Powered by Deep Web Technologies
Note: This page contains sample records for the topic "determination solution processable" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Review Process to be determined  

E-Print Network (OSTI)

Program Proposals The request for Authorization to Plan (ATP) must be submitted through the above reviewChancellor VCAA Dean Review Process to be determined within each College Review by Campus-Wide Curriculum Review Body Review by Graduate Council Recommend Approval/Disapproval Refer for Revision Refer

Olsen, Stephen L.


Detecting determinism from point processes  

Science Journals Connector (OSTI)

The detection of a nonrandom structure from experimental data can be crucial for the classification, understanding, and interpretation of the generating process. We here introduce a rank-based nonlinear predictability score to detect determinism from point process data. Thanks to its modular nature, this approach can be adapted to whatever signature in the data one considers indicative of deterministic structure. After validating our approach using point process signals from deterministic and stochastic model dynamics, we show an application to neuronal spike trains recorded in the brain of an epilepsy patient. While we illustrate our approach in the context of temporal point processes, it can be readily applied to spatial point processes as well.

Ralph G. Andrzejak; Florian Mormann; Thomas Kreuz



GE Lighting Solutions: Noncompliance Determination (2013-SE-4901) |  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Noncompliance Determination (2013-SE-4901) Noncompliance Determination (2013-SE-4901) GE Lighting Solutions: Noncompliance Determination (2013-SE-4901) January 11, 2013 DOE issued a Notice of Noncompliance Determination to General Electric Lighting Solutions finding that various models of traffic signal modules do not comport with the energy conservation standards. DOE determined the products were noncompliant based on the company's own testing. GE Lighting Solutions must immediately notify each person (or company) to whom GE Lighting Solutions distributed the noncompliant products that the products do not meet Federal standards. In addition, GE Lighting Solutions must provide to DOE documents and records showing the number of units GE Lighting Solutions distributed and to whom. The manufacturer


Process for the extraction of strontium from acidic solutions  

DOE Patents (OSTI)

The invention is a process for selectively extracting strontium values from aqueous nitric acid waste solutions containing these and other fission product values. The extractant solution is a macrocyclic polyether in an aliphatic hydrocarbon diluent containing a phase modifier. The process will selectively extract strontium values from nitric acid solutions which are up to 6 molar in nitric acid. 4 figs.

Horwitz, E.P.; Dietz, M.L.



Process for the extraction of strontium from acidic solutions  

DOE Patents (OSTI)

The invention is a process for selectively extracting strontium values from aqueous nitric acid waste solutions containing these and other fission product values. The extractant solution is a macrocyclic polyether in an aliphatic hydrocarbon diluent containing a phase modifier. The process will selectively extract strontium values from nitric acid solutions which are up to 6 molar in nitric acid.

Horwitz, E.P.; Dietz, M.L.



Solution-Processed Solar Cells using Colloidal Quantum Dots ...  

NLE Websites -- All DOE Office Websites (Extended Search)

of solar cells and light sensors based on solution-processed semiconductors." He is a Fellow of the IEEE "... for contributions to colloidal quantum dot optoelectronic devices."...


Coulometric determination of americium in acetonitrile solution of phosphoric acid  

SciTech Connect

A procedure was developed for the coulometric determination of americium using the electrochemical couple Am(IV)-Am(III). An acetonitrile solution of 0.3-0.2 M H/sub 3/PO/sub 4/ was used as the electrolyte. Americium can be determined in the presence of large amounts of Cm, Pu, Ce, and other impurities; limit of detection approx. 10 ..mu..g.

Perevalov, S.A.; Kulyakov, Yu.M.; Lebedev, I.A.; Myasoedov, B.F.



Process for removing mercury from aqueous solutions  

DOE Patents (OSTI)

A process for removing mercury from water to a level not greater than two parts per billion wherein an anion exchange material that is insoluble in water is contacted first with a sulfide containing compound and second with a compound containing a bivalent metal ion forming an insoluble metal sulfide. To this treated exchange material is contacted water containing mercury. The water containing not more than two parts per billion of mercury is separated from the exchange material.

Googin, John M. (Oak Ridge, TN); Napier, John M. (Oak Ridge, TN); Makarewicz, Mark A. (Knoxville, TN); Meredith, Paul F. (Knoxville, TN)



Process for removing mercury from aqueous solutions  

DOE Patents (OSTI)

A process for removing mercury from water to a level not greater than two parts per billion wherein an anion exchange material that is insoluble in water is contacted first with a sulfide containing compound and second with a compound containing a bivalent metal ion forming an insoluble metal sulfide. To this treated exchange material is contacted water containing mercury. The water containing not more than two parts per billion of mercury is separated from the exchange material.

Googin, J.M.; Napier, J.M.; Makarewicz, M.A.; Meredith, P.F.



Vertical morphology in solution-processed organic solar cells  

Science Journals Connector (OSTI)

Motivated by a report of an all-solution processed P3HT/PCBM ‘bilayer’ organic solar cell, we have investigated the vertical morphology by using a combination of...

Lee, Kwan H; Schwenn, Paul E; Smith, Arthur R G; Cavaye, Hamish; Shaw, Paul E; James, Michael; Krueger, Karsten B; Gentle, Ian R; Meredith, Paul; Burn, Paul L


Process for the recovery of strontium from acid solutions  

DOE Patents (OSTI)

The invention is a process for selectively extracting strontium and technetium values from aqueous nitric acid waste solutions containing these and other fission product values. The extractant is a macrocyclic polyether in a diluent which is insoluble in water, but which will itself dissolve a small amount of water. The process will extract strontium and technetium values from nitric acid solutions which are up to 6 molar in nitric acid. 5 figs.

Horwitz, E.P.; Dietz, M.L.



Actinide solution processing at the Rocky Flats Environmental Technology Site  

SciTech Connect

The Department of Energy (DOE) has prepared an Environmental Assessment (EA), DOE/EA-1039, for radioactive solution removal and processing at Rocky Flats Environmental Technology Site, Golden, Colorado. The proposal for solution removal and processing is in response to independent safety assessments and an agreement with the State of Colorado to remove mixed residues at Rocky Flats and reduce the risk of future accidents. Monthly public meetings were held during the scoping and preparation of the EA. The scope of the EA included evaluations of alternative methods and locations of solution processing. A comment period from February 20, 1995 through March 21, 1995 was provided to the public and the State of Colorado to offer written comment on the EA. Comments were received from the State of Colorado and the U.S. Environmental Protection Agency. A response to the agency comments is included in the Final EA.




Absorption process for producing oxygen and nitrogen and solution therefor  

DOE Patents (OSTI)

Process for the separation and purification of oxygen and nitrogen is disclosed which utilizes solutions of oxygen carriers to selectively absorb oxygen from a gaseous stream, leaving nitrogen as a byproduct. In the process, an oxygen carrier capable of reversibly binding molecular oxygen is dissolved in a solvent solution, which absorbs oxygen from an oxygen-containing gaseous feed stream such as atmospheric air and desorbs oxygen to a gaseous product stream. The feed stream is maintained at a sufficiently high oxygen pressure to keep the oxygen carrier in its oxygenated form during absorption, while the product stream is maintained at a sufficiently low oxygen pressure to keep the carrier in its deoxygenated form during desorption. In an alternate mode of operation, the carrier solution is maintained at a sufficiently low temperature and high oxygen pressure to keep the oxygen carrier in its oxygenated form during absorption, and at a sufficiently high temperature to keep the carrier in its deoxygenated form during desorption. Under such conditions, exceptionally high oxygen concentrations on the order of 95% to 99% are obtained, as well as a long carrier lifetime in excess of 3 months, making the process commercially feasible. 1 figure

Roman, I.C.; Baker, R.W.



Absorption process for producing oxygen and nitrogen and solution therefor  

DOE Patents (OSTI)

Process for the separation and purification of oxygen and nitrogen is disclosed which utilizes solutions of oxygen carriers to selectively absorb oxygen from a gaseous stream, leaving nitrogen as a byproduct. In the process, an oxygen carrier capable of reversibly binding molecular oxygen is dissolved in a solvent solution, which absorbs oxygen from an oxygen-containing gaseous feed stream such as atmospheric air and desorbs oxygen to a gaseous product stream. The feed stream is maintained at a sufficiently high oxygen pressure to keep the oxygen carrier in its oxygenated form during absorption, while the product stream is maintained at a sufficiently low oxygen pressure to keep the carrier in its deoxygenated form during desorption. In an alternate mode of operation, the carrier solution is maintained at a sufficiently low temperature and high oxygen pressure to keep the oxygen carrier in its oxygenated form during absorption, and at a sufficiently high temperature to keep the carrier in its deoxygenated form during desorption. Under such conditions, exceptionally high oxygen concentrations on the order of 95% to 99% are obtained, as well as a long carrier lifetime in excess of 3 months, making the process commercially feasible.

Roman, Ian C. [Wilmington, DE; Baker, Richard W. [Palo Alto, CA



Thermal diffusion processes in aqueous sodium chloride solutions  

SciTech Connect

The experimental results for the Soret coefficients are variable, but suggest a trend with NaCl concentration that is consistent with electrolyte solution behavior. The temperature dependence of the Soret coefficients is in approximate agreement with previous measurements obtained using other techniques. In general, the Soret coefficient values are best interpreted based on the expansion of the fluid inclusion migration fields. The high temperature values for {sigma} at 1.0 N NaCl concentration suggest an expansion of the migration field to smaller inclusion sizes, which for a single halite crystal at these conditions, approach a dimension of one micron. The corresponding fluid inclusion size for the polycrystalline material, where grain boundaries retard the migration, is approximately 10 microns. Although the Soret results obtained in the present study provide additional data for high temperature applications in nuclear waste isolation, more experimentation and new equipment design are required in order to obtain data at temperatures above 80{degree}C. The experimental approach utilized in this study is limited in that respect. The almost immeasurable nature of the thermal diffusion process for the brines as examined in the laboratory, suggests that this effect will be insignificant (outside of fluid inclusion migration) in most rock-water interactions associated with a rocksalt nuclear waste repository. Other effects, such as convective fluid transport, pressure solution, and groundwater flow, will be orders-of-magnitude more important in evaluating the critical nature of brine migration, waste canister corrosion, and the potential for leaching radioisotopes from waste repositories.

Cygan, R.T. [Sandia National Labs., Albuquerque, NM (United States); Jarrell, G.D. [ManTech Environmental Technology, Inc., Corvallis, OR (United States)



Process of concentrating ethanol from dilute aqueous solutions thereof  

DOE Patents (OSTI)

Relatively dilute aqueous solutions of ethanol are concentrated by passage through a bed of a crystalline silica polymorph, such as silicalite, to adsorb the ethanol with residual dilute feed in contact with the bed, which is displaced by passing concentrated aqueous ethanol through the bed without displacing the adsorbed ethanol. A product concentrate is then obtained by removing the adsorbed ethanol from the bed together with at least a portion of the concentrated aqueous ethanol used as the displacer liquid. This process permits ethanol to be concentrated from dilute fermentation beers, which may contain from 6 to 10% ethanol, to obtain a concentrate product at very low energy cost having an ethanol concentration in excess of 95%, such as a concentration of from 98 to 99.5%.

Oulman, Charles S. [Ames, IA; Chriswell, Colin D. [Slater, IA



Process of concentrating ethanol from dilute aqueous solutions thereof  

DOE Patents (OSTI)

Relatively dilute aqueous solutions of ethanol are concentrated by passage through a bed of a crystalline silica polymorph, such as silicalite, to adsorb the ethanol with residual dilute feed in contact with the bed, which is displaced by passing concentrated aqueous ethanol through the bed without displacing the adsorbed ethanol. A product concentrate is then obtained by removing the adsorbed ethanol from the bed together with at least a portion of the concentrated aqueous ethanol used as the displacer liquid. This process permits ethanol to be concentrated from dilute fermentation beers, which may contain from 6 to 10% ethanol, to obtain a concentrate product at very low energy cost having an ethanol concentration in excess of 95%, such as a concentration of from 98 to 99.5%. 5 figs.

Oulman, C.S.; Chriswell, C.D.



New Solutions for Substation Sensing, Signal Processing and Decision Making M. Kezunovic, Fellow IEEE  

E-Print Network (OSTI)

New Solutions for Substation Sensing, Signal Processing and Decision Making M. Kezunovic, Fellow describes a new solution for integrating substation sensing, signal processing and decision making for more. Introduction The existing substation designs for sensing, signal processing and decision-making have been



E-Print Network (OSTI)

by drilling followed by a number of steps to develop a solution mining cavern. Water is injected to dissolve a sump area within the salt at the base of the solution mining cavern. The sump allows insoluble materials settle within the cavern to avoid affecting the solution mining process and the dissolved salt can


Separation processes using expulsion from dilute supercritical solutions  

DOE Patents (OSTI)

A process is described for separating isotopes as well as other mixtures by utilizing the behavior of dilute repulsive or weakly attractive elements of the mixtures as the critical point of the solvent is approached.

Cochran, H.D. Jr.


Note: This page contains sample records for the topic "determination solution processable" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Stealth carriers for low-resolution structure determination of membrane proteins in solution  

Science Journals Connector (OSTI)

Specifically deuterated phospholipid bilayer nanodiscs have been developed which give a minimal contribution to neutron scattering data when used in 100% D2O. These provide an optimal platform for low-resolution structural determination of membrane proteins and their complexes in solution.

Maric, S.



Solution-processed infrared photovoltaic devices with >10% monochromatic internal quantum efficiency  

E-Print Network (OSTI)

, solution-cast photovoltaics are of urgent interest to realize low-cost solar cells. Polymer, polymerSolution-processed infrared photovoltaic devices with >10% monochromatic internal quantum-fullerene, and polymer-nanocrystal photovoltaics absorb light only to wavelengths as long as 750 nm, with the exception


Metallocene/carbon hybrids prepared by a solution process for supercapacitor applications  

E-Print Network (OSTI)

Efficient and scalable solution-based processes are not generally available to integrate well-studied pseudocapacitive materials (i.e., metal oxides and conducting polymers) with other components such as porous carbon, ...

Mao, Xianwen


Surfactant based imbibition and induced solution gas drive process: investigation by nuclear magnetic resonance  

E-Print Network (OSTI)


Cox, James Calvin



A Membrane Process for Recycling Die Lube from Wastewater Solutions  

SciTech Connect

An active-surface membrane technology was used to separate a die lube manufacturing wastewater stream consisting of various oils, hydrocarbons, heavy metals, and silicones. The ultrafiltration membranes reduced organics from initial oil and grease contents by 20–25X, carbon oxygen demand (COD) by 1.5 to 2X, and total organic carbon (TOC) by 0.6, while the biological oxygen demand (BOD) remained constant. The active-surface membranes were not fouled as badly as non-active-surface systems and the active-surface membrane flux levels were consistently higher and more stable than those of the non-active-surface membranes tested. Field testing demonstrated that the rotary microfilter can concentrate the die lube, i.e. remove the glycerin component, and produce a die lube suitable for recycling. The recycling system operated for six weeks with only seven cleaning cycles and no mechanical or electrical failures. Test data and quality records indicate that the die casting scrap was reduced from 8.4 to 7.8%. There is no doubt that this test yielded tremendous results. This separation process presents significant opportunities that can be evaluated further.

Eric S. Peterson; Jessica Trudeau; Bill Cleary; Michael Hackett; William A. Greene



A Membrane Process for Recycling Die Lube from Wastewater Solutions  

SciTech Connect

An active-surface membrane technology was used to separate a die lube manufacturing wastewater stream consisting of various oils, hydrocarbons, heavy metals, and silicones. The ultrafiltration membranes reduced organics from initial oil and grease contents by 20?25X, carbon oxygen demand (COD) by 1.5 to 2X, and total organic carbon (TOC) by 0.6, while the biological oxygen demand (BOD) remained constant. The active-surface membranes were not fouled as badly as non-active-surface systems and the active-surface membrane flux levels were consistently higher and more stable than those of the non-active-surface membranes tested. Field testing demonstrated that the rotary microfilter can concentrate the die lube, i.e. remove the glycerin component, and produce a die lube suitable for recycling. The recycling system operated for six weeks with only seven cleaning cycles and no mechanical or electrical failures. Test data and quality records indicate that the die casting scrap was reduced from 8.4 to 7.8%. There is no doubt that this test yielded tremendous results. This separation process presents significant opportunities that can be evaluated further.

Peterson, E.S.; Trudeau, J.; Cleary, B.; Hackett, M.; Greene, W.A.



Fully Solution-Processed Copper Chalcopyrite Thin Film Solar Cells: Materials Chemistry, Processing, and Device Physics  

E-Print Network (OSTI)

nanowire networks as window layers in thin film solar cells.window layer for fully solution-deposited thin filmITO) thin films by silver nanowire composite window layers

Chung, Choong-Heui



Process for separating and recovering an anionic dye from an aqueous solution  

DOE Patents (OSTI)

A solid/liquid phase process for the separation and recovery of an anionic dye from an aqueous solution is disclosed. The solid phase comprises separation particles having surface-bonded poly(ethylene glycol) groups, whereas the aqueous solution from which the anionic dye molecules are separated contains a poly(ethylene glycol) liquid/liquid biphase-forming amount of a dissolved lyotropic salt. After contact between the aqueous solution and separation particles, the anionic dye is bound to the particles. The bound anionic dye molecules are freed from the separation particles by contacting the anionic dye-bound particles with an aqueous solution that does not contain a poly(ethylene glycol) liquid/liquid biphase-forming amount of a dissolved lyotropic salt to form an aqueous anionic dye solution whose anionic dye concentration is preferably higher than that of the initial dye-containing solution. 7 figs.

Rogers, R.; Horwitz, E.P.; Bond, A.H.



D-A-D structured organic molecules with diketopyrrolopyrrole acceptor unit for solution-processed organic solar cells  

Science Journals Connector (OSTI)

...for solution-processed organic solar cells Jing Zhang Chang He Zhi-Guo Zhang...in solution-processed organic solar cells (OSCs). The molecules show broad...illumination of AM1.5, 100cm2. organic solar cells|solution-processable organic...



Solution Synthesis and Processing of PZT Materials for Neutron Generator Applications  

SciTech Connect

A new solution synthesis route has been developed for the preparation of lead-based ferroelectric materials (patent filed). The process produces controlled stoichiometry precursor powders by non-aqueous precipitation. For a given ferroelectric material to be prepared, a metal acetate/alkoxide solution containing constituent metal species in the appropriate ratio is mixed with an oxalic acid/n-propanol precipitant solution. An oxalate coprecipitate is instantly fonned upon mixing that quantitatively removes the metals from solution. Most of the process development was focused on the synthesis and processing of niobium-substituted lead zirconate titanate with a Zr-to-Ti ratio of 95:5 (PNZT 95/5) that has an application in neutron generator power supplies. The process was scaled to produce 1.6 kg of the PNZT 95/5 powder using either a sen-ii-batch or a continuous precipitation scheme. Several of the PNZT 95/5 powder lots were processed into ceramic slug form. The slugs in turn were processed into components and characterized. The physical properties and electrical performance (including explosive functional testing of the components met the requirements set for the neutron generator application. Also, it has been demonstrated that the process is highly reproducible with respect to the properties of the powders it produces and the properties of the ceramics prepared from its powders. The work described in this report was funded by Sandia's Laboratory Directed Research and Development Program.

Anderson, M.A.; Ewsuk, K.G.; Montoya, T.V.; Moore, R.H.; Sipola, D.L.; Tuttle, B.A.; Voigt, J.A.



Process for recovering chaotropic anions from an aqueous solution also containing other ions  

DOE Patents (OSTI)

A solid/liquid process for the separation and recovery of chaotropic anions from an aqueous solution is disclosed. The solid support comprises separation particles having surface-bonded poly(ethylene glycol) groups, whereas the aqueous solution from which the chaotropic anions are separated contains a poly(ethylene glycol) liquid/liquid biphase-forming amount of a dissolved salt (lyotrope). A solid/liquid phase admixture of separation particles containing bound chaotropic anions in such an aqueous solution is also contemplated, as is a chromatography apparatus containing that solid/liquid phase admixture. 19 figs.

Rogers, R.; Horwitz, E.P.; Bond, A.H.



Categorical Exclusion Determination Form Proposed Action Title: (0208-1695) Sustainable Energy Solutions LLC -  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

208-1695) Sustainable Energy Solutions LLC - 208-1695) Sustainable Energy Solutions LLC - Cryogenic Carbon Capture (Phase 2) Program or Field Office: Advanced Research Projects Agency - Energy LocationCs) CCity/County/State): Utah; Wyoming Proposed Action Description: Funding will support development of a cryogenic carbon capture (CCC) process for separating carbon dioxide from flue gas via desublimination of the flue gas and compression of the resulting solid and liquid products. Proposed work will consist of (1) design, fabrication/acquisition, and testing of components for the pilot-scale prototype CCC system; (2) integration of the components into a skid-mounted, pilot-scale prototype CCC system; and (3) testing of the skid-mounted, pilot-scale prototype CCC system using actual or simulated flue gas streams.


Composition and process for separating cesium ions from an acidic aqueous solution also containing other ions  

DOE Patents (OSTI)

A crown ether cesium ion extractant is disclosed as is its synthesis. The crown ether cesium ion extractant is useful for the selective purification of cesium ions from aqueous acidic media, and more particularly useful for the isolation of radioactive cesium-137 from nuclear waste streams. Processes for isolating cesium ions from aqueous acidic media using the crown ether cesium extractant are disclosed as are processes for recycling the crown ether cesium extractant and processes for recovering cesium from a crown ether cesium extractant solution.

Dietz, Mark L. (Elmhurst, IL); Horwitz, E. Philip (Naperville, IL); Bartsch, Richard A. (Lubbock, TX); Barrans, Jr., Richard E. (Downers Grove, IL); Rausch, David (Naperville, IL)



Multipass optical device and process for gas and analyte determination  

DOE Patents (OSTI)

A torus multipass optical device and method are described that provide for trace level determination of gases and gas-phase analytes. The torus device includes an optical cavity defined by at least one ring mirror. The mirror delivers optical power in at least a radial and axial direction and propagates light in a multipass optical path of a predefined path length.

Bernacki, Bruce E. (Kennewick, WA)



Enhancing performing characteristics of organic semiconducting films by improved solution processing  

DOE Patents (OSTI)

Improved processing methods for enhanced properties of conjugated polymer films are disclosed, as well as the enhanced conjugated polymer films produced thereby. Addition of low molecular weight alkyl-containing molecules to solutions used to form conjugated polymer films leads to improved photoconductivity and improvements in other electronic properties. The enhanced conjugated polymer films can be used in a variety of electronic devices, such as solar cells and photodiodes.

Bazan, Guillermo C; Moses, Daniel; Peet, Jeffrey; Heeger, Alan J



Solution processable organic polymers and small molecules for bulk?heterojunction solar cells: A review  

Science Journals Connector (OSTI)

Solution processed bulk heterojunction (BHJ) organic solar cells (OSCs) have gained wide interest in past few years and are established as one of the leading next generation photovoltaic technologies for low cost power production. Power conversion efficiencies up to 6% and 6.5% have been reported in the literature for single layer and tandem solar cells respectively using conjugated polymers. A recent record efficiency about 8.13% with active area of 1.13 cm 2 has been reported. However Solution processable small molecules have been widely applied for photovoltaic (PV) devices in recent years because they show strong absorption properties and they can be easily purified and deposited onto flexible substrates at low cost. Introducing different donor and acceptor groups to construct donor—acceptor (D—A) structure small molecules has proved to be an efficient way to improve the properties of organic solar cells (OSCs). The power conversion efficiency about 4.4 % has been reported for OSCs based on the small molecules. This review deals with the recent progress of solution processable D—A structure small molecules and discusses the key factors affecting the properties of OSCs based on D—A structure small molecules: sunlight absorption charge transport and the energy level of the molecules.

G. D. Sharma



Assessing the Power Generation Solution by Thermal-chemical Conversion of Meat Processing Industry Waste  

Science Journals Connector (OSTI)

Abstract The paper presents a waste to energy conversion solution using a pyro-air-gasification process applied to biodegradable residues from meat processing industry integrated with small scale thermodynamic cycle for power generation. The solution of air- gasification at atmospheric pressure is based on experimental research and engineering computation developed during the study. The input data, such as: waste chemical composition, low/high heating value and proximate analysis, correspond to real waste products, sampled directly from the industrial processing line. Separate drying as first stage pre-treatment and integrated partial drying inside the reactor was used. The syngas low heating value of about 4.3 MJ/Nm3 is insured by its combustible fraction (H2– 12.2%, CO – 19.2%, CH4 – 1.6%). According to syngas composition the thermodynamic cycle was chosen – Otto gas engine. For a given waste feed-in flow considered in our computation of about 110 kg/h the power output obtained is about 50 kWel. The global energy efficiency of the unit is about 15%. The results offer answers to energy recovery waste disposal for residues with characteristics that are not suitable for classic incineration or limit the energy efficiency of the process making it non-economical (the average humidity of the raw waste is about 42% in mass). The research focused on waste to energy conversion process energy efficiency, waste neutralization and power generation.

Cosmin Marculescu; Florin Alexe



Investigation of the neutral-solution etch process for refractive SOE antireflective surfaces  

SciTech Connect

Antireflection of optically clear glass used in photovoltaic concentrator refractive secondary optical elements (SOE's) was investigated using the neutral-solution etch process developed by Schott Glass. Test coupons and SOE's made from barium zinc glass, which does not solarize under ultraviolet exposure, were successfully etched at the center point process variable conditions of 87{degrees}C and 24 hours. Reflectance of the plano-plano dropped from 7.7% to 0.8%, with a corresponding increase in transmission from 91.7% to 98.5%. The etching process uses non-hydrofluoric, relatively non-toxic chemicals in a low-cost process well suited for use by photovoltaic system manufacturers during production. 10 refs., 4 figs., 1 tab.

Maish, A.B.



