattering lengths are calculated using Lschers finite volume tech- nique. We use a relativistic formulation for the charm quark. For the light quark, we use domain- wall fermions in the valence sector and improved Kogut-Susskind sea quarks. We calculate the scattering lengths of isospin-3/2 D p , D s p , D s K , isospin-0 D ? K and isospin-1 D ? K channels on the lattice. For the chiral extrapolation, we use a chiral unitary approach to next-to-leading order, which at the same time allows us to give predictions for other channels. It turns out that our results support the interpretation of the D s 0 ( 2317 ) as a DK molecule. At the same time, we also update a prediction for the isospin breaking hadronic decay width G ( D s 0 ( 2317 ) ! D s p ) to ( 133 22 ) keV.

Liuming, Liu; Orginos, Kostas; Guo, Feng-Kun; Hanhart, Christoph; Meissner, Ulf-G.

2014-11-01T23:59:59.000Z

176

AUREOCHROME1a-Mediated Induction of the Diatom-Specific Cyclin dsCYC2 Controls the Onset of Cell Division in Diatoms (Phaeodactylum tricornutum)  

Science Journals Connector (OSTI)

...dscyc2-2.9 batch cultures were cultivated at 12L/12D at 20C in air-lifted 100-mL test tubes. Flora light-emitting diode panels (CLF Plant Climatics) were used for illumination with monochromatic blue light and red light at wavelengths...

Marie J.J. Huysman; Antonio E. Fortunato; Michiel Matthijs; Benjamin Schellenberger Costa; Rudy Vanderhaeghen; Hilde Van den Daele; Matthias Sachse; Dirk Inzé; Chris Bowler; Peter G. Kroth; Christian Wilhelm; Angela Falciatore; Wim Vyverman; Lieven De Veylder

2013-01-04T23:59:59.000Z

177

Identification of Binding Sites for Both dsRBMs of PKR on Kinase-Activating and Kinase-Inhibiting RNA Ligands  

E-Print Network (OSTI)

-Inhibiting RNA Ligands Richard J. Spanggord, Momchilo Vuyisich, and Peter A. Beal* Department of Chemistry, Uni correspondence should be addressed. Tel: 801-585-9719. Fax: 801-581-8433. E-mail: beal@chemistry.utah.edu. 1

Beal, Peter A.

178

Emerging areas of mathematical modelling  

Science Journals Connector (OSTI)

...speed q, we then have vn = q cos , = d =ds, so that (5.1) becomes "2 d3 ds3 + d ds = q cos ; suitably rescaling s and rede ning " (now with 0 " 1), this is equivalent to "2 d3 ds3 + (1 "2 ) d ds = cos ; (5.9) which will be the most convenient...

2000-01-01T23:59:59.000Z

179

Local and synoptic mechanisms causing Southern Californias Santa Ana winds  

E-Print Network (OSTI)

DL (1994) Global physical climatology. Academic Press, Sancisely the month when the climatology of temperature favors

Hughes, Mimi; Hall, Alex

2010-01-01T23:59:59.000Z

180

IM  

NLE Websites -- All DOE Office Websites (Extended Search)

EH Tinker Creek 2 TC.2 E. folliculata; EF Donora Station 1 DS. 1 E. lugubris; EL Donora Station 2 DS.2 I E. complanata; EC Donora Station 3 DS.3 E. errans; EE Pen Branch 1 PB. 1...

Note: This page contains sample records for the topic "dl deltak ds" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


181

E-Print Network 3.0 - avancees du projet Sample Search Results  

NLE Websites -- All DOE Office Websites (Extended Search)

en classe. Examens o 1... DS la fin du cours Notes o 1 note de DS o 1 note de TP : note du projet individualise grce la... dmonstration o Si la note du DS ......

182

Electro-Magnetic Dipole Properties of The Even-Even {sup 160}Gd Nucleus in The Spectroscopic Region  

SciTech Connect

In this study result of calculations using rotational, translational and Galilean invariant quasiparticle random-phase approximation is presented for the low lying dipole excitations in the even-even {sup 60}Gd nucleus. To make detail structure analysis for electric and magnetic dipole states, calculations carried out for both {delta}K = 1 and {delta}K = 0 branches. The analysis shows that almost all transitions with {delta}K = 1 are magnetic character in 2.4 divide 4 MeV energy interval. However, the calculations indicate the presence of a few prominent negative parity K{sup {pi}} = 1 states in the investigated energy interval, one of them with rather high E1 strength B(E1) = 7.1{center_dot}10{sup -3} e{sup 2} fm{sup 2} at energy 3.2 MeV. Calculated M1 dipole strength of the scissors mode K{sup {pi}} = 1{sup +} excitations clustered in two groups around 2.7 and 3.3 MeV. A similar situation arises for the experimentally obtained states two bumps around {omega}{sub i} = 2.7 MeV and {omega}{sub i} = 3.3 MeV. It has been shown that main part of spin-1 states, observed at energy 2.4 divide 4 MeV in {sup 160}Gd may be attributed to have M1 character and may be interpreted as main fragments of the scissors mode. However, it is apparent that the experimental data exceeds the calculation results for the summed B(M1) by a factor of 1.13 for M1 transitions.

Ertugral, Filiz; Kuliev, Ali [Sakarya University, Department of Physics, 54100, Sakarya (Turkey); Guliyev, Ekber [National Academy of Sciences, Institute of Physics, Baku (Azerbaijan)

2008-11-11T23:59:59.000Z

183

A validation study of existing neutronics tools against ZPPR-21 and ZPPR-15 critical experiments.  

SciTech Connect

A study was performed to validate the existing tools for fast reactor neutronics analysis against previous critical experiments. The six benchmark problems for the ZPPR-21 critical experiments phases A through F specified in the Handbook of Evaluated Criticality Safety Benchmark Experiments were analyzed. Analysis was also performed for three loading configurations of the ZPPR-15 Phase A experiments. As-built core models were developed in XYZ geometries using the reactor loading records and drawer master information. Detailed Monte Carlo and deterministic transport calculations were performed, along with various modeling sensitivity analyses. The Monte Carlo simulations were carried out with the VIM code with continuous energy cross sections based on the ENDF/B-V.2 data. For deterministic calculations, region-dependent 230-group cross sections were generated using the ETOE-2/MC-2/SDX code system, again based on the ENDF/B-V.2 data. Plate heterogeneity effects were taken into account by SDX unit cell calculations. Core calculations were performed with the TWODANT discrete ordinate code for the ZPPR-21 benchmarks, and with the DIF3D nodal transport option for the ZPPR-15 experiments. For all six ZPPR-21 configurations where the Pu-239 concentration varies from 0 to 49 w/o and the U-235 concentration accordingly varies from 62 to 0 w/o, the core multiplication factor determined with a 230-group TWODANT calculation agreed with the VIM Monte Carlo solution within 0.20 %{Delta}k, and there was no indication of any systematic bias. The quality of principal cross sections generated with the MC-2 code was comparable to that of VIM cross sections. The overall reactivity effect due to the errors in the 230-group principal cross sections was estimated to be less than 0.05 %{Delta}k. The statistics of the differences between calculated values and specified benchmark experimental values showed similar bias (from -0.28 %{Delta}k to 0.33 %{Delta}k) for MC{sup 2}-2/TWODANT and VIM. This result suggests that the criticality prediction accuracy of MC{sup 2}-2/TWODANT is comparable to VIM. Investigation of group collapsing methods showed that direct generation of broad-group cross sections from MC{sup 2}-2 calculations was not adequate for analysis of ZPPR-21 assemblies. Scalar flux weighting for all cross sections, including anisotropic cross sections, was not sufficiently accurate, either. The use of higher flux moments for anisotropic scattering cross section collapsing reproduced the fine-group results with broad-group calculations. The ZPPR-15 analyses, starting from detailed as-built plate geometries, showed that the plate heterogeneity effect was as large as 1.3 %{Delta}k. Through a series of sensitivity studies, a procedure to generate effective cross sections was developed based on one-dimensional SDX unit cell calculations. With this procedure to account for the plate heterogeneity effect, the core multiplication factor determined with a 230-group DIF3D nodal transport calculation agreed with the VIM Monte Carlo solution within 0.12 %{Delta}k. It was however observed that the calculated values consistently underestimated the criticality by 0.32 %{Delta}k to 0.43 %{Delta}k. The sodium void worths determined from VIM Monte Carlo and DIF3D nodal transport calculations were also very close to each other, but both predictions overestimated the measured void worth by {approx}0.1 %{Delta}k, which amounted to {approx}40% of the measured value. Further investigation is needed to identify the reason for this discrepancy between calculated and measured sodium void worths. In summary, for all nine core configurations of ZPPR-21 and ZPPR-15 analyzed in this study, the deterministic transport solutions showed good agreement with Monte Carlo results. These results indicate that the existing deterministic methods for multigroup cross section generation and core calculation are adequate to use in the initial design stage of Advanced Burner Reactors, for which the startup fuel is expected to be conventional plutonium fuel. However, further verifica

Yang, W.S.; Kim, S.J. (Nuclear Engineering Division)

2007-09-30T23:59:59.000Z

184

Publication of New Atomic Bomb Radiation Dosimetry System  

Energy.gov (U.S. Department of Energy (DOE))

Atomic bomb dosimetry studies. The Radiation Effects Research Foundation Dosimetry System 2002 (DS02)

185

Charm-Production in e^+e^- Annihilation Around 4 GeV  

E-Print Network (OSTI)

Using the CLEO-c detector at the Cornell Electron Storage Ring, we have measured inclusive and exclusive cross sections for the production of $D^+$, $D^0$ and $D_s^+$ mesons in $e^{+}e^{-}$ annihilations at thirteen center-of-mass energies between 3.97 and 4.26 GeV. Exclusive cross sections are presented for final states consisting of two charmed mesons ($D\\bar{D}$, $D^{*}\\bar{D}$, $D^{*}\\bar{D}^{*}$, $D_s^+ D_s^-$, $D_s^{*+} D_s^-$, and $D_s^{*+} D_s^{*-}$) and for processes in which the charmed meson pair is accompanied by a pion.

B. W. Lang

2007-09-30T23:59:59.000Z

186

Fructose impairs glucose-induced hepatic triglyceride synthesis  

E-Print Network (OSTI)

The area under the curve (AOC) (Mean SD) for each of theand area under the curve (AOC, mg/dl min) for glucosea. BL b. IPGT blood glucose AOC mg/dl x min c. 120 min Serum

Huang, Danshan; Dhawan, Tania; Young, Stephen; Yong, William H; Boros, Laszlo G; Heaney, Anthony P

2011-01-01T23:59:59.000Z

187

Macronutrient and energy content of breast milk of mothers delivering prematurely  

Science Journals Connector (OSTI)

The protein, lactose, fat and energy contents of the fore-milk of mother with ... weeks of lactation, the mean (SD) energy (Kcal/dl), protein (g/dl) ... days, there was a decline in protein content while fat, la...

Vinod K. Paul; Meharban Singh; L. M. Srivastava

188

A mesostate-space model for EEG and MEG Jean Daunizeau and Karl J. Friston  

E-Print Network (OSTI)

-determination of DL inverse solutions (Grova et al., 2006). More recently, models of the coupling between active brain

Daunizeau, Jean

189

E-Print Network 3.0 - anchored carbon fiber Sample Search Results  

NLE Websites -- All DOE Office Websites (Extended Search)

; Activated carbon; Carbon fibers; D. Electrical (electronic) properties Electromagnetic interference (EMI... ) shielding is increas- ... Source: Chung, Deborah D.L. -...

190

Applied Clay Science, 1 (1985) 89--101 89 Elsevier Science Publishers B.V., Amsterdam --Printed in The Netherlands  

E-Print Network (OSTI)

in The Netherlands KINETICS OF POTASSIUM EXCHANGE IN HETEROGENEOUS SYSTEMS D.L. SPARKS and T.H. CARSKI Department

Sparks, Donald L.

191

Direct, Non-Destructive Observation of a Bose Condensate M.R. Andrews, M.-O. Mewes, N.J. van Druten, D.S. Durfee, D.M. Kurn, and W. Ketterle  

E-Print Network (OSTI)

phenomena such as superfluidity in liquid helium [1]. For a homogeneous sample, Bose- Einstein condensation in the earth's gravita- tional field, the condensate and the normal fraction of a Bose gas are spatially the first direct and non-destructive observation of the spatially localized condensate, in a gas

192

Winter 2009 FOr ALUMni, PArentS, AnD FrienDS OF tHe eAStMAn SCHOOL OF MUSiC BrubeckAjazzlegendishonored  

E-Print Network (OSTI)

Theatre Renovation and Expansion Project is proceeding as planned; that our entrepreneurial energies to expand and engage with vital purpose (Eastman Broadband and Arabesque Winds in Mexico, and the Arabesque Winds winning the grand prize in the 2008 International Chamber Music Competition); that our commitment

Goldman, Steven A.

194

Chemistry & Biology, Vol. 11, 12391250, September, 2004, 2004 Elsevier Ltd. All rights reserved. DOI 10.1016/j.chembiol.2004.06.009 The Binding Selectivity of ADAR2's dsRBMs  

E-Print Network (OSTI)

. Haudenschild, and Peter A. Beal* Department of Chemistry University of Utah editing enzyme ADAR2 and compare

Beal, Peter A.

195

3. Vorticity 3.1. Definition and interpretation of vorticity  

E-Print Network (OSTI)

2 u · dl = 0 if inviscid. (3.6) Eq.(3.6) is Kelvin's Circulation Theorem: for inviscid, uniform.5), we get dC dt = C - p + gz + 2 u · dl . Again the (...) · dl term integrates out, leaving dC dt = C

Read, Peter L.

196

New determination of the D0->K-pi+pi0 and D0->K-pi+pi+pi- coherence factors and average strong-phase differences  

E-Print Network (OSTI)

Measurements of the coherence factors (R_Kpipi0 and R_K3pi) and the average strong-phase differences (delta^Kpipi0_D and delta^K3pi_D) for the decays D0-> K-pi+pi0 and D0->K-pi+pi+pi- are presented. These parameters are important inputs to the determination of the unitarity triangle angle gamma in B+/- -> DK+/- decays, where D designates a D0 or D0bar meson decaying to a common final state. The measurements are made using quantum correlated DDbar decays collected by the CLEO-c experiment at the psi(3770) resonance, and augment a previously published analysis by the inclusion of new events in which the signal decay is tagged by the mode D-> K0Spi+pi-. The measurements also benefit from improved knowledge of external inputs, namely the D0D0bar mixing parameters, r_D^Kpi and several D-meson branching fractions. The measured values are R_Kpipi0 = 0.82 +- 0.07, delta_D^Kpipi0 = (164+20-14) deg., R_K3pi = 0.32+0.20-0.28 and delta^K3pi_D = (225+21_-78) deg. Consideration is given to how these measurements can be improved further by using the larger quantum-correlated data set collected by BESIII.

J. Libby; S. Malde; A. Powell; G. Wilkinson; D. M. Asner; G. Bonvicini; T. Gershon; P. Naik; T. K. Pedlar; J. Rademacker; S. Ricciardi; C. Thomas

2014-01-09T23:59:59.000Z

197

Improved measurement of the pseudoscalar decay constant fD(s)  

E-Print Network (OSTI)

models. The decay rate for Ds 1 is given by @1,2# G ~ Ds 1!l1n!5 GF 2 8p f Ds 2 ml 2M DsS 12 ml 2 M Ds 2 D 2 uVcsu2, ~1! where M Ds is the Ds mass, ml is the mass of the final state lepton, Vcs is a CKM matrix element equal to 0.974 @3#, and GF... was supporte tional Science Foundation, the U.S. Departmen and the Natural Sciences and Engineering Resea of Canada.G ~ Ds 1!m1ng! G ~ Ds 1!m1n! 5~1210!310 22 mV 2 GeV2, ~8! where mV 2 is a vector coupling constant which has a value of approximately 0.1...

Baringer, Philip S.

1998-06-22T23:59:59.000Z

198

Generation of a head phantom according to the 95th percentile Chinese population data for evaluating the specific absorption rate by wireless communication devices  

Science Journals Connector (OSTI)

......developed in the platform of Maya ( http://www.autodesk.com/products/autodesk-maya/overview ). The entire procedures are...consequently imported into 3ds Max (http://www.autodesk.com/products/autodesk-3ds-max/overview......

Yu Ma; Yuduo Wang; Qing Shao; Congsheng Li; Tongning Wu

2014-03-01T23:59:59.000Z

199

Bryozoan biodiversity in the New Zealand region and implications for marine conservation  

Science Journals Connector (OSTI)

Marine biodiversity and its distribution in the New Zealand ... 1 and 2 (DS1 and DS2). Biodiversity was assessed using measures based on relatedness ... variation in taxonomic distinctness. High values of biodiversity

A.A. Rowden; R.M. Warwick; D.P. Gordon

2004-12-01T23:59:59.000Z

200

E-Print Network 3.0 - advanced backcross population Sample Search...  

NLE Websites -- All DOE Office Websites (Extended Search)

30 min to 1 h. was tested with the Shapiro-Wilk test... -the DS1DT1 genotype, the Al-4 F1 had the DS2DT1 geno- resented in the ... Source: Parrott, Wayne - Institute of Ecology &...

Note: This page contains sample records for the topic "dl deltak ds" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


201

3 April 2012 Ay 127 E.S. Phinney Cosmology and Galaxy Formation  

E-Print Network (OSTI)

uses the MTW metric sign convention, where space-like intervals have positive ds2 as God and Euclid intended. Serjeant, under the influence of some satanic particle physicists, uses the opposite sign for ds2

Phinney, E. Sterl

202

Final Summary  

E-Print Network (OSTI)

Vector field F : SF dS. Special cases: ? ScurlF dS. ? S is a closed surface. Fund. Thm. of line integrals. Green's. Theorem. Parametrize the curve C,.

nane-nanu

2014-04-17T23:59:59.000Z

203

An unknown regulator affects cell division and the timing of entry into stationary phase in Escherichia coli  

E-Print Network (OSTI)

...................................................................... 22 P 1 mapping....................................................................... 27 Complementation tests with F?111.................................... 31 Sequencing of the cpxA gene from DS380 and DS381...-independent. Using phage P 1, transduction of YK410 flhD cells to flhD+ (strain DS522) did not rescue the mutant phenotype, and when the flhD mutation from YK4131 was transduced into the flhD+ parental strain (to produce strain DS513), the cells did not demonstrate...

Bain, Sherrie Valarie

2005-08-29T23:59:59.000Z

204

Technical Report TR-2014-06 CHRONO  

E-Print Network (OSTI)

information. Tools such as Lightwave [11], Autodesk 3ds Max [2], and Autodesk Maya [3] have their own

Negrut, Dan

205

Emancipatory Digital Archaeology  

E-Print Network (OSTI)

More specialized software such as Autodesk costs 4000 for aworlds require knowledge of Autodesk 3ds Max 3 (for brevity,

Morgan, Colleen

2012-01-01T23:59:59.000Z

206

E-Print Network 3.0 - albumin-adjusted ischemia modified Sample...  

NLE Websites -- All DOE Office Websites (Extended Search)

Lipid Mediator Lipidomics: New Pathways in Mapping Resolution Summary: . Keywor ds: Acrolein, arachidonic acid, cerebral ischemia, cytidine-5-diphosphocholine, CDP......

207

E-Print Network 3.0 - acids alter glycerolipid Sample Search...  

NLE Websites -- All DOE Office Websites (Extended Search)

diseases, that involve deregulated lipid metabolism. Altered... . Keywor ds: Acrolein, arachidonic acid, cerebral ischemia, cytidine-5-diphosphocholine, CDP Source: Kalil,...

208

Optimized fabrication and electrical analysis of silver nanowires templated on DNA molecules  

E-Print Network (OSTI)

. In this letter, we present the base sequence design of synthetic double-stranded DNA dsDNA and fabrication of metallic silver nanowires templated on both synthetic dsDNA and bacteriophage -DNA molecules. We also as programmable interconnects in bio- electronic devices. The DNA base sequence of the synthetic unit dsDNA tile

Finkelstein, Gleb

209

Identifying Problems Associated with Focus and Context Awareness in 3D Modelling Tasks  

Science Journals Connector (OSTI)

......modelling software such as Maya and 3ds Max (Autodesk, 2014) provide a large range of functions...modelling software such as MAYA and 3ds Max (Autodesk, 2014). The students anonymous participation...Interestingly new extensions to 3ds Max (Autodesk, 2014) are planned to provide stereo......

Masood Masoodian; Azmi bin Mohd Yusof; Bill Rogers

2014-11-01T23:59:59.000Z

210

On multiple connectivity and reduction of constants for composites with body forces  

Science Journals Connector (OSTI)

...fini ds = ( f) dV = 0, (3.16) as does condition (3.13): xfn ds = ( xf...3.17) However, condition (3.14) does not vanish: yfn ds = ( yf) dV = y...Salvadori, M. G. 1950 Analogies. In Handbook of experimental stress analysis (ed...

1998-01-01T23:59:59.000Z

211

Design of a PSi header processor for the X.25 packet level protocol  

E-Print Network (OSTI)

processor data for Begin CP of the Receive DL Data. 4. 14. Connection processor data for Call Connected HP of the Receive DL Data. 4. 15. Connection processor data for Close CP of the Receive DL Data.... Connection processor data for Call Request HP . . . ? 4. 20. Connection processor data for Call Accepted HP . . . 4. 21. Connection processordataforClear Request HP . . . 52 53 53 4. 22. Connection processor data for Detach CP 2 . . . . . 54 5. 1...

Yu, Tsai-Fa

2012-06-07T23:59:59.000Z

212

E-Print Network 3.0 - american erionite-associated mesothelioma...  

NLE Websites -- All DOE Office Websites (Extended Search)

Chernyavsky AI, Jolkovsky DL, Pinkerton KE, Grando SA. A Summary: and Liu H. Incomplete birth certificates: a risk marker for infant mortality. American Journal of Public......

213

Nonprice incentives and energy conservation.  

E-Print Network (OSTI)

individual choices about energy efficiency. Proc. Natl.4. Costa DL, Kahn ME (2013) Energy conservation nudges andInformation strategies and energy conservation behavior: a

Asensio, OI; Delmas, MA

2015-01-01T23:59:59.000Z

214

ENVIRONMENTAL REVIEW FOR CATEGORICAL EXCLUSION DETERMINATION  

NLE Websites -- All DOE Office Websites (Extended Search)

RoclDl'ainage Maintenance Montrose County, Colorado A. Brief Description of Proposal: Western...

215

E-Print Network 3.0 - allowing direct observation Sample Search...  

NLE Websites -- All DOE Office Websites (Extended Search)

Observation Software Systems DASEL Technical Report 200707DL01 Summary: , this simple logic could be encoded directly into either the observer construction or event response...

216

E-Print Network 3.0 - acid-induced stress resistance Sample Search...  

NLE Websites -- All DOE Office Websites (Extended Search)

stress sensing, as described by the fractional change in resistance per unit... for the resistance away from the ... Source: Chung, Deborah D.L. - Department of Mechanical and...

217

E-Print Network 3.0 - absolute negative resistance Sample Search...  

NLE Websites -- All DOE Office Websites (Extended Search)

31 March 1999 Abstract Apparent negative electrical resistance... .33 MPa), the apparent resistance was either positive or ... Source: Chung, Deborah D.L. - Department of...

218

Microsoft Word - Scott-CV2013Sept.docx  

NLE Websites -- All DOE Office Websites (Extended Search)

Center, Spartanburg, South Carolina. Recent Publications (2000-2013): Submitted (in review)- Soteropoulos DL, Lance SL, Flynn RW, and Scott DE. Effects of copper exposure on...

219

Physiological effects of dietary amaranth  

E-Print Network (OSTI)

? free control diet. After four weeks, total serum cholesterol, triglycerides, HDL, LDL, VLDL cholesterol and liver cholesterol and triglycezides were determined. Whole amaranth (WA) resulted in significantly lower serum cholesterol values compared... to the fiber-free control (FF) (WA 148 + -8 mg/dl, FF 195 " -17 mg/dl, P&0. 05) appazently by decreasing LDL cholesterol (WA 96 10 mg/dl, FF 146 -+ 18 mg/dl) since HDL cholesterol levels of amaranth-fed animals were similar to those of controls (WA 33 -+ 2...

Danz, Ruth Ann

2012-06-07T23:59:59.000Z

220

E-Print Network 3.0 - active carbon process Sample Search Results  

NLE Websites -- All DOE Office Websites (Extended Search)

; Activated carbon; Carbon fibers; D. Electrical (electronic) properties Electromagnetic interference (EMI... in the composites is typically that ... Source: Chung, Deborah D.L....

Note: This page contains sample records for the topic "dl deltak ds" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


221

E-Print Network 3.0 - activated carbon chemically Sample Search...  

NLE Websites -- All DOE Office Websites (Extended Search)

; Activated carbon; Carbon fibers; D. Electrical (electronic) properties Electromagnetic interference (EMI... in the composites is typically that ... Source: Chung, Deborah D.L....

222

E-Print Network 3.0 - activated carbon treatment Sample Search...  

NLE Websites -- All DOE Office Websites (Extended Search)

; Activated carbon; Carbon fibers; D. Electrical (electronic) properties Electromagnetic interference (EMI... in the composites is typically that ... Source: Chung, Deborah D.L....

223

E-Print Network 3.0 - activated carbon particles Sample Search...  

NLE Websites -- All DOE Office Websites (Extended Search)

; Activated carbon; Carbon fibers; D. Electrical (electronic) properties Electromagnetic interference (EMI... in the composites is typically that ... Source: Chung, Deborah D.L....

224

E-Print Network 3.0 - activated carbon process Sample Search...  

NLE Websites -- All DOE Office Websites (Extended Search)

; Activated carbon; Carbon fibers; D. Electrical (electronic) properties Electromagnetic interference (EMI... in the composites is typically that ... Source: Chung, Deborah D.L....

225

1547.ps  

E-Print Network (OSTI)

Dec 18, 2006 ... tic; [objt,Xt,yt,Zt,info] = mysdps(blk,A,C,b); t = toc;. >> tic; [fL, Y, dl] = vsdplow(blk,A,

226

Association of Serum Phosphorus Concentration with Mortality in Elderly and Non-Elderly Hemodialysis Patients  

E-Print Network (OSTI)

between serum phosphorous levels (main predictor) with all-likely to have serum phosphorous levels <3.5 mg/dl, compared

2013-01-01T23:59:59.000Z

227

E-Print Network 3.0 - american scorpions arachnida Sample Search...  

NLE Websites -- All DOE Office Websites (Extended Search)

Sample search results for: american scorpions arachnida Page: << < 1 2 3 4 5 > >> 1 Johnson, D.L. 2004. The Northern Scorpion, Paruroctonus boreus, in southern Alberta,...

228

DISCLAIMER  

NLE Websites -- All DOE Office Websites (Extended Search)

level AMF ARM Mobile Facility AMFDL AMF Doppler Lidar ARM Atmospheric Radiation Measurement DL Doppler Lidar DMF Data Management Facility DOE U.S. Department of Energy DQO...

229

Sun Protocols in the ISO Open Systems Interconnect Model Application  

E-Print Network (OSTI)

. Technical Report, (1985). [6] J. M. Chang, "SunNet," USENIX (1985). [7] D.L. Presotto and D. M. Ritchie

California at Davis, University of

230

Advanced Organic Vapor Cycles for Improving Thermal Conversion Efficiency in Renewable Energy Systems  

E-Print Network (OSTI)

DL Chase and PT Kehoe, "GE Combined-Cycle Product Line andand W Stenze, "Combined Cycle Heat Recovery Optimization,"bottoming cycle FOR combined cycle power plants," Applied

Ho, Tony

2012-01-01T23:59:59.000Z

231

Combining multivariate analysis and monosaccharide composition modeling to identify plant cell wall variations by Fourier Transform Near Infrared spectroscopy.  

E-Print Network (OSTI)

19. Wetzel DL: Near-infrared reflectance analysis - sleepertreatments of raw near-infrared signal in the measurement ofusing transmittance near-infrared spectroscopy. J Agric Food

2011-01-01T23:59:59.000Z

232

Combining multivariate analysis and monosaccharide composition modeling to identify plant cell wall variations by Fourier Transform Near Infrared spectroscopy  

E-Print Network (OSTI)

19. Wetzel DL: Near-infrared reflectance analysis - sleepertreatments of raw near-infrared signal in the measurement ofusing transmittance near-infrared spectroscopy. J Agric Food

2011-01-01T23:59:59.000Z

233

Minnesota's 5th congressional district: Energy Resources | Open Energy  

Open Energy Info (EERE)

Policy Organizations in Minnesota's 5th congressional district Policy Organizations in Minnesota's 5th congressional district Windustry Registered Energy Companies in Minnesota's 5th congressional district Advanced Bioenergy LLC Best Buy Best Power International LLC Bison Renewable Energy LLC Clear Wind Renewable Power Delphi Financial Corporation Deltak LLC Despatch Industries EcoSystem Corporation Emerald Renewable Energy FC3 Group FreEner-g Freener g Genmar Holdings Inc Great Plains Institute Honor the Earth International Green Power IGP MagStar Technologies NRG Thermal LLC National Wind National Wind Assessments formerly Romuld Wind Consulting Natural Resource Group Navitas Energy Inc Project Resources Corporation Ryan Companies U.S. Sunnyside Technologies Inc Superior Process Technology Inc Target The Center for Energy and the Environment

234

Expression of Aurora A (but Not Aurora B) Is Predictive of Survival in Breast Cancer  

Science Journals Connector (OSTI)

...Lett 2007;247:266-72. 33 Camp RL, Dolled-Filhart M, King...Res 2003;63:1445-8. 34 Camp RL, Chung GG, Rimm DL. Automated...A, Giltnane J, Cregger M, Camp RL, Rimm DL. Quantitative...Tumor Female History, 17th Century Humans Image Processing, Computer-Assisted...

Yasmine Nadler; Robert L. Camp; Candice Schwartz; David L. Rimm; Harriet M. Kluger; and Yuval Kluger

2008-07-15T23:59:59.000Z

235

Interspecific audience effects on the alarm-calling behaviour of a kleptoparasitic bird  

Science Journals Connector (OSTI)

...anbe.2000.1636 Cheney, D.L , and R.M Seyfarth1990How...x Leavesley, A.J , and R.D Magrath2005Communicating about...508809 Seyfarth, R.M , and D.L Cheney2003Signalers and receivers...Fitzpatrick Institute, DST/NRF Centre of Excellence, University...

2007-01-01T23:59:59.000Z

236

Extraction abilities of methods used for estimating of different phosphorus fractions  

E-Print Network (OSTI)

readily available P (P CaCl2 ). Anion exchange (AE)methods (P ar =100%) P CaCl2 P ex P DL P M3 P in P org P M-for different methods P CaCl2 P ex P DL P M3 P in P org P

Kulhanek, Martin; Balik, Jiri; Cerny, Jindrich; Kozlovsky, Ondrej; Nedved, Vaclav

2009-01-01T23:59:59.000Z

237

Genes from Pseudomonas sp. Strain BS Involved in the Conversion of l-2-Amino-?2-Thiazolin-4-Carbonic Acid to l-Cysteine  

Science Journals Connector (OSTI)

...purified intermediate by two-dimensional 1H nuclear magnetic resonance indicated that the intermediate...amidohydrolase from Pseudomonas sp. strain BS, which is able to convert dl-ATC to...l-cysteine synthesis from dl-ATC in strain BS. The 2.6-kb insert DNA fragment in...

Toshikazu Shiba; Kohji Takeda; Misako Yajima; Makoto Tadano

2002-05-01T23:59:59.000Z

238

Similarity of genes horizontally acquired by Escherichia coli and Salmonella enterica is evidence of a supraspecies pangenome  

Science Journals Connector (OSTI)

...1073/pnas.1109451108 Katherine A. Karberg Gary J. Olsen James...Science 328 : 994 999 . 39 Wheeler DL ( 2007 ) Database...a supra-species pangenome Katherine A. Karberga,1, Gary J...Evol 27: 800 ZZQQhy810. 12. Wheeler, DL, et al. (2007) Database...

Katherine A. Karberg; Gary J. Olsen; James J. Davis

2011-01-01T23:59:59.000Z

239

Verrucomicrobia Are Candidates for Polysaccharide-Degrading Bacterioplankton in an Arctic Fjord of Svalbard  

Science Journals Connector (OSTI)

...DL Kirchman. 2011. Activity of abundant and rare bacteria in a coastal ocean. Proc. Natl. Acad. Sci. U. S. A. 108 :12776-12781. doi: 10.1073/pnas.1101405108 . 76. Landa, M , MT Cottrell, DL Kirchman, S Blain and I Obernosterer. 2013...

Z. Cardman; C. Arnosti; A. Durbin; K. Ziervogel; C. Cox; A. D. Steen; A. Teske

2014-04-11T23:59:59.000Z

240

Carbon Nanotube Field-effect Transistors: AC Performance Capabilities.  

E-Print Network (OSTI)

Carbon Nanotube Field-effect Transistors: AC Performance Capabilities. D.L. Pulfrey, D.L. John-barrier carbon nanotube field-effect transistors are examined via simulations using a self-consistent Schrödinger is known about the DC capabilities of carbon nanotube field-effect transistors [1,2,3], and devices

Pulfrey, David L.

Note: This page contains sample records for the topic "dl deltak ds" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


241

CARBON NANOTUBE TRANSISTORS: AN EVALUATION  

E-Print Network (OSTI)

CARBON NANOTUBE TRANSISTORS: AN EVALUATION L.C. Castro, D.L. John, and D.L. Pulfrey Department A simple, non-equilibrium model is used to evaluate the likely DC performance of carbon nanotube field and transcon- ductance close to the low-quantum-capacitance limit. Keywords: Carbon nanotubes, field

Pulfrey, David L.

242

Publications List Refereed: (78 Total)  

E-Print Network (OSTI)

. Southern pine volume equations and associated conversion factors for southwest Georgia. FL. Agr. Exp. Sta: 19 27. Frampton, LJ, Jr., and DL Rockwood. 1983. Genetic variation in traits important for energy Series Bull. No. 275, p. 28 39. Roeder, KR, and DL Rockwood. 1983. Potential stem biomass and energy

Hill, Jeffrey E.

243

Optimal Use of Groundwater and Surface Water to Reduce Land Subsidence  

E-Print Network (OSTI)

TR- 103 1980 Optimal Use of Groundwater and Surface Water to Reduce Land Subsidence G. Acosta-Gonzalez D.L. Reddell Texas Water Resources Institute Texas A&M University ...TR- 103 1980 Optimal Use of Groundwater and Surface Water to Reduce Land Subsidence G. Acosta-Gonzalez D.L. Reddell Texas Water Resources Institute Texas A&M University ...

Acosta-Gonzalez, G.; Reddell, D. L.

244

Please print your full name exactly as it appears on your passport or birth certificate. We cannot issue your immigration document (I-20 or DS-2019) until we receive this form from you. Please complete both sides of the form and attach all  

E-Print Network (OSTI)

Please print your full name exactly as it appears on your passport or birth certificate. We cannot passport identification page or if your passport is unavailable, a copy of your birth certificate. Are you identification page or birth certificate. Please complete: I plan to come alone. I plan to bring the following

245

Physiological changes in cultured Sorghum bicolor (L.) Moench cells in response to induced water stress: osmotic potential, relative water content, carbohydrates, organic acids, potassium, and amino acids  

E-Print Network (OSTI)

, Table 1). At week 2 the weight of absorbed PEG in DT-s was 50% of its DW and 1. 8 times more than that of DS-s. It is obvious then that calculations could be misleading if the added weight of PEG is not subtracted 28 v 9 / III 9 S00 450 400 2S0... differences, and Duncan's test of pEG content of DT and DS calli in control and stressed conditions. (a). Cultivar-treatment WEEK 0 1 2 4 7 DT-c DT-s S S S S DT-c DS-c DT-s DS-s S S DS-c DS-s S S S S 29 TABLE 1. Continued. (h) WEEK 0...

Diquez, Ricardo

2012-06-07T23:59:59.000Z

246

YANMAR NFD9-M, NF19-SK,--p,A"R--,, OEy, Ad,Zg--p,AOESw`'u,,,"rKX', PM,`',,D  

E-Print Network (OSTI)

Flying Wheel Hydrolic Dynamometer Exhaust Gas Pipe DO Tank Suction Pipe Measuring Point Specification,ð`ª'è,µ,½·D Z? OE± Ds Ds Ds(nm) Da Simulated Form of Aggregated PM in Exhaust Gas --±Zq on Diesel Engine 25 50 75 100 0 10 20 0 200 400 600 AirRatio Exp. results on NF-19SK Diesel Eng. Fuel oil

Ishii, Hitoshi

247

Self-Similar Structure of the Universe and Fundamental Sense of Existence of Large and Small Black Holes in the Nature  

E-Print Network (OSTI)

The origin of self-similar (according to Y.Kulakov) structure of the Universe is discussed from a position of the theory of dynamic systems (DS). A probable nature of the isomorphism of DS configurations of different levels is revealed. Nucleon DS configuration like black hole (BH) might be acquired by the last as a result of Hawking radiation of initial BH and serve further as a genome of the Universe development.

I. A. Kuchin; S. S. Boichenko; Y. I. Kuchin

2005-07-29T23:59:59.000Z

248

PHYSICAL REVIEW A 84, 062504 (2011) Scalar vertex operator for bound-state QED in the Coulomb gauge  

E-Print Network (OSTI)

14} = 1 0 dx 1 0 du 1 0 ds x xs {1,u,u2 } ( Z)2 , (5) {F15,F16,F17,F18} = 1 0 dx 1 0 du 1 0 ds x xs) {F10,F11} = 1 0 du 2 t2C tanh-1 t2 C 1/2 ? {1,u} , (16) {F12,F13,F14,F15,F16,F17,F18} = 1 0 ds 1 0

Lindgren, Ingvar

249

E-Print Network 3.0 - ainulaadne dna anals Sample Search Results  

NLE Websites -- All DOE Office Websites (Extended Search)

31, 2005; Accepted September 18, 2005 ABSTRACT Peptide nucleic acid (PNA) is a synthetic DNA mimic... is capable of sequence-specific targeting of complementary dsDNA...

250

E-Print Network 3.0 - arizona state route Sample Search Results  

NLE Websites -- All DOE Office Websites (Extended Search)

James - Space Telescope Science Institute Collection: Physics 13 Regional Network Access Point DS1 (T1) single or multiple Summary: Centers Carondelet St Marys Hospital Tucson...

251

E-Print Network 3.0 - arizona state university Sample Search...  

NLE Websites -- All DOE Office Websites (Extended Search)

Imaging Collection: Engineering ; Biology and Medicine 8 Regional Network Access Point DS1 (T1) single or multiple Summary: Centers Carondelet St Marys Hospital Tucson...

252

E-Print Network 3.0 - area northeastern arizona Sample Search...  

NLE Websites -- All DOE Office Websites (Extended Search)

University Collection: Environmental Sciences and Ecology 6 Regional Network Access Point DS1 (T1) single or multiple Summary: Centers Carondelet St Marys Hospital Tucson...

253

E-Print Network 3.0 - arizona public service Sample Search Results  

NLE Websites -- All DOE Office Websites (Extended Search)

Imaging Collection: Engineering ; Biology and Medicine 45 Regional Network Access Point DS1 (T1) single or multiple Summary: Centers Carondelet St Marys Hospital Tucson...

254

Aspects of the rate distortion theory of Gaussian sources under spectral uncertainty  

E-Print Network (OSTI)

e Fig. 8 4o. s(~) Fig. 8 illustrates 4?(~) for r = . 8, which is a typical value in speech modeling. By numerical integration, we obtain the R(D) function given by l Ds = ? f min[0, C, (~))d~, 2 (4. 45) l r I C(u) 1 R(Ds) = ? f max 0, log ' due... constraint on the frequency-weighted mean squared error (FWMSE) between ((*} and (rl}. It can be shown [I] that this rate distortion function is given parametrically by De = Di+Ds(0)+D, Rs(De) = R((Ds(8)). (1. 4) Source Optimal Noise Encoder Ideal...

Duchesne, Joe?lle Marie-Odile

2012-06-07T23:59:59.000Z

255

INTERNATIONAL JOURNAL OF c 2006 Institute for Scientific NUMERICAL ANALYSIS AND MODELING Computing and Information  

E-Print Network (OSTI)

t = · (M v) - Iion(s, v), ds dt = F(s, v), (1) where v is the transmembrane potential, M is the (diagonal

Karlsen, Kenneth Hvistendahl

256

InternationalJournalofNumericalAnalysis&Modeling,3(4):395412,2006. ON A FINITE DIFFERENCE SCHEME FOR A BEELER-REUTER BASED  

E-Print Network (OSTI)

for this phenomenon is commonly written v t = · (M v) - Iion(s, v), ds dt = F(s, v), (1) where v is the transmembrane

Karlsen, Kenneth Hvistendahl

257

A Framework for Environmental Assessment of CO2 Capture and Storage Systems  

E-Print Network (OSTI)

Aaron DS, Williams KA. Is carbon capture and storage reallyal. Comparison of carbon capture and storage with renewablefuel power plants with carbon capture and storage. Energy

Sathre, Roger

2013-01-01T23:59:59.000Z

258

Assess in-depth contributions of selected scenarios to goals...  

Open Energy Info (EERE)

Resource Assessment (SWERA) SolarDS Stochastic Energy Deployment System (SEDS) System Advisor Model (SAM) Tool for Rapid Assessment of City Energy (TRACE) UNDP-Energy Costing Tool...

259

The Feasibility of Producing and Using Biomass-Based Diesel and...  

NLE Websites -- All DOE Office Websites (Extended Search)

node30545.UpzkicSkqDs. 10. Cobalt. "BIOBUTANOL - Versatile Chemical Serving Large Markets". Accessed March 2013: http:www.cobalttech.com. 11. Coskata Inc. "The Coskata...