The Construction Wage Determination Process in the 1970's  

E-Print Network (OSTI)

policy, manpower training programs, labor relations involvement, targeted tax incentives, etc., government may and, in fact, does intervene in this process at all times. We do not, however, know whether existing government intervention is optimally... industry is a highly complex one which does not always conform to the dictates of orthodox microeconomic theory. A post-World War II history of construe- tion wages reveals a highly expansionary period during the 1950's and 1960's, followed by a control...

Shulenburger, David E.; McLean, Robert; Rasch, Sara E.



Method for determining processability of a hydrocarbon containing feedstock  

SciTech Connect

Disclosed herein is a method involving the steps of (a) precipitating an amount of asphaltenes from a liquid sample of a first hydrocarbon-containing feedstock having solvated asphaltenes therein with one or more first solvents in a column; (b) determining one or more solubility characteristics of the precipitated asphaltenes; (c) analyzing the one or more solubility characteristics of the precipitated asphaltenes; and (d) correlating a measurement of feedstock reactivity for the first hydrocarbon-containing feedstock sample with a mathematical parameter derived from the results of analyzing the one or more solubility characteristics of the precipitated asphaltenes.

Schabron, John F.; Rovani, Jr., Joseph F.


Note: This page contains sample records for the topic "determination solution processable" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Method and apparatus for determining nutrient stimulation of biological processes  

DOE Patents (OSTI)

A method and apparatus are disclosed for determining the nutrients to stimulate microorganisms in a particular environment. A representative sample of microorganisms from a particular environment are contacted with multiple support means wherein each support means has intimately associated with the surface of the support means a different nutrient composition for microorganisms in the sample. The multiple support means is allowed to remain in contact with the microorganisms in the sample for a time period sufficient to measure difference in microorganism effects for the multiple support means. Microorganism effects for the multiple support means are then measured and compared. The invention is particularly adaptable to being conducted in situ. The additional steps of regulating nutrients added to the particular environment of microorganisms can enhance the desired results. Biological systems particularly suitable for this invention are bioremediation, biologically enhanced oil recovery, biological leaching of metals, and agricultural bioprocesses. 5 figs.

Colwell, F.S.; Geesey, G.G.; Gillis, R.J.; Lehman, R.M.



Method and apparatus for determining nutrient stimulation of biological processes  

DOE Patents (OSTI)

A method and apparatus is described for determining the nutrients to stimulate microorganisms in a particular environment. A representative sample of microorganisms from a particular environment are contacted with multiple support means wherein each support means has intimately associated with the surface of the support means a different nutrient composition for said microorganisms in said sample. The multiple support means is allowed to remain in contact with the microorganisms in the sample for a time period sufficient to measure differences in microorganism effects for the multiple support means. Microorganism effects for the multiple support means are then measured and compared. The invention is particularly adaptable to being conducted in situ. The additional steps of regulating nutrients added to the particular environment of microorganisms can enhance the desired results. Biological systems particularly suitable for this invention are bioremediation, biologically enhanced oil recovery, biological leaching of metals, and agricultural bioprocesses. 5 figs.

Colwell, F.S.; Geesey, G.G.; Gillis, R.J.; Lehman, R.M.



Analysis of energy saving for ammonium sulfate solution processing with self-heat recuperation principle  

Science Journals Connector (OSTI)

Abstract As an important production process, the evaporative concentration of the inorganic salt solution is extensively applied in the industry, and it is significant to investigate the energy saving potential of such evaporation systems. In the paper, taking the ammonium sulfate solution for example, the self-heat recuperation technology (SHRT) is utilized to design two mechanical vapor recompression (MVR) systems, and the relevant energy saving performance is analyzed. It is found that the designed systems, which are satisfied with SHTR, enable the recovery of the sensible and latent heat of the emission solution without any additional heat, and compared to the conventional three-effect evaporation system, the energy saving performance are more prominent. However, in view of the existence of the boiling point elevation (BPE) for the inorganic salt solution, a maximum reduction amplitude of 40% of the energy saving performance for the double-stage MVR system is obtained compared with the single-stage MVR system. As a result, it is concluded that the only satisfaction to the SHRT is not enough, and the pattern of the MVR system should also be considered to ensure a prominent energy saving performance.

Dong Han; Weifeng He; Chen Yue; Wenhao Pu; Lin Liang



Room temperature solution-processed electron transport layer for organic solar cells  

Science Journals Connector (OSTI)

Abstract We present a new recipe for a solution-processed titanium oxide (TiOx) based electron transport layer at room temperature. Due to its high chemical compatibility with all types of organic blends (semi-crystalline or amorphous) and it is good adhesion to both surfaces of glass/ITO substrate and the active layer (blend), the buffer layer is suitable for use in organic solar cell devices with conventional, inverted or multi-junction structures. The main goal of this recipe is producing with easiness an repeatable and stable precursor that will leads to titanium oxide buffer layer each time with the same quality. Since the processing of the titanium oxide layer itself does not require any initial or additional treatment before and after the coating, and can even be carried in air as well as under protective atmosphere, our room temperature solution-processed electron transport layer is highly versatile and very promising for cost effective mass production of organic solar cells.

A. Hadipour; R. Müller; P. Heremans



Variability in Brain Death Determination in Europe: Looking for a Solution  

Science Journals Connector (OSTI)

Criteria for determining brain death (BD) vary between countries. We report the results of an investigation designed to compare procedures to determine BD in different European countries.

Giuseppe Citerio; Ilaria Alice Crippa; Alfio Bronco; Alessia Vargiolu…



Highly conductive p-type amorphous oxides from low-temperature solution processing  

SciTech Connect

We report solution-processed, highly conductive (resistivity 1.3-3.8 m{Omega} cm), p-type amorphous A-B-O (A = Bi, Pb; B = Ru, Ir), processable at temperatures (down to 240 Degree-Sign C) that are compatible with plastic substrates. The film surfaces are smooth on the atomic scale. Bi-Ru-O was analyzed in detail. A small optical bandgap (0.2 eV) with a valence band maximum (VBM) below but very close to the Fermi level (binding energy E{sub VBM} = 0.04 eV) explains the high conductivity and suggests that they are degenerated semiconductors. The conductivity changes from three-dimensional to two-dimensional with decreasing temperature across 25 K.

Li Jinwang [Japan Science and Technology Agency (JST), ERATO, Shimoda Nano-Liquid Process Project, 2-5-3 Asahidai, Nomi, Ishikawa 923-1211 (Japan); Green Devices Research Center, Japan Advanced Institute of Science and Technology, 1-1 Asahidai, Nomi, Ishikawa 923-1292 (Japan); Tokumitsu, Eisuke [Japan Science and Technology Agency (JST), ERATO, Shimoda Nano-Liquid Process Project, 2-5-3 Asahidai, Nomi, Ishikawa 923-1211 (Japan); Green Devices Research Center, Japan Advanced Institute of Science and Technology, 1-1 Asahidai, Nomi, Ishikawa 923-1292 (Japan); School of Materials Science, Japan Advanced Institute of Science and Technology, 1-1 Asahidai, Nomi, Ishikawa 923-1292 (Japan); Precision and Intelligence Laboratory, Tokyo Institute of Technology, 4259-R2-19 Nagatsuta, Midori-ku, Yokohama 226-8503 (Japan); Koyano, Mikio [Green Devices Research Center, Japan Advanced Institute of Science and Technology, 1-1 Asahidai, Nomi, Ishikawa 923-1292 (Japan); School of Materials Science, Japan Advanced Institute of Science and Technology, 1-1 Asahidai, Nomi, Ishikawa 923-1292 (Japan); Mitani, Tadaoki [Japan Science and Technology Agency (JST), ERATO, Shimoda Nano-Liquid Process Project, 2-5-3 Asahidai, Nomi, Ishikawa 923-1211 (Japan); Shimoda, Tatsuya [Japan Science and Technology Agency (JST), ERATO, Shimoda Nano-Liquid Process Project, 2-5-3 Asahidai, Nomi, Ishikawa 923-1211 (Japan); Green Devices Research Center, Japan Advanced Institute of Science and Technology, 1-1 Asahidai, Nomi, Ishikawa 923-1292 (Japan); School of Materials Science, Japan Advanced Institute of Science and Technology, 1-1 Asahidai, Nomi, Ishikawa 923-1292 (Japan)



Process-circuit and layout solutions for steam-turbine units and performance efficiency of thermal power plants  

Science Journals Connector (OSTI)

Criteria for evaluating process-circuit and layout solutions adopted in designing steam-turbine units are presented together with their values for a number of steam-turbine units produced by the Ural Turbine Work...

A. A. Gol’dberg; T. L. Shibaev



Processing results of 1,800 gallons of mercury and radioactively contaminated mixed waste rinse solution  

SciTech Connect

The mercury-contaminated rinse solution (INEL waste ID{number_sign} 123; File 8 waste) was successfully treated at the Idaho National Engineering Laboratory (INEL). This waste was generated during the decontamination of the Heat Transfer Reactor Experiment 3 (HTRE-3) reactor shield tank. Approximately 1,800 gal of waste was generated and was placed into 33 drums. Each drum contained precipitated sludge material ranging from 1--10 in. in depth, with the average depth of about 2.5 in. The pH of each drum varied from 3--11. The bulk liquid waste had a mercury level of 7.0 mg/l, which exceeded the Resource Conservation and Recovery Act (RCRA) limit of 0.2 mg/l. The average liquid bulk radioactivity was about 2.1 pCi/ml, while the average sludge contamination was about 13,800 pci/g. Treatment of the waste required separation of the liquid from the sludge, filtration, pH adjustment, and ion exchange. Because of difficulties in processing, three trials were required to reduce the mercury levels to below the RCRA limit. In the first trial, insufficient filtration of the waste allowed solid particulate produced during pH adjustment to enter into the ion exchange columns and ultimately the waste storage tank. In the second trial, the waste was filtered down to 0.1 {mu} to remove all solid mercury compounds. However, before filtration could take place, a solid mercury complex dissolved and mercury levels exceeded the RCRA limit after filtration. In the third trial, the waste was filtered through 0.3-A filters and then passed through the S-920 resin to remove the dissolved mercury. The resulting solution had mercury levels at 0.0186 mg/l and radioactivity of 0.282 pCi/ml. This solution was disposed of at the TAN warm waste pond, TAN782, TSF-10.

Thiesen, B.P.



On-line method of determining utilization factor in Hg-196 photochemical separation process  

DOE Patents (OSTI)

The present invention is directed to a method for determining the utilization factor [U] in a photochemical mercury enrichment process (.sup.196 Hg) by measuring relative .sup.196 Hg densities using absorption spectroscopy.

Grossman, Mark W. (Belmont, MA); Moskowitz, Philip E. (Peabody, MA)



Solution-processed silver nanowires as a transparent conducting electrode for air-stable inverted organic solar cells  

Science Journals Connector (OSTI)

Abstract Highly efficient and air-stable inverted organic solar cells (IOSCs) were fabricated using solution-processed silver nanowire electrodes. The electrodes showed a low sheet resistance of ~ 16 ? sq? 1 and a high transmittance of ~ 95% at a wavelength of 550 nm. A solution-processed ZnO buffer layer is typically used for electron transport and effective passivation of the surface of Ag NW electrodes. The device performance of the \\{IOSCs\\} that used these Ag NW electrodes, which were fabricated on a glass or plastic substrate, was > 94% of that of devices containing indium tin oxide (ITO) electrodes. This indicates that solution-processed Ag NW electrode can replace commercialized ITO and can be utilized in roll-to-roll and large-area fabrication processes.

Myungkwan Song; Jong-Kuk Kim; Shi-Young Yang; Jae-Wook Kang



Determination of Boron in Silicate Samples by Direct Aspiration of Sample HF Solutions into ICPMS  

Science Journals Connector (OSTI)

A rapid and precise technique for the determination of boron content in silicate rocks was developed by employing isotope dilution inductively coupled plasma mass spectrometry with a flow injection system (FI-ID-ICPMS). The sample was decomposed with HF ...

Akio Makishima; Eizo Nakamura; Toshio Nakano



Determination of alpha-amylase activity in dextran, ficoll and polyethylene glycol solutions  

Science Journals Connector (OSTI)

A new insoluble chromolytic substrate for the spectrophotometric determination of alpha-amylase activity (starch cross-linked with 1,4 ... phase-forming polymers interfere with some commonly used alpha-amylase as...

Ivo Šafa?ík; Miroslava Šafa?íková


NMR characterization and solution structure determination of the oxidized cytochrome c7 from Desulfuromonas?acetoxidans  

Science Journals Connector (OSTI)

...of heme proteins deposited in the Protein Data Bank. diana calculations, including the redundant angle strategy routine ( redac ) (30), were performed following the procedure and with the parameters already used by us for the determination of other...

Lucia Banci; Ivano Bertini; Mireille Bruschi; Pornthep Sompornpisut; Paola Turano



Multisoliton solutions in terms of double Wronskian determinant for a generalized variable-coefficient nonlinear Schroedinger equation from plasma physics, arterial mechanics, fluid dynamics and optical communications  

SciTech Connect

In this paper, the multisoliton solutions in terms of double Wronskian determinant are presented for a generalized variable-coefficient nonlinear Schroedinger equation, which appears in space and laboratory plasmas, arterial mechanics, fluid dynamics, optical communications and so on. By means of the particularly nice properties of Wronskian determinant, the solutions are testified through direct substitution into the bilinear equations. Furthermore, it can be proved that the bilinear Baecklund transformation transforms between (N - 1)- and N-soliton solutions.

Lue Xing [School of Science, P.O. Box 122, Beijing University of Posts and Telecommunications, Beijing 100876 (China)], E-mail: xinglv655@yahoo.com.cn; Zhu Hongwu; Yao Zhenzhi; Meng Xianghua; Zhang Cheng [School of Science, P.O. Box 122, Beijing University of Posts and Telecommunications, Beijing 100876 (China); Zhang Chunyi [Ministry-of-Education Key Laboratory of Fluid Mechanics and National Laboratory for Computational Fluid Dynamics, Beijing University of Aeronautics and Astronautics, Beijing 100083 (China); Meteorology Center of Air Force Command Post, Changchun 130051 (China); Tian Bo [School of Science, P.O. Box 122, Beijing University of Posts and Telecommunications, Beijing 100876 (China); State Key Laboratory of Software Development Environment, Beijing University of Aeronautics and Astronautics, Beijing 100083 (China); Key Laboratory of Optical Communication and Lightwave Technologies, Ministry of Education, Beijing University of Posts and Telecommunications, Beijing 100876 (China)], E-mail: gaoyt@public.bta.net.cn



Efficient solution-processed small molecule: Cadmium selenide quantum dot bulk heterojunction solar cells  

SciTech Connect

We report bulk heterojunction solar cells based on blends of solution-processed small molecule [7,7?-(4,4-bis(2-ethylhexyl)-4H-silolo[3,2-b:4,5-b?]dithiophene-2,6-diyl) bis(6-fluoro-4-(5?-hexyl-[2,2?-bithiophen]-5yl)benzo[c] [1,2,5] thiadiazole)] p-DTS(FBTTh{sub 2}){sub 2}: Cadmium Selenide (CdSe) (70:30, 60:40, 50:50, and 40:60) in the device configuration: Indium Tin Oxide /poly(3,4-ethylenedioxythiophene):poly(styrenesulfonate) (PEDOT:PSS)/p-DTS(FBTTh{sub 2}){sub 2}: CdSe/Ca/Al. The optimized ratio of p-DTS(FBTTh{sub 2}){sub 2}:CdSe::60:40 leads to a short circuit current density (J{sub sc})?=?5.45?mA/cm{sup 2}, open circuit voltage (V{sub oc})?=?0.727?V, and fill factor (FF)?=?51%, and a power conversion efficiency?=?2.02% at 100 mW/cm{sup 2} under AM1.5G illumination. The J{sub sc} and FF are sensitive to the ratio of p-DTS(FBTTh{sub 2}){sub 2}:CdSe, which is a crucial factor for the device performance.

Gupta, Vinay, E-mail: drvinaygupta@netscape.net [Physics of Energy Harvesting Division, Organic and Hybrid Solar Cell Group, CSIR-National Physical Laboratory, New Delhi-110012 (India) [Physics of Energy Harvesting Division, Organic and Hybrid Solar Cell Group, CSIR-National Physical Laboratory, New Delhi-110012 (India); Department of Physics, University of California, Santa Barbara, California 93106 (United States); Upreti, Tanvi; Chand, Suresh [Physics of Energy Harvesting Division, Organic and Hybrid Solar Cell Group, CSIR-National Physical Laboratory, New Delhi-110012 (India)] [Physics of Energy Harvesting Division, Organic and Hybrid Solar Cell Group, CSIR-National Physical Laboratory, New Delhi-110012 (India)



Solution Processed Tungsten Oxide Interfacial Layer for Efficient Hole-Injection in Quantum Dot Light-Emitting Diodes  

E-Print Network (OSTI)

2/2014 Solution Processed Tungsten Oxide Interfacial Layer for Efficient Hole-Injection in Quantum Layer for Efficient Hole-Injection in Quantum Dot Light- Emitting Diodes Xuyong Yang, Evren Mutlugun-based devices, the organic interfacial buffer layers have inferior thermal stability. Efforts to replace PEDOT

Demir, Hilmi Volkan


Solution-Processed Organic Solar Cells with Power Conversion Efficiencies of 2.5% using Benzothiadiazole/Imide-Based Acceptors  

E-Print Network (OSTI)

Solution-Processed Organic Solar Cells with Power Conversion Efficiencies of 2.5% using achieved 0.1% power-conversion efficiency. KEYWORDS: organic electronics, solar cells, photovoltaic devices significantly different behav- iors in bulk heterojunction (BHJ) solar cells using poly(3-hexylthiophene) (P3HT

McGehee, Michael



E-Print Network (OSTI)

DETERMINATION OF THE UAV POSITION BY AUTOMATIC PROCESSING OF THERMAL IMAGES Wilfried Hartmann.hartmann, sebastian.tilch, henri.eisenbeiss, konrad.schindler)@geod.baug.ethz.ch KEY WORDS: Thermal, UAV, Camera, Calibration, Bundle, Photogrammetry, GPS/INS ABSTRACT: If images acquired from Unmanned Aerial Vehicles (UAVs

Schindler, Konrad


Guiding Cooperative Stakeholders to Compromise Solutions Using an Interactive Tradespace Exploration Process  

E-Print Network (OSTI)

Engineering projects frequently involve the cooperation of multiple stakeholders with varying objectives and preferences for the resulting system. Finding a mutually agreeable solution is of paramount importance in order ...

Fitzgerald, Matthew E.


Enthalpy of formation of forsterite, enstatite, akermanite, monticellite and merwinite at 1073 K determined by alkali borate solution calorimetry  

Science Journals Connector (OSTI)

Enthalpies of solution of synthetic enstatite (Mg2Si2O6), forsterite (Mg2SiO4), akermanite (Ca2MgSi2O7), monticellite (CaMgSiO4), and merwinite (Ca3MgSi2O8) and their component oxides were determined in eutectic (Li, Na)BO2 at 1073 K. Resulting enthalpies of formation at 1073 are enstatite: ?8.10 ± 0.42 kcal; forsterite: ?14.23 ± 0.45 kcal; akermanite: ?42.60 ± 0.39 kcal; monticellite: ?25.05 ± 0.41 kcal; and merwinite: ?51.10 ± 0.49 kcal. The value for the synthetic monticellite of composition Mo.965Fo.035 was corrected slightly for non-stoichiometry based on experimental monticellite-forsterite phase equilibrium relations. The enthalpies of formation of enstatite and forsterite are somewhat less negative than yielded by several other solution calorimetric studies but are in good agreement with the recent Pb2B2O5 solution calorimetry of Kiselevaet al. (1979), and are in good agreement with values to be derived from reliable phase equilibrium data in the system MgO-Al2O3-SiO2. The enthalpies of formation of akermanite, monticellite and merwinite are all much less negative than values tabulated by robieet al. (1978) and helgesonet al. (1978) but are shown to be compatible with reliable phase equilibrium data for the system CaO-MgO-SiO2, whereas the tabulated values are not. Several methods of analysis yield an entropy of monticellite at 1000 K of 69.9 ± 0.2 cal/K.

C. Brousse; R.C. Newton; O.J. Kleppa


Note: This page contains sample records for the topic "determination solution processable" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Determination of characteristic alterations of the mass transfer process of thermodynamically nonequilibrium hydrocarbon systems  

SciTech Connect

The results of research on hydrocarbon mixture sorption in porous medium showed that adsorbent activity with regard to separate components of a gas mixture changes in partial dependence on pressure. The alteration of vented gas content will take place not only in gas condensate fields, when this effect is conditioned by the losses of condensate in the stratum, but also in gas fields, by methods connected with desorption processes. At the same time, gas composition is the basis for different process calculations, such as separation, gas transport, gas filtration in porous medium, and others. Thus the determination of characteristic alterations of gas mixture composition in thermodynamically nonequilibrium hydrocarbon systems mass transfer process becomes important. The binary (methane + pentane) and tricomponent (methane + butane + pentane) systems composed of individual gases of high purity have been researched. Then with help of mathematical methods of experimental data processing the moment of the more characteristic changes of the mass transfer process was discovered. Processing of experimental data for tricomponent system by statistical differentiation allowed the discovery of a pressure below of which lightening of the vented gas was observed.

Ramazanova, E.E.; Nurmamedova, Z.A. [Azerbaijan State Oil Academy, Baku (Azerbaijan). Geotechnological Research Inst. of Oil, Gas, and Chemistry



Pilot test of Pickliq{reg_sign} process to determine energy and environmental benefits & economic feasibility  

SciTech Connect

Green Technology Group (GTG) was awarded Grant No. DE-FG01-96EE 15657 in the amount of $99,904 for a project to advance GTG`s Pickliq{reg_sign} Process in the Copper and Steel Industries. The use of the Pickliq{reg_sign} Process can significantly reduce the production of waste acids containing metal salts. The Pickliq{reg_sign} Process can save energy and eliminate hazardous waste in a typical copper rod or wire mill or a typical steel wire mill. The objective of this pilot project was to determine the magnitude of the economic, energy and environmental benefits of the Pickliq{reg_sign} Process in two applications within the metal processing industry. The effectiveness of the process has already been demonstrated at facilities cleaning iron and steel with sulfuric acid. 9207 companies are reported to use sulfuric and hydrochloric acid in the USA. The USEPA TRI statistics of acid not recycled in the US is 2.4 x 10{sup 9} lbs (net) for Hydrochloric Acid and 2.0 x 10{sup 9} lbs (net) for Sulfuric Acid. The energy cost of not reclaiming acid is 10.7 x 10{sup 6} BTU/ton for Hydrochloric Acid and 21.6 x 10{sup 6} BTU/Ton for Sulfuric Acid. This means that there is a very large market for the application of the Pickliq{reg_sign} Process and the widespread use of the process will bring significant world wide savings of energy to the environment.

Olsen, D.R.



Extraction and recovery of plutonium and americium from nitric acid waste solutions by the TRUEX process - continuing development studies  

SciTech Connect

This report summarizes the work done to date on the application of the TRUEX solvent extraction process for removing and separately recovering plutonium and americium from a nitric acid waste solution containing these elements, uranium, and a complement of inert metal ions. This simulated waste stream is typical of a raffinate from a tributyl phosphate (TBP)-based solvent extraction process for removing uranium and plutonium from dissolved plutonium-containing metallurgical scrap. The TRUEX process solvent in these experiments was a solution of TBP and octyl(phenyl)-N,N-diisobutylcarbamoylmethylphosphine oxide (CMPO) dissolved in carbon tetrachloride. A flowsheet was designed on the basis of measured batch distribution ratios to reduce the TRU content of the solidified raffinate to less than or equal to 10 nCi/g and was tested in a countercurrent experiment performed in a 14-stage Argonne-model centrifugal contractor. The process solvent was recycled without cleanup. An unexpectedly high evaporative loss of CCl/sub 4/ resulted in concentration of the active extractant, CMPO, to nearly 0.30M in the solvent. Results are consistent with this higher CMPO concentration. The raffinate contained only 2 nCi/g of TRU, but the higher CMPO concentration resulted in reduced effectiveness in the stripping of americium from the solvent. Conditions can be easily adjusted to give high yields and good separation of americium and plutonium. Experimental studies of the hydrolytic and gamma-radiolytic degradation of the TRUEX-CCl/sub 4/ showed that solvent degradation would be (1) minimal for a year of processing this typical feed, which contained no fission products, and (2) could be explained almost entirely by hydrolytic and radiolytic damage to TBP. Even for gross amounts of solvent damage, scrubbing with aqueous sodium carbonate solution restored the original americium extraction and stripping capability of the solvent. 43 refs., 5 figs., 36 tabs.

Leonard, R.A.; Vandegrift, G.F.; Kalina, D.G.; Fischer, D.F.; Bane, R.W.; Burris, L.; Horwitz, E.P.; Chiarisia, R.; Diamond, H.




SciTech Connect

The performance of spherical Resorcinol-Formaldehyde ion-exchange resin for the removal of cesium from alkaline radioactive waste solutions has been investigated through computer modeling. Cesium adsorption isotherms were obtained by fitting experimental data using a thermodynamic framework. Results show that ion-exchange is an efficient method for cesium removal from highly alkaline radioactive waste solutions. On average, two 1300 liter columns operating in series are able to treat 690,000 liters of waste with an initial cesium concentration of 0.09 mM in 11 days achieving a decontamination factor of over 50,000. The study also tested the sensitivity of ion-exchange column performance to variations in flow rate, temperature and column dimensions. Modeling results can be used to optimize design of the ion exchange system.

Smith, F; Luther Hamm, L; Sebastian Aleman, S; Johnston Michael, J



Removal of Vanadium(IV) from Aqueous Solutions by Adsorption Process with Aluminum-Pillared Bentonite  

Science Journals Connector (OSTI)

The objective of this research work is to investigate the possibility of using a natural bentonite clay as a precursor to produce aluminum-pillared clay (Al?PILC) for the removal of vanadium(IV) from aqueous solutions. ... The original bentonite and Al?PILC were characterized with the help of surface area analyzer, X-ray diffraction, scanning electron microscopy, and potentiometric titration. ... The adsorption of vanadium(IV) onto Al?PILC has been dynamically and thermodynamically investigated. ...