260

Climate Dynamics manuscript No. (will be inserted by the editor)  

E-Print Network (OSTI)

02139-4307. E-mail: thedhoe@mit.edu D.M.W. Frierson · D.S. Battisti Department of Atmospheric Sciences

Battisti, David

Note: This page contains sample records for the topic "dl deltak ds" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


261

Plastic Bronchitis  

E-Print Network (OSTI)

al. Three children with plastic bronchitis associated within E mergency M edicine Plastic Bronchitis Annie Quysner, MDElshami AA, Kang DS, et al. Plastic Bronchitis. Eur Resp J

Quysner, Annie; Surani, Salim; Roberts, Daniel

2011-01-01T23:59:59.000Z

262

RigMesh: Automatic Rigging for Part-Based Shape Modeling and Deformation Peter Borosan1  

E-Print Network (OSTI)

proficient at commercial, state-of-the-art tools such as Maya and 3ds Max [Autodesk 2012c; Autodesk 2012a

Columbia University

263

E-Print Network 3.0 - automated microchip system Sample Search...  

NLE Websites -- All DOE Office Websites (Extended Search)

Microchip's quality system for the design and manufacture of development systems is ISO 9001... 1997 Microchip Technology Inc. DS00658A-page 1 INTRODUCTION This...

264

Hydrogen Embrittlement in Pipeline Steels  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

& Materials Division Material Measurement Laboratory HYDROGEN EMBRITTLEMENT IN PIPELINE STEELS AJ Slifka, ES Drexler, RL Amaro, DS Lauria, JR Fekete Applied Chemicals &...

265

Alcohol and Culture  

E-Print Network (OSTI)

A. 1948. 3d edition. Ancient Egyp OOl>DS, E. R. 1956. Theof banquet scenes. Egyp tian taverns, like those in

Mandelbaum, David G.

1965-01-01T23:59:59.000Z

266

E-Print Network 3.0 - acute cerebral ischemia Sample Search Results  

NLE Websites -- All DOE Office Websites (Extended Search)

Lipid Mediator Lipidomics: New Pathways in Mapping Resolution Summary: . Keywor ds: Acrolein, arachidonic acid, cerebral ischemia, cytidine-5-diphosphocholine, CDP... 's and...

267

E-Print Network 3.0 - arachidonic acid degradation Sample Search...  

NLE Websites -- All DOE Office Websites (Extended Search)

Lipid Mediator Lipidomics: New Pathways in Mapping Resolution Summary: . Keywor ds: Acrolein, arachidonic acid, cerebral ischemia, cytidine-5-diphosphocholine, CDP... ) they...

268

E-Print Network 3.0 - arachidonic acid liberation Sample Search...  

NLE Websites -- All DOE Office Websites (Extended Search)

Lipid Mediator Lipidomics: New Pathways in Mapping Resolution Summary: . Keywor ds: Acrolein, arachidonic acid, cerebral ischemia, cytidine-5-diphosphocholine, CDP... ) they...

269

E-Print Network 3.0 - arachidonic acid cascade Sample Search...  

NLE Websites -- All DOE Office Websites (Extended Search)

Lipid Mediator Lipidomics: New Pathways in Mapping Resolution Summary: . Keywor ds: Acrolein, arachidonic acid, cerebral ischemia, cytidine-5-diphosphocholine, CDP... ) they...

270

E-Print Network 3.0 - arachidonic acid metabolism Sample Search...  

NLE Websites -- All DOE Office Websites (Extended Search)

Lipid Mediator Lipidomics: New Pathways in Mapping Resolution Summary: . Keywor ds: Acrolein, arachidonic acid, cerebral ischemia, cytidine-5-diphosphocholine, CDP... ) they...

271

E-Print Network 3.0 - arachidonic acid mobilization Sample Search...  

NLE Websites -- All DOE Office Websites (Extended Search)

Lipid Mediator Lipidomics: New Pathways in Mapping Resolution Summary: . Keywor ds: Acrolein, arachidonic acid, cerebral ischemia, cytidine-5-diphosphocholine, CDP... ) they...

272

E-Print Network 3.0 - administered arachidonic acid Sample Search...  

NLE Websites -- All DOE Office Websites (Extended Search)

Lipid Mediator Lipidomics: New Pathways in Mapping Resolution Summary: . Keywor ds: Acrolein, arachidonic acid, cerebral ischemia, cytidine-5-diphosphocholine, CDP... ) they...

273

E-Print Network 3.0 - assessing cerebral ischemia Sample Search...  

NLE Websites -- All DOE Office Websites (Extended Search)

Lipid Mediator Lipidomics: New Pathways in Mapping Resolution Summary: . Keywor ds: Acrolein, arachidonic acid, cerebral ischemia, cytidine-5-diphosphocholine, CDP... 's and...

274

E-Print Network 3.0 - acid liberation eicosanoid Sample Search...  

NLE Websites -- All DOE Office Websites (Extended Search)

Lipid Mediator Lipidomics: New Pathways in Mapping Resolution Summary: . Keywor ds: Acrolein, arachidonic acid, cerebral ischemia, cytidine-5-diphosphocholine, CDP... -choline,...

275

E-Print Network 3.0 - arachidonic acid triggers Sample Search...  

NLE Websites -- All DOE Office Websites (Extended Search)

Lipid Mediator Lipidomics: New Pathways in Mapping Resolution Summary: . Keywor ds: Acrolein, arachidonic acid, cerebral ischemia, cytidine-5-diphosphocholine, CDP... ) they...

276

E-Print Network 3.0 - assess cerebral ischemia Sample Search...  

NLE Websites -- All DOE Office Websites (Extended Search)

Lipid Mediator Lipidomics: New Pathways in Mapping Resolution Summary: . Keywor ds: Acrolein, arachidonic acid, cerebral ischemia, cytidine-5-diphosphocholine, CDP... 's and...

277

E-Print Network 3.0 - aux produits petroliers Sample Search Results  

NLE Websites -- All DOE Office Websites (Extended Search)

Mistigri Un produit en enchre se caractrise... DS 2009 Mistigri est un site marchand sur Internet de vente la baisse de ... Source: Johnen, Colette - Laboratoire...

278

Chirped laser dispersion spectroscopy using a directly modulated quantum cascade laser  

SciTech Connect

Chirped laser dispersion spectroscopy (CLaDS) utilizing direct modulation of a quantum cascade laser (QCL) is presented. By controlling the laser bias nearly single- and dual-sideband CLaDS operation can be realized in an extremely simplified optical setup with no external optical modulators. Capability of direct single-sideband modulation is a unique feature of QCLs that exhibit a low linewidth enhancement factor. The developed analytical model shows excellent agreement with the experimental, directly modulated CLaDS spectra. This method overcomes major technical limitations of mid-infrared CLaDS systems by allowing significantly higher modulation frequencies and eliminating optical fringes introduced by external modulators.

Hangauer, Andreas, E-mail: hangauer@princeton.edu; Nikodem, Michal; Wysocki, Gerard, E-mail: gwysocki@princeton.edu [Electrical Engineering Department, Princeton University, Princeton, New Jersey 08544 (United States)] [Electrical Engineering Department, Princeton University, Princeton, New Jersey 08544 (United States); Spinner, Georg [Electrical Engineering Department, Princeton University, Princeton, New Jersey 08544 (United States) [Electrical Engineering Department, Princeton University, Princeton, New Jersey 08544 (United States); Institute for Quantum Electronics, ETH Zurich, 8093 Zurich (Switzerland)

2013-11-04T23:59:59.000Z

279

Chirped Laser Dispersion Spectroscopy with Directly Modulated Quantum Cascade Laser  

Science Journals Connector (OSTI)

A feasibility study of chirped laser dispersion spectroscopy (CLaDS) with utilizing direct modulation of a quantum cascade laser instead of external modulators is presented....

Hangauer, Andreas; Spinner, Georg; Nikodem, Michal; Wysocki, Gerard

280

Determination of Charm Hadronic Branching Fractions at CLEO-c  

E-Print Network (OSTI)

Recent results from CLEO-c on measurements of absolute hadronic branching fractions of D0, D+, and Ds+ mesons are presented.

A. Ryd

2007-11-24T23:59:59.000Z

Note: This page contains sample records for the topic "dl deltak ds" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


281

The Cost of Transmission for Wind Energy in the United States: A Review of Transmission Planning Studies.  

E-Print Network (OSTI)

Grid. 2006. Trans mission and Wind Energy: Capturing theour sample. 20% Wind Energy: Wind Deployment System (WinDS)and Renewable Energy (Wind & Hydropower Technologies

Wiser, Ryan

2014-01-01T23:59:59.000Z

282

Since the advent of DT imaging in the early 1990s,2,20,26 the technique has generated a tremendous amount of inter-  

E-Print Network (OSTI)

.D.S., D.M.SC., DAVID S. TUCH, PH.D., METTE R. WIEGELL, PH.D., AND NOUCHINE HADJIKHANI, M.D. Martinos

Hadjikhani, Nouchine

283

Chloride improves fruit yield and quality of strawberry (Fragaria ananassa Duch.)  

E-Print Network (OSTI)

1988; 88: 194-199 Martnez Barroso MC, Alvarez CE, Toxicityof 2 dS m -1 (Martnez Barroso and Alvarez 1997). Hypotheses

Bellof, Svenja; Schubert, Sven

2009-01-01T23:59:59.000Z

284

Remediation of Abandoned Metal Mine Drainage using Dealginated Seaweed .  

E-Print Network (OSTI)

??This thesis develops and demonstrates an innovative method for adsorbing metals from metal mine drainage in mid-Wales and northern Italy using dealginated seaweed (DS) as (more)

Hartley, Suzanne

2008-01-01T23:59:59.000Z

285

Design and analysis of an ATM network traffic security device  

E-Print Network (OSTI)

by the ATM Forum. These are (in order of increasing data rates): ~ DS-I (1. 544 Mb/sec) physical interface specification [26] ~ 25. 6 Mb/sec over twisted pair physical interface specification [27] ~ DS-3 (44. 21 Mb/sec) physical interface specification... by the ATM Forum. These are (in order of increasing data rates): ~ DS-I (1. 544 Mb/sec) physical interface specification [26] ~ 25. 6 Mb/sec over twisted pair physical interface specification [27] ~ DS-3 (44. 21 Mb/sec) physical interface specification...

Teodor, Dan Cristian

2012-06-07T23:59:59.000Z

286

E-Print Network 3.0 - access health corp Sample Search Results  

NLE Websites -- All DOE Office Websites (Extended Search)

Science 2 Regional Network Access Point DS1 (T1) single or multiple Summary: Regional Health Care Corp Tonalea Chapter House Pima County Adult Detention Center University...

287

J-1 Exchange Visitor Visa The Non-Immigrant Student  

E-Print Network (OSTI)

and a diving mask. c. my DS-2019 and $400. d. my Social Security card and deep-sea fishing gear. 8. I can re

288

Double layer created by electron cyclotron resonance heating in an inhomogeneously magnetized plasma with high-speed ion flow  

SciTech Connect

A potential jump, i.e., an electric double layer (DL) is formed near an electron cyclotron resonance (ECR) point when an electron cyclotron wave is injected into an inhomogeneously magnetized plasma with high-speed ion flow. A charge separation is caused by an electron reflection due to -{mu}{nabla}B{sub z} force enhanced by ECR heating and ion inertia. It is clearly demonstrated in the experiment that the potential height of the DL is almost proportional to the field-aligned ion flow energy; the DL is found to be self-consistently formed for maintaining charge neutrality by reflecting a part of the flowing ions.

Takahashi, K.; Kaneko, T.; Hatakeyama, R. [Department of Electronic Engineering, Tohoku University, Sendai, 980-8579 (Japan)

2008-07-15T23:59:59.000Z

289

The World of Dark Shadows Issue 9  

E-Print Network (OSTI)

. 16. MORE DARK SHADOWS BLOOPERS by Jean Peacock When Kathy and I met with many fellow DS fans at Equicon '76. one of the topics of conversation was classic bloope:s. Bec~us~ retaping was too expensive. DS had an abundance of sld~-splltt7ng boo...

Multiple Contributors

1977-01-01T23:59:59.000Z

290

The Role of single minded 2 short in mammary gland development and breast cancer  

E-Print Network (OSTI)

deficiencies associated with DS, it has become apparent that women with DS are 10-25 times less likely to develop breast cancer in comparison to age-matched normal populations. Such significant effects on breast cancer susceptibility are thought to result from...

Kwak, Hyeong-il

2009-05-15T23:59:59.000Z

291

Identification of Human Cytomegalovirus UL84 Virus- and Cell-Encoded Binding Partners by Using Proteomics Analysis  

Science Journals Connector (OSTI)

...000 Da, and 1,250 laser shots were averaged for...cells with a UL44-dsRed fusion expression plasmid along...UL44-dsRed expresses a fusion protein composed of the...with UL84 and pp65-HA fusion expression plasmids...and transfected cells. HF cells were infected and...

Yang Gao; Kelly Colletti; Gregory S. Pari

2007-10-24T23:59:59.000Z

292

THE SCALE PROBLEM FOR OLD MAPS (and mental maps)  

E-Print Network (OSTI)

THE SCALE PROBLEM FOR OLD MAPS (and mental maps) Waldo Tobler From the theory of cartography we know that the instantaneous scale at a point on any map is always represented by the equation: dS2 /ds2 = g cos2 + 2g cos sin + g sin2 . This shows that the scale on a map is generally different in all

Tobler, Waldo

293

Phonological development in toddlers with Down syndrome and mixed-etiology developmental delays  

E-Print Network (OSTI)

-consonant inventory were coded during two 15-minute videotaped conversational samples with a parent at two points in time, 18 months apart. For all measures at Time 1 (age ~25 months), the children with DS performed equally well or better than their peers without DS...

Sokol, Shari Baron

2008-01-01T23:59:59.000Z

294

81Dr. Gregory A. Dorais, NASA Ames Research Center Dr. David Kortenkamp, NASA Johnson Space Center Deep Space One Remote AgentDeep Space One Remote Agent  

E-Print Network (OSTI)

81Dr. Gregory A. Dorais, NASA Ames Research Center Dr. David Kortenkamp, NASA Johnson Space Center of the NASA 1999 Software of the Year Award #12;82Dr. Gregory A. Dorais, NASA Ames Research Center Dr. David Kortenkamp, NASA Johnson Space Center Deep Space One (DS1)Deep Space One (DS1) l Launched 10/98 l Remote

Kortenkamp, David

295

HUMAN GENE THERAPY 14:871881 (June 10, 2003) Mary Ann Liebert, Inc.  

E-Print Network (OSTI)

vector end removal in mouse hepatocytes in vivo. In addition, we show the pres- ence of a DNAHUMAN GENE THERAPY 14:871­881 (June 10, 2003) © Mary Ann Liebert, Inc. Pathways of Removal of Free in vivo. Ds monomer genome formation and cellular ds DNA break (DSB) repair pathways that remove free

Kay, Mark A.

296

A monomeric red fluorescent protein Robert E. Campbell*, Oded Tour*  

E-Print Network (OSTI)

A monomeric red fluorescent protein Robert E. Campbell*, Oded Tour* , Amy E. Palmer*, Paul A, and the obligate tetramerization of the red fluorescent protein from Discosoma (DsRed). Although the weak, the obligate tet- ramerization of DsRed has greatly hindered its use as a genetically encoded fusion tag. We

Tsien, Roger Y.

297

UNL College of Architecture 2012 -2013 Required Software: Help Sheet  

E-Print Network (OSTI)

, Autodesk AutoCAD 2013, and Autodesk 3ds Max 2013 For the 2012-2013 academic year the College of Architecture will continue using the Autodesk Student Software Program. AutoCAD 2013, Revit Architecture 2013, 3ds Max Design 2013, and other titles may be downloaded directly from the Autodesk Education

Farritor, Shane

298

A rock engraving made by Neanderthals in Gibraltar  

Science Journals Connector (OSTI)

...u-bordeaux.fr/TIVMI/). The 3D video was created using Autodesk 3ds Max and Adobe Premiere Pro CC. A rock engraving made by...u-bordeaux.fr/TIVMI/). The 3D video was created using Autodesk 3ds Max and Adobe Premiere Pro CC. Movie S1 Other Supporting...

Joaqun Rodrguez-Vidal; Francesco dErrico; Francisco Giles Pacheco; Ruth Blasco; Jordi Rosell; Richard P. Jennings; Alain Queffelec; Geraldine Finlayson; Darren A. Fa; Jos Mara Gutirrez Lpez; Jos S. Carrin; Juan Jos Negro; Stewart Finlayson; Lus M. Cceres; Marco A. Bernal; Santiago Fernndez Jimnez; Clive Finlayson

2014-01-01T23:59:59.000Z

299

New Reactions and Synthetic Strategies toward Indolizidine Alkaloids and Pallavicinia Diterpenes  

E-Print Network (OSTI)

parameters 11/16/08 RN f1 (ppm) ARHXV-065A AV-500 new TBI(HvH. Set DS=0 1/10/07 RN f1 (ppm) ARHXV-070A AV-500 new TBI(HvH. Set DS=0 1/10/07 RN f1 (ppm) ARHXV-110B AVB-400 ZBO

Narayan, Alison Rae Hardin

2011-01-01T23:59:59.000Z

300

Microfabricated electrophoresis systems for DNA sequencing and genotyping applications: current technology and future directions  

Science Journals Connector (OSTI)

...pre-existing laboratory infrastructure, they are readily deployable...the migration of DNAprotein hybrids relative to that of the DNA...dsDNA ladders glasssilicon hybrid 1.0 30 25 6 min (500 bp...dsDNA ladders glasssilicon hybrid 0.5 30 25 15 min (1000...

2004-01-01T23:59:59.000Z

Note: This page contains sample records for the topic "dl deltak ds" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


301

Mode Estimation of Model-based Programs: Monitoring Systems with Complex Behavior  

E-Print Network (OSTI)

. An example of a complex device is DS-1, which flies by an asteroid and comet using ion propulsion. DS-1's, and stores each picture on disk. The three images are then read, processed and a course correction. The camera generates a faulty image, which is stored on disk. At some later time the image is read, processed

Williams, Brian C.

302

Processing Steps For Creating Standardized 5-Minute-by-Lane Datasets  

E-Print Network (OSTI)

1 Processing Steps For Creating Standardized 5-Minute-by-Lane Datasets (program code in "city measures. · Dataset DS1: Import original source data into SAS using INFILE statement. In SAS, we give this first dataset a "DS1" label (DataSet1). Most, if not all, original source data is submitted as ASCII

303

Kinetic and equilibrium adsorption of methylene blue and remazol dyes onto steam-activated carbons developed from date pits  

Science Journals Connector (OSTI)

Steam-activated carbons DS2 and DS5 were prepared by gasifying 600C-date pits carbonization products with steam at 950C to burn-off=20 and 50%, respectively. The textural properties of these carbons were determined from the nitrogen adsorption at ?196C. The chemistry of the carbon surface was determined from the surface pH and from neutralization of the surface carbonoxygen groups of basic and acidic type. The kinetic and equilibrium adsorption of MB and RY on DS2 and DS5 was determined at 27 and 37C and at initial sorption solution pH 37. DS2 and DS5 have expanded surface area, large total pore volume and contain both micro and mesoporosity. They have on their surface basic and acidic groups of different strength and functionality. This enhanced the sorption of the cationic dye (MB) and of the anionic dye (RY). The adsorption of MB and RY on DS2 and DS5 involves intraparticle diffusion and followed pseudo-second order kinetics. The adsorption isotherms were applicable to the Langmuir isotherm and high monolayer capacities for MB and RY dyes were evaluated indicating the high efficiencies of the carbons for dye adsorption.

Sheikha S. Ashour

2010-01-01T23:59:59.000Z

304

0011-9164/09/$ See front matter 2008 Elsevier B.V. All rights reserved Desalination 239 (2009) 1021  

E-Print Network (OSTI)

, the diluted DS is treated in a reverse osmosis (RO) unit; the by-product is a reconcentrated DS for reuse. For potable reuse (e.g., indirect reuse through aquifer recharge), advanced treat- ment [e.g., reverse osmosis) 10­21 The forward osmosis membrane bioreactor: A low fouling alternative to MBR processes Andrea

305

Evaluation of traits associated with bucking bull performance and behavior  

E-Print Network (OSTI)

aunt and uncle, Robert and Kim Romero, for all of their love and support during my academic career. vi NOMENCLATURE DAB Dataset ?All Bulls? DBG Dataset ?Bull Groups? DS Dataset ?Sires? DS1 Dataset ?Sires with more than 1 son................................................................................................................. 21 Average score................................................................................................ 22 Career average score ..................................................................................... 22 Datasets...