D. M. Manohar; B. F. Noeline; T. S. Anirudhan



Monaco-A domain-specific language solution for reactive process control programming with hierarchical components  

Science Journals Connector (OSTI)

In this paper, we present Monaco - a domain-specific language for developing event-based, reactive process control programs - and its visual interactive programming environment. The main purpose of the language is to bring process control programming ... Keywords: Automation control, Component-based systems, Domain-specific languages, Reactive programming

Herbert Prähofer; Roland Schatz; Christian Wirth; Dominik Hurnaus; Hanspeter Mössenböck



ANGEL program: Solution of large systems of linear differential equations describing nonstationary processes using CUDA technology  

SciTech Connect

This paper presents the formulation of the problem and the methodical approach for solving large systems of linear differential equations describing nonstationary processes with the use of CUDA technology; this approach is implemented in the ANGEL program. Results for a test problem on transport of radioactive products over loops of a nuclear power plant are given. The possibilities for the use of the ANGEL program for solving various problems that simulate arbitrary nonstationary processes are discussed.

Moryakov, A. V., E-mail: sailor@yauza.ru; Pylyov, S. S. [National Research Centre Kurchatov Institute (Russian Federation)



Process for preparing chemically modified micas for removal of cesium salts from aqueous solution  

DOE Patents (OSTI)

A chemically modified mica composite formed by heating a trioctahedral mica in an aqueous solution of sodium chloride having a concentration of at least 1 mole/liter at a temperature greater than 180 degrees Centigrade for at least 20 hours, thereby replacing exchangeable ions in the mica with sodium. Formation is accomplished at temperatures and pressures which are easily accessed by industrial equipment. The reagent employed is inexpensive and non-hazardous, and generates a precipitate which is readily separated from the modified mica.

Yates, Stephen Frederic (1539 S. Kennicott Dr., Arlington Heights, IL 60005); DeFilippi, Irene (208 E. Edgewood La., Palatine, IL 60067); Gaita, Romulus (6646 Davis Rd., Morton Grove, IL 60053); Clearfield, Abraham (Department of Chemistry, Texas A& M University, College Station, TX 77843); Bortun, Lyudmila (Department of Chemistry, Texas A& M University, College Station, TX 77843); Bortun, Anatoly (Department of Chemistry, Texas A& M University, College Station, TX 77843)



Modeling of hydrologic conditions and solute movement in processed oil shale waste embankments under simulated climatic conditions  

SciTech Connect

The scope of this program is to study interacting hydrologic, geotechnical, and chemical factors affecting the behavior and disposal of combusted processed oil shale. The research combines bench-scale testing with large scale research sufficient to describe commercial scale embankment behavior. The large scale approach was accomplished by establishing five lysimeters, each 7.3 {times} 3.0 {times} 3.0 m deep, filled with processed oil shale that has been retorted and combusted by the Lurgi-Ruhrgas (Lurgi) process. Approximately 400 tons of Lurgi processed oil shale waste was provided by RBOSC to carry out this study. Research objectives were designed to evaluate hydrologic, geotechnical, and chemical properties and conditions which would affect the design and performance of large-scale embankments. The objectives of this research are: assess the unsaturated movement and redistribution of water and the development of potential saturated zones and drainage in disposed processed oil shale under natural and simulated climatic conditions; assess the unsaturated movement of solubles and major chemical constituents in disposed processed oil shale under natural and simulated climatic conditions; assess the physical and constitutive properties of the processed oil shale and determine potential changes in these properties caused by disposal and weathering by natural and simulated climatic conditions; assess the use of previously developed computer model(s) to describe the infiltration, unsaturated movement, redistribution, and drainage of water in disposed processed oil shale; evaluate the stability of field scale processed oil shale solid waste embankments using computer models.

Reeves, T.L.; Turner, J.P.; Hasfurther, V.R.; Skinner, Q.D.



Modeling of hydrologic conditions and solute movement in processed oil shale waste embankments under simulated climatic conditions  

SciTech Connect

The scope of this program is to study interacting hydrologic, geotechnical, and chemical factors affecting the behavior and disposal of combusted processed oil shale. The research combines bench-scale testing with large scale research sufficient to describe commercial scale embankment behavior. The large scale approach was accomplished by establishing five lysimeters, each 7.3 [times] 3.0 [times] 3.0 m deep, filled with processed oil shale that has been retorted and combusted by the Lurgi-Ruhrgas (Lurgi) process. Approximately 400 tons of Lurgi processed oil shale waste was provided by RBOSC to carry out this study. Research objectives were designed to evaluate hydrologic, geotechnical, and chemical properties and conditions which would affect the design and performance of large-scale embankments. The objectives of this research are: assess the unsaturated movement and redistribution of water and the development of potential saturated zones and drainage in disposed processed oil shale under natural and simulated climatic conditions; assess the unsaturated movement of solubles and major chemical constituents in disposed processed oil shale under natural and simulated climatic conditions; assess the physical and constitutive properties of the processed oil shale and determine potential changes in these properties caused by disposal and weathering by natural and simulated climatic conditions; assess the use of previously developed computer model(s) to describe the infiltration, unsaturated movement, redistribution, and drainage of water in disposed processed oil shale; evaluate the stability of field scale processed oil shale solid waste embankments using computer models.

Reeves, T.L.; Turner, J.P.; Hasfurther, V.R.; Skinner, Q.D.



Process and design solutions for exploiting FD-SOI technology towards energy efficient SOCs  

Science Journals Connector (OSTI)

Planar UTBB FD-SOI technology is an opportunity for energy efficient SOCs in deeply scaled technologies. Thanks to its excellent responsiveness to power management design techniques, this technology brings a significant improvement in terms of performance ... Keywords: body biasing, energy efficiency, low voltage, multi-vt, process compensation, soc, ultra wide voltage range, utbb fd-soi

Philippe Flatresse



Modeling and the Adaptive Solution of CVD Fiber-Coating Processes  

E-Print Network (OSTI)

guidance for improving the process. 1 Introduction Ceramic composites are designed for use in high permeate the matrix and react with the bers to weaken the composite. Coating the bers can protect them from, New York 12180, USA Abstract We develop a mathematical model for the coating of ceramic bers

Adjerid, Slimane


The Role of Advanced Process Control in Your Energy Management Solution  

E-Print Network (OSTI)

as cost savings are proven ? Custom application development and protocol emulation services are available Presentation title Service, Customization, Innovation Typical System Architecture DCS/PLC/OPC L1 Interface DCS Manual Entry ASCII files... Other computersPLC Process Lan RDBMS LIMS Other OPC Server Direct Interface SCADA Custom Application Systems ERP WEB Server RBV Corporate WAN EAMS Server & Historian Plant LAN LAB Presentation title Service, Customization...

Johnson, K.; Van Wyk, L.



Determination of the three-dimensional solution structure of Raphanus sativus Antifungal Protein 1 by 1H NMR  

Science Journals Connector (OSTI)

Raphanus sativus Antifungal Protein 1 (Rs-AFP1) is a 51 amino acid residue plant defensin isolated from radish (Raphanus sativusL.) seeds. The three-dimensional structure in aqueous solution has been determined from two-dimensional 1H NMR data recorded at 500 \\{MHz\\} using the DIANA/REDAC calculation protocols. Experimental constraints consisted of 787 interproton distances extracted from NOE cross-peaks, 89 torsional constraints from 106 vicinal interproton coupling constants and 32 stereospecific assignments of prochiral protons. Further refinement by simulated annealing resulted in a set of 20 structures having pairwise root-mean-square differences of 1.35(±0.35) Å over the backbone heavy atoms and 2.11(±0.46) Å over all heavy atoms. The molecule adopts a compact globular fold comprising an ?-helix from Asn18 till Leu28 and a triple-stranded ?-sheet (?1=Lys2-Arg6, ?2=His33-Tyr38 and ?3=His43-Pro50). The central strand of this ?-sheet is connected by two disulfide bridges (Cys21–Cys45 and Cys25–Cys47) to the ?-helix. The connection between ?-strand 2 and 3 is formed by a type \\{VIa\\} ?-turn. Even the loop (Pro7 to Asn17) between ?-strand 1 and the ?-helix is relatively well defined. The structure of Raphanus sativus Antifungal Protein 1 features all the characteristics of the “cysteine stabilized ?? motif”. A comparison of the complete structure and of the regions important for interaction with the fungal receptor according to a mutational study, is made with the structure of ?-thionin, a plant defensin that has no antifungal activity. It is concluded that this interaction is both electrostatic and specific, and some possible scenarios for the mode of action are given.

Franky Fant; Wim Vranken; Willem Broekaert; Frans Borremans



Regeneration of an aqueous solution from an acid gas absorption process by matrix stripping  

DOE Patents (OSTI)

Carbon dioxide and other acid gases are removed from gaseous streams using aqueous absorption and stripping processes. By replacing the conventional stripper used to regenerate the aqueous solvent and capture the acid gas with a matrix stripping configuration, less energy is consumed. The matrix stripping configuration uses two or more reboiled strippers at different pressures. The rich feed from the absorption equipment is split among the strippers, and partially regenerated solvent from the highest pressure stripper flows to the middle of sequentially lower pressure strippers in a "matrix" pattern. By selecting certain parameters of the matrix stripping configuration such that the total energy required by the strippers to achieve a desired percentage of acid gas removal from the gaseous stream is minimized, further energy savings can be realized.

Rochelle, Gary T. (Austin, TX); Oyenekan, Babatunde A. (Katy, TX)



Degradation of Rabeprazole-N-oxide in aqueous solution using sonication as an advanced oxidation process  

Science Journals Connector (OSTI)

Abstract The degradation of Rabeprazole-N-oxide with sonication (US), peroxide mediated sonication (US/H2O2), Sono-Fenton (US/Fenton), TiO2 mediated sonication (US/TiO2) and sonication in combination with H2O2 and TiO2 (US/TiO2 + H2O2) is investigated and compared for their treatment efficiency. The effects of the frequency, power, different reactant concentrations and pH on the degradation rate have been examined. The efficiency of the treatment system is measured in terms of compound degradation and COD reduction. Among all the treatment processes studied, US/TiO2 + H2O2 is observed to be effective in degrading the drug impurity. A maximum of 72% degradation of the compound is observed at pH 7 with 50 mg of TiO2 and peroxide concentration of 500 mg/L.

G. Shankaraiah; P. Saritha; Nalini Vijayalaximi Pedamalla; D. Bhagawan; V. Himabindu



Whole fusion-fission process with Langevin approach and compared with analytical solution for barrier passage  

E-Print Network (OSTI)

We investigate time-dependent probability for a Brownian particle passing over the barrier to stay at a metastable potential pocket against escaping over the barrier. This is related to whole fusion-fission dynamical process and can be called the reverse Kramers problem. By the passing probability over the saddle point of inverse harmonic potential multiplying the exponential decay factor of a particle in the metastable potential, we present an approximate expression for the modified passing probability over the barrier, in which the effect of reflection boundary of potential is taken into account. Our analytical result and Langevin Monte-Carlo simulation show that the probability passing and against escaping over the barrier is a non-monotonous function of time and its maximal value is less than the stationary result of passing probability over the saddle point of inverse harmonic potential.

Han, Jie



Post-processing of seismic parameter data based on valid seismic event determination  

DOE Patents (OSTI)

An automated seismic processing system and method are disclosed, including an array of CMOS microprocessors for unattended battery-powered processing of a multi-station network. According to a characterizing feature of the invention, each channel of the network is independently operable to automatically detect, measure times and amplitudes, and compute and fit Fast Fourier transforms (FFT's) for both P- and S- waves on analog seismic data after it has been sampled at a given rate. The measured parameter data from each channel are then reviewed for event validity by a central controlling microprocessor and if determined by preset criteria to constitute a valid event, the parameter data are passed to an analysis computer for calculation of hypocenter location, running b-values, source parameters, event count, P- wave polarities, moment-tensor inversion, and Vp/Vs ratios. The in-field real-time analysis of data maximizes the efficiency of microearthquake surveys allowing flexibility in experimental procedures, with a minimum of traditional labor-intensive postprocessing. A unique consequence of the system is that none of the original data (i.e., the sensor analog output signals) are necessarily saved after computation, but rather, the numerical parameters generated by the automatic analysis are the sole output of the automated seismic processor.

McEvilly, Thomas V. (733 Alvarado Rd., Berkeley, CA 94705)



An Analytical Model for Determination of the Solvent Convective Dispersion Coefficient in the Vapor Extraction Heavy Oil Recovery Process  

Science Journals Connector (OSTI)

In this article, a new model is developed to determine the solvent convective dispersion coefficient in a solvent vapor extraction (VAPEX) heavy oil recovery process. It is assumed that solvent mass transfer b...

Mohammad Derakhshanfar; Yongan Gu



Roll-to-Roll Solution-Processible Small-Molecule OLEDs  

SciTech Connect

The objective of this program is to develop key knowledge and make critical connections between technologies needed to enable low-cost manufacturing of OLED lighting products. In particular, the program was intended to demonstrate the feasibility of making high performance Small-Molecule OLEDs (SM-OLED) using a roll-to-roll (R2R) wet-coating technique by addressing the following technical risks (1) Whether the wet-coating technique can provide high performance OLEDs, (2) Whether SM-OLED can be made in a R2R manner, (3) What are the requirements for coating equipment, and (4) Whether R2R OLEDs can have the same performance as the lab controls. The program has been managed and executed according to the Program Management Plan (PMP) that was first developed at the beginning of the program and further revised accordingly as the program progressed. Significant progress and risk reductions have been accomplished by the end of the program. Specific achievements include: (1) Demonstrated that wet-coating can provide OLEDs with high LPW and long lifetime; (2) Demonstrated R2R OLEDs can be as efficient as batch controls (Figure 1) (3) Developed & validated basic designs for key equipment necessary for R2R SM-OLEDs; (4) Developed know-hows & specifications on materials & ink formulations critical to wetcoating; (5) Developed key R2R processes for each OLED layer (6) Identified key materials and components such as flexible barrier substrates necessary for R2R OLEDs.

Liu, Jie Jerry


Note: This page contains sample records for the topic "determination solution processable" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


INDEX - a solution to the high cost of processing transient workers  

SciTech Connect

In 1985 twelve midwestern utilities formed the Nuclear Employee Data System for the US Nuclear Regulatory Commission's (NRC's) Region III (NEDS III) group. These utilities are Cleveland Electric Illuminating Company, Commonwealth Edison Company, Consumers Power Company, Detroit Edison Company, Illinois Power Company, Indiana and Michigan Electric Company, Iowa Electric Light and Power Company, Northern States Power Company, Toledo Edison Company, Union Electric Company, and Wisconsin Public Service Corporation. Early in 1986, Kansas Gas and Electric of NRC's Region IV joined the group and a cost-benefit study of a nuclear employee data system was initiated. The purpose of this system is to reduce the cost of processing workers requiring unescorted access to nuclear power plants. The involved utilities continued this project as the Integrated Nuclear Data Exchange (INDEX). In 1987 the following additional utilities joined INDEX: Houston Lighting and Power, Pacific Gas and Electric, Texas Utilities Electric Company, Arkansas Power and Light, Louisiana Power and Light, Systems Energy Resources Inc., and Southern California Edison. This paper summarizes the results of the study and discusses the current status of the program.

Stroupe, E.P.



A Novel Method for the Determination of Carbonyl Groups in Cellulosics by Fluorescence Labeling. 3. Monitoring Oxidative Processes  

Science Journals Connector (OSTI)

This work, as the third and last part of this series, gives four illustrative examples, which are not only scientifically interesting but also industrially relevant:? solutions of cellulose in N-methylmorpholine-N-oxide (NMMO) as used in the Lyocell process; alkalization and aging of pulp in 18% NaOH as the initial step in the viscose rayon production; electron beaming of pulp as a means of activation for further processing to derivatives; cellulose changes as occurring upon prolonged drying and storage of pulp under thermal stress. ... It was evident that both processes, carbonyl generation and chain shortening, were closely interrelated and proceeded simultaneously. ...

Antje Potthast; Jürgen Röhrling; Thomas Rosenau; Andrea Borgards; Herbert Sixta; Paul Kosma



Solution Processed Al-Doped ZnO Nanoparticles/TiOx Composite for Highly Efficient Inverted Organic Solar Cells  

Science Journals Connector (OSTI)

Solution Processed Al-Doped ZnO Nanoparticles/TiOx Composite for Highly Efficient Inverted Organic Solar Cells ... This metal-oxide composition, called AZOTi, has two important elements that benefit production of low cost devices. ... After successful utilization of AZOTi in the fabrication of optimized single layer P3HT/PCBM-inverted solar cells, we also fabricated tandem cells comprising ITO/AZOTi/P3HT/PCBM in the front cell and a blend of a low band gap polymer [2,1,3-benzothiadiazole-4,7-diyl [4,4-bis(2-ethylhexyl)-4H-cyclopenta[2,1-b:3,4-b?]dithiophene-2,6-diyl

Abay Gadisa; Travis Hairfield; Leila Alibabaei; Carrie L. Donley; Edward T. Samulski; Rene Lopez



Convergence method for calculating solutions to the 3D invariant embedding integro-differential equations describing electron transport processes  

E-Print Network (OSTI)

The electron and photon transport processes in spectroscopy techniques described by the invariant embedding theory is here revisited. We report a convergence method to obtain closed analytical solutions to the 3D integro-differential equations. This method was successfully used in calculating the dependence of the electron backscattered fraction on the atomic number and on the energy. Also the fraction of absorbed electron as a function of incident angles was calculated. Using a states ladder model for the electron energies, this method provides a tool for testing physical parameters involved in the transport theory, such as the elastic and inelastic cross sections. The outstanding feature of the invariant embedding differential equations of considering observable quantities (such as the emergent flux of particles) as independent variables makes them a suitable tool to describe experimental situations.

Carlos Figueroa; Horacio Brizuela; Silvia P. Heluani




SciTech Connect

To support the assessment of inspection findings as part of the risk-informed inspection in the United States Nuclear Regulatory Commission's (USNRC's) Reactor Oversight Process (ROP), risk inspection notebooks, also called significance determination process (SDP) notebooks, have been developed for each of the operating plants in the United States. These notebooks serve as a tool for assessing risk significance of inspection findings along with providing an engineering understanding of the significance. Plant-specific notebooks are developed to capture plant-specific features, characteristics, and analyses that influence the risk profile of the plant. At the same time, the notebooks follow a consistent set of assumptions and guidelines to assure consistent treatment of inspection findings across the plants. To achieve these objectives, notebooks are designed to provide specific information that are unique both in the manner in which the information is provided and in the way the screening risk assessment is carried out using the information provided. The unique features of the SDP notebooks, the approaches used to present the information for assessment of inspection findings, the assumptions used in consistent modeling across different plants with due credit to plant-specific features and analyses form the technical basis of the SDP notebooks. In this document, the unique features and the technical basis for the notebooks are presented. The types of information that are included and the reasoning/basis for including that information are discussed. The rules and basis for developing the worksheets that are used by the inspectors in the assessment of inspection findings are presented. The approach to modeling plants' responses to different initiating events and specific assumptions/considerations used for each of the reactor types are also discussed.




Applications of Living Fire PRA models to Fire Protection Significance Determination Process in Taiwan  

SciTech Connect

The living fire probabilistic risk assessment (PRA) models for all three operating nuclear power plants (NPPs) in Taiwan had been established in December 2000. In that study, a scenario-based PRA approach was adopted to systematically evaluate the fire and smoke hazards and associated risks. Using these fire PRA models developed, a risk-informed application project had also been completed in December 2002 for the evaluation of cable-tray fire-barrier wrapping exemption. This paper presents a new application of the fire PRA models to fire protection issues using the fire protection significance determination process (FP SDP). The fire protection issues studied may involve the selection of appropriate compensatory measures during the period when an automatic fire detection or suppression system in a safety-related fire zone becomes inoperable. The compensatory measure can either be a 24-hour fire watch or an hourly fire patrol. The living fire PRA models were used to estimate the increase in risk associated with the fire protection issue in terms of changes in core damage frequency (CDF) and large early release frequency (LERF). In compliance with SDP at-power and the acceptance guidelines specified in RG 1.174, the fire protection issues in question can be grouped into four categories; red, yellow, white and green, in accordance with the guidelines developed for FD SDP. A 24-hour fire watch is suggested only required for the yellow condition, while an hourly fire patrol may be adopted for the white condition. More limiting requirement is suggested for the red condition, but no special consideration is needed for the green condition. For the calculation of risk measures, risk impacts from any additional fire scenarios that may have been introduced, as well as more severe initiating events and fire damages that may accompany the fire protection issue should be considered carefully. Examples are presented in this paper to illustrate the evaluation process. (authors)

De-Cheng, Chen; Chung-Kung, Lo; Tsu-Jen, Lin; Ching-Hui, Wu [Institute of Nuclear Energy Research, P. O. Box 3-3, Lung-Tan, Tao-Yuan Taiwan (China); Lin, James C. [ABSG Consulting Inc., 300 Commerce Drive, Suite 200, Irvine, CA 92602 (United States)



Determination of residual monomers resulting from the chemical polymerization process of dental materials  

SciTech Connect

The residual monomer present in post-polymerized dental materials encourages premature degradation of the reconstructed tooth. That is why the residual monomer should be quantified in a simple, fast, accurate and reproducible manner. In our work we propose such an approach for accurate determination of the residual monomer in dental materials which is based on low-field nuclear magnetic resonance (NMR) relaxometry. The results of the NMR approach are compared with those of the high performance liquid chromatography (HPLC) technique. The samples under study contain the main monomers (2,2-bis[4-(2-hydroxy-3-methacryloyloxypropoxy)phenyl]propane and triethylene glycol dimethacrylate) constituting the liquid phase of most dental materials and an initiator. Two samples were analyzed with different ratios of chemical initiation systems: N,N-dimethyl-p-toluide: benzoyl peroxide (1:2 and 0.7:1.2). The results obtained by both techniques highlight that by reducing the initiator the polymerization process slows down and the amount of residual monomer reduces. This prevents the premature degradation of the dental fillings and consequently the reduction of the biomaterial resistance.

Boboia, S. [Babes Bolyai University, Raluca Ripan Chemistry Research Institute, Department of Polymer Composites, 400294 Cluj-Napoca, Romania and Technical University of Cluj-Napoca, Physics and Chemistry Department, 400114 Cluj-Napoca (Romania)] [Babes Bolyai University, Raluca Ripan Chemistry Research Institute, Department of Polymer Composites, 400294 Cluj-Napoca, Romania and Technical University of Cluj-Napoca, Physics and Chemistry Department, 400114 Cluj-Napoca (Romania); Moldovan, M. [Babes Bolyai University, Raluca Ripan Chemistry Research Institute, Department of Polymer Composites, 400294 Cluj-Napoca (Romania)] [Babes Bolyai University, Raluca Ripan Chemistry Research Institute, Department of Polymer Composites, 400294 Cluj-Napoca (Romania); Ardelean, I. [Technical University of Cluj-Napoca, Physics and Chemistry Department, 400114 Cluj-Napoca (Romania)] [Technical University of Cluj-Napoca, Physics and Chemistry Department, 400114 Cluj-Napoca (Romania)



Obtaining process mass balances of pharmaceuticals and triclosan to determine their fate during wastewater treatment  

Science Journals Connector (OSTI)

Abstract To better understand pharmaceutical fate during wastewater treatment, analysis in both aqueous and particulate phases is needed. Reported herein is a multi-residue method for the determination of ten pharmaceutical drugs and the personal care product triclosan in wastewater matrices. Method quantitation limits ranged from 7.6 to 76.6 ng l? 1 for aqueous phases and from 7.0 to 96.7 ng g? 1 for particulate phases. The analytical method was applied to attain a complete process mass balance of a pilot-scale activated sludge plant (ASP) operated under controlled conditions. The mass balance (inclusive of aqueous and particulate concentrations at all sample points) was used to diagnose removal, revealing pharmaceuticals to be separable into three fate pathways: (a) biological degradation, (b) sorption onto activated sludge and (c) resistant to removal from the aqueous phase. These differences in fate behaviour explained a broad range of secondary removal observed (? 8 to 99%). The ASP was also simultaneously compared to a full-scale trickling filter (TF) works whilst receiving the same influent wastewater. Performance of the ASP and TF was similar, achieving total pharmaceutical removals of 253 and 249 ?g g? 1 biochemical oxygen demand (BOD) removed, respectively. This corresponded with reductions in total pharmaceutical load of 91 and 90% (ANOVA, p-value > 0.05). Interestingly, despite low suspended solid concentrations final effluents of both the ASP and TF contained significant concentrations of some chemicals in the particulate phase. Individually, triclosan and the antibiotics ofloxacin and ciprofloxacin were within the particulate phase of effluents at concentrations ranging from 26 to 296 ng l? 1.

Bruce Petrie; Ewan J. McAdam; John N. Lester; Elise Cartmell



Determination of Transport Properties From Flowing Fluid Temperature LoggingIn Unsaturated Fractured Rocks: Theory And Semi-Analytical Solution  

SciTech Connect

Flowing fluid temperature logging (FFTL) has been recently proposed as a method to locate flowing fractures. We argue that FFTL, backed up by data from high-precision distributed temperature sensors, can be a useful tool in locating flowing fractures and in estimating the transport properties of unsaturated fractured rocks. We have developed the theoretical background needed to analyze data from FFTL. In this paper, we present a simplified conceptualization of FFTL in unsaturated fractured rock, and develop a semianalytical solution for spatial and temporal variations of pressure and temperature inside a borehole in response to an applied perturbation (pumping of air from the borehole). We compare the semi-analytical solution with predictions from the TOUGH2 numerical simulator. Based on the semi-analytical solution, we propose a method to estimate the permeability of the fracture continuum surrounding the borehole. Using this proposed method, we estimated the effective fracture continuum permeability of the unsaturated rock hosting the Drift Scale Test (DST) at Yucca Mountain, Nevada. Our estimate compares well with previous independent estimates for fracture permeability of the DST host rock. The conceptual model of FFTL presented in this paper is based on the assumptions of single-phase flow, convection-only heat transfer, and negligible change in system state of the rock formation. In a sequel paper [Mukhopadhyay et al., 2008], we extend the conceptual model to evaluate some of these assumptions. We also perform inverse modeling of FFTL data to estimate, in addition to permeability, other transport parameters (such as porosity and thermal conductivity) of unsaturated fractured rocks.