Romero, Natasha Elizabeth

2009-05-15T23:59:59.000Z

306

Stereotactic body radiation therapy planning with duodenal sparing using volumetric-modulated arc therapy vs intensity-modulated radiation therapy in locally advanced pancreatic cancer: A dosimetric analysis  

SciTech Connect

Stereotactic body radiation therapy (SBRT) achieves excellent local control for locally advanced pancreatic cancer (LAPC), but may increase late duodenal toxicity. Volumetric-modulated arc therapy (VMAT) delivers intensity-modulated radiation therapy (IMRT) with a rotating gantry rather than multiple fixed beams. This study dosimetrically evaluates the feasibility of implementing duodenal constraints for SBRT using VMAT vs IMRT. Nonduodenal sparing (NS) and duodenal-sparing (DS) VMAT and IMRT plans delivering 25 Gy in 1 fraction were generated for 15 patients with LAPC. DS plans were constrained to duodenal D{sub max} of<30 Gy at any point. VMAT used 1 360 coplanar arc with 4 spacing between control points, whereas IMRT used 9 coplanar beams with fixed gantry positions at 40 angles. Dosimetric parameters for target volumes and organs at risk were compared for DS planning vs NS planning and VMAT vs IMRT using paired-sample Wilcoxon signed rank tests. Both DS VMAT and DS IMRT achieved significantly reduced duodenal D{sub mean}, D{sub max}, D{sub 1cc}, D{sub 4%}, and V{sub 20} {sub Gy} compared with NS plans (all p?0.002). DS constraints compromised target coverage for IMRT as demonstrated by reduced V{sub 95%} (p = 0.01) and D{sub mean} (p = 0.02), but not for VMAT. DS constraints resulted in increased dose to right kidney, spinal cord, stomach, and liver for VMAT. Direct comparison of DS VMAT and DS IMRT revealed that VMAT was superior in sparing the left kidney (p<0.001) and the spinal cord (p<0.001), whereas IMRT was superior in sparing the stomach (p = 0.05) and the liver (p = 0.003). DS VMAT required 21% fewer monitor units (p<0.001) and delivered treatment 2.4 minutes faster (p<0.001) than DS IMRT. Implementing DS constraints during SBRT planning for LAPC can significantly reduce duodenal point or volumetric dose parameters for both VMAT and IMRT. The primary consequence of implementing DS constraints for VMAT is increased dose to other organs at risk, whereas for IMRT it is compromised target coverage. These findings suggest clinical situations where each technique may be most useful if DS constraints are to be employed.

Kumar, Rachit; Wild, Aaron T.; Ziegler, Mark A.; Hooker, Ted K.; Dah, Samson D.; Tran, Phuoc T.; Kang, Jun; Smith, Koren; Zeng, Jing [Department of Radiation Oncology and Molecular Radiation Sciences, Sidney Kimmel Comprehensive Cancer Center, Johns Hopkins Hospital, 401N. Broadway, Weinberg Suite 1440, Baltimore, MD 21231 (United States); Pawlik, Timothy M. [Department of Surgery, Sidney Kimmel Comprehensive Cancer Center, Johns Hopkins University School of Medicine, Baltimore, MD (United States); Tryggestad, Erik [Department of Radiation Oncology and Molecular Radiation Sciences, Sidney Kimmel Comprehensive Cancer Center, Johns Hopkins Hospital, 401N. Broadway, Weinberg Suite 1440, Baltimore, MD 21231 (United States); Ford, Eric [Department of Radiation Oncology, Fred Hutchinson Cancer Center, University of Washington, Seattle, WA (United States); Herman, Joseph M., E-mail: jherma15@jhmi.edu [Department of Radiation Oncology and Molecular Radiation Sciences, Sidney Kimmel Comprehensive Cancer Center, Johns Hopkins Hospital, 401N. Broadway, Weinberg Suite 1440, Baltimore, MD 21231 (United States)

2013-10-01T23:59:59.000Z

307

A computer procedure for evaluating the effects of loading thin isotropic shells of revolution  

E-Print Network (OSTI)

geometry. riis method is used. in th? soluticn of the pro'blem. The computer used for thc program checxout and the test runs was the 1Bld 70P4 at the Texas AQN University Data Processing Center. Plot- ting wss done on CALCOii2 digit 1 plotter...-I (J). = 2C(ds)(Z. I - 2 ~I) (K). = 2(e + 1)(ds)ripn (ri+I i-I I + 2(ds)r. (r. (p - p ) + p (r. + - r. )] r ni+I ni-I ni 1+I 1 I (rgp (ds) + 2(ds)e((Z ~I - & 1)(r p )) 10 Solution of Bquations 1'quations of the form used in equations (14) and (15...

Petersen, Gary Stanley

2012-06-07T23:59:59.000Z

308

Voxel-based T2 relaxation rate measurements in temporal lobe epilepsy (TLE) with and without mesial temporal sclerosis  

E-Print Network (OSTI)

Voxel-based T2 Relaxation Rate Measurements in Temporal LobeD, Pike BG, Arnold DL. T2 relaxometry can lateralize mesialC, Grucker D. Contribution of T2 relaxation time mapping in

Mueller, S G; Laxer, K D; Schuff, N; Weiner, Michael W

2007-01-01T23:59:59.000Z

309

Enzymes of the shikimic acid pathway encoded in the genome of a basal metazoan, Nematostella vectensis, have microbial origins  

Science Journals Connector (OSTI)

...VDQHIKGLQAMGAEVRVEHGYVQAQVPRLKGARLFTDMVTVTGTENLMMAACLAQGETVI 182 Query 181 ENAAMEAEIDDLVCMLRKMGAQIDKNRDTKTWFITGVSSLHGADHGVVPDRIVAGTYAVA 240 ENAA E E+ DL L MGAQI T I GV +LHGA H ++PDRI GTY A Sbjct 183 ENAAREPEVVDLANCLVAMGAQI-SGAGTDVIRIRGVDALHGATHRIMPDRIETGTYLCA 241 Query 241 AVMTGGELTLT-LGPCPVPALMGCVLTCLRAAGAEVMELAEGIRVRGGRRPRSVSITTSP...

Antonio Starcevic; Shamima Akthar; Walter C. Dunlap; J. Malcolm Shick; Daslav Hranueli; John Cullum; Paul F. Long

2008-01-01T23:59:59.000Z

310

An empirical evaluation of live cattle futures and options for short hedging slaughter cattle in the Texas Panhandle  

E-Print Network (OSTI)

were able to derive the model: W(X, T) = XN(dl) ? Ce N(d2), ln X/C + (R + I/2V )(T) (10) dl = v Tl/2 sTI/2 2 1 where W(X, T) is the premium for a call stock option with an exercise 20 price of C and time T until expiration, the underlying stock... the necessary modifications, Black derived the commod- ity contract pricing model: CP(Z T) e [ZN(dl) CN(d2) ] X S (12) dl = [ln ? + ? (T)]ST C 2 d d uTI/2 2 1 This formula is identical to the Black-Scholes model if Ze is substi- tuted for X everywhere...

Winder, Jim R.

2012-06-07T23:59:59.000Z

311

ACM Reference Format Wei, X., Zhang, P., Chai, J. 2012. Accurate Realtime Full-body Motion Capture Using a Single Depth Cam-  

E-Print Network (OSTI)

-based animation, human motion tracking, 3D pose detection, vision-based motion modeling Links: DL PDF e-mail: xwei parallel and is therefore easily implemented on a GPU. We demonstrate the power of our approach

Chai, Jinxiang

312

Download Full-text PDF  

Science Journals Connector (OSTI)

types of sedimentary environments in the southern and eastern North Sea in August 1991 and ..... fusion (D,) coefficients (both in units of m2 d-l), the sedi-.

313

Communications mensuelles de l'lnstitut International dela Potasse, Berne (Suisse) Science du sol N 5/1981  

E-Print Network (OSTI)

sciences vc!igc!itales, Universitc!i de Delaware, Newark, Delaware 19711, USA Resume condense des publications suivantes: Sparks D.L., Martens D.C., Zelazny L. W.: Plant Uptake and Leaching of applied

Sparks, Donald L.

314

LCLS CDR Chapter 11 - Controls  

NLE Websites -- All DOE Office Websites (Extended Search)

will be EPICS-based. These systems include: (1) The LCLS Injector systems, such as, the gun, the gun laser, the injector linac and the DL1 beamline. (2) The undulator segments,...

315

E-Print Network 3.0 - anemia status hemoglobin Sample Search...  

NLE Websites -- All DOE Office Websites (Extended Search)

Sargent, MD Summary: dL after adjustments for children's age, hemoglobin level, and insurance status (12). The second, a study... Test children at risk for anemia (e.g., those...

316

The Personalized, Collaborative Digital Library Environment CYCLADES and Its Collections Management  

Science Journals Connector (OSTI)

Usually, a Digital Library (DL) is an information resource where ... additionally as a personalized collaborative working and meeting space of people sharing common interests, where users...i may organize the inf...

Leonardo Candela; Umberto Straccia

2004-01-01T23:59:59.000Z

317

Effects of Physical Activity and Restricted Energy Intake on Chemically Induced Mammary Carcinogenesis  

Science Journals Connector (OSTI)

...induces a greater flux of energy through the system that could...stress, whereas restricted energy intake (RE) reduces oxidative...maltodextrin, cornstarch, corn oil, cellulose, minerals...and dl-methionine. The energy distribution was protein (20...

Weiqin Jiang; Zongjian Zhu; and Henry J. Thompson

2009-04-01T23:59:59.000Z

318

Sources of CAM3 temperature bias during northern winter from diagnostic study of the temperature bias equation  

E-Print Network (OSTI)

References Boville BA, Rasch PJ, Hack JJ, McCaa JR (2006)WD, Rasch PJ, Boville BA, Hack JJ, McCaa JR, Williamson DL,602. doi:10.1002/joc.1423 Hack JJ, Kiehl JT, Hurrell JW (

Pan, Lin-Lin; Grotjahn, Richard; Tribbia, Joe

2010-01-01T23:59:59.000Z

319

1  

NLE Websites -- All DOE Office Websites (Extended Search)

Spectroscopy and Radiative Transfer 91:233-244. Collins, WD, PJ Rasch, BA Boville, JJ Hack, JR McCaa, DL Williamson, BP Briegleb, CM Bitz, S-J Lin, and M Zhang 2006. "The...

320

1  

NLE Websites -- All DOE Office Websites (Extended Search)

absorption of radiation." Contributions to Atmospheric Physics, 52, 1-16. Kiehl, JT, JJ Hack, GB Bonan, BA Boville, BP Briegleb, DL Williamson, and PJ Rasch. 1996. Description of...

Note: This page contains sample records for the topic "dl deltak ds" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


321

Effectiveness of Employing Multimedia Principles in The Design of Computer-Based Math Tutorials for Students with Learning Disabilities  

E-Print Network (OSTI)

DL). The animated tutorial prototype, which was studied as part of this project, was for young children. The study evaluated a prototype of online instructional tutorial in mathematics designed for students with disabilities. The tutorial prototype was instructional...

Kanitkar, Anjali Shridhar

2010-04-28T23:59:59.000Z

322

EROSION-CORROSION-WEAR PROGRAM  

E-Print Network (OSTI)

MD, Oct. 1979. dl. Oil Shale Retort Components" A. Levy andCorrosion of Metals in Oil Shale Retorts,'' AS! v! WESTEC 'of metals in coal and oil shale conver- sion environments

Levy, Alan V.

2013-01-01T23:59:59.000Z

323

October 1992 ISOLATOR-10  

E-Print Network (OSTI)

Suggested Reading Material A-1 CIRCUIT DIAGRAMS B-1 WARRANTY C-1 WARNING D-l RETURN MERCHANDISE be handled at all times with caution. ISOLATOR-10, COPYRIGHT OCTOBER 1992, AXON INSTRUMENTS, INC. #12;Page V

Kleinfeld, David

324

EROSION-CORROSION-WEAR PROGRAM  

E-Print Network (OSTI)

will also be conducted in shale oil product material. 1979MD, Oct. 1979. dl. Oil Shale Retort Components" A. Levy andof metals in coal and oil shale conver- sion environments

Levy, Alan V.

2013-01-01T23:59:59.000Z

325

Manufacturability Study and Scale-Up for Large Format Lithium...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

contributions out of over 40 in FY1314 * Selected publications 1. J. Li, B.L. Armstrong, J. Kiggans, C. Daniel, and D.L. Wood, "Lithium Ion Cell Performance Enhancement...

326

[)r PAR1 rMF.Nr o Dr (.FIrMr( A .IF]CNC)I,OGIi,  

E-Print Network (OSTI)

[)r PAR1 rMF.Nr o Dr (.FIrMr( A E .IF]CNC)I,OGIi, f)?]I I-ARMACo @ ;^.*r.l-EN,.m BANDO Dl SELEZIONE

Guidoni, Leonardo

327

Sustained fecundity when phytoplankton resources are in short supply  

Science Journals Connector (OSTI)

rates of egg production (1 l-45 eggs female 1 d-l) in the open waters of the Gulf of St. Lawrence in late. June-early July. These rates were comparable to egg...

1999-12-19T23:59:59.000Z

328

Science in support of the Deepwater Horizon response  

Science Journals Connector (OSTI)

...are total discharge: oil plus liquid natural gas. The total discharge (oil + liquid...science and views. Protecting intellectual capital is also important. However, some scientists...48 Redmond MC Valentine DL ( 2012 ) Natural gas and temperature structured...

Jane Lubchenco; Marcia K. McNutt; Gabrielle Dreyfus; Steven A. Murawski; David M. Kennedy; Paul T. Anastas; Steven Chu; Tom Hunter

2012-01-01T23:59:59.000Z

329

Structure of the rare archaeal biosphere and seasonal dynamics of active ecotypes in surface coastal waters  

Science Journals Connector (OSTI)

...Heidelberg JF Kirchman DL ( 2011 ) Activity of abundant and rare bacteria in a coastal ocean . Proc Natl Acad Sci USA 108 : 12776 12781 . 5 Lennon JT Jones SE ( 2011 ) Microbial seed banks: The ecological and evolutionary implications of dormancy...

Mylne Hugoni; Najwa Taib; Didier Debroas; Isabelle Domaizon; Isabelle Jouan Dufournel; Gisle Bronner; Ian Salter; Hlne Agogu; Isabelle Mary; Pierre E. Galand

2013-01-01T23:59:59.000Z

330

Single bacterial strain capable of significant contribution to carbon cycling in the surface ocean  

Science Journals Connector (OSTI)

...Heidelberg JF Kirchman DL ( 2011 ) Activity of abundant and rare bacteria in a coastal ocean . Proc Natl Acad Sci USA 108 ( 31 ): 12776 12781 . 52 Hunt DE ( 2013 ) Relationship between abundance and specific activity of bacterioplankton in open ocean surface...

Byron E. Pedler; Lihini I. Aluwihare; Farooq Azam

2014-01-01T23:59:59.000Z

331

Licensing stop place before laterals : a study of acoustic cues relevant to the perception of stop-lateral sequences  

E-Print Network (OSTI)

In phonological analyses of both adult and child language, a *dl constraint has frequently been used as a shorthand to indicate that coronal stops are dispreferred before laterals (Dinnsen et al. 2001). This dispreference ...

Michaels, Jennifer M. (Jennifer Marie)

2011-01-01T23:59:59.000Z

332

E-Print Network 3.0 - arterial blood gas Sample Search Results  

NLE Websites -- All DOE Office Websites (Extended Search)

54 ml CO2 dL blood The total CO2 content of blood in any systemic artery 49 ml CO2 d... of gas exchange with environment Difference in blood respiratory gas after...

333

A Unique Set of 11,008 Onion Expressed Sequence Tags Reveals Expressed Sequence and Genomic Differences between the Monocot Orders Asparagales and Poales  

Science Journals Connector (OSTI)

...Applied Biosystems, Foster City, CA). Analyses...the Entrez retrieval system to specify plant sequences...Food and Agricultural Systems Grant 2001-04434...Ostell, J., and Wheeler, D.L. (2003...Monocotyledons: A Comparative Study. (London: Academic...

Joseph C. Kuhl; Foo Cheung; Qiaoping Yuan; William Martin; Yayeh Zewdie; John McCallum; Andrew Catanach; Paul Rutherford; Kenneth C. Sink; Maria Jenderek; James P. Prince; Christopher D. Town; Michael J. Havey

2003-12-11T23:59:59.000Z

334

Reciprocal feeding facilitation between above- and below-ground herbivores  

Science Journals Connector (OSTI)

...potential mechanisms are induction of ethylene or abscisic acid in leaves by root...153-170. Wallingford, UK: CABI. 4 Price, PW , RF Denno, MD Eubanks, DL...Bhattarai, and I Kaloshian. 2009 Ethylene contributes to potato aphid susceptability...

2013-01-01T23:59:59.000Z

335

Improvement of epidemiological data analysis by unbiased estimates of log-normal dose distribution  

Science Journals Connector (OSTI)

The effects of radiation on population and risk assessment are studied through epidemiological studies that are heavily dependent on dose distribution. Radiation doses to individual workers follow a log-normal distribution. Computation of the collective dose with the minimum detectable values (Detection Limit or DL) as zero is biased. Hence the expectation value of the 'missed' doses is computed as the ratio of the collective dose of all dosimeters with DL to the product of the total number of dosimeters. So far, in all epidemiological studies, doses below DL are set equal to the DL itself and yield a positive bias in the dose-response relation. This paper presents an enhanced method by removing the bias with the help of the Expectation Maximisation (EM) algorithm. This algorithm, along with unbiased characteristic estimates of log-normal distribution, significantly improves the estimation of confounders by 95%, and improves the dose-response relationship.

Joyeeta Mukhopadhyaya; D. Datta; H.S. Kushwaha

2007-01-01T23:59:59.000Z

336

2007/08/1747  

E-Print Network (OSTI)

[6] Ian Porteous. Topological ... as a subgroup of U(n) decomposes into irreducible representations R1,...,Rl of dimensions d1,...,dl and with multiplicities m1,...,ml...

2008-10-06T23:59:59.000Z

337

RFP_WhitePaper_v4  

NLE Websites -- All DOE Office Websites (Extended Search)

White paper for 2014 FESAC Strategic Planning Aug. 2014 1 Opportunities and Context for Reversed Field Pinch Research J.S. Sarff 1 , A.F. Almagri, J.K. Anderson, D.L. Brower, B.E....

338

viennaking.PDF  

NLE Websites -- All DOE Office Websites (Extended Search)

IMPROVED ACCURACY FOR LOW-COST SOLAR IRRADIANCE SENSORS D.L. King, W.E. Boyson, B.R. Hansen, and W.I. Bower, Sandia National Laboratories Presented at the 2 nd World Conference and...

339

Rate-limiting Factors in Glycolysis and Transport of Inorganic Phosphate in DBAH1 Tumor, DBAG Tumor, Novikoff Hepatoma, and Novikoff Ascites Tumor  

Science Journals Connector (OSTI)

...are in SI units. The conversion factor for glucose is mg/dl...High-risk lifestyle factors may lead to insulin resistance...circulating levels of energy substrates, insulin, and insulin-like growth factor-1, may promote the...

Ray Wu; Helen Power; and David Hamerman

1965-11-01T23:59:59.000Z

340

Enhanced killing of pancreatic cancer cells by expression of fusogenic membrane glycoproteins in combination with chemotherapy  

Science Journals Connector (OSTI)

...and Medical Virology, Institute of Microbiology and Hygiene, Ruhr-University Bochum...Freytag SO, Rogulski KR, Paielli DL, Gilbert JD, Kim JH. A novel three-pronged...and Medical Virology, Institute of Microbiology and Hygiene, Ruhr-University Bochum...

Dennis Hoffmann and Oliver Wildner

2006-08-01T23:59:59.000Z

Note: This page contains sample records for the topic "dl deltak ds" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


341

LU Surface Chemistry 17 STM of (2222)R45-Ti5O8/Pt(100)  

E-Print Network (OSTI)

absorption with an evacuated FTIR spectrometer. RMS signal to noise ratios of over a million to one have been.bath.ac.uk/~chsacf/solartron/electro/html/dl.htm #12;LU Surface Chemistry 32 Exemplary Electrochemical Problems Requ

Gilchrist, James F.

342

Mycorrhizal fungi in roots of Texas crops  

E-Print Network (OSTI)

~h, 1 f d ' d with peanuts grown at Stephenville, Texas. In watermelon material, five different kinds of mycorrhiza1 ~ p ly d, ' 1 d' S h* G~ p G~t 11 'd, G. ~l d G. ~h, d p ' f S~ltt, S. Slf 1 d S. ~tfd . 1'h ~dl ' p 1 *1 f d ' h ll p t ~dl... ~h, 1 f d ' d with peanuts grown at Stephenville, Texas. In watermelon material, five different kinds of mycorrhiza1 ~ p ly d, ' 1 d' S h* G~ p G~t 11 'd, G. ~l d G. ~h, d p ' f S~ltt, S. Slf 1 d S. ~tfd . 1'h ~dl ' p 1 *1 f d ' h ll p t ~dl...

Yeh, May-Wei Mavix

2012-06-07T23:59:59.000Z

343

Modeling of Energy Production Decisions: An Alaska Oil Case Study  

E-Print Network (OSTI)

and Weimer, D.L. (1984) Oil prices shock, market response,OPEC behavior and world oil prices (pp. 175-185) London:many decades. Recent high oil prices have caused oil-holding

Leighty, Wayne

2008-01-01T23:59:59.000Z

344

Bilevel Direct Search Method for Leader-Follower Equilibrium ...  

E-Print Network (OSTI)

electricity markets [42, 46, 16], Nash equilibrium model in transportation [27] and signal trans- mission in wireless ...... Private market share (DH,DL). (0.62, 0.41)...

2012-02-12T23:59:59.000Z

345

The Very Large Telescope Interferometer: an update Pierre Haguenauer*a  

E-Print Network (OSTI)

, Casilla 19001, Santiago, Chile; b European Southern Observatory, Karl-Schwarzschild-Str. 2, 85748 Garching long tunnel. A system of movable mirrors allows sending the light from each DL to any of the sixteen

Liske, Jochen

346

E-Print Network 3.0 - area electron beam Sample Search Results  

NLE Websites -- All DOE Office Websites (Extended Search)

D.L. Summary: , Ann Arbor, MI 48109, USA Abstract We have used electron and photon beams from the 50 MV electron... the magnetic confinement of HE electron and photon...

347

Composition of Dioxin-like PCBs in Fish: An Application for Risk  

E-Print Network (OSTI)

Composition of Dioxin-like PCBs in Fish: An Application for Risk Assessment S A T Y E N D R A P . B in Aroclors and that toxicity varies considerably among the congeners with dioxin-like PCBs (dl

Jackson, Don

348

Carbohydrate-like composition of submicron atmospheric particles and their production from ocean bubble bursting  

Science Journals Connector (OSTI)

...much of the International Chemistry...trajectories and radon concentrations...campaign, with project averages...these two projects, two coastal [International Consortium...0.91) Radon (mBq m-3...the ICEALOT project. "<DL...

Lynn M. Russell; Lelia N. Hawkins; Amanda A. Frossard; Patricia K. Quinn; Tim S. Bates

2010-01-01T23:59:59.000Z

349

Modern Methods of Monosaccharide Synthesis from Non-Carbohydrate Tomas Hudlicky,* David A. Entwistle, Kevin K. Pitzer, and Andrew J. Thorpe  

E-Print Network (OSTI)

and Tafel to consist of a mixture of carbo- hydrates, two of which were identified as DL-arabino- hexulose, and propagation. Figure 1. Fischer and Tafel's synthesis of nonracemic sugars from formose. Figure 2. The first

Hudlicky, Tomas

350

KRAGER, CLINTON D., AND SARAH ANN WOODIN. Spatial ...  

Science Journals Connector (OSTI)

Exposure times for all quadrats ranged from 6 to 9 h d-l ... quadrats were started on 25 June and ended ...... morphology of the alimentary tract, food and feeding.

1999-12-22T23:59:59.000Z

351

ILDS  

Energy Science and Technology Software Center (OSTI)

003176IBMPC00 Intelligent Leak Detection System https://www.dropbox.com/sh/aycss2bffzmur10/AAAJvqH8IKmrA93kngsAy45qa?dl=0

352

EFFECT OF NITROGEN OXIDE PRETREATMENTS ON ENZYMATIC HYDROLYSIS OF CELLULOSE  

E-Print Network (OSTI)

Jerusalem, loR. Parkinson, Tappi, Meller, Holzforschung,L.L. Schaleger and D.L. Brink, Tappi, No.4, 65 ( 1978). N.I.Holocellulose in Wood," Tappi Standard T9 m-54. C.R.

Borrevik, R.K.

2011-01-01T23:59:59.000Z

353

Potassium-Calcium Exchange in a Multireactive Soil System: II. Thermodynamics1 P. M. JARDINE ANDD. L. SPARKS2  

E-Print Network (OSTI)

ions and sup- ports the hypothesis of the multireactive natureof the soil. Although K was selectively energy of ex- change, enthalpy of exchange, entropy of exchange. Jardine, P.M., and D.L. Sparks. 1984

Sparks, Donald L.

354

Memory, brain and aging: The good, the bad and the promising  

E-Print Network (OSTI)

temporal region endur- ing memory impairment following aE. 1994. What are the memory systems of 1994? In: SchacterDL, Tulving E (eds. ). Memory Systems 1994. Cambridge, MA:

Ober, Beth A.

2010-01-01T23:59:59.000Z

355

HUTCHINS, DA, GR DITULLIO, Y. ZHANG, AND KW BRULAND. An ...  

Science Journals Connector (OSTI)

organic Fe was added as a 26 M stock in 0.01 N Ultrex .... Results. In keeping with the large heterogeneity in Fe supplies along the ..... expressed in units of d-l.

356

Borehole geophysics evaluation of the Raft River geothermal reservoir...  

Open Energy Info (EERE)

GEOTHERMAL SYSTEMS; HYDROTHERMAL SYSTEMS; NORTH AMERICA; PACIFIC NORTHWEST REGION; USA Authors Applegate, J.K.; Donaldson, P.R.; Hinkley, D.L.; Wallace and T.L. Published...

357

A DNA Nanostructure Platform for Directed Assembly of Synthetic Vaccines  

Science Journals Connector (OSTI)

A DNA Nanostructure Platform for Directed Assembly of Synthetic Vaccines ... Here we report the design and synthesis of a 1,669-nucleotide, single-stranded DNA mol. ... These DL-DNAs induced greater amts. of tumor necrosis factor-? and interleukin-6 from RAW264.7 macrophage-like cells than did a mixt. of Y-DNA with the same sequences as the corresponding DL-DNA. ...

Xiaowei Liu; Yang Xu; Tao Yu; Craig Clifford; Yan Liu; Hao Yan; Yung Chang

2012-07-03T23:59:59.000Z

358

Shock-induced hyperalgesia: the role of the gaba and glutamate systems of the dorsolateral periaqueductal gray  

E-Print Network (OSTI)

sensitization bears similarities to the sensitization of acoustic startle. Both forms of sensitization can be induced by moderate shock and have a similar time course (approximately 30 min; Illich et al. , 1995). Recent This thesis follows the format... of the Journal of Neuroscience. evidence has implicated the dorsolateral PAG (dlPAG) in both forms of environmentally-induced sensitization. Lesions of the dlPAG eliminate shock- induced sensitization of acoustic startle, shock-induced hyperalgesia...

Sieve, Amy Nicole

2012-06-07T23:59:59.000Z

360

Effects of stress ratio and fiber orientation on fatigue crack growth behavior in APAL  

SciTech Connect

A new hybrid composite (APAL; Aramid Patched Aluminum Alloy), consisting of 2024-T3 aluminum alloy plate sandwiched between aramid/epoxy prepregs (HK 285/RS 1222), was developed. Fatigue crack growth behavior was examined at stress ratios of R = 0.2, 0.5 using two kinds of APAL with different fiber orientation (0{degree}/90{degree} and {+-} 45{degree} for crack direction). The APAL showed superior fatigue crack growth resistance, which may be attributed to the crack bridging effect imposed by the intact fibers in the crack wave. The magnitude of crack bridging was estimated quantitatively and determined by a new technique on the basis of the compliances of 2024-T3 aluminum alloy and APAL specimens. The crack growth rate of the APAL specimens was reduced significantly as comparison to the monolithic aluminum alloy and was not adequately correlated with the conventional stress intensity factor range ({Delta}K). It was found that the crack growth rate was successfully correlated with the effective stress intensity factor range ( {Delta}K{sub eff} = K{sub br} {minus} K{sub cl}) allowing for the crack closure and the crack bridging. The relation between da/dN and {Delta}K{sub eff} was plotted within a narrow scatter band regardless at loading line of 2024-T3 aluminum alloy, two kinds of the APAL (APAL 0{degree}/90{degree}, APAL {+-} 45{degree}) and two kinds of stress ratios (R = 0.2, 0.5).

Oh, S.W.; Park, W.J. [Dong-A Univ., Pusan (Korea, Republic of). Dept. of Mechanical Engineering; Yoon, H.K.; Lee, K.G. [Dong-Eui Univ., Pusan (Korea, Republic of). Dept. of Mechanical Engineering; Cho, J.M.; Lee, K.B. [Han Kuk Fiber Glass Co. Ltd., Kyungnam (Korea, Republic of)

1993-12-31T23:59:59.000Z

Note: This page contains sample records for the topic "dl deltak ds" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


361

MICROX-2 cross section library based on ENDF/B-VII  

SciTech Connect

New cross section libraries of a neutron transport code MICROX-2 have been generated for advanced reactor design and fuel cycle analyses. A total of 386 nuclides were processed, including 10 thermal scattering nuclides, which are available in ENDF/B-VII release 0 nuclear data. The NJOY system and MICROR code were used to process nuclear data and convert them into MICROX-2 format. The energy group structure of the new library was optimized for both the thermal and fast neutron spectrum reactors based on Contributon and Point-wise Cross Section Driven (CPXSD) method, resulting in a total of 1173 energy groups. A series of lattice cell level benchmark calculations have been performed against both experimental measurements and Monte Carlo calculations for the effective/infinite multiplication factor and reaction rate ratios. The results of MICROX-2 calculation with the new library were consistent with those of 15 reference cases. The average errors of the infinite multiplication factor and reaction rate ratio were 0.31% {delta}k and 1.9%, respectively. The maximum error of reaction rate ratio was 8% for {sup 238}U-to-{sup 235}U fission of ZEBRA lattice against the reference calculation done by MCNP5. (authors)

Hou, J.; Ivanov, K. [Dept. of Mechanical and Nuclear Engineering, Pennsylvania State Univ., Univ. Park, PA 16802-1414 (United States); Choi, H. [General Atomics, 3550 General Atomics Court, San Diego, CA 92121-1122 (United States)

2012-07-01T23:59:59.000Z

362

The effect of temperature and cyclic frequency upon fatigue crack growth behavior of several steels in an elevated temperature aqueous environment  

SciTech Connect

The fatigue crack propagation (FCP) behavior of several ASTM A302-B and A508-2 steels was characterized in deaerated elevated temperature aqueous environment. FCP behavior was determined over the range 121 C to 343 C at a constant value of [Delta]K, stress ratio, and load rise time. A complex response of FCP rates as a function of temperature was observed, and this is discussed in the light of similar results developed by others within the nuclear industry. Corrosion potentials (referenced to the standard hydrogen electrode) were measured for each of the steels over the above temperature range and comparisons are made to the observed FCP behavior. Cyclic frequency effects were studied at two temperatures, 149 C and 243 C, and these are analyzed within the time domain'' format first suggested by Shoji et al. The results, when expressed in the time domain format, clearly show regions where environmentally assisted cracking (EAC) occurs, and regions where EAC does not occur. A threshold'' for EAC was noted at 149 C, and the possibility of an EAC threshold was observed at 243 C.

James, L.A. (Westinghouse Electric Corp., West Mifflin, PA (United States))

1994-05-01T23:59:59.000Z

363

Fairness in optimal routing algorithms  

E-Print Network (OSTI)

functions. There is usually one link which will bottleneck 38 1. 0 w 0. 8 6 IP N I 0 06 Ds(z) P( ) q (~F, ) Ds(z) = E(?, )?x (, ' ) e N Cl c pe 6 0 Cl pZ Dr(z) = E( ul?A ??-F. , po 0. 00 0. 25 0. 50 traffic level 0. 75 1. 00 Fig. 11... function. The 1. 0 traffic level of each topology corresponds to the maximum link utilization oi' Ds(z). 8-node network The 8-node network in Fig. 2 represents a network with bottleneck links. Notice that several links have half the capacity oi...

Goos, Jeffrey Alan

2012-06-07T23:59:59.000Z

364

Field Notes, Idaho, Borell & Orr (1930-1932)  

E-Print Network (OSTI)

?n? ?v? oatyyo6 xtf fsmyt oatyyo gsia onm ibxnsli ?kyytio,,,,, v ?n?to ?1? oatyyo6 xtf fsmyt ?nsl iat nfsqsl-y ?nito -ft lni -l ,, KKa-lqto sl mnfd oxtyyslq gtft do,rt, sjik-isnl gtft TT X U JL? ? ?b...? ,,,,,,,,,,,,,,,,, ,,,,,,,,,,,,,,,,,,, b,,,,,,,,,,,,,,,,w )tf j-ds ?nf kot oxtjs-y oattio sl Ukotkd lnit?nj V?xnokft dtitf,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,? )tf j-ds O-? msyitf -lr anyrtf,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,w ot? )tf j-ds Oy...

Davis, William B.

2012-04-09T23:59:59.000Z

365

Technical report on the General Electric model #1 electrostatic electron microscope  

E-Print Network (OSTI)

results may be obtained. (&) The equation for spherical aberration is ds = CfP cm Eq. 5 where d is the diameter of the disc of confusion; 0 is 8 the d1mensionless constant due to spherical aberrations; f is the focal length; and p is the aperture.... Therefore ds -dd -8 Ctg a 10xl0 p~ 4 loxlo Cf ~ Eq. 7 f' or optimum resolution dopt = y'd + dd and since ds dd d t = 'i/2Cl dopt = ?' Z CfP substituting Eq. 7 d = 600(Cf) ~ V opt Eq. 8 Prom Eq. 8, it can be seen that if f is decreased and V 1...

Druce, Albert J

2012-06-07T23:59:59.000Z

366

Instability of Quantum de Sitter Spacetime  

E-Print Network (OSTI)

Quantized fields (e.g., the graviton itself) in de Sitter (dS) spacetime lead to particle production: specifically, we consider a thermal spectrum resulting from the dS (horizon) temperature. The energy required to excite these particles reduces slightly the rate of expansion and eventually modifies the semiclassical spacetime geometry. The resulting manifold no longer has constant curvature nor time reversal invariance, and back-reaction renders the classical dS background unstable to perturbations. In the case of AdS, there exists a global static vacuum state; in this state there is no particle production and the analogous instability does not arise.

Ho, Chiu Man

2015-01-01T23:59:59.000Z

367

D S Geo Innogy Fraport JV | Open Energy Information  

Open Energy Info (EERE)

Innogy Fraport JV Innogy Fraport JV Jump to: navigation, search Name D&S Geo Innogy & Fraport JV Place Germany Sector Geothermal energy Product Germany-based JV that will supply part of the airport with geothermal energy for its heat requirements. References D&S Geo Innogy & Fraport JV[1] LinkedIn Connections CrunchBase Profile No CrunchBase profile. Create one now! This article is a stub. You can help OpenEI by expanding it. D&S Geo Innogy & Fraport JV is a company located in Germany . References ↑ "D&S Geo Innogy & Fraport JV" Retrieved from "http://en.openei.org/w/index.php?title=D_S_Geo_Innogy_Fraport_JV&oldid=344021" Categories: Clean Energy Organizations Companies Organizations Stubs What links here Related changes

368

D S Geo Innogy | Open Energy Information  

Open Energy Info (EERE)

Innogy Innogy Jump to: navigation, search Name D&S Geo Innogy Place Germany Sector Geothermal energy Product JV company set up to develop existing RWE deep geothermal drilling areas. References D&S Geo Innogy[1] LinkedIn Connections CrunchBase Profile No CrunchBase profile. Create one now! This article is a stub. You can help OpenEI by expanding it. D&S Geo Innogy is a company located in Germany . References ↑ "D&S Geo Innogy" Retrieved from "http://en.openei.org/w/index.php?title=D_S_Geo_Innogy&oldid=344020" Categories: Clean Energy Organizations Companies Organizations Stubs What links here Related changes Special pages Printable version Permanent link Browse properties About us Disclaimers Energy blogs Linked Data Developer services

369

Drought stress influences leaf water content, photosynthesis, and water-use efficiency of Hibiscus rosa-sinensis at three potassium concentrations  

Science Journals Connector (OSTI)

The influence of drought stress (DS) upon whole-plant water content, water relations, photosynthesis, and water-use efficiency of Hibiscus rosa-sinensis cv. Leprechaun (Hibiscus...) plants at three levels of pota...

J. N. Egilla; F. T. Davies Jr.; T. W. Boutton

370

Characterization of Ebola virus VP35 first basic patch as a therapeutic target.  

E-Print Network (OSTI)

??Viral protein 35 (VP35), encoded by filoviruses, are multifunctional dsRNA binding proteins that play important roles in viral replication, innate immune evasion and pathogenesis. The (more)

Binning, Jennifer

2014-01-01T23:59:59.000Z

371

Methods of Beam Cooling  

E-Print Network (OSTI)

in the number and energy loss of muons (Landau straggling).energy. The energy loss function for muons, dEl ds, ismuons passing through a material medium lose energy (and

Sessler, A. M.

2008-01-01T23:59:59.000Z

372

The Cooling of Particle Beams  

E-Print Network (OSTI)

in the number and energy of muon-atom interactions. Anenergy. The energy loss function for muons, dE/ds is rapidlymuons passing through a material medium lose energy (and

Sessler, Andrew M.

2008-01-01T23:59:59.000Z

373

Information Dashboards  

E-Print Network (OSTI)

and geochemistry and Hanford and Oak Ridge, includingDs 27774, and one Dv Hanford isolate. ?Complete initialof stress, ED, TEA responses for Hanford Cr and Oak Ridge U

Shutkin, Amy

2008-01-01T23:59:59.000Z

374

ORIGINAL ARTICLE doi:10.1111/j.1558-5646.2010.00967.x  

E-Print Network (OSTI)

GENOME SIZE EVOLUTION? Kenneth D. Whitney,1,2 Eric J. Baack,3 James L. Hamrick,4 Mary Jo W. Godt,4 Brian Laboratory, Royal Botanic Gardens, Kew, Richmond, Surrey TW9 3DS, United Kingdom 7 Department of Biology

Kalisz, Susan

375

DOI: 10.1111/j.1466-8238.2008.00421.x 2008 The Authors 78 Journal compilation 2008 Blackwell Publishing Ltd www.blackwellpublishing.com/geb  

E-Print Network (OSTI)

(Ellstrand & Elam, 1993; Hamrick & Godt, 1996). As a result of specific environmental conditions acting Botanic Gardens, Kew, Richmond, Surrey TW9 3DS, UK. 1 WSL Swiss Federal Research Institute, Zürcherstrasse

376

E-Print Network 3.0 - adjustable microchip ring Sample Search...  

NLE Websites -- All DOE Office Websites (Extended Search)

DS21483B-page 1 TC940094019402 Summary: : 33-1-69-53-63-20 Fax: 33-1-69-30-90-79 Germany Microchip Technology GmbH Gustav-Heinemann Ring 125 D... 2002 Microchip Technology...

377

MDM711AP.ASM  

E-Print Network (OSTI)

RET ;in modem data port 13EH DS 6 ;spares if needed ; ANI$MODRCVB: ANI MODRCVB ! RET ;bit to test for receive ready 148H CPI$MODRCVR: CPI...

378

Reductive dechlorination of chlorinated aliphatic hydrocarbons by Fe(ii) in degradative solidification/stabilization  

E-Print Network (OSTI)

This dissertation examines the applicability of the iron-based degradative solidification/stabilization (DS/S-Fe(II)) to various chlorinated aliphatic hydrocarbons (CAHs) that are common chemicals of concern at contaminated sites. The research...

Jung, Bahng Mi

2007-04-25T23:59:59.000Z

379

Agribusiness Faculty Members Perceptions of Importance and Inclusion of Decision Science Topics in Undergraduate Agribusiness Curricula  

E-Print Network (OSTI)

Agribusiness degree programs train managers to make decisions in complex business environments. Curriculum designers generally look to the offerings of peer institutions for guidance. Decision science (DS) topics are important parts...

Wolfskill, Lawrence Arthur

2012-10-19T23:59:59.000Z

380

3D visualization of HIV transfer at the virological synapse between dendritic cells and T cells  

Science Journals Connector (OSTI)

...beam. Image segmentation was carried out in the environment of Amira (Visage Imaging) and rendered with 3ds MAX software (Autodesk, Inc.). Electron Tomography. Fixed embedded cell specimens were cut into 200-nm thick sections using a Leica Ultracut...

Richard L. Felts; Kedar Narayan; Jacob D. Estes; Dan Shi; Charles M. Trubey; Jing Fu; Lisa M. Hartnell; Gordon T. Ruthel; Douglas K. Schneider; Kunio Nagashima; Julian W. Bess; Jr.; Sina Bavari; Bradley C. Lowekamp; Donald Bliss; Jeffrey D. Lifson; Sriram Subramaniam

2010-01-01T23:59:59.000Z

Note: This page contains sample records for the topic "dl deltak ds" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


381

Arch 438 Design Visualization Professor: Alphonso Peluso  

E-Print Network (OSTI)

. Forthefinalstudentswillproduceseveral renderings of their current studio project for a presentation layout. Software: Autodesk Revit Architecture Autodesk 3ds Max Design Adobe Photoshop For free autodesk software downloads visit http://students.autodesk

Heller, Barbara

382

Mechanism of phototaxis in marine zooplankton  

Science Journals Connector (OSTI)

... CM 120 Biotwin equipped with Ditabis Digital Imaging Plates. Three-dimensional reconstructions were performed using Autodesk 3ds Max after manual alignment of image stacks. Scanning electron microscopy images were taken ...

Gspr Jkely; Julien Colombelli; Harald Hausen; Keren Guy; Ernst Stelzer; Franois Ndlec; Detlev Arendt

2008-11-20T23:59:59.000Z

383

Usefulness of VRML building models in a direction finding context  

Science Journals Connector (OSTI)

......knowledge. However, 3D building tools, e.g. Autodesk 3ds Max (2006), are also available thus making...Symposium, Monterey, California, 16-19, ACM. Autodesk, 2006 http://usa.autodesk.com/adsk/servlet/item-w?siteID......

Pietro Murano; Dino Mackey

2007-05-01T23:59:59.000Z

384

The walking dead: Blender as a tool for paleontologists with a case study on extinct arachnids  

Science Journals Connector (OSTI)

...comparable to Blender. These include 3ds Max, Autodesk Maya, ZBrush and Cinema 4D, to name a few...subtly in their focus and capabilities. Of these Autodesk Maya ( http://www.autodesk.com/products/autodesk-maya/overview...

Russell Garwood; Jason Dunlop

385

Fear and safety learning differentially affect synapse size and dendritic translation in the lateral amygdala  

Science Journals Connector (OSTI)

...of polyribosomes, so it was excluded from that analysis. Images of 3D reconstructions were rendered in 3DS Max software (Autodesk). Statistics. For behavior data, group means of freezing scores were compared across animals by ANOVA followed by Tukey's...