Mukhopadhyay, Sumit; Tsang, Yvonne W.



Solution structure of a fragment of the dimerization domain of E2F-1 determined by circular dichroism, 1H nuclear magnetic resonance and distance geometry  

Science Journals Connector (OSTI)

The structure of a synthesized peptide with the sequence GVVDLNWAAEVLKVQKRRIYDITNVLEGIQ which corresponds to residues 149–178 of transcription factor E2F-1 was determined by 1H nuclear magnetic resonance in 40% d3-TFE/water. NOE cross peaks and ?H chemical shifts indicate that the peptide consists of a helix from Ala-8 to Leu-26 in this solution. Circular dichroism measurements confirm the presence of nearly 45% helix in TFE/water solution but show no evidence of helicity in water solution of this peptide. Fifty structures were constructed with 329 upper distance limits by DIANA. The 20 best conformers show a RMSD of 0.78 Å for backbone atoms and 1.78 Å for heavy atoms from residue Ala-8 to Leu-26. This result, together with our previous work on the solution structure of a fragment of DP-1, supports the proposal that E2F-1 and DP-1 may dimerize with a coiled-coil type interaction.

Shouhong Guang; Jihui Wu; Limei Tao; Youlin Xia; Yunyu Shi



Determination of dispersivities and reactionkinetics of selected basalts of columbia river plateau using an inverse analytical solution technique  

E-Print Network (OSTI)

on the determination of transport parameters by modeling sodium transport in the Priest Rapids and Roza flow tops of the Wanapum formation, and Rocky Coulee and Umtanum flow tops of the Grande Ronde formation, within the Cold Creek Syncline of the Hanford Nuclear Waste...

Fahlquist, Lisa Armstrong



The experimental determination of the solubility product for NpO{sub 2}OH in NaCl solutions  

SciTech Connect

The solubility of Np(V) was measured in NaCl solutions ranging from 0.30 to 5.6 molal at room temperature ({approximately}21 {plus_minus} 2{degrees}C). Experiments were conducted from undersaturation and allowed to equilibrate in a CO{sub 2}-free environment for 37 days. The apparent solubility products varied with NaCl concentration and were between 10{sup -9} and 10{sup -8} mol{sup 2}{sm_bullet}L{sup -2}. Using the specific ion interaction theory (SIT), the log of the solubility product of NpO{sub 2}OH(am) at infinite dilution was found to be - 8.79 {plus_minus} 0.12. The interaction coefficient, {epsilon}(NpO{sub 2}{sup +} - Cl{sup -}), was found to be (0.08 {plus_minus} 0.05).

Roberts, K.E.; Torretto, P.C.; Prussin, T. [Lawrence Berkeley Lab., CA (United States)] [and others



Processing of bone samples for the determination of ultra low-levels of uranium and plutonium  

Science Journals Connector (OSTI)

We have developed cleanroom compatible techniques for processing bone samples for ... dried and ashed in quartz crucibles placed inside cleanroom compatible thermal ashing furnaces. The bone ash...238U and 8 femt...

D. W. Efurd; R. E. Steiner; S. P. LaMont…



Enhancing the Performance of Solution-Processed Bulk-Heterojunction Solar Cells Using Hydrogen-Bonding-Induced Self-Organization of Small Molecules  

Science Journals Connector (OSTI)

Small-molecule solar-cell performance is highly sensitive to the crystallinity and intermolecular connectivity of the molecules. In order to enhance the crystallinity for the solution-processed small molecule, it is possible to make use of carboxylic acid ...

Kwan Hang Lam; Thelese Ru Bao Foong; Zi En Ooi; Jie Zhang; Andrew Clive Grimsdale; Yeng Ming Lam



Simultaneous and rapid determination of multiple component concentrations in a Kraft liquor process stream  

DOE Patents (OSTI)

The present invention is a rapid method of determining the concentration of the major components in a chemical stream. The present invention is also a simple, low cost, device of determining the in-situ concentration of the major components in a chemical stream. In particular, the present invention provides a useful method for simultaneously determining the concentrations of sodium hydroxide, sodium sulfide and sodium carbonate in aqueous kraft pulping liquors through use of an attenuated total reflectance (ATR) tunnel flow cell or optical probe capable of producing a ultraviolet absorbency spectrum over a wavelength of 190 to 300 nm. In addition, the present invention eliminates the need for manual sampling and dilution previously required to generate analyzable samples. The inventive method can be used in Kraft pulping operations to control white liquor causticizing efficiency, sulfate reduction efficiency in green liquor, oxidation efficiency for oxidized white liquor and the active and effective alkali charge to kraft pulping operations.

Li, Jian (Marietta, GA); Chai, Xin Sheng (Atlanta, GA); Zhu, Junyoung (Marietta, GA)



Nuclear magnetic resonance solution structure of hirudin(1–51) and comparison with corresponding three-dimensional structures determined using the complete 65-residue hirudin polypeptide chain  

Science Journals Connector (OSTI)

The three-dimensional structure of the N-terminal 51-residue domain of recombinant hirudin in aqueous solution was determined by 1H nuclear magnetic resonance (NMR) spectroscopy, and the resulting high-quality solution structure was compared with corresponding structures obtained from studies with the intact, 65-residue polypeptide chain of hirudin. On the basis of 580 distance constraints derived from nuclear Overhauser effects and 109 dihedral angle constraints, a group of 20 conformers representing the solution structure of hirudin(1–51) was computed with the program DIANA and energyminimized with a modified version of the program AMBER. Residues 3 to 30 and 37 to 48 form a well-defined molecular core with two antiparallel ?-sheets composed of residues 14 to 16 and 20 to 22, and 27 to 31 and 36 to 40, and three reverse turns at residues 8 to 11 (type II), 17 to 20 (type II?) and 23 to 26 (type II). The average root-mean-square deviation of the individual NMR conformers relative to their mean co-ordinates is 0.38 Å for the backbone atoms and 0.77 Å for all heavy atoms of these residues. Increased structural disorder was found for the N-terminal dipeptide segment, the loop at residues 31 to 36, and the C-terminal tripeptide segment. The solution structure of hirudin(1–51) has the same molecular architecture as the corresponding polypeptide segment in natural hirudin and recombinant desulfatohirudin. It is also closely similar to the crystal structure of the N-terminal 51-residue segment of hirudin in a hirudin-thrombin complex, with root-mean-square deviations of the crystal structure relative to the mean solution structure of 0.61 Å for the backbone atoms and 0.91 Å for all heavy atoms of residues 3 to 30 and 37 to 48. Further coincidence is found for the loop formed by residues 31 to 36, which shows increased structural disorder in all available solution structures of hirudin, and of which residues 32 to 35 are not observable in the electron density map of the thrombin complex. Significant local structural differences between hirudin(1–51) in solution and hirudin in the crystalline thrombin complex were identified mainly for the N-terminal tripeptide segment and residues 17 to 21. These are further analyzed in an accompanying paper.

T. Szyperski; P. Güntert; S.R. Stone; K. Wüthrich



Determination of barreling curve in upsetting process by artificial neural networks  

Science Journals Connector (OSTI)

In this paper, an approach for prediction deformation of upsetting processes is developed. The approach combines the finite element method and Neural Network to view the resultant deformation changes in upsetting. Because real time deformation simulation ... Keywords: FEM, barreling, neural network(NN), prediction, train, upsetting

H. Mohammadi Majd; M. Poursina; K. H. Shirazi



Model independent determination of the light-cone wave functions for exclusive processes  

E-Print Network (OSTI)

We present a method to compute, by numerical simulations of lattice QCD, the light-cone wave functions which enter exclusive processes at large momentum transfer, such as electromagnetic elastic scatterings, or exclusive semi-leptonic decays as B -> pi (B -> rho) and radiative decays as B -> K* gamma. The method is based on first principles and does not require any model assumption.

Aglietti, U; Corbò, G; Franco, E; Martinelli, G; Silvestrini, L



Thermal processes in the systems with Li-battery cathode materials and LiPF6 -based organic solutions  

Science Journals Connector (OSTI)

Thermodynamic instability of positive electrodes (cathodes) in Li-ion batteries in humid air and battery solutions results in capacity fading and batteries degradation, especially at elevated temperatures. In thi...

Ortal Haik; Francis Susai Amalraj…



Infrared and visible laser double resonance studies of vibrational energy transfer processes in polyatomic molecules. [Chromyl chloride solutions  

SciTech Connect

A study of the spectroscopy of chromyl chloride (CrO{sub 2}Cl{sub 2} ) in dilute solutions has been initiated. A discussion is given of its spectra and emission bands. 17 refs, 5 figs, 1 tab. (DLC)

Bhatnagar, R. (Texas Southern Univ., Houston, TX (United States). Dept. of Chemistry)


Note: This page contains sample records for the topic "determination solution processable" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Determination of Thermal Contact Conductance of Metal Tabs for Battery Ultrasonic Welding Process  

SciTech Connect

A new experimental apparatus and data analysis algorithm were used to determine the thermal contact conductance between 0.2-mm-thick pure aluminum battery tabs as a function of contact pressure from 3.6 to 14.4 MPa. Specimens were sandwiched between one optically transparent and one infrared (IR) transparent glass windows, and heated up from one side by an intense short pulse of flash light. The temperature transient on the other side was measured by an IR camera. In order to determine the thermal contact conductance, two experiment configurations having different number of Al specimen layers were used. Numerical heat conduction simulations showed that the thermal contact conductance strongly depended on the ratio of the maximum temperature rise between the two configurations. Moreover, this ratio was not sensitive to the uncertainties of other thermal properties. Through the simulation results, a simple correlation between the gap conductance and the ratio was established. Therefore, once the ratio of the temperature rise between two configurations was experimentally measured, the thermal contact conductance could be readily determined from the correlation. The new method was fast and robust. Most importantly, the data analysis algorithm improved the measurement accuracy by considerably reducing the uncertainties associated with the thermophysical properties of materials and measurement system.

Chen, Jian [ORNL] [ORNL; Zhang, Wei [ORNL] [ORNL; Yu, Zhenzhen [ORNL] [ORNL; Feng, Zhili [ORNL] [ORNL



Novel Regenerated Solvent Extraction Processes for the Recovery of Carboxylic Acids or Ammonia from Aqueous Solutions Part II. Recovery of Ammonia from Sour Waters  

SciTech Connect

Two novel regenerated solvent extraction processes are examined. The first process has the potential to reduce the energy costs inherent in the recovery of low-volatility carboxylic acids from dilute aqueous solutions. The second process has the potential for reducing the energy costs required for separate recovery of ammonia and acid gases (e.g. CO{sub 2} and H{sub 2}S) from industrial sour waters. The recovery of carboxylic acids from dilute aqueous solution can be achieved by extraction with tertiary amines. An approach for regeneration and product recovery from such extracts is to back-extract the carboxylic acid with a water-soluble, volatile tertiary amine, such as trimethylamine. The resulting trimethylammonium carboxylate solution can be concentrated and thermally decomposed, yielding the product acid and the volatile amine for recycle. Experimental work was performed with lactic acid, SUCCiOlC acid, and fumaric acid. Equilibrium data show near-stoichiometric recovery of the carboxylic acids from an organic solution of Alamine 336 into aqueous solutions of trimethylamine. For fumaric and succinic acids, partial evaporation of the aqueous back extract decomposes the carboxylate and yields the acid product in crystalline form. The decomposition of aqueous solutions of trimethylammonium lactates was not carried out to completion, due to the high water solubility of lactic acid and the tendency of the acid to self-associate. The separate recovery of ammonia and acid gases from sour waters can be achieved by combining steam-stripping of the acid gases with simultaneous removal of ammonia by extraction with a liquid cation exchanger. The use of di-2,4,4-trimethylpentyl phosphinic acid as the liquid cation exchanger is explored in this work. Batch extraction experiments were carried out to measure the equilibrium distribution ratio of ammonia between an aqueous buffer solution and an organic solution of the phosphinic acid (0.2N) in Norpar 12. The concentration-based distribution ratios increase from 0.11 to 0.46 as the aqueous phase pH increases from 7.18 to 8.15. Regeneration of the organic extractant solution was carried out by stripping at elevated temperatures to remove the ammonia, with 99% recovery of the ammonia being obtained at 125 C.

Poole, L.J.; King, C.J.



Mission-Critical Platform for Online Transaction Processing (OLTP) SQL Server 2008 Mission-Critical Platform for OLTP Data Solutions  

E-Print Network (OSTI)

Mission-Critical Platform for Online Transaction Processing (OLTP) SQL Server 2008 Mission Data Collector to troubleshoot and tune SQL Server 2008 instances. Help ensure compliance 2008 high- performance query processing engine for industry leading performance and scalability. Define

Bernstein, Phil


Understanding how processing additives tune nanoscale morphology of high efficiency organic photovoltaic blends: From casting solution to spun-cast thin film  

SciTech Connect

Adding a small amount of a processing additive to the casting solution of organic blends has been demonstrated to be an effective method for achieving improved power conversion efficiency (PCE) in organic photovoltaics (OPVs). However, an understanding of the nano-structural evolution occurring in the transformation from casting solution to thin photoactive films is still lacking. In this report, we investigate the effects of the processing additive diiodooctane (DIO) on the morphology of OPV blend of PBDTTT-C-T and fullerene derivative, PC71BM in a casting solution and in spun-cast thin films by using neutron/x-ray scattering, neutron reflectometry and other characterization techniques. The results reveal that DIO has no effect on the solution structures of PBDTTT-C-T and PC71BM. In the spun-cast films, however, DIO is found to promote significantly the molecular ordering of PBDTTT-C-T and PC71BM, and phase segregation, resulting in the improved PCE. Thermodynamic analysis based on Flory-Huggins theory provides a rationale for the effects of DIO on different characteristics of phase segregation as a solvent and due to evaporationg during the film formation. Such information may enable improved rational design of ternary blends to more consistently achieve improved PCE for OPVs.

Shao, Ming [ORNL; Keum, Jong Kahk [ORNL; Kumar, Rajeev [ORNL; Chen, Jihua [ORNL; Browning, Jim [ORNL; Chen, Wei [Argonne National Laboratory (ANL); Jianhui, Hou [Chinese Academy of Sciences (CAS), Institute of Chemistry; Do, Changwoo [ORNL; Littrell, Ken [ORNL; Sanjib, Das [University of Tennessee, Knoxville (UTK); Rondinone, Adam Justin [ORNL; Geohegan, David B [ORNL; Sumpter, Bobby G [ORNL; Xiao, Kai [ORNL



Combined Theoretical and Experimental Analysis of Processes Determining Cathode Performance in Solid Oxide Fuel Cells  

SciTech Connect

Solid oxide fuel cells (SOFC) are under intensive investigation since the 1980’s as these devices open the way for ecologically clean direct conversion of the chemical energy into electricity, avoiding the efficiency limitation by Carnot’s cycle for thermochemical conversion. However, the practical development of SOFC faces a number of unresolved fundamental problems, in particular concerning the kinetics of the electrode reactions, especially oxygen reduction reaction. We review recent experimental and theoretical achievements in the current understanding of the cathode performance by exploring and comparing mostly three materials: (La,Sr)MnO3 (LSM), (La,Sr)(Co,Fe)O3 (LSCF) and (Ba,Sr)(Co,Fe)O3 (BSCF). Special attention is paid to a critical evaluation of advantages and disadvantages of BSCF, which shows the best cathode kinetics known so far for oxides. We demonstrate that it is the combined experimental and theoretical analysis of all major elementary steps of the oxygen reduction reaction which allows us to predict the rate determining steps for a given material under specific operational conditions and thus control and improve SOFC performance.

Kukla, Maija M.; Kotomin, Eugene Alexej; Merkle, R.; Mastrikov, Yuri; Maier, J.



Adsorption of small organic solutes from beet distillery condensates on reverse-osmosis membranes: consequences on the process performances  

E-Print Network (OSTI)

1 Adsorption of small organic solutes from beet distillery condensates on reverse-osmosis membranes 93 50 95. Fax: +33 (0)1 69 93 50 44. E-mail: claire.fargues@agroparistech.fr Abstract Reverse osmosis of Membrane Science 446 (2013) 132-144" DOI : 10.1016/j.memsci.2013.05.051 #12;2 Keywords: reverse osmosis

Boyer, Edmond


Slurry Nebulization-Inductively Coupled Plasma Mass Spectrometry with Solution Calibration for Determination of Ultratrace Boron in High Pure Nuclear Graphite Powder  

Science Journals Connector (OSTI)

Slurry nebulization-inductively coupled plasma mass spectrometry (ICP-MS) was developed for the direct determination of trace boron (B) in high-purity graphite powders. After the graphite powders were ground and sifted, the particle size of graphite was collected less than 5 ?m. Polyvinylpyrrolidone (PVP) was used as the dispersant in slurry preparation. The optimal mass ratio of PVP to the graphite was found to be 0.5. Well-proportioned and stable slurry solution was obtained by magnetic stirrer. 0.1 M NH4OH as the aqueous medium could provide the optimal pH of 10 for the stable slurry and eliminate the memory effect of B. ICP-MS was operated in a higher resolution mode (0.6 amu) to eliminate the interference with the matrix 12C by peak tailing. Oxygen was added into the plasma at a flow rate of 60 mL min?1 to resolve carbon deposition on the sampler and skimmer cones and accelerate particle dissociation in the plasma. External calibration with aqueous solution standards was established for quantification. Beryllium was chosen as the internal standard to evaluate the efficiency of matrix effect correction. A correlation coefficient of 0.9995 was obtained for B concentration ranging 2–200 ?g L?1. The detection limit (3S) of B was 0.095 ?g g?1. As a practical application, the proposed method was used for the determination of trace B in four nuclear graphite samples (claimed 99.999% purity), with the satisfactory recoveries for the spike tests in the range of 97.2%–103.1%.

Xin-Li LIU; Tai-Cheng DUAN; Yi HAN; Xiao-Yu JIA; Wei-Na ZHANG; Hang-Ting CHEN



Determination of the Dynamic Characteristics in the CO Transient Process in a PEM Fuel Cell Woo-kum Lee and J. W. Van Zee  

E-Print Network (OSTI)

Determination of the Dynamic Characteristics in the CO Transient Process in a PEM Fuel Cell Woo Road, Elkton, MD 21922-1488 Key words: PEM Fuel Cell, CO transient, Time constant Prepared publications #12;1 Determination of the Dynamic Characteristics in the CO Transient Process in a PEM Fuel Cell

Van Zee, John W.


Determination of the structure of oxidised Desulfovibrio africanus ferredoxin I by 1H NMR spectroscopy and comparison of its solution structure with its crystal structure  

Science Journals Connector (OSTI)

The solution structure of the 64 amino acid Fe4S4ferredoxin I fromDesulfovibrio africanus has been determined using two-dimensional 1H NMR spectroscopy. Sequence-specific assignments were obtained for 59 amino acid residues and the structure determined with the program DIANA on the basis of 549 nuclear Overhauser enhancement (NOE) upper distance limits, and four dihedral angle and 52 distance constraints for the Fe4S4cluster. The NMR structure was refined using the simulated annealing and energy minimisation protocols of the program X-PLOR to yield a final family of 19 structures selected on the basis of good covalent geometry and minimal restraint violations. The r.m.s.d. values to the average structure for this family are 0.49(±0.07) Å and 0.94(±0.09) Å for the backbone and heavy-atoms of residues 3 to 62, respectively. The NMR structure has been compared to the previously reported X-ray structures for the two molecules within the asymmetric unit of the crystal, which have a network of seven hydrogen bonds between them. This intermolecular interface, involving residues 38, 40 to 43 and 46, has the same conformation in the solution structures showing that the crystal packing does not perturb the structure. There are three regions in which the NMR and X-ray structures differ: around the cluster, a turn involving residues 8 to 10, and a loop involving residues 29 to 32. In the family of solution structures the backbone of the loop region incorporating residues 29 to 32 is well-defined whilst in both of the X-ray molecules it is ill-defined. The small differences between the X-ray and NMR structures for the cluster environment and the turn between residues 8 to 10 probably reflects a lack of NMR constraints. The observation of relatively rapid amide NH hydrogen exchange of NH groups close to the cluster, together with rapid flipping for Phe25, which is also close to the cluster, indicates that the cluster environment is more dynamic than the corresponding regions of related Fe/S proteins.

Sharon L. Davy; Michael J. Osborne; Geoffrey R. Moore



Reduced cycle time and work in process in a medical device factory : the problem and a proposed solution  

E-Print Network (OSTI)

Many manufacturing firms have improved their operations by implementing a work-in-process (WIP) limiting control strategy. This project explores the application of this concept to limit WIP and reduce cycle time for the ...

Qian, Yi, M. Eng. Massachusetts Institute of Technology



Determining factors in process of socio-technical adequacy of renewable energy in Andean Communities of Salta, Argentina  

Science Journals Connector (OSTI)

The use of renewable energy presents a great potential to solve energy problems in remote communities. However, in populations of the northwestern of Argentina, there are a large number of abandoned devices. This situation motivated the research on the processes of ‘technology transfer’, in order to make theoretical and methodological contributions to help to improve them. The development of this work was based on the analysis of case studies in the Andean communities of Cabrería, San Juan and Las Capillas (Province of Salta, Argentina) where solar water heaters were ‘transferred’. The main results presented in this paper are the identification, assessment and analysis of factors and sub-factors that conditions the analyzed processes. There were identified the following determining factors: solar technology, community participation, involvement of technicians, inter-institutional coordination, logistics and monitoring of the project, and structure of the community. The analysis of interaction showed a strong interdependence among factors, in this manner; the way in which a factor is applied directly influences the development of other factors. Finally, it should be noted that although the analyzed experiences have much in common, each situation of socio-technical adequacy is particular and therefore it requires the opening-up of researchers and technicians to adapt technologies and methodological approaches of these processes.

K.N. Escalante; S. Belmonte; M.D. Gea



Waste treatment process for removal of contaminants from aqueous, mixed-waste solutions using sequential chemical treatment and crossflow microfiltration, followed by dewatering  

DOE Patents (OSTI)

In processes of this invention aqueous waste solutions containing a variety of mixed waste contaminants are treated to remove the contaminants by a sequential addition of chemicals and adsorption/ion exchange powdered materials to remove the contaminants including lead, cadmium, uranium, cesium-137, strontium-85/90, trichloroethylene and benzene, and impurities including iron and calcium. Staged conditioning of the waste solution produces a polydisperse system of size enlarged complexes of the contaminants in three distinct configurations: water-soluble metal complexes, insoluble metal precipitation complexes, and contaminant-bearing particles of ion exchange and adsorbent materials. The volume of the waste is reduced by separation of the polydisperse system by cross-flow microfiltration, followed by low-temperature evaporation and/or filter pressing. The water produced as filtrate is discharged if it meets a specified target water quality, or else the filtrate is recycled until the target is achieved. 1 fig.

Vijayan, S.; Wong, C.F.; Buckley, L.P.



Waste treatment process for removal of contaminants from aqueous, mixed-waste solutions using sequential chemical treatment and crossflow microfiltration, followed by dewatering  

DOE Patents (OSTI)

In processes of this invention aqueous waste solutions containing a variety of mixed waste contaminants are treated to remove the contaminants by a sequential addition of chemicals and adsorption/ion exchange powdered materials to remove the contaminants including lead, cadmium, uranium, cesium-137, strontium-85/90, trichloroethylene and benzene, and impurities including iron and calcium. Staged conditioning of the waste solution produces a polydisperse system of size enlarged complexes of the contaminants in three distinct configurations: water-soluble metal complexes, insoluble metal precipitation complexes, and contaminant-bearing particles of ion exchange and adsorbent materials. The volume of the waste is reduced by separation of the polydisperse system by cross-flow microfiltration, followed by low-temperature evaporation and/or filter pressing. The water produced as filtrate is discharged if it meets a specified target water quality, or else the filtrate is recycled until the target is achieved.

Vijayan, Sivaraman (Deep River, CA); Wong, Chi F. (Pembroke, CA); Buckley, Leo P. (Deep River, CA)



Modeling of hydrologic conditions and solute movement in processed oil shale waste embankments under simulated climatic conditions  

SciTech Connect

The scope of the research program and the continuation is to study interacting hydrologic, geotechnical, and chemical factors affecting the behavior and disposal of combusted processed oil shale. The research combines bench-scale testing with large scale research sufficient to describe commercial scale embankment behavior. The large scale approach was accomplished by establishing five lysimeters, each 7.3 [times] 3.0 [times] 3.0 m deep, filled with processed oil shale that has been retorted and combusted by the Lurgi-Ruhrgas (Lurgi) process. Approximately 400 tons of Lurgi processed oil shale waste was provided by Rio Blanco Oil Shale Co., Inc. (RBOSC) through a separate cooperative agreement with the University of Wyoming (UW) to carry out this study. Three of the lysimeters were established at the RBOSC Tract C-a in the Piceance Basin of Colorado. Two lysimeters were established in the Environmental Simulation Laboratory (ESL) at UW. The ESL was specifically designed and constructed so that a large range of climatic conditions could be physically applied to the processed oil shale which was filled in the lysimeter cells.

Turner, J.P.; Hasfurther, V.



Solution structure of a fragment of the dimerization domain of DP-1 determined by 1H-nuclear magnetic resonance and distance geometry  

Science Journals Connector (OSTI)

The structure of a synthesized peptide with the sequence of NHILPNESAYDQKNIRRRVYDALNVLMAMNIISK that corresponds to residues 151–184 of transcription factor DP-1 (Girling et al., Nature 362 (1993) 83–87) was determined by 1H-nuclear magnetic resonance in water and 40% d3-trifluoroethanol/water, respectively. Nuclear Overhauser effect cross peaks, ?H chemical shifts and J-coupling constants of ?H–NH show that the peptide consists a helix from Ser-8 to Ser-33 in solution. Fifty structures were constructed with 288 upper distance limits and 21 angle constraints by DIANA (Guntert et al., J. Mol. Biol. 217 (1991) 517–530). Although the N-terminal of the peptide exhibits a random conformation, the 20 best structures show a root mean square deviation of 0.89±0.36 Å for backbone atoms and 1.80±0.34 Å for heavy atoms from residue Ser-8 to Ser-33. This result supports the proposal that DP-1 and E2F-1 may dimerize with a coiled-coil type interaction.