Linnaea E. Ostroff; Christopher K. Cain; Joseph Bedont; Marie H. Monfils; Joseph E. LeDoux

2010-01-01T23:59:59.000Z

386

Subsidizing Solar: The Case for an Environmental Goods and Services Carve-out from the Global Subsidies Regime  

E-Print Network (OSTI)

Measures Relating to the Feed-In Tariff Program (DS426). Thetargeted Ontarios feed-in tariff (FIT) program. Paragraphrequirements of Ontarios feed-in tariff (FIT) program (

Simmons, Zachary Scott

2014-01-01T23:59:59.000Z

387

In search for new physics at LHCb  

E-Print Network (OSTI)

LHCb detector 11Marina Artuso University of Chicago #12; sensors R sensors B-Vertex Measurement 12): Mass resolu6on for background suppression ! btag Bs K K +, K Ds Primary vertex

388

radiological | EMSL  

NLE Websites -- All DOE Office Websites (Extended Search)

Na8(AlSiO4)6I2, were observed in the 24000 ppm specimen and were verified with micro-XRD and wavelength dispersive spectroscopy. Citation: Riley BJ, MJ Schweiger, DS Kim,...

389

AVERYARCHITECTURALANDFINEARTSLIBRARY 2 0 0 LE VE L1 0 0 LE VE L  

E-Print Network (OSTI)

, Urban Planning], dissertations [Art History PhDs], trade catalogs [AT], periodicals [Glass Cabinet ENTRY ART PROPERTIES RESTROOMS CARD CATALOG RESHELVING AREA WATER FOUNTAIN TO 300 LEVEL TO 200 LEVEL

Salzman, Daniel

390

1 Introduction  

E-Print Network (OSTI)

Problem (1) arises naturally from diverse applications for these choices of K, and we only mention a few. ...... [9] M.R. Garey and D.S. Johnson. Computers and...

2007-10-04T23:59:59.000Z

391

Pulmonary toxicology of respirable particles. [Lead abstract  

SciTech Connect

Separate abstracts were prepared for the 44 papers presented in these proceedings. The last paper (Stannard) in the proceedings is an historical review of the field of inhalation toxicology and is not included in the analytics. (DS)

Sanders, C.L.; Cross, F.T.; Dagle, G.E.; Mahaffey, J.A. (eds.)

1980-09-01T23:59:59.000Z

392

Center for Science and Technology Policy Research Briefing #12, __ April 2008  

E-Print Network (OSTI)

, during drought: Kenney, D.S., C. Goemans, R. Klein, J. Lowrey, and K. Reidy. 2008. Residential Water., Gratz, J., Landsea, C. W., Collins, D., Saunders, M., and Musulin, R., 2008. Normalized Hurricane

Colorado at Boulder, University of

393

Fertiliser drawn forward osmosis desalination: the concept, performance and limitations for fertigation  

Science Journals Connector (OSTI)

The choice of fertiliser DS will be guided by many factors. The main factors include fertiliser economics and its performance as draw solute for FDFO process. Fertiliser economics relates to the availability and ...

Sherub Phuntsho; Ho Kyong Shon

2012-06-01T23:59:59.000Z

394

E-Print Network 3.0 - aodv based manet Sample Search Results  

NLE Websites -- All DOE Office Websites (Extended Search)

and using hints from the AODV routing table yielded the best performance. The AODV-DS algorithm is based... -Royer, and S. Das, "Ad hoc on demand distance vector ... Source:...

395

Mass spectrometric characterization of sequence-specific complexes of DNA and transcription factor PU.1 DNA binding domain  

SciTech Connect

Electrospray ionization mass spectrometry (ESI-MS) has been used to study the noncovalent interaction of the 13.5-kDa DNA binding domain of PU.1 (PU.1-DBD) with specific double-stranded DNA (dsDNA) target molecules. Mixtures of PU.1-DBD protein and wildtype target DNA sequence yielded ESI-MS spectra showing only protein-dsDNA complex ions of 1:1 stoichiometry and free dsDNA. When PU.1-DBD protein, wild type target DNA, and a mutant target DNA lacking the consensus sequence were mixed, only the 1:1 complex with the wild-type DNA was observed, consistent with gel electrophoresis mobility shift assay results, demonstrating the observation of sequence-specific protein-dsDNA complexes using ESI-MS. 22 refs., 5 figs., 1 tab.

Cheng, Xueheng; Harms, A.C.; Bruce, J.E. [Pacific Northwest National Lab., Richland, WA (United States)] [and others] [Pacific Northwest National Lab., Richland, WA (United States); and others

1996-07-15T23:59:59.000Z

396

Microsoft PowerPoint - ARM_2007_Presentation(Lawson).ppt  

NLE Websites -- All DOE Office Websites (Extended Search)

Imagery e.g., CPI, VIPS, Replicator 2D-S Probe has independent, custom, dual 128-photodiode arrays running at 17 MHz. Particles from 10 m to 1.28 mm are imaged. (Lawson et...

397

Implicit motif distribution based hybrid computational kernel for sequence classification  

Science Journals Connector (OSTI)

......Lu, P., Wishart, D.S., Poulin, B., Anvik, J., Macdonell, C...themostpopularmethodofencodingofaminoacidsrepor-ted in the literature is to represent each...Lu,P., Wishart,D.S., Poulin,B., Anvik,J., Macdonell,C......

Volkan Atalay; Rengul Cetin-Atalay

2005-04-01T23:59:59.000Z

398

The Honorable Sebastian J'. Garafalb.  

Office of Legacy Management (LM)

1 Departnient .of Energy ' > Wahingtoh. DC 20585 , .<- The Honorable Sebastian J'. Garafalb. P.O., Box 1300,' M iddletown,. Connecti,cut dS457 ' r 1 Dear Mayor Garafalo:...

399

Bi-directional dc-dc Converter  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Gate drive over -voltage protection T 1 SiC VJFET T 2 D 1 D 2 R g Built-in UV lockout 2008 DOE Merit Review Guidelines Preliminary, Experimental Gate-drive Results 11 V ds...

400

Projected Impact of Federal Policies on U.S. Wind Market Potential: Preprint  

SciTech Connect

This report discusses the potential for solar-powered agricultural irrigation pumps in the San Joaquin Valley and how these applications could improve the region's air This paper presents results from the Wind Deployment Systems Model (WinDS) for several potential energy policy cases. WinDS is a multiregional, multitime-period, Geographic Information System (GIS), and linear programming model of capacity expansion in the electric sector of the United States. WinDS is designed to address the principal market issues related to the penetration of wind energy technologies into the electric sector. These principal market issues include access to and cost of transmission, and the intermittency of wind power. WinDS has been used to model the impact of various policy initiatives, including a wind production tax credit (PTC) and a renewable portfolio standard (RPS).

Short, W.; Blair, N.; Heimiller, D.

2004-03-01T23:59:59.000Z

Note: This page contains sample records for the topic "dl deltak ds" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


401

UCI International Center 500 E. Peltason Drive, Irvine, CA 926975255 P: 949.824.7249 F: 949.824.3090 intl@uci.edu www.ic.uci.edu IC Office Use Only: Date Received: __________ Advisor's Initials: ___________ Ready for PickUp On: _________________ | Revised  

E-Print Network (OSTI)

UCI International Center 500 E. Peltason Drive, Irvine, CA 926975255 P: 949.824.7249 F: 949, Irvine, CA 926975255. NOTE: A NEW I20/DS2019 WILL BE ISSUED WITHIN 10 BUSINESS DAYS OF TRANSFER RELEASE

Barrett, Jeffrey A.

402

Undertaking Cancer Research in International Settings: Report from the American Society for Preventive Oncology Special Interest Group on International Issues in Cancer  

Science Journals Connector (OSTI)

...15,010 men (73%)] of the French National Gas and Electricity Company, followed annually since 1989 (18). Preliminary...Hatzenbuehler ML, Hasin DS.Stressful life experiences, alcohol consumption, and alcohol use disorders: the epidemiologic evidence...

Karen J. Wernli; Cari M. Kitahara; Sara L. Tamers; Mohammed H. Al-Temimi; and Dejana Braithwaite

2013-09-01T23:59:59.000Z

403

Inducible systemic RNA silencing in Caenorhabditis elegans  

E-Print Network (OSTI)

Introduction of double-stranded RNA (dsRNA) can elicit a gene-specific RNA interference response in a variety of organisms and cell types. In many cases, this response has a systemic character in that silencing of gene ...

Timmons, Lisa; Tabara, Hiroaki; Mello, Craig C.; Fire, Andrew Z.

2003-07-01T23:59:59.000Z

404

Direct Modulation of Quantum Cascade Lasers for Chirped Laser Dispersion Spectroscopy  

Science Journals Connector (OSTI)

This paper provides an analysis of direct modulation of a quantum cascade laser for applications in chirped laser dispersion spectroscopy (CLaDS). The developed laser model is used to...

Hangauer, Andreas; Spinner, Georg; Nikodem, Michal; Wysocki, Gerard

405

Determinging BPA under uncertainty environments and its application in data fusion  

Science Journals Connector (OSTI)

Dempster-Shafer (DS) theory of evidence has been widely used in many data fusion application systems. However, how to determine basic probability assignment, which is the main and the first step in evidence theor...

Yong Deng; Wen Jiang; Xiaobin Xu; Qi Li; Dong Wang

2009-01-01T23:59:59.000Z

406

Regional observations of the second North Korean nuclear test on 2009 May 25  

Science Journals Connector (OSTI)

......Dreger D.S., 2000. Performance test of an automated moment tensor determination...G., 2007. North Korean nuclear test: seismic discrimination at low yield...W. , 1986. Yield estimates of Nevada test site explosions obtained from seismic......

Jin Soo Shin; Dong-Hoon Sheen; Geunyoung Kim

2010-01-01T23:59:59.000Z

407

White fibrous papulosis of the neck: The first South American case  

E-Print Network (OSTI)

PubMed ] 13. Wang DG, Zhu WY. White fibrous papulosis of the14. Kim HS,Yu DS,Kim JW. White fibrous papulosis of theS, Harada T, Nishikawa T. White fibrous papulosis of the

2009-01-01T23:59:59.000Z

408

--No Title--  

NLE Websites -- All DOE Office Websites (Extended Search)

jobs now, producing PhDs in renewable energy for the future, and enhancing the rate of return of the ARPA-E investment. This program will uniquely integrate physical...

409

Title of the dossier/Titre du dossier Simulation of MCAO on (Extremely) large telescopes  

E-Print Network (OSTI)

Louarn, Ch. Verinaud, V. Korkiakoski ESO, Karl Schwarzschild Strasse 2, D-85748 Garching, Germany sampling of the Wavefront Sensor (WFS) mea- surement and deformable mirror (DM) correction. 2 (ds r0 )(5

Liske, Jochen

410

PoNOMAR~;V A. L. A. 1963. Evfauziidy severnoi poloviny Tikhogo okeana. ikh  

E-Print Network (OSTI)

and 40 cm FL. Adults inhabit inshore rocky and sandy areas, frequently in zones of turbulence. Mt:ch"ds Juvenile P. sexfilis were captured by seine on reef flats along windward Oahu in September and October 1970

411

Investigations into the mycoheterotrophic symbiosis between Rhizopogon salebrosus and Pterospora andromedea and development of bioinformatic tools related to non-assembled fungal genomes  

E-Print Network (OSTI)

such as penylacetic acid (PAA) to the culture medium,expression in response to PAA in DS17690 (van Den Berg etregardless of the presence of PAA, as well as a penicillin

Wong, Valerie

2011-01-01T23:59:59.000Z

412

PNNL-SA-84872  

NLE Websites -- All DOE Office Websites (Extended Search)

SA-84872 1 Glass Formulation and Testing for U.S. High-Level Tank Wastes Project 17210 Year 1 Status Report: October 15, 2014 JD Vienna, DS Kim, MJ Schweiger, GF Piepel, JO Kroll,...

413

Microsoft PowerPoint - CIMTEC Talk Final (6-17-14) [Read-Only...  

NLE Websites -- All DOE Office Websites (Extended Search)

Developments in the HLW Glass Formulation for the Hanford Tank Waste Treatment and Immobilization Plant and their Impacts on its Mission JD VIENNA 1 , DS KIM 1 , AA KRUGER 2 , AND...

414

Tolerating Radiation-Induced Transient Faults in Modern Processors  

E-Print Network (OSTI)

word G XOR1 D/S_en imm1 field XOR2 comparator CFE/CFE D/S NTJ_en Resolved branch condition NTJ NT M UX 3 TJ_en

Li, Xiaobin; Gaudiot, Jean-Luc

2010-01-01T23:59:59.000Z

415

Microsoft Word - MMCR_calibration_report_final_DOE-SC-ARM-TR...  

NLE Websites -- All DOE Office Websites (Extended Search)

References 1. Ulaby, FT, RK Moore, and K Fung. 1986. Microwave Remote Sensing, Active and Passive, Volume I and II. Artech House, Norwood, MA. 2. Doviak, RJ and DS Zrnic. 1993....

416

Developments of cast superalloys and technology for gas turbine blades in BIAM  

Science Journals Connector (OSTI)

Since 1960's many important subjects relating to cast turbine blades including alloy developments, directional solidification (DS) and single crystal (SC) technique and casting technology for blades have been ...

R. Z. Chen

1995-09-01T23:59:59.000Z

417

NATURE BIOTECHNOLOGY VOLUME 30 NUMBER 4 APRIL 2012 367 need to learn to work as part of a team and  

E-Print Network (OSTI)

, such as marketing, quality assurance, intellectual property, strategic management or project management. Thus of continuous education, and sci- ence PhDs are no exception to the rule. A multidisciplinary approach

Weiblen, George D

418

Low-Temperature Ultrafast Mobility in Systems with Long-Range Repulsive Interactions: M. Hupalo,1  

E-Print Network (OSTI)

and that this is one of the best realizations of an outstanding prediction in theoretical physics, i.e., the ``devil's staircase'' (DS) [1]. As predicted 25 years ago in systems with long-range (LR) repulsive interactions

Zaluska-Kotur, Magdalena

419

Evidence of reactive oxygen species-mediated damage to mitochondrial DNA in children with typical autism  

E-Print Network (OSTI)

1997:77102. 3. Lin MT, Beal MF: Mitochondrial dysfunction13:262270. 5. Albers DS, Beal MF: Mitochondrial dysfunctionAMS, Mecocci P, Cormio A, Beal MF, Cherubini A, Cantatore P,

Napoli, Eleonora; Wong, Sarah; Giulivi, Cecilia

2013-01-01T23:59:59.000Z

420

BBQ Beans  

E-Print Network (OSTI)

... Tomato sauce 1 1/2 tb Molasses 1/2 ts Apple cider vinegar 1 ds Tabasco sauce 4 c Beans, cooked Saute onion, pepper and garlic in 1/4 c water for 5 minutes.

Note: This page contains sample records for the topic "dl deltak ds" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


421

NIH Manual 2300-600-1 Page 1 Date: 10/30/2003  

E-Print Network (OSTI)

of paper at reasonable levels)? __Yes __ No 12. Overhead shelves or cabinets not in hazardous locations at www.nih.gov/od/ors/ds/ergonomics? __Yes __ No 7. Lighting: Directed behind or to the side of line

Baker, Chris I.

422

Predicting dioxin-like \\{PCBs\\} soil contamination levels using milk of grazing animal as indicator  

Science Journals Connector (OSTI)

Dioxin-like \\{PCBs\\} (dl-PCBs) are ubiquitous persistent organic pollutants of recognized negative effects on human health. Assessing highly polluted areas should be an important public health issue. This study proposes to use the milk of grazing animals as a bioindicator of dl-PCB contamination in the environment. The hypothesis is that milk concentration of dl-PCBs are related to soil concentrations of these compounds, and that soils are generally reflective of a larger environmental issue of dl-PCB contamination. In this study, we evaluate the possibility of predicting soil concentrations using milk of sheep, cows and buffalos in a spatial model. For this purpose, samples of soil and milk collected in Campania (Italy) were introduced in a GIS platform to perform geostatistical analysis for building a simple predictive model. The ordinary least squares regressions (OLS) showed a statistically significant correlation (pPCBs using sheeps, cows and buffalos milk showed a mean error of 23%, 25% and 36% respectively. According to these results the sheeps milk can be considered the best bioindicator of dl-PCBs contamination among the three species. The results of this project evidence the potentialities of the proposed approach to assess bioindicator performance in a spatial predictive model.

Monia Perugini; Esteban Gabriel Herrera Nuez; Loredana Baldi; Mauro Esposito; Francesco Paolo Serpe; Michele Amorena

2012-01-01T23:59:59.000Z

423

Ancillary-service details: Dynamic scheduling  

SciTech Connect

Dynamic scheduling (DS) is the electronic transfer from one control area to another of the time-varying electricity consumption associated with a load or the time-varying electricity production associated with a generator. Although electric utilities have been using this technique for at least two decades, its use is growing in popularity and importance. This growth is a consequence of the major changes under way in US bulk-power markets, in particular efforts to unbundle generation from transmission and to increase competition among generation providers. DS can promote competition and increase choices. It allows consumers to purchase certain services from entities outside their physical-host area and it allows generators to sell certain services to entities other than their physical host. These services include regulation (following minute-to-minute variations in load) and operating reserves, among others. Such an increase in the number of possible suppliers and customers should encourage innovation and reduce the costs and prices of providing electricity services. The purpose of the project reported here was to collect and analyze data on utility experiences with DS. Chapter 2 provides additional details and examples of the definitions of DS. Chapter 3 explains why DS might be an attractive service that customers and generators, as well as transmission providers, might wan to use. Chapter 4 presents some of the many current DS examples the authors uncovered in their interviews. Chapter 5 discusses the costs and cost-effectiveness of DS. Chapter 6 explains what they believe can and cannot be electronically moved from one control area to another, primarily in terms of the six ancillary services that FERC defined in Order 888. Chapter 7 discusses the need for additional research on DS.

Hirst, E.; Kirby, B.

1997-01-01T23:59:59.000Z

424

The special case I$_3$ of the Kholodenko-Silagadze multiple integral considered anew  

E-Print Network (OSTI)

The nested Kholodenko-Silagadze quadrature \\[ I_{n} = \\int_{-\\infty}^{\\;\\infty}ds_{1}\\int_{-\\infty}^{\\;s_{1}}ds_{2}\\int_{-\\infty}^{\\;s_{2}}ds_{3}\\cdots \\int_{-\\infty}^{\\;s_{2n-3}}ds_{2n-2}\\int_{-\\infty}^{\\;s_{2n-2}}ds_{2n-1}\\int_{-\\infty}^{\\;s_{2n-1}}ds_{2n}\\cos(s_{1}^{2}-s_{2}^{2})\\cos(s_{3}^{2}-s_{4}^{2})\\cdots\\cos(s_{2n-3}^{2}-s_{2n-2}^{2})\\cos(s_{2n-1}^{2}-s_{2n}^{2})= \\frac{2}{n!}\\left(\\frac{\\pi}{4}\\right)^{n} \\;, \\] obtained for all integers $n\\geq 1$ by an elegant but indirect argument, is tackled anew from a uniform quadrature reduction viewpoint. Along the way, at its first instance of real difficulty when $n=3,$ the recondite quadrature \\[ \\int_{\\,0}^{\\;\\infty} \\frac{\\cos(u)}{u} du \\int_{\\,0}^{\\,u} \\frac{\\sin^{2}(v)}{v}dv + \\int_{\\,0}^{\\;\\infty} \\frac{\\sin(u)}{u} du \\int_{\\,0}^{\\,u} \\frac{\\sin(v)\\cos(v)}{v}dv = \\,\\frac{\\pi^{2}}{12}\\;,\\] heretofore presumably unknown, receives an indirect resolution with its indicated value of $\\pi^{2}/12$.

J. A. Grzesik

2014-10-27T23:59:59.000Z

425

e00605-13.full.pdf  

NLE Websites -- All DOE Office Websites (Extended Search)

Clostridium Clostridium sp. Strain DL-VIII, a Novel Solventogenic Clostridium Species Isolated from Anaerobic Sludge Safiyh Taghavi, a,b Javier A. Izquierdo, a Daniel van der Lelie a,b Center for Agricultural and Environmental Biosolutions, RTI International, Research Triangle Park, North Carolina, USA a ; Biosciences Department, Brookhaven National Laboratory, Upton, New York, USA b We report the genome sequence of Clostridium sp. strain DL-VIII, a novel Gram-positive, endospore-forming, solventogenic bacterium isolated from activated anaerobic sludge of a wastewater treatment plant. Aside from a complete sol operon, the 6,477,357-bp genome of DL-VIII reveals genes for several unique enzymes with applications in lignocellulose degradation, in- cluding two phenolic acid decarboxylases. Received 5 July 2013 Accepted 11 July 2013 Published 8 August 2013 Citation Taghavi S,

426

Effect of Induced-Charge Electro-Kinetics on Concentration-Polarization in a Microchannel-Nafion System  

E-Print Network (OSTI)

Induced-charge electro-osmosis (ICEO) is shown to control the length scale of the diffusion layer (DL), which in turn, affects the diffusion limited ion transport through the microchannel-Nafion membrane system. The ICEO vortices form at an interdigitated floating electrode array embedded within a microchannel interfacing a Nafion membrane and stir the fluid, arresting the diffusive growth of the depletion layer. By varying the spacing between the array and the membrane we are able to control the length of the DL. Activating the electrodes results in further enhancement of the fluid stirring due to the emergence of alternating-current electro-osmotic (ACEO) flow on top of the ICEO. Such a new method of controlling the DL with an electrode array is of great importance in many CP related realizations.