Shouhong Guang; Jihui Wu; Tianning Yu; Youlin Xia; Yunyu Shi



CdS and CdS/CdSe sensitized ZnO nanorod array solar cells prepared by a solution ions exchange process  

SciTech Connect

Graphical abstract: - Highlights: • CdS and CdS/CdSe quantum dots are assembled on ZnO nanorods by ion exchange process. • The CdS/CdSe sensitization of ZnO effectively extends the absorption spectrum. • The performance of ZnO/CdS/CdSe cell is improved by extending absorption spectrum. - Abstract: In this paper, cadmium sulfide (CdS) and cadmium sulfide/cadmium selenide (CdS/CdSe) quantum dots (QDs) are assembled onto ZnO nanorod arrays by a solution ion exchange process for QD-sensitized solar cell application. The morphology, composition and absorption properties of different photoanodes were characterized with scanning electron microscope, transmission electron microscope, energy-dispersive X-ray spectrum and Raman spectrum in detail. It is shown that conformal and uniform CdS and CdS/CdSe shells can grow on ZnO nanorod cores. Quantum dot sensitized solar cells based on ZnO/CdS and ZnO/CdS/CdSe nanocable arrays were assembled with gold counter electrode and polysulfide electrolyte solution. The CdS/CdSe sensitization of ZnO can effectively extend the absorption spectrum up to 650 nm, which has a remarkable impact on the performance of a photovoltaic device by extending the absorption spectrum. Preliminary results show one fourth improvement in solar cell efficiency.

Chen, Ling; Gong, Haibo; Zheng, Xiaopeng; Zhu, Min; Zhang, Jun [Key Laboratory of Inorganic Functional Materials in Universities of Shandong, School of Materials Science and Engineering, University of Jinan, Jinan 250022, Shandong (China); Yang, Shikuan [Department of Engineering Science and Mechanics, The Pennsylvania State University, University Park, PA 16802-6812 (United States); Cao, Bingqiang, E-mail: mse_caobq@ujn.edu.cn [Key Laboratory of Inorganic Functional Materials in Universities of Shandong, School of Materials Science and Engineering, University of Jinan, Jinan 250022, Shandong (China)




SciTech Connect

Boehmite (e.g., aluminum oxyhydroxide) is a major non-radioactive component in Hanford and Savannah River nuclear tank waste sludge. Boehmite dissolution from sludge using caustic at elevated temperatures is being planned at Hanford to minimize the mass of material disposed of as high-level waste (HLW) during operation of the Waste Treatment Plant (WTP). To more thoroughly understand the chemistry of this dissolution process, we have developed an empirical kinetic model for aluminate production due to boehmite dissolution. Application of this model to Hanford tank wastes would allow predictability and optimization of the caustic leaching of aluminum solids, potentially yielding significant improvements to overall processing time, disposal cost, and schedule. This report presents an empirical kinetic model that can be used to estimate the aluminate production from the leaching of boehmite in Hanford waste as a function of the following parameters: (1) hydroxide concentration; (2) temperature; (3) specific surface area of boehmite; (4) initial soluble aluminate plus gibbsite present in waste; (5) concentration of boehmite in the waste; and (6) (pre-fit) Arrhenius kinetic parameters. The model was fit to laboratory, non-radioactive (e.g. 'simulant boehmite') leaching results, providing best-fit values of the Arrhenius A-factor, A, and apparent activation energy, E{sub A}, of A = 5.0 x 10{sup 12} hour{sup -1} and E{sub A} = 90 kJ/mole. These parameters were then used to predict boehmite leaching behavior observed in previously reported actual waste leaching studies. Acceptable aluminate versus leaching time profiles were predicted for waste leaching data from both Hanford and Savannah River site studies.




The Effect of Solution Processing on the Power Conversion Efficiency of P3HT-based Organic Solar Cells  

Science Journals Connector (OSTI)

Abstract Chloroform, Chlorobenzene, 1, 2-Dichlorobenze and co-solvent Chlorobenzene with Chloroform (1:1) were used to investigate the influence of the solvent on the morphology of P3HT:PCBM (with the ratio 1:1) as well as the photovoltaic properties of organic solar cells based on this polymer blend. Using co-solvents leads to higher absorption intensity as compared to other studied solvents. XRD measurements reveal improved crystallinity in P3HT films prepared by chloroform and chlorobenzene while large aggregates appeared in films prepared using dichlorobenzene. Films produced using co-solvents show well-ordered structure and improved crystallinity; these results were further confirmed by SEM images. The J(V) measurements show that a maximum PCE of 1.47% is obtained in films produced using co-solvents. This was associated with significant improvement in current density (11.77 mA/cm2) and a fill factor of 0.4 which was determined from the series and shunt resistances. Open circuit voltage has decreased in film prepared by co-solvents (0.31 Volt), and improved significantly (0.54 Volt) in film prepared in chloroform.

Burak Y. Kadem; Mohammed K. Al-hashimi; A.K. Hassan



Conservation of Mass 25 on the flow rates? b) Determine the amounts of the solutes in each of the tanks as  

E-Print Network (OSTI)

of the tanks as functions of time. (b) What happens to the concentrations of the solutes in each tank in the long run? Exercise 4.4. Imagine three tanks each containing three different substances in solution. The tanks are connected by equal sized pipes to form a closed loop; that is, tank-1 feeds tank-2 and is fed

Chicone, Carmen


The electroreduction of CO/sub 2/ in aqueous solutions. reaction orders, and the role of adsorption in the electroreduction process  

SciTech Connect

It was shown that depending on the electrode metal and potential, values between 0.6 and 1 are found for the reaction order of CO/sub 2/ electroreduction from the dependence of the reduction current on CO/sub 2/ partial pressure (between 1 kPa and 2.5 MPa). The effects of base-electrolyte type and concentration indicate that the slow step of the process involves radical-anions CO/sub 2/ in the first Tafel section and an uncharged species in the second Tafel section. The rates of oxidation and reduction of the radical-anions CO/sub 2/ are reduced when tetrabutylammonium ions are added to the solution.

Maiorova, N.A.; Khazova, O.A.; Mikhailova, A.A.; Vasil'ev, Y.B.


Note: This page contains sample records for the topic "determination solution processable" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


CX-001036: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

6: Categorical Exclusion Determination 6: Categorical Exclusion Determination CX-001036: Categorical Exclusion Determination Solution Processable Transparent Conductive Hole Injection Electrode for Organic Light Emitting Diode (OLED) Solid State Lighting (Pennsylvania) CX(s) Applied: B3.6 Date: 03/02/2010 Location(s): Pittsburgh, Pennsylvania Office(s): Energy Efficiency and Renewable Energy, National Energy Technology Laboratory The objective of this project is to develop a solution processable transparent conducting hole injection (TCHI) electrode. American Recovery and Reinvestment Act Funding: DE-FOA-0000082. DOCUMENT(S) AVAILABLE FOR DOWNLOAD CX-001036.pdf More Documents & Publications CX-002810: Categorical Exclusion Determination CX-002813: Categorical Exclusion Determination CX-001331


Strategic policy and process: An assessment of the evolution of American nuclear strategy, its determinants, and its implications  

SciTech Connect

This dissertation examines the evolution of American strategic nuclear policy with particular emphasis on the substantial change in nuclear doctrine which occurred during the first and second Administrations of President Richard M. Nixon. The dissertation argues that this period saw the emergence of a new and substantially different strategic nuclear policy which changed fundamentally the basis upon which America's nuclear deterrence rested. It argues, further, that this policy has remained largely unchanged through the course of five succeeding administrations. The dissertation describes and analyzes the evolution of the defense policy formulation process of the United States government from the years of the Truman Administration to the Bush Administration. Primary attention is directed towards identifying the specific policies of each Administration highlighting the factors which appear to have been the most significant in prompting changes in American strategic nuclear policy. An in-depth examination of strategic nuclear policy formulation and implementation is provided for the period of the Nixon Administration. The Administration's policies are analyzed and the full constellation of forces that brought about a major adjustment in the strategic nuclear policy of the Unites States are identified and analyzed. Particular emphasis is placed on tracking and assessing the role that Congress has played in the development of nuclear policy before, during, and after Nixon years. Specific attention is directed to defining the [open quotes]determinants[close quotes] of strategic nuclear policy and to a careful delineation of the dangers associated with a divergence between public policy pronouncements an the actual employment or targeting practices governing the potential use of nuclear weapons. A final section draws conclusions and postulates several basic guidelines for the formulation of future US strategic nuclear policy.

Lehman, C.M.




E-Print Network (OSTI)

layers for organic diodes and solar cells, and contacts tosensitized solar cells, as well as organic and inorganicorganic semiconductors in both diode (OLED and solar cell)[

Bakhishev, Teymur



Solution-Processed Organic Photovoltaics  

Science Journals Connector (OSTI)

The technology of organic solar cells has matured to an extent that commercialization of first products has already started. However, with the first products pushing into the market, the research community realiz...

Claudia N. Hoth; Pavel Schilinsky…



Macdonald processes  

E-Print Network (OSTI)

Macdonald processes are probability measures on sequences of partitions defined in terms of nonnegative specializations of the Macdonald symmetric functions and two Macdonald parameters q,t in [0,1). We prove several results about these processes, which include the following. (1) We explicitly evaluate expectations of a rich family of observables for these processes. (2) In the case t=0, we find a Fredholm determinant formula for a q-Laplace transform of the distribution of the last part of the Macdonald-random partition. (3) We introduce Markov dynamics that preserve the class of Macdonald processes and lead to new "integrable" 2d and 1d interacting particle systems. (4) In a large time limit transition, and as q goes to 1, the particles of these systems crystallize on a lattice, and fluctuations around the lattice converge to O'Connell's Whittaker process that describe semi-discrete Brownian directed polymers. (5) This yields a Fredholm determinant for the Laplace transform of the polymer partition function, and taking its asymptotics we prove KPZ universality for the polymer (free energy fluctuation exponent 1/3 and Tracy-Widom GUE limit law). (6) Under intermediate disorder scaling, we recover the Laplace transform of the solution of the KPZ equation with narrow wedge initial data. (7) We provide contour integral formulas for a wide array of polymer moments. (8) This results in a new ansatz for solving quantum many body systems such as the delta Bose gas.

Alexei Borodin; Ivan Corwin



A Flow-Through High-Pressure Electrical Conductance Cell for Determining of Ion Association of Aqueous Electrolyte Solutions at High Temperature and Pressure  

SciTech Connect

A flow-through high-pressure electrical conductance cell was designed and constructed to measure limiting molar conductances and ion association constants of dilute aqueous solutions with high precision at high temperatures and pressures. The basic concept of the cell employs the principle developed at the University of Delaware in 1995, but overall targets higher temperatures (to 600 C) and pressures (to 300 MPa). At present the cell has been tested by measuring aqueous NaCl and LiOH solutions (10{sup {minus}3} to 10{sup {minus}5} mol.kg{sup {minus}1}) to 405 C and 33 MPa with good results.

Bianchi, H.; Ho, P.C.; Palmer, D.A.; Wood, R.H.



Advising is an ongoing process in which the student, in consultation with the department academic advisor, determines and creates the best-fit educational path toward graduation. This  

E-Print Network (OSTI)

advisor, determines and creates the best-fit educational path toward graduation. This process enables and abilities. The advisor acts as an advocate for the student in the university system, serves as a resource setting. Each semester the advisor monitors the student's academic progress and provides information

Gelfond, Michael


Comparative study on triphenylamine-based bi-armed and four-armed small molecule donors for solution processed organic solar cells  

Science Journals Connector (OSTI)

Abstract A novel four-armed triphenylamine (TPA)-based molecule named (TPATh)4TPA2B with 4,7-bis(4-diphenylaminophenyl)-2,1,3-benzothiadiazole unit as the central building block and triphenylamine-3-dodecylthiophene unit as the arms and a bi-armed TPA-based molecule named (TPATh)2(MTPA)2B with the same central building block and arms as those of (TPATh)4TPA2B were designed and synthesized by Pd-catalyzed Stille reaction. The thermal stability, photophysical and electrochemical properties of these small molecules are studied. Moreover, they are evaluated in solution processed bulk-heterojunction organic solar cells (OSCs). The device performances of the \\{OSCs\\} based on these small molecule donors and [6,6]-phenyl-C71-butyric acid methyl ester (PC71BM) were studied. With the same core, the four-armed molecule has the higher absorption and better miscibility with PC71BM than that of bi-armed molecule, while the bi-armed molecule (TPATh)2(MTPA)2B has the higher hole mobility. The power conversion efficiency of the \\{OSCs\\} based on (TPATh)4TPA2B as donor and PC71BM as acceptor is 1.3% with open-circuit voltage 0.71 V.

Hongyu Zhen; Zuosheng Peng; Lintao Hou; Tao Jia; Qi Li; Qiong Hou



Excess heat capacity of the (Li1?xCax)F1+x liquid solution determined by differential scanning calorimetry and drop calorimetry  

Science Journals Connector (OSTI)

Abstract The work presents the measured heat capacity of the (Li1?xCax)F1+x liquid solution. Four samples with different compositions have been prepared and measured using a Differential Scanning Calorimeter. Since this technique was newly adopted for measuring encapsulated fluoride samples, some modifications were introduced in the standard configuration of the instrument and they are described in this work as well. For comparison one of the analysed composition ( x CaF 2 = 0.5) was also measured using drop calorimetry, which has been previously used for similar studies. The reliability of the results obtained was confirmed by the good agreement between the two techniques. Moreover, the excess heat capacity of the (Li1?xCax)F1+x liquid solution was derived and a strong deviation from the ideal behaviour was observed.

E. Capelli; O. Beneš; R.J.M. Konings



Accelerating Solutions  

NLE Websites -- All DOE Office Websites (Extended Search)

Solutions From vehicles on the road to the energy that powers them, Oak Ridge National Laboratory innovations are advancing American transportation. Oak Ridge National Laboratory is making an impact on everyday America by enhancing transportation choices and quality of life. Through strong collaborative partnerships with industry, ORNL research and development efforts are helping accelerate the deployment of a new generation of energy efficient vehicles powered by domestic, renewable, clean energy. EPA ultra-low sulfur diesel fuel rule ORNL and the National Renewable Energy Laboratory co-led a comprehensive research and test program to determine the effects of diesel fuel sulfur on emissions and emission control (catalyst) technology. In the course of this program, involving


Separate determination of PM10 emission factors of road traffic for tailpipe emissions and emissions from abrasion and resuspension processes  

Science Journals Connector (OSTI)

Little is known about the relevance of mechanically produced particles of road traffic from abrasion and resuspension processes in relation to the exhaust pipe particles. In this paper, emission factors of PM10 and PM1 for light and heavy-duty vehicles were derived for different representative traffic regimes from concentration differences of particles and nitrogen oxides (NOx) in ambient air upwind and downwind of busy roads, or alternatively of kerbsides and nearby background sites. Hereby, PM1 was interpreted as direct exhaust emissions and PM10-PM1 as mechanically produced emissions from abrasion and resuspension processes. The results show that abrasion and resuspension processes represent a significant part of the total primary PM10 emissions of road traffic. At sites with relatively undisturbed traffic flow they are in the same range as the exhaust pipe emissions. At sites with disturbed traffic flow due to traffic lights, emissions from abrasion/resuspension are even higher than those from the exhaust pipes.

Robert Gehrig; Matz Hill; Brigitte Buchmann; David Imhof; Ernest Weingartner; Urs Baltensperger



Advances in solar photovoltaics are urgently needed to increase the performance and reduce the cost of harvesting solar power. Solution-processed photovoltaics are cost-effective to manufacture and offer the potential for physical flexibility.  

E-Print Network (OSTI)

, Toronto, M5S 3G4, Canada. O ne hundred and twenty thousand terawatts of solar power irradiate EarthAdvances in solar photovoltaics are urgently needed to increase the performance and reduce the cost of harvesting solar power. Solution-processed photovoltaics are cost-effective to manufacture and offer


Final Closeout report for grant FG36-08GO18018, titled: Functional Multi-Layer Solution Processable Polymer Solar Cells  

SciTech Connect

The original objectives were: (1) Develop a method to deposit multiple conjugated polymer film layers and avoid the problem of dissolution from mutually solubility; (2) Use this deposition method to develop multi-layer polymer based solar cells with layers that are function specific; (3) characterize these layers and devices; (4) develop electrical and optical models that describe and predict the properties of the multi-layers; and (5) Ultimate efficiency goals are {approx}6.75% with J{sub sc} = 12 mA/cm{sup 2}, FF = 0.75, and V{sub oc} = 0.75. The question of whether photovoltaic (PV) cells will ever be able to replace fossil fuels as the main provider of electrical power is not just a question of device efficiency; it is a question of how much power can be provided for what price. It has been well documented that PV devices at 10% power efficiency can provide for all of the world's power needs without covering too much of the earth's surface. Assuming desert like cloud coverage, an area equivalent to the land area of Texas would have to be covered. However, it has also been shown that using the current state-of-the-art silicon devices, the price-per-Watt will never be low enough to be economically feasible for large-scale development. Solution-processable PV devices based on polymers are a very attractive alternative to traditional Silicon PV because this technology is much lower in materials cost and in environmentally toxic waste production. Solution-based polymers can be rapidly deposited using printing technologies and are compatible with light-weight flexible substrates that can increase the range of available PV applications. In the past ten years, the efficiency of polymer based PV devices has increased from {approx}1% to over 10%. The highest efficiency organic solar cells are based upon a single layer than consists of a mixture of donor and acceptor moieties. This one layer has multiple optical and electrical functions, so the design of a single heterojunction layer is based upon the idea of balancing good and bad properties within a single film. This proposal addresses the idea that the use of multiple layers that have differing electrical and optical functions could lead to greater efficiency because fewer materials compromises must be made. This idea is not new, multiple functional layer have been successfully used in cross-linked OLED's and organic small molecule evaporated PV devices. The main reason that multiple layers of polymers are not commonly deposited is that most conjugated polymers are mutually soluble in the same solvents. The work outlined in the proposal was intended to develop a new deposition strategy that would allow multiple organic layers to be deposited from solution using spin coating. The deposition method that we proposed was successful, sometimes, but ultimately not reliable. Instead we focused on more reliable methods to implement doping along the interface between layers. This work has been very successful. We found that using PEDOT:PSS, the PSS would form a surface layer of {approx}2-3 nm thickness that would mix with and electrochemically react with P3HT upon heating. This mechanism is also a crosslinking reaction in that H{sub 2} is released and permanent new bonds are formed. Using the Plextronics Inc. replacement to PEDOT:PSS, for which there are no mobile dopants, we were able to show that a second and different mechanism can be used to p-type dope organic materials. We are currently working with Plextronics to develop a new product. Finally we produced n-type doping of a thin fullerene layer near the cathode also using a self-assembly method. Low work function metals will diffuse into the BHJ layer and dope the fullerene upon heating. This doping also affects the vertical segregation of BHJ materials in a predictable way. We accomplished all of the scientific goals that we set out in the proposal written in May 2007. Some of the methods we proposed were not fully successful, but we did come up with better methods to achieve the same goal. We did not achieve the efficiency g

Adam J. Moule



Unique Hardware and Software Data Acquisition and Processing Solutions in a Small Engine Test Cell for Enhanced Kinetic Engine Modeling Accuracy  

Energy.gov (U.S. Department of Energy (DOE))

Novel use of AVL data acquisition/processing units provides simultaneous real-time acquisition, processing, and storage of low-speed, high-speed, and heat release data.


The use of post detonation analysis of stable isotope ratios to determine the type and production process of the explosive involved  

SciTech Connect

The detonation of a series of explosives was performed in a controlled manner to collect the resulting, solid residue or {open_quotes}soot.{close_quotes} This residue was examined to determine the ratios of the stable carbon, hydrogen, and nitrogen isotopes. The goal of the experiment was to determine if these ratios could be used to indicate, from the post detonation residues, the type and origin of the detonated explosive. The ratios of the stated stable isotopes in the undetonated explosive were also determined. Despite some reservations in the quality of the data resulting from contamination by nonexplosive components, certain trends can be discerned. (1) Carbon isotopes allow aromatic explosives to be distinguished from nonaromatic explosives. This trend seems to carry through the detonation so that the distinction might be made after the fact. (2) The amination process for TATB can be detected through the hydrogen and, to some extent, the nitrogen isotope ratios. Unfortunately, the data are not sufficiently good to determine if this differential carries through the detonation. (3) The relative magnitude and sign of the nitrogen isotope ratio seems to carry through the detonation: some exchange with atmospheric nitrogen is probable. Even though this set of experiments must also be viewed as preliminary, there is a definite indication that certain qualitative characteristics of explosives can be detected after the detonation. This {open_quotes}signature{close_quotes} could have application to both intelligence and counter terrorism.

McGuire, R.R.; Velsko, C.A.; Lee, C.G.; Raber, E.



The Carnoules mine. Generation of As-rich acid mine drainage, natural attenuation processes and solutions for passive in-situ remediation  

E-Print Network (OSTI)

and solutions for passive in-situ remediation F.ELBAZ-POULICHET, UMR Hydrosciences, CNRS-University Montpellier-Zn mine (Department of Gard, France) has produced 1.5 Mt of solid waste containing pyrite and associated oxidation they generate acid (pH3) water containing up to 350mg/l of arsenic, 750 to 2700mg/L of iron

Paris-Sud XI, Université de


Solvent wash solution  

DOE Patents (OSTI)

A process is claimed for removing diluent degradation products from a solvent extraction solution, which has been used to recover uranium and plutonium from spent nuclear fuel. A wash solution and the solvent extraction solution are combined. The wash solution contains (a) water and (b) up to about, and including, 50 vol % of at least one-polar water-miscible organic solvent based on the total volume of the water and the highly-polar organic solvent. The wash solution also preferably contains at least one inorganic salt. The diluent degradation products dissolve in the highly-polar organic solvent and the organic solvent extraction solvent do not dissolve in the highly-polar organic solvent. The highly-polar organic solvent and the extraction solvent are separated.

Neace, J.C.



CX-010141: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

41: Categorical Exclusion Determination 41: Categorical Exclusion Determination CX-010141: Categorical Exclusion Determination Characterization of Process Solutions and Solids CX(s) Applied: B3.6 Date: 03/06/2013 Location(s): South Carolina Offices(s): Savannah River Operations Office K-area Materials Storage and H-Area Completion continue to request flowsheets for processing solids and liquids in H-Canyon and HB-Line facilities. Laboratory operations involved in flowsheet development include characterization, mixing, and neutralization of aqueous process and product solutions, heating of solids at elevated temperatures, and characterization and dissolution of solids in aqueous solutions. Heating, characterization, and dissolution studies will be performed in radhoods and gloveboxes located in C-wing and F-wing laboratories in 773-A. Characterization


Low-Cost Label-Free Electrical Detection of Artificial DNA Nanostructures Using Solution-Processed Oxide Thin-Film Transistors  

Science Journals Connector (OSTI)

As stabilizers, monoethanolamine (MEA) and acetic acid (CH3COOH) were dropped to ameliorate the solubility of the precursors and make a homogeneous IGZO solution, respectively. ... Prepared DNA-covered mica sheet was attached onto the metal puck using instant glue and 5 ?L of DX solution, 30 ?L of 1 × TAE/Mg2+ buffer was dropped onto the mica and 10 ?L of 1 × TAE/Mg2+ buffer was mounted onto the AFM tip (A NP-S oxide-sharpened silicon nitride tip). ... The original influence of water on the back-channel of sol-gel derived amorphous indium-gallium-zinc-oxide thin film transistors was studied in various relative humidity environments. ...

Si Joon Kim; Joohye Jung; Keun Woo Lee; Doo Hyun Yoon; Tae Soo Jung; Sreekantha Reddy Dugasani; Sung Ha Park; Hyun Jae Kim



Categorical Exclusion Determinations: National Energy Technology Laboratory  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

1, 2010 1, 2010 CX-001158: Categorical Exclusion Determination An Evaluation of the Carbon Sequestration Potential of the Cambro-Ordovician Strata of the Illinois and Michigan Basins CX(s) Applied: A9 Date: 03/11/2010 Location(s): Bloomington, Indiana Office(s): Fossil Energy, National Energy Technology Laboratory March 11, 2010 CX-001153: Categorical Exclusion Determination Roll-to-Roll Solution-Processable Small-Molecule Organic Light-Emitting Diodes (Wilmington) Date: 03/11/2010 Location(s): Wilmington, Delaware Office(s): Energy Efficiency and Renewable Energy, National Energy Technology Laboratory March 11, 2010 CX-001152: Categorical Exclusion Determination Roll-to-Roll Solution-Processable Small-Molecule Organic Light-Emitting Diodes (Niskayuna) CX(s) Applied: B3.6

Note: This page contains sample records for the topic "determination solution processable" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Novel Regenerated Solvent Extraction Processes for the Recovery of Carboxylic Acids or Ammonia from Aqueous Solutions Part II. Recovery of Ammonia from Sour Waters  

E-Print Network (OSTI)

of Economic Materials from Oil Shale Retort Water by anDerived from In Situ Oil Shale Processing", Proceedings, 2ndWastewaters Sour Waters from Oil Shale Retorting Sour Waters

Poole, L.J.



Transuranic decontamination of nitric acid solutions by the TRUEX solvent extraction process: preliminary development studies. [Octyl(phenyl)-N,N-diisobutylcarbamoylmethylphosphine oxide  

SciTech Connect

This report summarizes the work that has been performed to date at Argonne National Laboratory on the development of the TRUEX process, a solvent extraction process employing a bifunctional organophosphorous reagent in a PUREX process solvent (tributyl phosphate-normal paraffinic hydrocarbons). The purpose of this extraction process is to separate and concentrate transuranic (TRU) elements from nuclear waste. Assessments were made of the use of two TRUEX solvents: one incorporating the well-studied dihexyl-N,N-diethylcarbamoylmethylphosphonate (DHDECMP) and a second incorporating an extractant with superior properties for a 1M HNO/sub 3/ acid feed, octyl(phenyl)-N,N-diisobutylcarbamoylmethylphosphine oxide (O/sub phi/D(IB)CMPO). In this report, conceptual flowsheets for the removal of soluble TRUs from high-level nuclear wastes using these two TRUEX proces solvents are presented, and flowsheet features are discussed in detail. The conceptual flowsheet for TRU-element removal from a PUREX waste by the O/sub phi/D(IB)CMPO-TRUEX process solvent was tested in a bench-scale countercurrent experiment, and results of that experiment are presented and discussed. The conclusion of this study is that the TRUEX process is able to separate TRUs from high-level wastes so that the major portion of the solid waste (approx. 99%) can be classified as non-TRU. Areas where more experimentation is needed are listed at the end of the report. 45 references, 17 figures, 56 tables.

Vandegrift, G.F.; Leonard, R.A.; Steindler, M.J.; Horwitz, E.P.; Basile, L.J.; Diamond, H.; Kalina, D.G.; Kaplan, L.



The biogenic content of process streams from mechanical–biological treatment plants producing solid recovered fuel. Do the manual sorting and selective dissolution determination methods correlate?  

Science Journals Connector (OSTI)

The carbon emissions trading market has created a need for standard methods for the determination of biogenic content (?B) in solid recovered fuels (SRF). We compare the manual sorting (MSM) and selective dissolution methods (SDM), as amended by recent research, for a range of process streams from a mechanical–biological treatment (MBT) plant. The two methods provide statistically different biogenic content values, as expressed on a dry mass basis, uncorrected for ash content. However, they correlate well (r2 > 0.9) and the relative difference between them was <5% for ?B between 21% w/wd and 72% w/wd (uncorrected for ash content). This range includes the average SRF biogenic content of ca. 68% w/wd. Methodological improvements are discussed in light of recent studies. The repeatability of the SDM is characterised by relative standard deviations on triplicates of <2.5% for the studied population.

Mélanie Séverin; Costas A. Velis; Phil J. Longhurst; Simon J.T. Pollard



State and Local Solution Center: Financing Solutions  

NLE Websites -- All DOE Office Websites (Extended Search)

Technical Assistance Technical Assistance Resources Printable Version Share this resource Send a link to State and Local Solution Center: Financing Solutions to someone by E-mail Share State and Local Solution Center: Financing Solutions on Facebook Tweet about State and Local Solution Center: Financing Solutions on Twitter Bookmark State and Local Solution Center: Financing Solutions on Google Bookmark State and Local Solution Center: Financing Solutions on Delicious Rank State and Local Solution Center: Financing Solutions on Digg Find More places to share State and Local Solution Center: Financing Solutions on AddThis.com... Strategic Energy Planning Energy Policies & Programs Financing Financing Overview Financing Program Market Segments Energy Data Management Energy Technologies


A DMF-assisted solution process boosts the efficiency in P3HT:PCBM solar cells up to 5.31%  

Science Journals Connector (OSTI)

To achieve ideal phase separation in P3HT:PCBM (1:1, w/w) blend films, a selective second solvent, DMF, which cannot dissolve P3HT but slightly dissolves PCBM, was added into 1,2-dichlorobenzene. Addition of 10% DMF led to better charge transport, better morphology and average power conversion efficiency (PCE) enhancement from 3.75% to 4.29%. To form an acceptor rich layer near the cathode and achieve effective vertical phase separation, PCBM solution in DMF was spin-coated on the top surface of the P3HT:PCBM active layer. The PCBM rich layer enhanced hole blocking and electron transport, leading to an average PCE improvement from 4.29% to 4.83% (for the PCBM rich layer formed by a 2 mg ml?1 PCBM solution). Finally, to obtain more uniform and smooth films with better contact of Ca/PCBM and BHJ/PCBM interfaces, the films were thermally annealed at 120?° C for 10 min after spin coating the PCBM rich layer, leading to an average PCE enhancement from 4.83% to 5.17% (the best PCE was 5.31%).

Pei Cheng; Yongfang Li; Xiaowei Zhan



Modeling of hydrologic conditions and solute movement in processed oil shale waste embankments under simulated climatic conditions. Third quarterly report, April 1993--June 1993  

SciTech Connect

This report presents research objectives, discusses activities, and presents technical progress for the period April 1, 1993 through June 31, 1993 on Contract No. DE-FC21-86LC11084 with the Department of Energy, Laramie Project Office. The scope of the research program and the continuation is to study interacting hydrologic, geotechnical, and chemical factors affecting the behavior and disposal of combusted processed oil shale. The research combines bench-scale testing with large scale research sufficient to describe commercial scale embankment behavior. The large scale approach was accomplished by establishing five lysimeters, each 7.3 {times} 3.0 {times} 3.0 m deep, filled with processed oil shale that has been retorted and combusted by the Lurgi-Ruhrgas (Lurgi) process. Approximately 400 tons of Lurgi processed oil shale waste was provided by Rio Blanco Oil Shale Co., Inc. (RBOSC) through a separate cooperative agreement with the University of Wyoming (UW) to carry out this study. Three of the lysimeters were established at the RBOSC Tract C-a in the Piceance Basin of Colorado. Two lysimeters were established in the Environmental Simulation Laboratory (ESL) at UW. The ESL was specifically designed and constructed so that a large range of climatic conditions could be physically applied to the processed oil shale which was filled in the lysimeter cells.

Reeves, T.L.; Turner, J.P.; Rangarajan, S.; Skinner, Q.D.; Hasfurther, V.



Modeling of hydrologic conditions and solute movement in processed oil shale waste embankments under simulated climatic conditions. Second quarterly report, January 1, 1992--March 31, 1992  

SciTech Connect

The scope of the research program and the continuation is to study interacting hydrologic, geotechnical, and chemical factors affecting the behavior and disposal of combusted processed oil shale. The research combines bench-scale testing with large scale research sufficient to describe commercial scale embankment behavior. The large scale approach was accomplished by establishing five lysimeters, each 7.3 {times} 3.0 {times} 3.0 m deep, filled with processed oil shale that has been retorted and combusted by the Lurgi-Ruhrgas (Lurgi) process. Approximately 400 tons of Lurgi processed oil shale waste was provided by Rio Blanco Oil Shale Co., Inc. (RBOSC) through a separate cooperative agreement with the University of Wyoming (UW) to carry out this study. Three of the lysimeters were established at the RBOSC Tract C-a in the Piceance Basin of Colorado. Two lysimeters were established in the Environmental Simulation Laboratory (ESL) at UW. The ESL was specifically designed and constructed so that a large range of climatic conditions could be physically applied to the processed oil shale which was filled in the lysimeter cells.

Turner, J.P.; Hasfurther, V.



Modeling of hydrologic conditions and solute movement in processed oil shale waste embankments under simulated climatic conditions. Fourth quarterly report, July--September 1993  

SciTech Connect

The scope of the research program and the continuation is to study interacting hydrologic, geotechnical, and chemical factors affecting the behavior and disposal of combusted processed oil shale. The research combines bench-scale testing with large scale research sufficient to describe commercial scale embankment behavior. The large scale approach was accomplished by establishing five lysimeters, each 7.3 {times} 3.0 {times} 3.0 m deep, filled with processed oil shale that has been retorted and combusted by the Lurgi-Ruhrgas (Lurgi) process. Approximately 400 tons of Lurgi processed oil shale waste was provided by Rio Blanco Oil Shale Co., Inc. (RBOSC) through a separate cooperative agreement with the University of Wyoming (UW) to carry out this study. Three of the lysimeters were established at the RBOSC Tract C-a in the Piceance Basin of Colorado. Two lysimeters were established in the Environmental Simulation Laboratory (ESL) at UW. The ESL was specifically designed and constructed so that a large range of climatic conditions could be physically applied to the processed oil shale which was filled in the lysimeter cells.

Turner, J.P.; Hasfurther, V.



U.S. Department of Energy Categorical Exclusion Determination Form  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Dissolution of Sludge Constituents in Glycolate-containing 2H Evaporator Rad Feed Solution Dissolution of Sludge Constituents in Glycolate-containing 2H Evaporator Rad Feed Solution Savannah River Site Aiken/Aiken/South Carolina Glycolic acid is being studied as an alternate reductant in the Defense Waste Processing Facility (DWPF) feed preparation process. It will either be a total or partial replacement for the formic acid that is currently used. The DWPF recycle stream serves as a portion of the feed to the 2H Evaporator. The DWPF recycle stream, in addition to containing sludge, also will contain glycolate. This testing seeks to determine the extent to which sludge constituents (Pu, U, Fe, etc.) dissolve (or the solubility of sludge constituents) in the glycolate-containing 2H Evaporator feed solution (Tank 43H). The testing also seeks to determine the interaction of the glycolate-containing evaporator feed solutions with 2H evaporator


Novel Regenerated Solvent Extraction Processes for the Recovery of Carboxylic Acids or Ammonia from Aqueous Solutions Part II. Recovery of Ammonia from Sour Waters  

E-Print Network (OSTI)

19,20). In the coking step, coal is heated III the absencethe "coking" process in In the second step the which coal isCoal Liquefaction Wastewaters Sour Waters from Oil Shale Retorting Sour Waters from Petroleum Refining Sour Waters from Coking

Poole, L.J.




SciTech Connect

We present a new measurement of the {alpha}-spectroscopic factor (S{sub {alpha}}) and the asymptotic normalization coefficient for the 6.356 MeV 1/2{sup +} subthreshold state of {sup 17}O through the {sup 13}C({sup 11}B, {sup 7}Li){sup 17}O transfer reaction and we determine the {alpha}-width of this state. This is believed to have a strong effect on the rate of the {sup 13}C({alpha}, n){sup 16}O reaction, the main neutron source for slow neutron captures (the s-process) in asymptotic giant branch (AGB) stars. Based on the new width we derive the astrophysical S-factor and the stellar rate of the {sup 13}C({alpha}, n){sup 16}O reaction. At a temperature of 100 MK, our rate is roughly two times larger than that by Caughlan and Fowler and two times smaller than that recommended by the NACRE compilation. We use the new rate and different rates available in the literature as input in simulations of AGB stars to study their influence on the abundances of selected s-process elements and isotopic ratios. There are no changes in the final results using the different rates for the {sup 13}C({alpha}, n){sup 16}O reaction when the {sup 13}C burns completely in radiative conditions. When the {sup 13}C burns in convective conditions, as in stars of initial mass lower than {approx}2 M{sub Sun} and in post-AGB stars, some changes are to be expected, e.g., of up to 25% for Pb in our models. These variations will have to be carefully analyzed when more accurate stellar mixing models and more precise observational constraints are available.

Guo, B.; Li, Z. H.; Li, Y. J.; Su, J.; Yan, S. Q.; Bai, X. X.; Chen, Y. S.; Fan, Q. W.; Jin, S. J.; Li, E. T.; Li, Z. C.; Lian, G.; Liu, J. C.; Liu, X.; Shu, N. C. [China Institute of Atomic Energy, P.O. Box 275(1), Beijing 102413 (China); Lugaro, M.; Buntain, J. [Monash Centre for Astrophysics, Monash University, Clayton 3800, Victoria (Australia); Pang, D. Y. [School of Physics and State Key Laboratory of Nuclear Physics and Technology, Peking University, Beijing 100871 (China); Karakas, A. I. [Research School of Astronomy and Astrophysics, Mount Stromlo Observatory, Weston Creek ACT 2611 (Australia); Shi, J. R., E-mail: wpliu@ciae.ac.cn, E-mail: guobing@ciae.ac.cn [National Astronomical Observatories, Chinese Academy of Science, Beijing 100012 (China); and others



Energy Level Alignment in PCDTBT:PC70BM Solar Cells: Solution Processed NiOx for Improved Hole Collection and Efficiency  

SciTech Connect

Solution-based NiO{sub x} outperforms PEDOT:PSS in device performance and stability when used as a hole-collection layer in bulk-heterojunction (BHJ) solar cells formed with poly[N-9'-heptadecanyl-2,7-carbazole-alt-5,5-(4',7'-di-2-thienyl-2',1',3'-benzothiadiazole)] (PCDTBT) and PC70BM. The origin of the enhancement is clarified by studying the interfacial energy level alignment between PCDTBT or the 1:4 blended heterojunctions and PEDOT:PSS or NiO{sub x} using ultraviolet and inverse photoemission spectroscopies. The 1.6 eV electronic gap of PEDOT:PSS and energy level alignment with the BHJ result in poor hole selectivity of PEDOT:PSS and allows electron recombination at the PEDOT:PSS/BHJ interface. Conversely, the large band gap (3.7 eV) of NiO{sub x} and interfacial dipole (0.6 eV) with the organic active layer leads to a hole-selective interface. This interfacial dipole yields enhanced electron blocking properties by increasing the barrier to electron injection. The presence of such a strong dipole is predicted to further promote hole collection from the organic layer into the oxide, resulting in increased fill factor and short circuit current. An overall decrease in recombination is manifested in an increase in open circuit voltage and power conversion efficiency of the device on NiO{sub x} versus PEDOT:PSS interlayers.

Ratcliff, E. L.; Meyer, J.; Steirer, K. X.; Armstrong, N. R.; Olson, D.; Kahn, A.



Comparative Deterministic and Probabilistic Modeling in Geotechnics: Applications to Stabilization of Organic Soils, Determination of Unknown Foundations for Bridge Scour, and One-Dimensional Diffusion Processes  

E-Print Network (OSTI)

to develop reliable solutions for challenging problems in geotechnics. This study addresses the theoretical and computational advantages and limitations of these methods in application to: 1) prediction of the stiffness and strength of stabilized organic...

Yousefpour, Negin



Electrodialysis operation with buffer solution  

DOE Patents (OSTI)

A new method for improving the efficiency of electrodialysis (ED) cells and stacks, in particular those used in chemical synthesis. The process entails adding a buffer solution to the stack for subsequent depletion in the stack during electrolysis. The buffer solution is regenerated continuously after depletion. This buffer process serves to control the hydrogen ion or hydroxide ion concentration so as to protect the active sites of electrodialysis membranes. The process enables electrodialysis processing options for products that are sensitive to pH changes.

Hryn, John N. (Naperville, IL); Daniels, Edward J. (Orland Park, IL); Krumdick, Greg K. (Crete, IL)



Modeling of hydrologic conditions and solute movement in processed oil shale waste embankments under simulated climatic conditions. Final report, November 1995  

SciTech Connect

A study is described on the hydrological and geotechnical behavior of an oil shale solid waste. The objective was to obtain information which can be used to assess the environmental impacts of oil shale solid waste disposal in the Green River Basin. The spent shale used in this study was combusted by the Lurgi-Ruhrgas process by Rio Blanco Oil Shale Company, Inc. Laboratory bench-scale testing included index properties, such as grain size distribution and Atterberg limits, and tests for engineering properties including hydraulic conductivity and shear strength. Large-scale tests were conducted on model spent shale waste embankments to evaluate hydrological response, including infiltration, runoff, and seepage. Large-scale tests were conducted at a field site in western Colorado and in the Environmental Simulation Laboratory (ESL)at the University of Wyoming. The ESL tests allowed the investigators to control rainfall and temperature, providing information on the hydrological response of spent shale under simulated severe climatic conditions. All experimental methods, materials, facilities, and instrumentation are described in detail, and results are given and discussed. 34 refs.




CX-002964: Categorical Exclusion Determination | Department of...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Categorical Exclusion Determination CX-002964: Categorical Exclusion Determination Wind Energy and Sustainable Energy Solutions CX(s) Applied: B3.11, A9 Date: 07092010...


CX-003573: Categorical Exclusion Determination | Department of...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Exclusion Determination CX-003573: Categorical Exclusion Determination Strategic Biomass Solutions
CX(s) Applied: A9
Date: 08252010


CX-002530: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

530: Categorical Exclusion Determination 530: Categorical Exclusion Determination CX-002530: Categorical Exclusion Determination Modular Salt Processing (MSP) Mixing Studies CX(s) Applied: B3.6 Date: 05/24/2010 Location(s): Aiken, South Carolina Office(s): Environmental Management, Savannah River Operations Office The Modular Salt Processing (MSP) Project seeks to deploy equipment to remove the cesium (Cs), strontium (Sr), and select actinides from the high level waste salt solutions using existing waste tanks for shielding. This process will be tested in Engineering Development Laboratory (EDL) using non-radioactive simulants. DOCUMENT(S) AVAILABLE FOR DOWNLOAD CX-002530.pdf More Documents & Publications CX-005770: Categorical Exclusion Determination CX-006642: Categorical Exclusion Determination


Extraction of antimony from nitric acid solutions using tributyl phosphate. I. Tributyl phosphate-antimony(III)-nitric acid system  

SciTech Connect

Experimental data have been reported concerning the extraction of trivalent antimony from nitric acid solutions using tributyl phosphate (TBP). A possible mechanism for the extraction of antimony(III) has been determined and the (pre)concentration constant for the process has been calculated. The effect of temperature on trivalent antimony extraction has also been evaluated. The enthalpy value and standard isobar potential and entropy for this process have been determined.

Lakaev, V.S.; Smelov, V.S.



Efficient indium-tin-oxide free inverted organic solar cells based on aluminum-doped zinc oxide cathode and low-temperature aqueous solution processed zinc oxide electron extraction layer  

SciTech Connect

Indium-tin-oxide (ITO) free inverted organic solar cells (IOSCs) based on aluminum-doped zinc oxide (AZO) cathode, low-temperature aqueous solution processed zinc oxide (ZnO) electron extraction layer, and poly(3-hexylthiophene-2, 5-diyl):[6, 6]-phenyl C{sub 61} butyric acid methyl ester blend were realized in this work. The resulted IOSC with ZnO annealed at 150?°C shows the superior power conversion efficiency (PCE) of 3.01%, if decreasing the ZnO annealing temperature to 100?°C, the obtained IOSC also shows a PCE of 2.76%, and no light soaking issue is observed. It is found that this ZnO film not only acts as an effective buffer layer but also slightly improves the optical transmittance of AZO substrates. Further, despite the relatively inferior air-stability, these un-encapsulated AZO/ZnO IOSCs show comparable PCEs to the referenced ITO/ZnO IOSCs, which demonstrates that the AZO cathode is a potential alternative to ITO in IOSCs. Meanwhile, this simple ZnO process is compatible with large area deposition and plastic substrates, and is promising to be widely used in IOSCs and other relative fields.

Chen, Dazheng; Zhang, Chunfu, E-mail: cfzhang@xidian.edu.cn; Wang, Zhizhe; Zhang, Jincheng; Tang, Shi; Wei, Wei; Sun, Li; Hao, Yue, E-mail: yhao@xidian.edu.cn [State Key Discipline Laboratory of Wide Band Gap Semiconductor Technology, School of Microelectronics, Xidian University, No. 2 South Taibai Road, Xi'an 710071 (China)


Note: This page contains sample records for the topic "determination solution processable" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Nanocrystal solar cells processed from solution  

DOE Patents (OSTI)

A photovoltaic device having a first electrode layer, a high resistivity transparent film disposed on the first electrode, a second electrode layer, and an inorganic photoactive layer disposed between the first and second electrode layers, wherein the inorganic photoactive layer is disposed in at least partial electrical contact with the high resistivity transparent film, and in at least partial electrical contact with the second electrode. The photoactive layer has a first inorganic material and a second inorganic material different from the first inorganic material, wherein the first and second inorganic materials exhibit a type II band offset energy profile, and wherein the photoactive layer has a first population of nanostructures of a first inorganic material and a second population of nanostructures of a second inorganic material.

Alivisatos, A. Paul; Gur, Ilan; Milliron, Delia



Categorical Exclusion (CX) Determinations By Date | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

1, 2010 1, 2010 CX-001158: Categorical Exclusion Determination An Evaluation of the Carbon Sequestration Potential of the Cambro-Ordovician Strata of the Illinois and Michigan Basins CX(s) Applied: A9 Date: 03/11/2010 Location(s): Bloomington, Indiana Office(s): Fossil Energy, National Energy Technology Laboratory March 11, 2010 CX-001153: Categorical Exclusion Determination Roll-to-Roll Solution-Processable Small-Molecule Organic Light-Emitting Diodes (Wilmington) Date: 03/11/2010 Location(s): Wilmington, Delaware Office(s): Energy Efficiency and Renewable Energy, National Energy Technology Laboratory March 11, 2010 CX-001152: Categorical Exclusion Determination Roll-to-Roll Solution-Processable Small-Molecule Organic Light-Emitting Diodes (Niskayuna) CX(s) Applied: B3.6


Categorical Exclusion (CX) Determinations By Date | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

1, 2010 1, 2010 CX-001153: Categorical Exclusion Determination Roll-to-Roll Solution-Processable Small-Molecule Organic Light-Emitting Diodes (Wilmington) Date: 03/11/2010 Location(s): Wilmington, Delaware Office(s): Energy Efficiency and Renewable Energy, National Energy Technology Laboratory March 11, 2010 CX-001152: Categorical Exclusion Determination Roll-to-Roll Solution-Processable Small-Molecule Organic Light-Emitting Diodes (Niskayuna) CX(s) Applied: B3.6 Date: 03/11/2010 Location(s): Niskayuna, New York Office(s): Energy Efficiency and Renewable Energy, National Energy Technology Laboratory March 11, 2010 CX-001169: Categorical Exclusion Determination Pre-Combustion Carbon Dioxide Capture by a New Dual-Phase Ceramic Carbonate Membrane Reactor CX(s) Applied: B3.6


A Study to Determine the Effectiveness of Agriculture/Natural Resource Program Area Committees on the Texas AgriLife Extension Service Program Planning Process  

E-Print Network (OSTI)

of Graduate Studies of Texas A&M University in partial fulfillment of the requirements for the degree of DOCTOR OF EDUCATION August 2011 Major Subject: Agricultural Leadership, Education, and Communications A STUDY TO DETERMINE..., Jack Elliot August 2011 Major Subject: Agricultural Leadership, Education, and Communications iii ABSTRACT A Study to Determine the Effectiveness of Agriculture/Natural Resource Program Area Committees on the Texas AgriLife Extension...

Weems, Whit Holland



Categorical Exclusion Determinations: Wyoming | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

March 7, 2012 March 7, 2012 CX-008379: Categorical Exclusion Determination Archer Communications Building CX(s) Applied: B4.6 Date: 03/07/2012 Location(s): Wyoming Offices(s): Western Area Power Administration-Rocky Mountain Region January 24, 2012 CX-008675: Categorical Exclusion Determination Sustainable Energy Solutions LLC - Cryogenic Carbon Capture (Phase 2) CX(s) Applied: B3.6, B3.9 Date: 01/24/2012 Location(s): Utah, Wyoming Offices(s): Advanced Research Projects Agency-Energy January 12, 2012 CX-007755: Categorical Exclusion Determination Routine and Proposed Actions at the Riverton, Wyoming, Processing Site CX(s) Applied: B1.3, B3.1 Date: 01/12/2012 Location(s): Wyoming Offices(s): Legacy Management December 15, 2011 CX-007515: Categorical Exclusion Determination Bucknam Temporary Tap, Natrona County, Wyoming


Poly(3-decylthiophene) Radical Anions and Cations in Solution  

NLE Websites -- All DOE Office Websites (Extended Search)

Poly(3-decylthiophene) Radical Anions and Cations in Solution: Single and Poly(3-decylthiophene) Radical Anions and Cations in Solution: Single and Multiple Polarons and Their Delocalization Lengths in Conjugated Polymers N. Takeda and J. R. Miller J. Phys. Chem. B 116, 14715-14723 (2012). [Find paper at ACS Publications] Abstract: Optical absorption spectra of anions and cations of poly(3-decylthiophene) (P3DT) in solution were identified as single polarons. Pulse radiolysis of P3DT in THF determined the spatial extent of one negative polaron to be similar to 11.5 thiophene units by observing transient absorption of P3DT(-dot) radical ions, which are prinicpally free ions, at 850 nm with epsilon = (7.25 ± 0.47) x 104 M-1 cm-1 and bleaching of the neutral absorption band at 450 nm. P3DT(-dot) was formed in a combination of diffusive reactions and fast "step" processes. Similarly, a positive


CX-007854: Categorical Exclusion Determination | Department of...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Exclusion Determination CX-007854: Categorical Exclusion Determination Streamlining Solar Standards & Processes: The Southern California Rooftop Solar Challenge CX(s)...


CX-001473: Categorical Exclusion Determination | Department of...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Exclusion Determination CX-001473: Categorical Exclusion Determination Direct Coal Liquefaction Process Development Date: 04022010 Location(s): Grand Forks, North...


CX-011555: Categorical Exclusion Determination | Department of...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Determination CX-011555: Categorical Exclusion Determination Managing Zirconium Chemistry and Phase Compatibility in Combined Process Separations for Minor Actinide...


Determination of the solubility of Np(IV), Pu(III) - (VI),Am(III) - (VI), and Te(IV), (V) hydroxo compounds in 0.5 - 14 M NaOH solutions  

SciTech Connect

The solubilities of Am(III), Np(IV), Pu(IV), Tc(IV), Np(V), Pu(V), Am(V), and Tc(V) hydroxo compounds were studied in 0.5 to 14 M NaOH solutions at 25{+-}2 {degrees}C. The effects of fluoride, phosphate, carbonate, oxalate, and some other organic complexing agents on the solubilities of Np(IV), Pu(IV), and TC(IV) hydroxides were investigated at 1.0 and 4.0 M NAOH. Some predictions were made on the dissolved (I.V) and (V) species present in alkali solutions.

Delegard, C.H.