Park, Sinwook

2015-01-01T23:59:59.000Z

427

Pion elastic scattering from ?p4?sHe  

E-Print Network (OSTI)

) = . 4. 46 APPEVDIX B pppl Cttttttt'tttttt twtxtetett ttttttt PPP2 Cttttttt*tttttt*tettttt*tttttetttttt 0003 SUBROUTIiVE WFiVCRD(LT, TNSH, EFCTR, R) 0004 IiNCLL DE 'RVIPPRM. FOR' 0101 0102 0103 COMMON /LSINT j XXQLS(DlV'INS5), AAQLS(DMNS5...) = . 4. 46 APPEVDIX B pppl Cttttttt'tttttt twtxtetett ttttttt PPP2 Cttttttt*tttttt*tettttt*tttttetttttt 0003 SUBROUTIiVE WFiVCRD(LT, TNSH, EFCTR, R) 0004 IiNCLL DE 'RVIPPRM. FOR' 0101 0102 0103 COMMON /LSINT j XXQLS(DlV'INS5), AAQLS(DMNS5...

Mahmoud, Ahmed Mohamed

2012-06-07T23:59:59.000Z

428

Thesaurus construction through knowledge representation  

Science Journals Connector (OSTI)

Semantic metadata describing subject content plays a vital role in supporting indexing and retrieval in Digital Libraries. Mechanisms used to deliver this metadata include keyword collections, thesauri and classifications. Constructing a large thesaurus, however, is a difficult process which can be facilitated through the application of knowledge representation techniques developed for managing and reasoning about concepts. We describe such a scheme a Description Logic (DL) and show through an example how a DL can play a part in the classification construction process, aiding in the production of coherent hierarchies and ensuring that the relationships represented in a thesaurus are sensible.

Sean Bechhofer; Carole Goble

2001-01-01T23:59:59.000Z

429

Mandatory Dedication of Park and Open Space Lands: The Situation in Texas.  

E-Print Network (OSTI)

267S02d860; Krughoff v . NaperVille 354NE2d489 (1975); Calls v. Bloomington 246NW2dl9 (1976). 'California Business and Professions Code, Section 11546. tional denial of due process or equal protection. The land developer who brought this action con... Ridge Estates. Inc. v. Planning Commission of Danbury 230A2d45 (1967); Krughoff v. Naperville 345NE2d489 (1974); Collis v. Bloomington 246NW2dl9 (1976). 'OJordan v. Menomonee Falls 137NW2d442 (1965). " Frank Ansuini. Inc. v. Cranston 264A2d91O (1970...

Taylor, P. D.; Kamp, B. D.; Seymour, J. S.

1979-01-01T23:59:59.000Z

430

CRYOPUMP BEHAVIOR IN THE PRESENCE OF BEAM OR NUCLEAR RADIATION  

E-Print Network (OSTI)

1976). D.M. Meade. Nuclear Fusion lU, 289 (197**). W.J.p. 68l, D.L. Jassby. Nuclear Fusion 17 1.2), 309 (1977). R.vacuum in a thermo nuclear fusion device is essential due

Law, P.K.

2011-01-01T23:59:59.000Z

431

Statistical Issues in Translational Cancer Research  

Science Journals Connector (OSTI)

...Storm Peterson, and others. The fundamental idea behind the concept of personalized...979-85. 8 Crowley J, Ankerst DP. Handbook of statistics in clinical oncology...Friedman LM, Furberg CD, Demets DL. Fundamentals of clinical trials. 3rd ed. New York...

Stephen L. George

2008-10-01T23:59:59.000Z

432

Wear 267 (2009) 653660 Contents lists available at ScienceDirect  

E-Print Network (OSTI)

Wear 267 (2009) 653­660 Contents lists available at ScienceDirect Wear journal homepage: www.elsevier.com/locate/wear A route to wear resistant PTFE via trace loadings of functionalized nanofillers D.L. Burrisa, , S. Zhaob, Newark, DE, USA b Rensselaer Polytechnic Institute, Troy, NY, USA c University of Florida, Gainesville

Sawyer, Wallace

433

NK Cell Genotype and Phenotype at Diagnosis of Acute Lymphoblastic Leukemia Correlate with Postinduction Residual Disease  

Science Journals Connector (OSTI)

...Hospital, 262 Danny Thomas Place, Memphis, TN 38105. Phone: 901-595-2554; Fax...MRD-positive patients were more likely to have KIR2DL5A (P = 0.006) and expressed...lymphoblastic leukemia has been established to be one of the most important prognostic...

Erin M. Sullivan; Sima Jeha; Guolian Kang; Cheng Cheng; Barbara Rooney; Martha Holladay; Rafijul Bari; Sarah Schell; MaCal Tuggle; Ching-Hon Pui; Wing Leung

2014-12-01T23:59:59.000Z

434

LTERE DEUTSCHE LITERATUR ...............S. 1 FACHDIDAKTIK DEUTSCH ...............S. 8  

E-Print Network (OSTI)

Inhalt: ?LTERE DEUTSCHE LITERATUR ...............S. 1 FACHDIDAKTIK DEUTSCH ...............S. 8 NEUERE DEUTSCHE LITERATUR ...............S. 13 ?LTERE DEUTSCHE LITERATUR ?DL I ?ltere deutsche Literatur Mo, 10:15 ­ 11:45 Uhr HS OpWsches Museum, CZ 12 J

Rossak, Wilhelm R.

435

Enzymatic Hydrolysis of Poly(lactide)s:? Effects of Molecular Weight, l-Lactide Content, and Enantiomeric and Diastereoisomeric Polymer Blending  

Science Journals Connector (OSTI)

Nonblended poly(l-lactide) (PLLA) films having different molecular weights and nonblended poly(lactide) (PLA) films, enantiomeric blend films from PLLA and poly(d-lactide) (PDLA), and diastereoisomeric blend films of poly(dl-lactide) (PDLLA) with either ...

Hideto Tsuji; Shinya Miyauchi

2001-04-24T23:59:59.000Z

436

The environmental impact of recombinant bovine somatotropin (rbST) use in dairy production  

Science Journals Connector (OSTI)

...Audsley E Sandars DL ( 2006 ) DEFRA Research Project ISO205 , Determining the Environmental Burdens and...supported in part by funding provided by the Liberty Hyde Bailey Professorship in College...Monsanto, holding the position of Technical Project Manager for POSILAC rbST with the primary...

Judith L. Capper; Euridice Castaeda-Gutirrez; Roger A. Cady; Dale E. Bauman

2008-01-01T23:59:59.000Z

437

IS C O N SIN FUSION TECHNOLOGY INSTITUTE  

E-Print Network (OSTI)

W IS C O N SIN · FUSION·T E CHNOLOGY · INSTITUTE FUSION TECHNOLOGY INSTITUTE UNIVERSITY at the 6th International Symposium on Fusion Nuclear Technology, 7­12 April 2002, San Diego CA #12 Wall Chamber L.A. El-Guebaly, D.L. Henderson, P.P.H. Wilson, A.E. Abdou, ARIES Team Fusion Technology

438

Matrix Effect and Cross-Reactivity of Select Amphetamine-Type Substances, Designer Analogues, and Putrefactive Amines using the Bio-Quant Direct ELISA Presumptive Assays for Amphetamine and Methamphetamine  

Science Journals Connector (OSTI)

......Li, D-L. Lin, and R.H. Liu. Performance...2003). 2. H. Zhao, R. Brenneisen, A. Scholar, A.J.McNally, M.A. Elsohly, T...Kerriganand W.H. Phillips, Jr.Comparison of ELISAsfor...540-547 (2001). 18. H.R.M. Far,F.Torabi......

Luigino G. Apollonio; Ian R. Whittall; Dennis J. Pianca; Jennelle M. Kyd; William A. Maher

439

Is low pathogenic avian influenza virus virulent for wild waterbirds?  

Science Journals Connector (OSTI)

...JD , DE Stallknecht, JR Beck, DL Suarez, and...Bestebroer, WE Beyer, R van Lavieren, AD Osterhaus...Bewick's swans. Proc. R. Soc. B 279, 529-534...settings. Chicago, IL: Rand McNally College Publishing. 52...or vice versa? Proc. R. Soc. B 276, 2345-2346...

2013-01-01T23:59:59.000Z

440

High-Performance Liquid Chromatography of Industrial Polyurethane Polyols  

Science Journals Connector (OSTI)

......D.L. Hendrix, R.E. Lee, Jr., J.G. Baust...McFadden and D.R. Scheuing. Determination...L.L. Merritt, Jr., J.A. Dean...Callis, and L.R. Field. Fourier transform...1983). 16. M.E. McNally and L.B. Rogers......

D. Nol; P. VanGheluwe

1987-06-01T23:59:59.000Z

Note: This page contains sample records for the topic "dl deltak ds" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


441

DIPARTIMENTO DI MEDICINA MOLECOI,ARE  

E-Print Network (OSTI)

DIPARTIMENTO DI MEDICINA MOLECOI,ARE @;.ffiJ#Nm AWISO DI CONFERIMENTO DI COLLABORAZIONE Cod ice Ba; si rende noto che il Dipartimento di Medicina Molecolare intende conferire un incarico per lo Dl ESECUZIONE: 6 mesi - Dipartimento di Medicina Molecolare - Sezione di Storia della Medicina

Guidoni, Leonardo

442

DIPARTIMENTo DI MEDICINA MOLECOI,ARE  

E-Print Network (OSTI)

DIPARTIMENTo DI MEDICINA MOLECOI,ARE -z\\/i\\E!t/L\\ rM) 5APTET\\IZAlmnrflEl wZ tJNtvFRsrrA Dt Ro che il Dipartimento di Medicina Molecolare intende conferire un incarico per lo svolgimento della'italiano all'inglese di testi letterari DURATA E WOGO Dl ESECUZIONE: 6 mesi - Dipartimento di Medicina

Guidoni, Leonardo

443

10354 DOI: 10.1021/la900907d Langmuir 2009, 25(17), 1035410363Published on Web 06/05/2009 pubs.acs.org/Langmuir  

E-Print Network (OSTI)

.; Flynn, T. M.; Marsh, A.; Knowles, P. F.; Bushby, R. J.; Boden, N. Langmuir 1997, 13, 751. (10) Cornell. Faragher, Renate Naumann,§ Wolfgang Knoll,§ John R. Dutcher, and Jacek Lipkowski*, Department of Chemistry the conformation, orientation, and hydration of a monolayer of 2,3-di-O-phytanyl-sn-glycerol-1-tetraethylene glycol-DL-R

Dutcher, John

444

Permanent magnet helicon source for ion propulsion Francis F. Chen  

E-Print Network (OSTI)

. These ion energy peaks at the 29 eV plasma potential and at 47 eV behind the DL. The latter is supersonic, size, impulse, and gas efficiency of the thruster. This paper concerns the source itself and shows , which should yield much higher ion currents than reported so far. The design principles have been

Chen, Francis F.

445

Testing the DistanceDuality Relation with Galaxy Clusters and Type Ia Supernovae  

Science Journals Connector (OSTI)

In this Letter, we propose a new and model-independent cosmological test for the distance-duality (DD) relation, ? = DL (z)(1 + z)2/DA (z) = 1, where DL and DA are, respectively, the luminosity and angular diameter distances. For DL we consider two sub-samples of Type Ia supernovae (SNe Ia) taken from Constitution data whereas DA distances are provided by two samples of galaxy clusters compiled by De Filippis etal. and Bonamente etal. by combining Sunyaev-Zeldovich effect and X-ray surface brightness. The SNe Ia redshifts of each sub-sample were carefully chosen to coincide with the ones of the associated galaxy cluster sample (?z DA (z) ? DL (z), we have tested the DD relation by assuming that ? is a function of the redshift parameterized by two different expressions: ?(z) = 1 + ?0 z and ?(z) = 1 + ?0 z/(1 + z), where ?0 is a constant parameter quantifying a possible departure from the strict validity of the reciprocity relation (?0 = 0). In the best scenario (linear parameterization), we obtain ?0 = 0.28+0.44 0.44 (2?, statistical + systematic errors) for the De Filippis etal. sample (elliptical geometry), a result only marginally compatible with the DD relation. However, for the Bonamente etal. sample (spherical geometry) the constraint is ?0 = 0.42+0.34 0.34 (3?, statistical + systematic errors), which is clearly incompatible with the duality-distance relation.

R. F. L. Holanda; J. A. S. Lima; M. B. Ribeiro

2010-01-01T23:59:59.000Z

446

Presented at the 13th ICTMC, Oct 14 18, 2002  

E-Print Network (OSTI)

Effect on the Photovoltaic Properties of Solar Cells K. Ramanathan, F. S. Hasoon, S. Smith, D.L. Young solar cells based on CuInSe2 (CIS) have been developed as a competitive option for low cost power generation. Photovoltaic cells and modules made using alloys of CIS with Ga and or S have demonstrated

Sites, James R.

447

Shedding light on carbon-mineral complexation in the soil environment: impacts on C sequestration and cycling  

E-Print Network (OSTI)

42 Shedding light on carbon-mineral complexation in the soil environment: impacts on C sequestration and cycling Sparks, D.L. & C. Chen Department of Plant and Soil Sciences and Delaware@udel.edu) Abstract Organic matter (OM)-mineral complexation plays a critical role in soil carbon (C) stabilization

Sparks, Donald L.

448

Transmission Line Theory 51 MOTOROLAECLinPS and ECLinPS Lite  

E-Print Network (OSTI)

Transmission Line Theory 5­1 MOTOROLAECLinPS and ECLinPS Lite DL140 -- Rev 3 SECTION 2 Transmission interconnects to determine if transmission line phenomena will occur. A handy rule of thumb to determine if an interconnect trace should be considered a transmission line is if the interconnect delay is greater than 1/8th

McNeill, John A.

449

Impact of mating systems on patterns of sequence polymorphism in flowering plants  

Science Journals Connector (OSTI)

...Table 3 Results of ANOVAs for nuclear gene patterns of LD, including...Purugganan, and D.L Hartl2002The cost of inbreeding in Arabidopsis...an ancestral recombination graph with partial self-fertilization...2004Comparison of different nuclear DNA markers for estimating intraspecific...

2006-01-01T23:59:59.000Z

450

A Population Genomics Study of the Arabidopsis Core Cell Cycle Genes Shows the Signature of Natural Selection  

Science Journals Connector (OSTI)

...region was to keep resequencing costs and efforts at a minimum, while...from the 2010 data set. The graphs of the distributions are normal...Hartl, D.L. (2002). The cost of inbreeding in Arabidopsis...retinoblastoma homologues control nuclear proliferation in the female...

Roel Sterken; Raphaël Kiekens; Emmy Coppens; Ilse Vercauteren; Marc Zabeau; Dirk Inzé; Jonathan Flowers; Marnik Vuylsteke

2009-10-30T23:59:59.000Z

451

Automated Quantitative Analysis of HDM2 Expression in Malignant Melanoma Shows Association with Early-Stage Disease and Improved Outcome  

Science Journals Connector (OSTI)

...NIH Grant K0-8 ES11571 (R. Camp), C. J. Swebilius Award...issues as we approach the 21st century. J Am Acad Dermatol 1996...Med 1998;4:844-7. 16 Camp RL, Chung GG, Rimm DL Automated...Med 2002;8:1323-7. 17 Camp RL, Dolled-Filhart M, King...

Aaron J. Berger; Robert L. Camp; Kyle A. DiVito; Harriet M. Kluger; Ruth Halaban; and David L. Rimm

2004-12-01T23:59:59.000Z

452

Potassium-argon and uranium-lead ages from two localities  

Science Journals Connector (OSTI)

...etal'.,(7956)to advocatethe view o 3 a h T b 0 A T ;x)aoc\\-1.,6l I o i b i l n l s,, i l o o v ! \\ i Y t 4 5 I...o + aoc! ;; Dl'-ci 6i 0) * t _ I t F.

Sheila M.A Boutcher; G. L. Davis; W. W. Moorhouse

453

Bending Energy of Rods and Plates  

E-Print Network (OSTI)

bending energy over a rod of length L is therefore ( )21 2 0 L llEI dl r (9.2) For 2D objects185 Chapter 9 Bending Energy of Rods and Plates Integrated curvature and bending energy of a closed curvature/energy values over a chain-code description of the contour (as in binary length estimators). We

van Vliet, Lucas J.

454

BAT RESEARCH NEWS Volume 37: Number 4 Winter 1996  

E-Print Network (OSTI)

, BAT RESEARCH NEWS Volume 37: Number 4 Winter 1996 Bat Collisions with Wind Turbines colliding with a lighthouse at LODg POlDL. OnWlo. Bat collisions with wind turbines used to produce e \\IIRA IS a 25·megawau faciluy and conSISts cf 73 KVS-33 wind turbines thaI were grouped InlO 10 Stnngs

455

AACR Cancer Progress Report 2013  

Science Journals Connector (OSTI)

...main source of ionizing radiation is a natural source: Radon gas. However, people are also exposed to ionizing radiation from...95:825-8. 42. Jiao L , Duan Z, Sangi-Haghpeykar H, Hale L, White DL El-Serag HB. Sleep duration and incidence of...

Charles L. Sawyers; Cory Abate-Shen; Kenneth C. Anderson; Anna Barker; Jose Baselga; Nathan A. Berger; Margaret Foti; Ahmedin Jemal; Theodore S. Lawrence; Christopher I. Li; Elaine R. Mardis; Peter J. Neumann; Drew M. Pardoll; George C. Prendergast; John C. Reed; and George J. Weiner

2013-10-15T23:59:59.000Z

456

Impact of Tumor Microenvironment and Epithelial Phenotypes on Metabolism in Breast Cancer  

Science Journals Connector (OSTI)

...4-bromo-dl-phenylalanine, and 0.5 mug/mL amitryptyline. For gas chromatography/mass spectrometry (GC/MS), samples were...Cancer Res 2010;12:R68. 21. Santarpia L , Qi Y, Stemke-Hale K, Wang B, Young EJ, Booser DJ, et alMutation profiling identifies...

Heather Ann Brauer; Liza Makowski; Katherine A. Hoadley; Patricia Casbas-Hernandez; Lindsay J. Lang; Erick Romn-Prez; Monica D'Arcy; Alex J. Freemerman; Charles M. Perou; and Melissa A. Troester

2013-02-01T23:59:59.000Z

457

DONALD BURKHOLDER'S WORK IN MARTINGALES AND ...  

E-Print Network (OSTI)

Dec 21, 2010 ... singular integral operator (the two dimensional Hilbert transform) and .... For example, R.E.A.C. Paley [138] proved an inequality for the Haar system ...... [53] D.L. Burkholder, Martingales and singular integrals, in Banach spaces, Handbook .... Lp estimates for powers of the Ahlfors-Beurling operator, J. Math.

2010-12-21T23:59:59.000Z

458

Comparative structural modeling and docking studies of uricase: Possible implication in enzyme supplementation therapy for hyperuricemic disorders  

Science Journals Connector (OSTI)

Uricase (EC 1.7.3.3, UC) catalyzes the oxidation of uric acid (UA) to more soluble allantoin thereby lowering plasma UA levels. In humans, when concentration of UA exceeds >7mg/dl, it leads to hyperuricemia, gout, nephrolithiasis and urolithiasis. A ... Keywords: Automated docking, Gout, Homology modeling, Regio-specificity of enzyme, Uricase

Supriya D. Beedkar; C. N. Khobragade; Ragini G. Bodade; Aruna S. Vinchurkar

2012-06-01T23:59:59.000Z

459

Individuals in foraging groups may use vocal cues when assessing their need for anti-predator vigilance  

Science Journals Connector (OSTI)

...as random terms in the LMM.) full model d.f. x2 p foraging group size 1 22.86...tree.2003.10.003 Krause, J , and G.D Ruxton2002Living in groupsOxford, UK:Oxford...1006/anbe.2001.1860 Palombit, R.A , D.L Cheney, and R.M Seyfarth1999Male grunts...

2007-01-01T23:59:59.000Z

460

UNIVERSITY OF BRISTOL Minutes of the 102nd  

E-Print Network (OSTI)

Cottrell Mr R Cowap Mr R Cross Dr M Crossley Evans Dr N Dahnoun Mrs CA Davies Dr R Davies Mr W Davies Dr G-Chancellor), Dr JS Foulds (Pro-Chancellor), Sir James Tidmarsh (Pro-Chancellor), Dr JM Woolley (Pro Honour Paul Batterbury TD DL Ms S Bennett Prof Sir John Beringer Prof Sir Michael Berry Prof R Bickers Dr

Bristol, University of

Note: This page contains sample records for the topic "dl deltak ds" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


461

Quantitative structural analysis using remote sensing data: Kurdistan, northeast Iraq  

Science Journals Connector (OSTI)

...10.1130/0091-7613(2002)0302.0.CO;2 . Autodeak AutoCAD dxf file technical description: http://usa.autodesk.com/adsk/servlet/ps/dl/item?siteID=123112linkID=9240617 (accessed July 10, 2010). Bahroudi, A., and...

Daniel Reif; Bernhard Grasemann; Robert H. Faber

462

A&G Volume 55 Issue 1, Full Issue  

Science Journals Connector (OSTI)

......Should the UK government fund the launch of prebuilt...uk News A&G February 2014 Vol. 55 1.5 Lennon...astronomy. A&G February 2014 Vol. 55 1.39 Society...universities who are seeking funds to support vacation studentships...1dck5dl NAM2014 The 2014 National Astronomy Meeting......

A&G Volume 55 Issue 1; Full Issue

463

Harnessing Genetic Diversity in Saccharomyces cerevisiae for Fermentation of Xylose in Hydrolysates of Alkaline Hydrogen Peroxide-Pretreated Biomass  

Science Journals Connector (OSTI)

...inhibitory effects on cell growth and fermentation...34). Alkaline hydrogen peroxide (AHP...production of fuel ethanol. J...characterization of cell wall decomposition...Banerjee, G , S Car, T Liu, DL Williams...integration of alkaline hydrogen peroxide pretreatment...organization of plant cell walls, p 61-93...

Trey K. Sato; Tongjun Liu; Lucas S. Parreiras; Daniel L. Williams; Dana J. Wohlbach; Benjamin D. Bice; Irene M. Ong; Rebecca J. Breuer; Li Qin; Donald Busalacchi; Shweta Deshpande; Chris Daum; Audrey P. Gasch; David B. Hodge

2013-11-08T23:59:59.000Z

464

Mutational Scan of the Human Immunodeficiency Virus Type 2 Integrase Protein  

Science Journals Connector (OSTI)

...1089 V249D;L213I...D193E;K219R * ** 1079 C65S;W131N;C182S...1080 G59S...1085 S81R ND ND ND ND ND ND...1086 Q146R...

Fusinita M. I. van den Ent; Arnold Vos; Ronald H. A. Plasterk

1998-05-01T23:59:59.000Z

465

Scientific basis for safely shutting in the Macondo Well after the April 20, 2010 Deepwater Horizon blowout  

Science Journals Connector (OSTI)

...6-m-thick) M110 sand: (i) a circular...regarding the amount of gas dissolved in the oil and...that the targets were hydrate-coated methane bubbles...Orange DL ( 1998 ) Gas hydrate formation in the deep...methane, natural gas, and carbon dioxide...

Stephen H. Hickman; Paul A. Hsieh; Walter D. Mooney; Catherine B. Enomoto; Philip H. Nelson; Larry A. Mayer; Thomas C. Weber; Kathryn Moran; Peter B. Flemings; Marcia K. McNutt

2012-01-01T23:59:59.000Z

466

-./012&3)45&%$6'&78 -.//$9$).:);$573/)<$(&=&5$  

E-Print Network (OSTI)

Cardiovascular Disease (heart trouble, heart attack, angina, coronary insufficiency, coronary occlusion, FIC/derrame cerebral Heart Attack Ataque al corazón FIC)JC&K DL)JD.K If yes, when? Si es así, ¿cuando padecido alguna vez de alguna de las siguientes enfermedades o problemas? Damaged heart valves

Grishok, Alla

467

A Population Genomics Study of the Arabidopsis Core Cell Cycle Genes Shows the Signature of Natural Selection  

Science Journals Connector (OSTI)

...region was to keep resequencing costs and efforts at a minimum, while...Hartl, D.L. (2002). The cost of inbreeding in Arabidopsis...retinoblastoma homologues control nuclear proliferation in the female...URen J, Tenaillon O, Gaut BS. (2004). Selection versus...

Roel Sterken; Raphaël Kiekens; Emmy Coppens; Ilse Vercauteren; Marc Zabeau; Dirk Inzé; Jonathan Flowers; Marnik Vuylsteke

2009-10-30T23:59:59.000Z

468

Skeletal Complications of Breast Cancer Therapies  

Science Journals Connector (OSTI)

...Katherine Weilbaecher Requests for reprints: Katherine Weilbaecher, Division of Oncology...Direct effects. Animal studies by Wheeler et al. (34) showed that male rats...Cancer Treat Rev 2005;31:115-42. 34 Wheeler DL, Vander Griend RA, Wronski TJ...

Angela Hirbe; Elizabeth A. Morgan; zge Ulukan; and Katherine Weilbaecher

2006-10-15T23:59:59.000Z

469

Patients with hippocampal amnesia cannot imagine new experiences  

Science Journals Connector (OSTI)

...Schrauf RW Greenberg DL ( 2003 ) Mem Cognit 31 : 887 901 . 23 Wheeler MA Stuss DT Tulving E ( 1997 ) Psychol Bull 121 : 331 354 . 24 Burgess N Becker S King...Hospital (London) for patient referrals; and Peter Aston, Katherine Woollett, Hugo Spiers, and Neil Burgess for assistance and...

Demis Hassabis; Dharshan Kumaran; Seralynne D. Vann; Eleanor A. Maguire

2007-01-01T23:59:59.000Z

470

Phage auxiliary metabolic genes and the redirection of cyanobacterial host carbon metabolism  

Science Journals Connector (OSTI)

...pnas.1102164108 Luke R. Thompson Qinglu Zeng Libusha Kelly Katherine H. Huang Alexander U. Singer JoAnne Stubbe Sallie W. Chisholm...Benson DA, Karsch-Mizrachi I, Lipman DJ, Ostell J, Wheeler DL (2008) GenBank. Nucleic Acids Res 36(database issue...

Luke R. Thompson; Qinglu Zeng; Libusha Kelly; Katherine H. Huang; Alexander U. Singer; JoAnne Stubbe; Sallie W. Chisholm

2011-01-01T23:59:59.000Z

471

GULF OF MEXICO RESEARCH PLAN SEPTEMBER 2009  

E-Print Network (OSTI)

GULF OF MEXICO RESEARCH PLAN SEPTEMBER 2009 #12;Suggested citation: Sempier, S.H., K. Havens, R. Stickney, C. Wilson, and D.L. Swann. 2009. Gulf of Mexico Research Plan. MASGP-09-024. Document design organizations. Texas · Louisiana · Florida Mississippi-Alabama #12;iGulf of Mexico Research Plan CONTENTS TABLE

472

Rainfall-induced carbon dioxide pulses result from sequential resuscitation of phylogenetically clustered microbial groups  

Science Journals Connector (OSTI)

...Heidelberg JF Kirchman DL ( 2011 ) Activity of abundant and rare bacteria in a coastal ocean . Proc Natl Acad Sci USA 108 : 12776 12781 . 29 Mukamolova GV Kaprelyants AS Young DI Young M Kell DB ( 1998 ) A bacterial cytokine . Proc Natl Acad Sci USA...

Sarah A. Placella; Eoin L. Brodie; Mary K. Firestone

2012-01-01T23:59:59.000Z

473

Identification of Soil Bacteria Susceptible to TiO2 and ZnO Nanoparticles  

Science Journals Connector (OSTI)

...DL Kirchman. 2011. Activity of abundant and rare bacteria in a coastal ocean. Proc. Natl. Acad. Sci. U. S. A. 108 :12776-12781. 7. Caporaso, JG , et al. 2010. QIIME allows analysis of high-throughput community sequencing data. Nat. Methods...

Yuan Ge; Joshua P. Schimel; Patricia A. Holden

2012-07-13T23:59:59.000Z

474

Relationship between Abundance and Specific Activity of Bacterioplankton in Open Ocean Surface Waters  

Science Journals Connector (OSTI)

...DL Kirchman. 2011. Activity of abundant and rare bacteria in a coastal ocean. Proc. Natl. Acad. Sci. U. S. A. 108 :12776-12781. 10. Pedros-Alio, C . 2012. The rare bacterial biosphere. Ann. Rev. Mar. Sci. 4 :449-466. 11. Lennon...

Dana E. Hunt; Yajuan Lin; Matthew J. Church; David M. Karl; Susannah G. Tringe; Lisa K. Izzo; Zackary I. Johnson

2012-10-19T23:59:59.000Z

475

Conditionally Rare Taxa Disproportionately Contribute to Temporal Changes in Microbial Diversity  

Science Journals Connector (OSTI)

...Kirchman DL. 2011. Activity of abundant and rare bacteria in a coastal ocean. Proc. Natl. Acad. Sci. U. S. A. 108 :12776-12781. doi: 10.1073/pnas.1101405108 . 15. Jones SE and Lennon JT. 2010. Dormancy contributes to the maintenance...

Ashley Shade; Stuart E. Jones; J. Gregory Caporaso; Jo Handelsman; Rob Knight; Noah Fierer; Jack A. Gilbert

2014-08-01T23:59:59.000Z

476

IAEA-F1-CN69.pdf  

NLE Websites -- All DOE Office Websites (Extended Search)

CONFINEMENT IN THE RFP: LUNDQUIST NUMBER SCALING, PLASMA FLOW, AND REDUCED TRANSPORT G. Fiksel, 1 A.F. Almagri, 1 J.K. Anderson, 1 T.M. Biewer, 1 D.L. Brower, 2 C-S. Chiang, 1 B.E....

477

Identification of a tetratricopeptide repeat-like domain in the nicastrin subunit of ?-secretase using synthetic antibodies  

Science Journals Connector (OSTI)

...mi-croscopy using a 60 oil immersion objective...Thermal melts were performed by heating the...3. Li T, Ma G, Cai H, Price DL, Wong PC (2003...14. Kelly SM, Jess TJ, Price NC (2005) How to study proteins...

Xulun Zhang; Robert J. Hoey; Guoqing Lin; Akiko Koide; Brenda Leung; Kwangwook Ahn; Georgia Dolios; Marcin Paduch; Takeshi Ikeuchi; Rong Wang; Yue-Ming Li; Shohei Koide; Sangram S. Sisodia

2012-01-01T23:59:59.000Z

478

Nucleus basalis-enabled stimulus-specific plasticity in the visual cortex is mediated by astrocytes  

Science Journals Connector (OSTI)

...responses. 1 Kitt CA Hohmann C Coyle JT Price DL ( 1994 ) Cholinergic innervation of...surgery and was re-placed with silicon oil during imaging. Body temperature was maintained at 37.5 C with a heating pad. The mice were placed in a stereotaxic...

Naiyan Chen; Hiroki Sugihara; Jitendra Sharma; Gertrudis Perea; Jeremy Petravicz; Chuong Le; Mriganka Sur

2012-01-01T23:59:59.000Z

479

Functional Replacement of Ferredoxin by a Cyanobacterial Flavodoxin in Tobacco Confers Broad-Range Stress Tolerance  

Science Journals Connector (OSTI)

...plants grown in soil were also subjected to heating, high light intensity (1200 mumol21...reisolated by centrifugation through silicone oil layers (Serra et al., 1995). Digestion...116, 1351-1357. Erdner, D.L., Price, N.M., Doucette, G.J., Peleato...

Vanesa B. Tognetti; Javier F. Palatnik; María F. Fillat; Michael Melzer; Mohammad-Reza Hajirezaei; Estela M. Valle; Néstor Carrillo

2006-07-07T23:59:59.000Z

480

CLNS 95/1338 CLEO 95-8  

E-Print Network (OSTI)

Search for Exclusive Charmless Hadronic B Decays D.M. Asner, M. Athanas, D.W. Bliss, W.S. Brower, P.C. Kim, D.L. Kreinick, T. Lee, Y. Liu, G.S. Ludw* *ig, J. Masui, J. Mevissen, N.B. Mistry, C, Gainesville, Florida 32611 G. Brandenburg, D. Cinabro, T. Liu, M. Saulnier, R. Wilson, and H. Yamamoto

Note: This page contains sample records for the topic "dl deltak ds" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


481

Quantitating tissue specificity of human genes to facilitate biomarker discovery  

Science Journals Connector (OSTI)

......28 health states (Wheeler et al., 2003...other methods. This study describes a novel...Applied Biosystems, Foster City, CA, USA...Sequence Detection System. Expression levels...reported a new system, GEPIS, which determines...270:484-487. Wheeler DL , et al. Database......

George Vasmatzis; Eric W. Klee; Dagmar M. Kube; Terry M. Therneau; Farhad Kosari

2007-06-01T23:59:59.000Z

482

Independently recruited oxidases from the glucose-methanol-choline oxidoreductase family enabled chemical defences in leaf beetle larvae (subtribe Chrysomelina) to evolve  

Science Journals Connector (OSTI)

...in the glandular system of P. cochleariae...described in previous studies of the oxidative...oxidase. Further study of this oxidase as...are due to Emily Wheeler for her critical...B. designed the study. P.R. performed...Iida, K , DL Cox-Foster, XL Yang, WY Ko...

2014-01-01T23:59:59.000Z

483

The Interconversion of Lactate and Pyruvate and Its Effect on the Apparent Oxidative Decarboxylation of These Substrates in Normal Tissue and Ascites Tumor Cells  

Science Journals Connector (OSTI)

...when these were present in excess with regard to the equilibration...Corporation, Cleveland, Ohio, and lithium DL- lactate from British Drug...steps 1,2). When added in excess, pyruvate inhibits the activity...1, 4) which were in great excess in relation to the noticeable7...

Dalia Ram; Ruth Navon; and Leah Bloch-Frankenthal

1966-08-01T23:59:59.000Z

484

Regression-based quantitative trait loci mapping: robust, efficient and effective  

Science Journals Connector (OSTI)

...model (section-union test)? Both Jansen (1993) and Zeng (1993) highlighted...regression. Genetics. 151, 885-894. Jansen, R.C 1993Interval mapping of multiple...140, 1111-1127. Johnson, D.L , Jansen, R.C, van Arendonk, J.A.M1999Mapping...

2005-01-01T23:59:59.000Z

485

Evaluation of High-intensity and Low-intensity Preconditioning Systems  

E-Print Network (OSTI)

within breed and BW strata. The systems consisted of ad libitum access to a self-fed milo-based diet in drylot (DL); ad libitum access to the same self-fed diet while grazing dormant warm season pasture (SF); and hand-fed 20 precent CP pellets (2.1 kg 3...

Orsak, Andrew Nathan

2012-02-14T23:59:59.000Z

486

A STUDY OF ACTIVATED SLUDGE DEWATERING IN EXPERIMENTAL REED-PLANTED OR UNPLANTED SLUDGE  

E-Print Network (OSTI)

94/0169 A STUDY OF ACTIVATED SLUDGE DEWATERING IN EXPERIMENTAL REED-PLANTED OR UNPLANTED SLUDGE of the reeds in bed 2 died in spite of the influent sludge dose of 70 g. of SS.m"2.d~l. During the second phase (917 days) the 3 beds were aerated from the bottom and fed with sludge, directly extracted from

Paris-Sud XI, Université de

487

Data integration driven ontology design, case study smart city  

Science Journals Connector (OSTI)

Methods to design of formal ontologies have been in focus of research since the early nineties when their importance and conceivable practical application in engineering sciences had been understood. However, often significant customization of generic ... Keywords: DL-lite family, data integration, description logic, ontology design, ontology mapping, semantic web

German Nemirovski; Andreas Nolle; lvaro Sicilia; Ilaria Ballarini; Vincenzo Corado

2013-06-01T23:59:59.000Z

488

Factors Affecting Ni and Zn Hydroxide Precipitate Formation in Soils. (S02-peltier222185-oral)  

E-Print Network (OSTI)

Factors Affecting Ni and Zn Hydroxide Precipitate Formation in Soils. (S02-peltier222185-oral) Authors: E.F. Peltier* - Univ. of Delaware D.L. Sparks - Univ. of Delaware Abstract: The formation matter in the soil. Speaker Information: Edward Peltier, Univ. of Delaware, Dept. of Plant and Soil

Sparks, Donald L.

489

Tissue-Based Research in Kidney Cancer: Current Challenges and Future Directions  

Science Journals Connector (OSTI)

...sectioning. To minimize the waste of tissue, laboratories...slides in paraffin before storage and storage in a nitrogen...influenced by short- and long-term storage conditions of both tissue...Rimm DL, Camp RL. Long-term preservation of antigenicity...

Sabina Signoretti; Gennady Bratslavsky; Frederick M. Waldman; Victor E. Reuter; John Haaga; Maria Merino; George V. Thomas; Michael R. Pins; Towia Libermann; John Gillespie; Joseph E. Tomaszewski; Carolyn C. Compton; Andrew Hruszkewycz; W. Marston Linehan; and Michael B. Atkins

2008-06-15T23:59:59.000Z

490

Nova Scotia Topographic Database 1:10000 Received: April 2009  

E-Print Network (OSTI)

scales. Utilities_Line UT_LINE A line dataset showing features related to utilities. Some examples include pipelines, and transmission lines. Utilities_Point UT_POINT A point dataset showing features examples are arenas, factories, and schools Delimiters_Line DL_LINE Information used for positioning

Brownstone, Rob

491

P351 : Models of Categorization Models of Categorization  

E-Print Network (OSTI)

Psychology Fall 1999 Thomas Palmeri 507 Wilson Hall 343-7900 (office) 228-2382 (home) thomas" in a multiple-trace model. Psychological Review, 93, 411-428. Medin, D.L., & Schaffer, M.M. (1978). Context of Categorization Anderson, J.R. (1990). The adaptive character of thought. Hillsdale, NJ: Erlbaum. Chapters 1 and 3

Palmeri, Thomas

492

Research Report Sensory experience determines enrichment-induced plasticity  

E-Print Network (OSTI)

in an enriched environment increases response strength and paired-pulse depression in the auditory cortex of awake and anesthetized rats [Engineer, N.D., Percaccio, C.R., Pandya, P.K., Moucha, R., Rathbun, D.L., Kilgard, M.P., 2004. Environmental enrichment improves response strength, threshold, selectivity

Kilgard, Michael P.

493

Regulation of the Protocadherin Celsr3 Gene and Its Role in Globus Pallidus Development and Connectivity  

Science Journals Connector (OSTI)

...G Lopez-Bendito, P Maness, and DJ Price. 2012. Mechanisms controlling the guidance...1219280110 . 31. Splinter, E , E de Wit, HJ van de Werken, P Klous, and W de...35. Hedreen, JC , SJ Bacon, and DL Price. 1985. A modified histochemical technique...

Zhilian Jia; Ya Guo; Yuanxiao Tang; Quan Xu; Baojie Li; Qiang Wu

2014-08-11T23:59:59.000Z

494

Cost-Effectiveness of Prophylactic Surgery for Duodenal Cancer in Familial Adenomatous Polyposis  

Science Journals Connector (OSTI)

...S. dollars using the medical care component of the Consumer Price Index (U.S. Bureau of Labor Statistics, 2007). Patient...Wellesley (MA): UpToDate; 2008. 22 Cahen DL , Fockens P, de Wit LT, Offerhaus GJ, Obertop H, Gouma DJ. Local resection or...

Wesley H. Greenblatt; Chin Hur; Amy B. Knudsen; John A. Evans; Daniel C. Chung; and G. Scott Gazelle

2009-10-01T23:59:59.000Z

495

E-Print Network 3.0 - arterial oxygen partial Sample Search Results  

NLE Websites -- All DOE Office Websites (Extended Search)

Transport by the Blood --SOLUTION Animal Physiology Summary: * dl blood HCT 50 arterial pH 7.4 RA pH 7.2 0 50% 100% 0 50 100 Partial Pressure of Oxygen 7.4 7... .5 7.3 7.2...

496

c SPIE and IS&T. This paper was published by SPIE/IS&T and is made available as an electronic reprint with permission of SPIE and IS&T. One print or electronic copy may be made  

E-Print Network (OSTI)

³tBt¯IIti?tl§eVex¯IxF¶tC¢ ¸¤V§A¯I¤DI£rDl¿Bt¯AxU§x£f³tU¢UGI t¶tutD®qrqv8xUxµVVDG¢3V¤³wxU§x§3§tlw

Uhl, Andreas

497

Effect of TiO2 nanoparticle-accumulated bilayer photoelectrode and condenser lens-assisted solar concentrator on light harvesting in dye-sensitized solar cells  

Science Journals Connector (OSTI)

In order to qualitatively verify the increase of power output by using the T25/T240-DL-based DSSCs, we tried to operate a small propeller installed on an electric motor (rated voltage = 0.6 V, rated current = 12...

Kook Joo Moon; Sun Woo Lee; Yong Hun Lee; Ji Hoon Kim

2013-06-01T23:59:59.000Z

498

A Standard Dictionary of the English Language. Vol. I., quarto. New York, Funk and Wagnalls Company  

Science Journals Connector (OSTI)

...5 !.'e:L& D-l A beautifully illustrated journal of Horticulture, Landscape Art an Forestry, filled every week with fresh...under the general heads. of air and ventilation; heating and lighting; waterits character, impurities, and purification; fo'lods...

1894-02-23T23:59:59.000Z

499

Augmented Prefrontal Acetylcholine Release during Challenged Attentional  

E-Print Network (OSTI)

by bilateral basal forebrain infusions of the NMDA receptor antagonist DL-2- amino-5-phosphonovaleric acid (APV in a sustained attention task and equipped with three guide cannula for the bilateral infusion of the NMDA prefrontal cortex (mPFC). APV or vehicle was infused remotely following completion of the first of five

Bruno, John P.

500

Information Theory in Biology after 18 Years  

Science Journals Connector (OSTI)

...impressive as that of a diesel engine. Why had this informational...information over a complete life cycle is zero: dl =0 Going...at some time in the cycle, just one cell from an...from that. The sex cycle, the periodic reduction...

Horton A. Johnson

1970-06-26T23:59:59.000Z