2010 Water & Aqueous Solutions  

SciTech Connect

Water covers more than two thirds of the surface of the Earth and about the same fraction of water forms the total mass of a human body. Since the early days of our civilization water has also been in the focus of technological developments, starting from converting it to wine to more modern achievements. The meeting will focus on recent advances in experimental, theoretical, and computational understanding of the behavior of the most important and fascinating liquid in a variety of situations and applications. The emphasis will be less on water properties per se than on water as a medium in which fundamental dynamic and reactive processes take place. In the following sessions, speakers will discuss the latest breakthroughs in unraveling these processes at the molecular level: Water in Solutions; Water in Motion I and II; Water in Biology I and II; Water in the Environment I and II; Water in Confined Geometries and Water in Discussion (keynote lecture and poster winners presentations).

Dor Ben-Amotz



Fermentation process  

SciTech Connect

Fermentation process consists essentially of fermenting a 10-45% w/w aqueous slurry of granular starch for the production of ethanol with an ethanol-producing microorganism in the presence of alpha-amylase and glucoamylase, the conduct of said fermentation being characterized by low levels of dextrin and fermentable sugars in solution in the fermentation broth throughout the fermentation, and thereafter recovering enzymes from the fermentation broth for use anew in fermentation of granular starch.

Lutzen, N.W.



U.S. Department of Energy Categorical Exclusion Determination Form  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Dissolution of Sludge Constituents in Glycolate-Containing 2H Evaporator Rad Feed Solution Dissolution of Sludge Constituents in Glycolate-Containing 2H Evaporator Rad Feed Solution Savannah River Site Aiken/Aiken/South Carolina Glycolic acid is being studied as an alternate reductant in the Defense Waste Processing Facility (DWPF) feed preparation process. It will either be a total or partial replacement for the formic acid that is currently used. The DWPF recycle stream serves as a portion of the feed to the 2H Evaporator. The DWPF recycle stream in addition to containing sludge will also contain glycolate. This testing seeks to determine the extent to which sludge constituents (Pu, U, Fe, etc.) dissolve (or the solubility of sludge constituents) in the glycolate-containing 2H Evaporator feed solution (Tank 43H). B3.6 - Small-scale research and development, laboratory operations, and pilot projects


CX-007967: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

67: Categorical Exclusion Determination 67: Categorical Exclusion Determination CX-007967: Categorical Exclusion Determination "Electrochemical Fluorination in Molten Fluoride Salts CX(s) Applied: B3.6 Date: 02/07/2012 Location(s): South Carolina Offices(s): Savannah River Operations Office This EEC covers activities related to development of an electrochemical fluorination process to separate selected metals (non-RCRA) from depleted uranium. The goal of the process is to convert depleted uranium metal (U) to gaseous uranium hexafluoride (UF6) that can be easily separated from solution while other metallic constituents remain as metals or are converted to non-volatile fluoride salts. The electrochemical fluorination process will be conducted in molten fluoride eutectic salts at temperatures


Categorical Exclusion Determinations: B3.6 | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

7, 2012 7, 2012 CX-009108: Categorical Exclusion Determination Precipitation of Mixed Actinide Solid Solutions CX(s) Applied: B3.6 Date: 08/27/2012 Location(s): South Carolina Offices(s): Savannah River Operations Office August 27, 2012 CX-009107: Categorical Exclusion Determination Xylene Measurement for Saltstone Antifoams CX(s) Applied: B3.6 Date: 08/27/2012 Location(s): South Carolina Offices(s): Savannah River Operations Office August 27, 2012 CX-008998: Categorical Exclusion Determination "Sustainable Manufacturing via Multi-scale Physics-based Process Modeling and Manufacturing-informed Design CX(s) Applied: A9, B3.6 Date: 08/27/2012 Location(s): Minnesota Offices(s): Golden Field Office" August 27, 2012 CX-009006: Categorical Exclusion Determination High Metal Removal Rate Process for Machining Difficult Materials


CX-004449: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

449: Categorical Exclusion Determination 449: Categorical Exclusion Determination CX-004449: Categorical Exclusion Determination Bench Scale Testing to Provide Data on Precipitation Control in the Cesium Nitric Acid Recovery Process CX(s) Applied: B3.6 Date: 10/15/2010 Location(s): Aiken, South Carolina Office(s): Savannah River Operations Office The Hanford Tank Waste Treatment and Immobilization Plant (WPT) project is completing solubility models for nitrate salts to evaluate control of the Cesium Nitric Acid Recovery Process (CNP) in order to avoid precipitation of solids in the evaporator concentrate. In order to do this, bench scale tests to determine salt solubility in nitric acid solutions at expected feed and final evaporated concentrations will be done. This work will provide the necessary data to verify predicted salt solubilities and basic


Viscosity of polymer solutions  

Science Journals Connector (OSTI)

Viscosity of polymer solutions ... Abstracts for Volume 5A, Number 2. This program contains three components: "Density of Liquids", "Viscosity of Liquids", and "Viscosity of Polymer Solutions". ...

Gary L. Bertrand




E-Print Network (OSTI)

1980, pp.l4-20 THE DAYLIGHTING SOLUTION Stephen SelkowitzEEB-W·-80-19 W-74 THE DAYLIGHTING SOLUTION Stephen Selkowitz

Selkowitz, Stephen



CX-008363: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

3: Categorical Exclusion Determination 3: Categorical Exclusion Determination CX-008363: Categorical Exclusion Determination Evaluation of Sorbent/Ion Exchangers for Radiochemical and Metal Separations CX(s) Applied: B3.6 Date: 04/09/2012 Location(s): South Carolina Offices(s): Savannah River Operations Office This Research and Demonstration (R&D) activity involves the preparation, characterization and testing of inorganic-based materials for the sorption/ion exchange of radioactive and non-radioactive sorbates from waste and process solutions. New sorbent materials are prepared or received from collaborators and vendors and characterized as needed for chemical and physical properties. Research will also include Extraction-Scrub-Strip (ESS) tests utilizing similar sorbate solutions described above, and an


CX-008618: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

8: Categorical Exclusion Determination 8: Categorical Exclusion Determination CX-008618: Categorical Exclusion Determination Evaluation of Sorbent/Ion Exchangers for Radiochemical and Metal Separations CX(s) Applied: B3.6 Date: 06/26/2012 Location(s): South Carolina Offices(s): Savannah River Operations Office This research and development activity involves the preparation, characterization and testing of inorganic-based materials for the sorption/ion exchange of radioactive and non-radioactive sorbates from waste and process solutions. New sorbent materials are prepared or received from collaborators and vendors and characterized as needed for chemical and physical properties. Research will also include Extraction-Scrub-Strip (ESS) tests utilizing similar sorbate solutions described above, and an

Note: This page contains sample records for the topic "determination solution processable" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Synthetic fluid inclusions: XII. The system H[sub 2]O-NaCl. Experimental determination of the halite liquidus and isochores for a 40 wt% NaCl solution  

SciTech Connect

The slopes of the liquidus and lines of constant liquid-vapor homogenization temperature (iso-Th) in P-T space for a 40 wt% NaCl bulk composition in the H[sub 2]O-NaCl system were determined using synthetic fluid inclusions. Inclusions were synthesized in the one-phase field at 350-800[degrees]C and 1-6 kbar, and the temperatures of liquid-vapor homogenization and halite dissolution were determined on a heating/cooling stage. The pressure along the liquidus corresponding to a measured halite dissolution temperature [Tm (halite)] was determined from the intersection of the inclusion iso-Th line in the one-phase field with the measured liquid-vapor homogenization temperature [Th [L-V

Bodnar, R.J. (Virginia Polytechnic Institute and State Univ., Blacksburg, VA (United States))



Competitive photoelectrochemical processes as studied by in situ photocalorimetry. Competition between the photoanodic oxidation of a solute (Cl sup minus , Br sup minus , H sub 2 O sub 2 , SO sub 3 sup 2 minus ) and that of water at some n-type TiO sub 2 electrodes  

SciTech Connect

An analysis is presented of the dependence on electrode potential of the relative change, L(U), of the photocalorimetric (heat-monitoring) signal measured in situ during competitive photoanodic oxidation of two species (S{sub r,1} and S{sub r,2}) at an n-type semiconductor electrode. Relations are given by which the photocurrent field for oxidation of a solute (S{sub r,2}) competing with that of water (S{sub r,1}) in aqueous solution can be determined from L(U) measured in the presence and in the absence of the solute. Further, it is shown how to obtain, from L(U), the light-into-chemical energy conversion efficiency and the Peltier heat for photoanodic oxidation of the solute. Photocalorimetric measurements employing photoacoustic or pyroelectric detection are reported for oxidation of Cl{sup {minus}}, Br{sup {minus}}, H{sub 2}O{sub 2} (HO{sub 2}{sup {minus}}), and SO{sub 3}{sup 2{minus}} at some illuminated TiO{sub 2} thin-film electrodes in aqueous solution. Values of the photocurrent yield, the internal quantum efficiency of the photocurrent, the energy conversion efficiency, and the Peltier heat for photoanodic oxidation of the solutes are given and discussed.

Rappich, J.; Dohrmann, J.K. (Freie Universitaet Berlin (West Germany))



CX-011117: Categorical Exclusion Determination | Department of...  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

Categorical Exclusion Determination Comprehensive Solutions for Integration of Solar Resources into Grid Operations CX(s) Applied: A9, A11 Date: 08192013 Location(s): New York...


CX-004808: Categorical Exclusion Determination | Department of...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Exclusion Determination Flowsheet Evaluation for the Neutralization of High Aluminum ? Low Uranium Used Nuclear Fuel (UNF) Solution CX(s) Applied: B3.6 Date: 11292010...


Periodic wave solutions of the Boussinesq equation  

Science Journals Connector (OSTI)

The Boussinesq equation usually arises in a physical problem as a long wave equation. The present work extends the search of periodic wave solutions for it. The Hirota bilinear method and Riemann theta function are employed in the process. We also analyse the asymptotic property of periodic waves in detail. Furthermore, it is of interest to note that well-known soliton solutions can be reduced from the periodic wave solutions.

Yi Zhang; Ling-ya Ye; Yi-neng Lv; Hai-qiong Zhao



Determination of Total Biodiesel Fatty Acid Methyl, Ethyl Esters, and Hydrocarbon Types in Diesel Fuels by Supercritical Fluid Chromatography-Flame Ionization Detection  

Science Journals Connector (OSTI)

......Determination of Total Biodiesel Fatty Acid Methyl...vortex mixer. This process produced solutions ranging...D5186 indicated that the biodiesel esters were not eluted...0%. For further evaluation, the quantitative analysis...determination of the biodiesel ester components by......

John W. Diehl; Frank P. DiSanzo


Financing Solutions | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Solution Center Financing Solutions Financing Solutions Transitioning to a clean energy economy requires innovative financing solutions that enable state, local, and tribal...


Autonomic Product Development Process Automation.  

E-Print Network (OSTI)

??Market globalization and mass customization requirements are forcing companies towards automation of their product development processes. Many task-specific software solutions provide localized automation. Coordinating these… (more)

Daley, John E.



Pervaporation process and assembly  

DOE Patents (OSTI)

The invention is a pervaporation process and pervaporation equipment, using a series of membrane modules, and including inter-module reheating of the feed solution under treatment. The inter-module heating is achieved within the tube or vessel in which the modules are housed, thereby avoiding the need to repeatedly extract the feed solution from the membrane module train.

Wynn, Nicholas P. (Redwood City, CA); Huang, Yu (Palo Alto, CA); Aldajani, Tiem (San Jose, CA); Fulton, Donald A. (Fairfield, CA)



EIS-0219: F-Canyon Plutonium Solutions  

Energy.gov (U.S. Department of Energy (DOE))

This EIS evaluates the potential environmental impacts of processing the plutonium solutions to metal form using the F-Canyon and FB-Line facilities at the Savannah River Site.


Technical solutions to nonproliferation challenges  

SciTech Connect

The threat of nuclear terrorism is real and poses a significant challenge to both U.S. and global security. For terrorists, the challenge is not so much the actual design of an improvised nuclear device (IND) but more the acquisition of the special nuclear material (SNM), either highly enriched uranium (HEU) or plutonium, to make the fission weapon. This paper provides two examples of technical solutions that were developed in support of the nonproliferation objective of reducing the opportunity for acquisition of HEU. The first example reviews technologies used to monitor centrifuge enrichment plants to determine if there is any diversion of uranium materials or misuse of facilities to produce undeclared product. The discussion begins with a brief overview of the basics of uranium processing and enrichment. The role of the International Atomic Energy Agency (IAEA), its safeguard objectives and how the technology evolved to meet those objectives will be described. The second example focuses on technologies developed and deployed to monitor the blend down of 500 metric tons of HEU from Russia's dismantled nuclear weapons to reactor fuel or low enriched uranium (LEU) under the U.S.-Russia HEU Purchase Agreement. This reactor fuel was then purchased by U.S. fuel fabricators and provided about half the fuel for the domestic power reactors. The Department of Energy established the HEU Transparency Program to provide confidence that weapons usable HEU was being blended down and thus removed from any potential theft scenario. Two measurement technologies, an enrichment meter and a flow monitor, were combined into an automated blend down monitoring system (BDMS) and were deployed to four sites in Russia to provide 24/7 monitoring of the blend down. Data was downloaded and analyzed periodically by inspectors to provide the assurances required.

Satkowiak, Lawrence [Director, Nonproliferation, Safeguards and Security Programs, Oak Ridge National Laboratory, Oak Ridge, Tennessee (United States)



Application of the 2 principle and unbiased predictive risk estimator for determining the regularization parameter in 3-D focusing gravity inversion  

Science Journals Connector (OSTI)

......rhomax] are imposed. During the inversion process if a given density value falls outside...which further complicates the solution process. First, an approach for determining...Abstracts. 251-254. 69th Ann. Internat. Mtg. Mead J.L. , Renaut R.A. A Newton......

Saeed Vatankhah; Vahid E. Ardestani; Rosemary A. Renaut



Characterising Vainshtein Solutions in Massive Gravity  

E-Print Network (OSTI)

We study static, spherically symmetric solutions in a recently proposed ghost-free model of non-linear massive gravity. We focus on a branch of solutions where the helicity-0 mode can be strongly coupled within certain radial regions, giving rise to the Vainshtein effect. We truncate the analysis to scales below the gravitational Compton wavelength, and consider the weak field limit for the gravitational potentials, while keeping all non-linearities of the helicity-0 mode. We determine analytically the number and properties of local solutions which exist asymptotically on large scales, and of local (inner) solutions which exist on small scales. We find two kinds of asymptotic solutions, one of which is asymptotically flat, while the other one is not, and also two types of inner solutions, one of which displays the Vainshtein mechanism, while the other exhibits a self-shielding behaviour of the gravitational field. We analyse in detail in which cases the solutions match in an intermediate region. The asymptotically flat solutions connect only to inner configurations displaying the Vainshtein mechanism, while the non asymptotically flat solutions can connect with both kinds of inner solutions. We show furthermore that there are some regions in the parameter space where global solutions do not exist, and characterise precisely in which regions of the phase space the Vainshtein mechanism takes place.

Fulvio Sbisa'; Gustavo Niz; Kazuya Koyama; Gianmassimo Tasinato



CX-002948: Categorical Exclusion Determination | Department of...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Determination CX-002948: Categorical Exclusion Determination Wind Energy and Sustainable Energy Solutions - Kansas State University CX(s) Applied: B3.11, A9, B5.1 Date: 07...


Equilibria in aqueous iodine solutions  

E-Print Network (OSTI)

for the determination of pH and. 1odide concentration. This instrument, reads pH to 0. 001 pH units and millivolts to F 1 mv. An Orion Specific Ion Electrode, Iodide Model 94-53, was used in the iodide determination. A Corning Triple Purpose pH glass elect- rode... with such electrodes fully confirms this statement. The optimum concentration of Solution I was found to be between 5 x 10 and 10 H iodide. Error in ZIIF Although short-term reproducibility to within 0. 001 26 pH unit can in principle be achieved. with the glass...

Burger, Joanne Denise




SciTech Connect

This report provides data, analysis, and conclusions from a series of tests that were conducted at the Vitreous State Laboratory of The Catholic University of America (VSL) to determine the melter processing rates that are achievable with RPP-WTP HLW simulants. The principal findings were presented earlier in a summary report (VSL-00R2S90-l) but the present report provides additional details. One of the most critical pieces of information in determining the required size of the RPP-WTP HLW melter is the specific glass production rate in terms of the mass of glass that can be produced per unit area of melt surface per unit time. The specific glass production rate together with the waste loading (essentially, the ratio of waste-in to glass-out, which is determined from glass formulation activities) determines the melt area that is needed to achieve a given waste processing rate with due allowance for system availability. As a consequence of the limited amount of relevant information, there exists, for good reasons, a significant disparity between design-base specific glass production rates for the RPP-WTP LAW and HLW conceptual designs (1.0 MT/m{sup 2}/d and 0.4 MT/m{sup 2}/d, respectively); furthermore, small-scale melter tests with HLW simulants that were conducted during Part A indicated typical processing rates with bubbling of around 2.0 MT/m{sup 2}/d. This range translates into more than a factor of five variation in the resultant surface area of the HLW melter, which is clearly not without significant consequence. It is clear that an undersized melter is undesirable in that it will not be able to support the required waste processing rates. It is less obvious that there are potential disadvantages associated with an oversized melter, over and above the increased capital costs. A melt surface that is consistently underutilized will have poor cold cap coverage, which will result in increased volatilization from the melt (which is generally undesirable) and increased plenum temperatures due to increased thermal radiation from the melt surface (which mayor may not be desirable but the flexibility to choose may be lost). Increased volatilization is an issue both in terms of the increased challenge to the off-gas system as well as for the ability to effectively close the recycle loops for volatile species that must be immobilized in the glass product, most notably technetium and cesium. For these reasons, improved information is needed on the specific glass production rates of RPP-WTP HLW streams in DuraMelterJ systems over a range of operating conditions. Unlike the RPP-WTP LAW program, for which a pilot melter system to provide large-scale throughout information is already in operation, there is no comparable HLW activity; the results of the present study are therefore especially important. This information will reduce project risk by reducing the uncertainty associated with the amount of conservatism that mayor may not be associated with the baseline RPP-WTP HLW melter sizing decision. After the submission of the first Test Plan for this work, the RPP-WTP requested revisions to include tests to determine the processing rates that are achievable without bubbling, which was driven by the potential advantages of omitting bubblers from the HLW melter design in terms of reduced maintenance. A further objective of this effort became the determination of whether the basis of design processing rate could be achieved without bubbling. Ideally, processing rate tests would be conducted on a full-scale RPP-WTP melter system with actual HLW materials, but that is clearly unrealistic during Part B1. As a practical compromise the processing rate determinations were made with HL W simulants on a DuraMelter J system at as close to full scale as possible and the DM 1000 system at VSL was selected for that purpose. That system has a melt surface area of 1.2 m{sup 2}, which corresponds to about one-third scale based on the specific glass processing rate of 0.4 MT/m{sup 2}/d assumed in the RPP-WTP HLW conceptual design, but would correspon




Blending of Radioactive Salt Solutions in Million Gallon Tanks - 13002  

SciTech Connect

Research was completed at Savannah River National Laboratory (SRNL) to investigate processes related to the blending of radioactive, liquid waste, salt solutions in 4920 cubic meter, 25.9 meter diameter storage tanks. One process was the blending of large salt solution batches (up to 1135 - 3028 cubic meters), using submerged centrifugal pumps. A second process was the disturbance of a settled layer of solids, or sludge, on the tank bottom. And a third investigated process was the settling rate of sludge solids if suspended into slurries by the blending pump. To investigate these processes, experiments, CFD models (computational fluid dynamics), and theory were applied. Experiments were performed using simulated, non-radioactive, salt solutions referred to as supernates, and a layer of settled solids referred to as sludge. Blending experiments were performed in a 2.44 meter diameter pilot scale tank, and flow rate measurements and settling tests were performed at both pilot scale and full scale. A summary of the research is presented here to demonstrate the adage that, 'One good experiment fixes a lot of good theory'. Experimental testing was required to benchmark CFD models, or the models would have been incorrectly used. In fact, CFD safety factors were established by this research to predict full-scale blending performance. CFD models were used to determine pump design requirements, predict blending times, and cut costs several million dollars by reducing the number of required blending pumps. This research contributed to DOE missions to permanently close the remaining 47 of 51 SRS waste storage tanks. (authors)

Leishear, Robert A.; Lee, Si Y.; Fowley, Mark D.; Poirier, Michael R. [Savannah River National Laboratory, Aiken. S.C., 29808 (United States)] [Savannah River National Laboratory, Aiken. S.C., 29808 (United States)



Blending Of Radioactive Salt Solutions In Million Gallon Tanks  

SciTech Connect

Research was completed at Savannah River National Laboratory (SRNL) to investigate processes related to the blending of radioactive, liquid waste, salt solutions in 4920 cubic meter, 25.9 meter diameter storage tanks. One process was the blending of large salt solution batches (up to 1135 ? 3028 cubic meters), using submerged centrifugal pumps. A second process was the disturbance of a settled layer of solids, or sludge, on the tank bottom. And a third investigated process was the settling rate of sludge solids if suspended into slurries by the blending pump. To investigate these processes, experiments, CFD models (computational fluid dynamics), and theory were applied. Experiments were performed using simulated, non-radioactive, salt solutions referred to as supernates, and a layer of settled solids referred to as sludge. Blending experiments were performed in a 2.44 meter diameter pilot scale tank, and flow rate measurements and settling tests were performed at both pilot scale and full scale. A summary of the research is presented here to demonstrate the adage that, ?One good experiment fixes a lot of good theory?. Experimental testing was required to benchmark CFD models, or the models would have been incorrectly used. In fact, CFD safety factors were established by this research to predict full-scale blending performance. CFD models were used to determine pump design requirements, predict blending times, and cut costs several million dollars by reducing the number of required blending pumps. This research contributed to DOE missions to permanently close the remaining 47 of 51 SRS waste storage tanks.

Leishear, Robert A.; Lee, Si Y.; Fowley, Mark D.; Poirier, Michael R.



Categorical Exclusion Determinations: B1.3 | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

April 28, 2010 April 28, 2010 CX-002550: Categorical Exclusion Determination Bubbler Upgrade Support - Defense Waste Processing Facility Dry Frit Addition CX(s) Applied: B1.3 Date: 04/28/2010 Location(s): Aiken, South Carolina Office(s): Environmental Management, Savannah River Operations Office April 28, 2010 CX-002547: Categorical Exclusion Determination Bubbler Upgrade Support - Defense Waste Processing Facility Water Separation from Decon Frit Solution CX(s) Applied: B1.3 Date: 04/28/2010 Location(s): Aiken, South Carolina Office(s): Environmental Management, Savannah River Operations Office April 27, 2010 CX-002236: Categorical Exclusion Determination C-Farm Electrical, Lighting, and Walkway Upgrades CX(s) Applied: B1.13, B2.1, B1.3 Date: 04/27/2010 Location(s): Richland, Washington


CX-004251: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

4251: Categorical Exclusion Determination 4251: Categorical Exclusion Determination CX-004251: Categorical Exclusion Determination High Yield Hybrid Cellulosic Ethanol Process Using High-Impact Feedstock for Commercialization by 2013 CX(s) Applied: A9, B3.6 Date: 10/14/2010 Location(s): Oregon Office(s): Energy Efficiency and Renewable Energy, Golden Field Office Department of Energy and cost share funds would be used to design, construct, and operate the "Boardman Project". The Boardman Project consists of the design, construction and operation of two standalone processing units. One unit would convert biomass to a fermentable sugar solution (chemical fractionation) and the other would convert carboxylic esters to ethanol (hydrogenolysis). The Boardman Project, together with ZeaChem's Core Facility, would constitute an integrated cellulosic ethanol

Note: This page contains sample records for the topic "determination solution processable" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Reverse osmosis performance with solutions containing tri-n-butyl phosphate  

SciTech Connect

Tests were conducted to determine whether the reverse osmosis (RO) units at the F/H Effluent Treatment Facility (ETF) at the Savannah River could be made to process solutions containing tri-n-butyl phosphate (TBP). It was desired to test whether operation at a feed pH other than neutral would improve performance. Test results are discussed in this report and indicate that little improvement in the water flux can be expected at other pH values.

Siler, J.L.



Thermodynamics of dilute solutions  

Science Journals Connector (OSTI)

Thermodynamics of dilute solutions ... The development of the necessary thermodynamic equations directly in terms of molality is not common ... ...

Gabor Jancso; David V. Fenby



Robust Waste-to-Value Solution Using Advanced Monitoring and...  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

Monitoring and Controls Introduction Waste-to-value is a promising and comprehensive wastewater processing solution being pursued by GE that recovers valuable energy and purified...


"Upcycling": A Green Solution to the Problem of Plastic - Energy...  

NLE Websites -- All DOE Office Websites (Extended Search)

"Upcycling": A Green Solution to the Problem of Plastic Developing a Process to Transform Waste Plastic into a Valuable Commodity Argonne National Laboratory Contact ANL About This...


Process / CI Process  

NLE Websites -- All DOE Office Websites (Extended Search)

2 Process/Continual Improvement Rev. 11_0406 Page 1 of 6 2 Process/Continual Improvement Rev. 11_0406 Page 1 of 6 EOTA - Business Process Document Title: Process/Continual Improvement Document Number: P-012 Rev 11_0406 Document Owner: Elizabeth Sousa Backup Owner: David Rocha Approver(s): Melissa Otero Parent Document: Q-001 Quality Manual Notify of Changes: EOTA Staff Referenced Document(s): F-016 Process/Continual Improvement Form, P-001 Document Control Process, P-008 Corrective Action and Preventive Action, P-004 Business System Management Review P-012 Process/Continual Improvement Rev. 11_0406 Page 2 of 6 Revision History:


CX-010761: Categorical Exclusion Determination | Department of...  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

1: Categorical Exclusion Determination CX-010761: Categorical Exclusion Determination Green Gasoline from Wood using Carbona Gasification and Topsoe TIGAS Processes CX(s) Applied:...


CX-009118: Categorical Exclusion Determination | Department of...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

8: Categorical Exclusion Determination CX-009118: Categorical Exclusion Determination Sludge Batch 8 Qualification: Washing and Defense Waste Processing Facility Simulations (Rad)...


CX-003037: Categorical Exclusion Determination | Department of...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Determination CX-003037: Categorical Exclusion Determination Mercury Removal from Clean Coal Processing Air Stream CX(s) Applied: B3.6 Date: 07132010 Location(s): Butte,...


CX-008294: Categorical Exclusion Determination | Department of...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

4: Categorical Exclusion Determination CX-008294: Categorical Exclusion Determination Waste Heat Integration with Solvent Process for More Efficient Carbon Dioxide Removal from...


CX-008293: Categorical Exclusion Determination | Department of...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

93: Categorical Exclusion Determination CX-008293: Categorical Exclusion Determination Waste Heat Integration with Solvent Process for More Efficient Carbon Dioxide Removal from...


CX-008295: Categorical Exclusion Determination | Department of...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

5: Categorical Exclusion Determination CX-008295: Categorical Exclusion Determination Waste Heat Integration with Solvent Process for More Efficient Carbon Dioxide Removal from...


CX-008292: Categorical Exclusion Determination | Department of...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

2: Categorical Exclusion Determination CX-008292: Categorical Exclusion Determination Waste Heat Integration with Solvent Process for More Efficient Carbon Dioxide Removal from...


CX-003877: Categorical Exclusion Determination | Department of...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

77: Categorical Exclusion Determination CX-003877: Categorical Exclusion Determination Hybrid MembraneAbsorption Process for Post-Combustion Carbon Dioxide Capture CX(s) Applied:...


CX-003876: Categorical Exclusion Determination | Department of...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Categorical Exclusion Determination CX-003876: Categorical Exclusion Determination Hybrid MembraneAbsorption Process for Post-Combustion Carbon Dioxide Capture CX(s) Applied:...


CX-009000: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

0: Categorical Exclusion Determination 0: Categorical Exclusion Determination CX-009000: Categorical Exclusion Determination "High Quality, Low Cost Bulk Gallium Nitride (GaN) Substrates Grown by the Electrochemical Solution Growth Method CX(s) Applied: A9, B3.6 Date: 08/20/2012 Location(s): Missouri Offices(s): Golden Field Office The U.S. Department of Energy (DOE) is proposing to provide federal funding to MEMC Electronic Materials, Inc. MEMC would conduct research and development activities for a two phase project to develop a new process method for growing large bulk gallium nitrate (GaN) crystals at low cost with improved functional properties." CX-009000.pdf More Documents & Publications CX-000845: Categorical Exclusion Determination Energy Storage Systems 2010 Update Conference Presentations - Day 3,


CX-001388: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

88: Categorical Exclusion Determination 88: Categorical Exclusion Determination CX-001388: Categorical Exclusion Determination City of Wasilla Wastewater Treatment Facility Governor's Highway Safety Program CX(s) Applied: B5.1 Date: 03/25/2010 Location(s): Wasilla, Alaska Office(s): Energy Efficiency and Renewable Energy Energy Efficiency and Conservation Block Grant (EECBG) funds.The geothermal system will be used in conjunction with the existing facility's primary heating system to alleviate process piping from freezing and reduce overall operating costs. Great Northern Engineering (GNE) has determined that a 5 ton geothermal system may be possible in order to remain under the $50,000 price cap established by the customer; recommendations have been presented as a solution for preventing pipe freeze-up and improve the performance of


Categorical Exclusion (CX) Determinations By Date | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

22: Categorical Exclusion Determination 22: Categorical Exclusion Determination Mulberry Grove Geo-Thermal Installation CX(s) Applied: B5.1 Date: 04/28/2010 Location(s): Mulberry Grove, Illinois Office(s): Energy Efficiency and Renewable Energy, Golden Field Office April 28, 2010 CX-002547: Categorical Exclusion Determination Bubbler Upgrade Support - Defense Waste Processing Facility Water Separation from Decon Frit Solution CX(s) Applied: B1.3 Date: 04/28/2010 Location(s): Aiken, South Carolina Office(s): Environmental Management, Savannah River Operations Office April 28, 2010 CX-002175: Categorical Exclusion Determination U tu Utu Gwaitu Paiute Tribe Energy and Conservation Strategy and Implementation Plan CX(s) Applied: B2.5, A9, A11, B5.1 Date: 04/28/2010 Location(s): California Office(s): Energy Efficiency and Renewable Energy


Hepa filter dissolution process  

DOE Patents (OSTI)

A process for dissolution of spent high efficiency particulate air (HEPA) filters and then combining the complexed filter solution with other radioactive wastes prior to calcining the mixed and blended waste feed. The process is an alternate to a prior method of acid leaching the spent filters which is an inefficient method of treating spent HEPA filters for disposal.

Brewer, Ken N. (Arco, ID); Murphy, James A. (Idaho Falls, ID)



Interrelated fundamental solutions for various heterogeneous potential, wave and advective-diffusive problems  

Science Journals Connector (OSTI)

The Green's fundamental solutions for several second order elliptic partial differential equations governing various physical processes are found to be interrelated. These solutions are required for boundary integral equation formulations. Thus a solution for one such process is essentially a solution for several others. This is particularly useful for heterogeneous media where the catalog of existing fundamental solutions is meager. After a discussion of these relationships, a new class of two dimensional fundamental solutions involving axisymmetric material variations is given.

Richard Paul Shaw; G. Steven Gipson



Method for chemically analyzing a solution by acoustic means  

DOE Patents (OSTI)

A method and apparatus are disclosed for determining a type of solution and the concentration of that solution by acoustic means. Generally stated, the method consists of: immersing a sound focusing transducer within a first liquid filled container; locating a separately contained specimen solution at a sound focal point within the first container; locating a sound probe adjacent to the specimen, generating a variable intensity sound signal from the transducer; measuring fundamental and multiple harmonic sound signal amplitudes; and then comparing a plot of a specimen sound response with a known solution sound response, thereby determining the solution type and concentration. 10 figs.

Beller, L.S.


Note: This page contains sample records for the topic "determination solution processable" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Method for chemically analyzing a solution by acoustic means  

DOE Patents (OSTI)

A method and apparatus for determining a type of solution and the concention of that solution by acoustic means. Generally stated, the method consists of: immersing a sound focusing transducer within a first liquid filled container; locating a separately contained specimen solution at a sound focal point within the first container; locating a sound probe adjacent to the specimen, generating a variable intensity sound signal from the transducer; measuring fundamental and multiple harmonic sound signal amplitudes; and then comparing a plot of a specimen sound response with a known solution sound response, thereby determining the solution type and concentration.

Beller, Laurence S. (Idaho Falls, ID)



Interim Action Determination  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Interim Action Determination Interim Action Determination Processing of Plutonium Materials from the DOE Standard 3013 Surveillance Program in H-Canyon at the Savannah River Site The Department of Energy (DOE) is preparing the Surplus Plutonium Disposition Supplemental Environmental Impact Statement (SPD SEIS, DOE/EIS-0283-S2). DOE is evaluating alternatives for disposition of non-pit plutonium that is surplus to the national


Selective sorption of PCBs by low-cost polymers and application to soil washing processes  

SciTech Connect

Surfactant-assisted soil washing and soil flushing processes have shown to be a promising soil decontamination method. In these and other remediation technologies that employ surfactants to mobilize organic contaminants, large volumes of contaminated aqueous solutions are generated. An efficient process to selectively concentrate the organic contaminant from the aqueous surfactant solution, thereby allowing the recycle of the surfactant, is considered essential for cost-effective application of these remediation methods. To this end, a process was developed wherein commercial, low-cost polymers are used to selectively sorb PCBs and petroleum oils from aqueous surfactant solutions. Sorption isotherms and sorption rates were determined for a large number of polymer sorbents and several significant structure-property relationships were observed. Two classes of polymers, polyester elastomers and carbon-filled elastomer rubbers (e.g., recycled rubber tire), were found to perform superiorly in this application and a successful pilot-scale demonstration of the process was conducted.

Sivavec, T.M.; Webb, J.L.; Gascoyne, D.G. [GE Corporate Research and Development, Schenectady, NY (United States)



Solution deposition assembly  

DOE Patents (OSTI)

Methods and devices are provided for improved deposition systems. In one embodiment of the present invention, a deposition system is provided for use with a solution and a substrate. The system comprises of a solution deposition apparatus; at least one heating chamber, at least one assembly for holding a solution over the substrate; and a substrate curling apparatus for curling at least one edge of the substrate to define a zone capable of containing a volume of the solution over the substrate. In another embodiment of the present invention, a deposition system for use with a substrate, the system comprising a solution deposition apparatus; at heating chamber; and at least assembly for holding solution over the substrate to allow for a depth of at least about 0.5 microns to 10 mm.

Roussillon, Yann; Scholz, Jeremy H; Shelton, Addison; Green, Geoff T; Utthachoo, Piyaphant



Process for recovering actinide values  

DOE Patents (OSTI)

A process for rendering actinide values recoverable from sodium carbonate scrub waste solutions containing these and other values along with organic compounds resulting from the radiolytic and hydrolytic degradation of neutral organophosphorous extractants such as tri-n butyl phosphate (TBP) and dihexyl-N,N-diethyl carbamylmethylene phosphonate (DHDECAMP) which have been used in the reprocessing of irradiated nuclear reactor fuels. The scrub waste solution is preferably made acidic with mineral acid, to form a feed solution which is then contacted with a water-immiscible, highly polar organic extractant which selectively extracts the degradation products from the feed solution. The feed solution can then be processed to recover the actinides for storage or recycled back into the high-level waste process stream. The extractant is recycled after stripping the degradation products with a neutral sodium carbonate solution.

Horwitz, E. Philip (Elmhurst, IL); Mason, George W. (Clarendon Hills, IL)



Solution 3 - Spring 2011  

E-Print Network (OSTI)

Neglecting air resistance, find the maximum height above the roadway which the particle can reach. Solution: (by Shuhao Cao, Graduate student, Mathematics).


Economic Considerations of Biomass Conversion Processes  

Science Journals Connector (OSTI)

Earlier chapters have described various biomass conversion processes and processing procedures. This chapter provides a systematic method of estimating biomass process economics and determining the revenue requir...

Fred A. Schooley



Film-forming capacity of alcoholic solutions of iron(III) chloride with acetylacetone  

Science Journals Connector (OSTI)

Processes in which film-forming solutions based on acetylacetonate and iron(III) chloride are produced were subjected to...

S. A. Kuznetsova; I. A. Senokosova



Proposed Multi-step DOE NIETC Designation Process  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

6 6 DOE Technical Conference - Mike Heyeck - AEP VP, Transmission 1 Proposed Multi-Step DOE NIETC Designation Process Proposed Multi-Step DOE NIETC Designation Process 1) DOE designates NIETCs that exhibit significant congestion and reliability problems in studies or per request and delegates to FERC siting process for action according to statute. 2) RTOs, ISOs or individual TOs determine the optimal solution to alleviate the problems identified above. 3) DOE designates NIETCs if transmission solutions are found that are not designated NIETCs per step 1. 4) State and local agencies fully engage with transmission developers on siting requirements including environmental impact studies. DOE delegates its lead agency role to FERC for federal lands and areas not covered by state and local siting requirements.


Dispersant solutions for dispersing hydrocarbons  

DOE Patents (OSTI)

A dispersant solution includes a hydrocarbon dispersing solution derived from a bacterium from ATCC 75527, ATCC 75529, or ATCC 55638.

Tyndall, R.L.



Method for cleaning solution used in nuclear fuel reprocessing  

DOE Patents (OSTI)

Nuclear fuel processing solution consisting of tri-n-butyl phosphate and dodecane, with a complex of uranium, plutonium, or zirconium and with a solvent degradation product such as di-n-butyl phosphate therein, is contacted with an aqueous solution of a salt formed from hydrazine and either a dicarboxylic acid or a hydroxycarboxylic acid, thereby removing the aforesaid complex from the processing solution.

Tallent, O.K.; Crouse, D.J.; Mailen, J.C.



Ammonia Solubility in High Concentration Salt Solutions  

SciTech Connect

Solubility data for ammonia in water and various dilute solutions are abundant in the literature. However, there is a noticeable lack of ammonia solubility data for high salt, basic solutions of various mixtures of salts including those found in many of the Hanford Washington underground waste tanks. As a result, models based on solubility data for dilute salt solutions have been used to extrapolate to high salt solutions. These significant extrapolations need to be checked against actual laboratory data. Some indirect vapor measurements have been made. A more direct approach is to determine the ratio of solubility of ammonia in water to its solubility in high salt solutions. In various experiments, pairs of solutions, one of which is water and the other a high salt solution, are allowed to come to equilibrium with a common ammonia vapor pressure. The ratio of concentrations of ammonia in the two solutions is equal to the ratio of the respective ammonia solubilities (Henry's Law constants) at a given temperature. This information can then be used to refine the models that predict vapor space compositions of ammonia. Ammonia at Hanford is of concern because of its toxicity in the environment and its contribution to the flammability of vapor space gas mixtures in waste tanks.




Categorical Exclusion (CX) Determinations By Date | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

2, 2010 2, 2010 CX-001102: Categorical Exclusion Determination Recovery Act: Clemson University Wind Turbine Testing Facility CX(s) Applied: A9 Date: 03/02/2010 Location(s): North Charleston, South Carolina Office(s): Energy Efficiency and Renewable Energy, Golden Field Office March 2, 2010 CX-001037: Categorical Exclusion Determination Low-Cost Illumination Grade Light Emitting Diodes (LEDs) CX(s) Applied: B3.6, B5.1 Date: 03/02/2010 Location(s): San Jose, California Office(s): Energy Efficiency and Renewable Energy, National Energy Technology Laboratory March 2, 2010 CX-001036: Categorical Exclusion Determination Solution Processable Transparent Conductive Hole Injection Electrode for Organic Light Emitting Diode (OLED) Solid State Lighting (Pennsylvania) CX(s) Applied: B3.6


Categorical Exclusion Determinations: A11 | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

August 13, 2013 August 13, 2013 CX-010800: Categorical Exclusion Determination Hybrid Membrane/Absorption Process for Post-Combustion Carbon Dioxide (CO2) Capture CX(s) Applied: A1, A9, A11, B3.6 Date: 08/13/2013 Location(s): Illinois Offices(s): National Energy Technology Laboratory August 9, 2013 CX-010746: Categorical Exclusion Determination Better Buildings- Commercial Energy Efficiency Solutions, Pre-Packaged Commercial PACE: The BEERE Menu CX(s) Applied: A9, A11, B5.1 Date: 08/09/2013 Location(s): Florida Offices(s): Golden Field Office August 5, 2013 CX-010811: Categorical Exclusion Determination South Louisiana Enhanced Oil Recovery (EOR)/Sequestration Research and Development (R&D) Project CX(s) Applied: A1, A9, A11 Date: 08/05/2013 Location(s): Texas Offices(s): National Energy Technology Laboratory


Categorical Exclusion Determinations: B3.6 | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

2, 2010 2, 2010 CX-001130: Categorical Exclusion Determination Explosives Stabilization Testing CX(s) Applied: B3.6 Date: 03/02/2010 Location(s): Aiken, South Carolina Office(s): Environmental Management, Savannah River Operations Office March 2, 2010 CX-001037: Categorical Exclusion Determination Low-Cost Illumination Grade Light Emitting Diodes (LEDs) CX(s) Applied: B3.6, B5.1 Date: 03/02/2010 Location(s): San Jose, California Office(s): Energy Efficiency and Renewable Energy, National Energy Technology Laboratory March 2, 2010 CX-001036: Categorical Exclusion Determination Solution Processable Transparent Conductive Hole Injection Electrode for Organic Light Emitting Diode (OLED) Solid State Lighting (Pennsylvania) CX(s) Applied: B3.6 Date: 03/02/2010 Location(s): Pittsburgh, Pennsylvania


Extraction of antimony from nitric acid solutions using tributyl phosphate. II. Tributyl phosphate-antimony(V)-nitric acid system  

SciTech Connect

The extraction of pentavalent antimony from nitric acid solutions using tributyl phosphate has been investigated. A possible mechanism for the extraction of antimony(V) has been determined and the (pre)concentration constant for the process has been calculated. The composition of the extracted antimony(V) complex has been deduced. A negative effect of temperature on the distribution coefficient for antimony(V) has also been demonstrated.

Lakaev, V.S.; Smelov, V.S.



Future Climate Engineering Solutions  

E-Print Network (OSTI)

Engineering Associations from around the world are part of the project `Future Climate - Engineering Solu- tions'. Within the project the participating associations have been developing national climate plansFuture Climate Engineering Solutions Joint report 13 engineering participating engeneering


Selected Solution 7  

E-Print Network (OSTI)

Selected Solutions. Math 341 Homework 7*. November 4, 2014. 1. (Alternating Series Test.) Take zn = 1/n2. Show that s2n = (z1 ? z2)+(z3 ? z4) + ··· + z2n?1 ...



Osmosis with active solutes  

E-Print Network (OSTI)

Despite much current interest in active matter, little is known about osmosis in active systems. Using molecular dynamics simulations, we investigate how active solutes perturb osmotic steady states. We find that solute activity increases the osmotic pressure, and can also expel solvent from the solution - i.e. cause reverse osmosis. The latter effect cannot be described by an effective temperature, but can be reproduced by mapping the active solution onto a passive one with the same degree of local structuring as the passive solvent component. Our results provide a basic framework for understanding active osmosis, and suggest that activity-induced structuring of the passive component may play a key role in the physics of active-passive mixtures.

Thomas W. Lion; Rosalind J. Allen



Osmosis with active solutes  

E-Print Network (OSTI)

Despite much current interest in active matter, little is known about osmosis in active systems. Using molecular dynamics simulations, we investigate how active solutes perturb osmotic steady states. We find that solute activity increases the osmotic pressure, and can also expel solvent from the solution - i.e. cause reverse osmosis. The latter effect cannot be described by an effective temperature, but can be reproduced by mapping the active solution onto a passive one with the same degree of local structuring as the passive solvent component. Our results provide a basic framework for understanding active osmosis, and suggest that activity-induced structuring of the passive component may play a key role in the physics of active-passive mixtures.

Lion, Thomas W


Note: This page contains sample records for the topic "determination solution processable" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Sodium Hydroxide Extraction From Caustic Leaching Solutions  

SciTech Connect

This report describes experiments conducted to demonstrate the proof-of-principle of a method to recover NaOH from Hanford tank sludge leaching solutions. Aqueous solutions generated from leaching actual Hanford tank waste solids were used. The process involves neutralization of a lipophilic weak acid (t-octylphenol was used in these experiments) by reaction with NaOH in the aqueous phase. This results in the transfer of Na into the organic phase. Contacting with water reverses this process, reprotonating the lipophilic weak acid and transferring Na back into the aqueous phase as NaOH. The work described here confirms the potential application of solvent extraction to recover and recycle NaOH from solutions generated by leaching Hanford tank sludges. Solutions obtained by leaching sludges from tanks S-110 and T-110 were used in this work. It was demonstrated that Na+ is transferred from caustic leaching solution to the organic phase when contacted with t-octylphenol solutions. This was accompanied by a concomitant decrease in the aqueous-phase hydroxide ion concentration. Seventy to 80 % of the extracted Na was recovered by 3 to 4 sequential contacts of the organic phase with water. Cesium was co-extracted by the procedure, but Al and Cr remained in the feed stream.

Lumetta, Gregg J.; Garza, Priscilla A.; Levitskaia, Tatiana G.; Brown, Gilbert M.



CX-001152: Categorical Exclusion Determination  

Energy.gov (U.S. Department of Energy (DOE))

Roll-to-Roll Solution-Processable Small-Molecule Organic Light-Emitting Diodes (Niskayuna)CX(s) Applied: B3.6Date: 03/11/2010Location(s): Niskayuna, New YorkOffice(s): Energy Efficiency and Renewable Energy, National Energy Technology Laboratory


Recommendation 207 : Automate the Stewardship Verification Process...  

Office of Environmental Management (EM)

recommends exploring ways to automate the stewardship tracking process and establish a web-based solution for managing long-term stewardship information for the Oak Ridge...


Analyses of multiplicity distributions of $e^{+}e^{-}$ and $e-p$ collisions by means of modified negative binomial distribution and Laguerre-type distribution Interrelation of solutions in stochastic processes  

E-Print Network (OSTI)

A pure birth stochastic process with several initial conditions is considered.We analyze multiplicity distributions of e^+e^- collisions and e-p collisions, usigthe Modified Negative Binomial Distribution (MNBD) and the Laguerre-type distribution. Several multiplicity distributions show the same minimum \\chi^2's values in analyses by means of two formulas: In these cases, we find that a parameter N contained in the MNBD becomes to be large. Taking large N limit in the MNBD, we find that the Laguerre-type distribution can be derived from it. Moreover, from the generalized MNBD we can also derive the generalized Glauber-Lachs formula. Finally stochastic properties of QCD and multiparticle dynamics are discussed.

Biyajima, M; Takei, K



Analyses of multiplicity distributions of e^+e^- and e-p collisions by means of modified negative binomial distribution and Laguerre-type distribution: Interrelation of solutions in stochastic processes  

E-Print Network (OSTI)

A pure birth stochastic process with several initial conditions is considered.We analyze multiplicity distributions of e^+e^- collisions and e-p collisions, usigthe Modified Negative Binomial Distribution (MNBD) and the Laguerre-type distribution. Several multiplicity distributions show the same minimum \\chi^2's values in analyses by means of two formulas: In these cases, we find that a parameter N contained in the MNBD becomes to be large. Taking large N limit in the MNBD, we find that the Laguerre-type distribution can be derived from it. Moreover, from the generalized MNBD we can also derive the generalized Glauber-Lachs formula. Finally stochastic properties of QCD and multiparticle dynamics are discussed.

M. Biyajima; T. Osada; K. Takei



Process for purifying molybdenum  

SciTech Connect

This patent describes a process for purifying molybdenum containing arsenic and phosphorus. The process comprising: adding to an acidic slurry of molybdenum trioxide, a source of magnesium ions in a solid form, with the amount of magnesium and the magnesium ion concentration in the subsequently formed ammonium molybdate solution being sufficient to subsequently form insoluble compounds containing greater than about 80% by weight of the arsenic and greater than about 80% by weight of the phosphorus, and ammonia in an amount sufficient to subsequently dissolve the molybdenum and subsequently form the insoluble compounds, with the source of magnesium ions being added prior to the addition of the ammonia; digesting the resulting ammoniated slurry at a temperature sufficient to dissolve the molybdenum and form an ammonium molybdate solution while the pH is maintained at from bout 9 to about 10 to form a solid containing the insoluble compounds; and separating the solid from the ammonium molybdate solution.

Cheresnowsky, J.



Process / CI Process  

NLE Websites -- All DOE Office Websites (Extended Search)

7 Post Travel Summary 11_0221 Page 1 of 3 7 Post Travel Summary 11_0221 Page 1 of 3 EOTA - Business Process Document Title: Post Travel Summary Document Number: ADMF-017 Post Travel Summary 11_0221 Document Owner: Elizabeth Sousa Backup Owner: Melissa Otero Approver(s): Melissa Otero Parent Document: ADMP-004, Contractor Travel Process Notify of Changes: EOTA Staff Referenced Document(s): ADMF-007 EOTA Pre-Travel Authorization Form ADMF-017 Post Travel Summary 11_0221 Page 2 of 3 Revision History: Rev. Description of Change 11_0221 Initial Release ADMF-017 Post Travel Summary 11_0221 Page 3 of 3


Industrial process surveillance system  

DOE Patents (OSTI)

A system and method are disclosed for monitoring an industrial process and/or industrial data source. The system includes generating time varying data from industrial data sources, processing the data to obtain time correlation of the data, determining the range of data, determining learned states of normal operation and using these states to generate expected values, comparing the expected values to current actual values to identify a current state of the process closest to a learned, normal state; generating a set of modeled data, and processing the modeled data to identify a data pattern and generating an alarm upon detecting a deviation from normalcy. 96 figs.

Gross, K.C.; Wegerich, S.W.; Singer, R.M.; Mott, J.E.



Radiochemical Radiochemical Processing Laboratory  

E-Print Network (OSTI)

Organizations needing innovative processes and technical solutions for environmental cleanup, nuclear energy Category 2 non-reactor nuclear facility, the RPL houses specialized facilities for work with microgram in simple and complex media. Our staff can work with highly radioactive material, highly dispersible


Process for strontium-82 separation  

DOE Patents (OSTI)

A process for selective separation of strontium-82 and strontium-85 from proton irradiated molybdenum targets comprises dissolving the molybdenum target in a hydrogen peroxide solution to form a first solution containing ions selected from a group consisting of molybdenum, niobium, technetium, selenium, vanadium, arsenic, germanium, zirconium, rubidium, zinc, beryllium, cobalt, iron, manganese, chromium, strontium, and yttrium; passing the solution through a first cationic resin whereby ions selected from a group consisting of zinc, beryllium, cobalt, iron, manganese, chromium, strontium, yttrium a portion of zirconium and a portion of rubidium are selectively absorbed by the first resin; contacting the first resin with an acid solution to strip and remove the absorbed ions from the first cationic exchange resin to form a second solution; evaporating the second solution for a time sufficient to remove substantially all of the acid and water from the solution whereby a residue remains; dissolving the residue in a dilute acid to form a third solution; passing the third solution through a second cationic resin whereby the ions are absorbed by the second resin; contacting the second resin with a dilute sulfuric acid solution whereby the absorbed ions selected from the group consisting of rubidium, zinc, beryllium, cobalt, iron, manganese, chromium and zirconium are selectively removed from the second resin; and contacting the second resin with a dilute acid solution whereby the absorbed strontium ions are selectively removed. 1 fig.

Heaton, R.C.; Jamriska, D.J. Sr.; Taylor, W.A.



New solutions in 3D gravity  

Science Journals Connector (OSTI)

We study gravitational theory in 1+2 spacetime dimensions which is determined by the Lagrangian constructed as a sum of the Einstein-Hilbert term plus the two (translational and rotational) gravitational Chern-Simons terms. When the corresponding coupling constants vanish, we are left with purely Einstein theory of gravity. We obtain new exact solutions for the gravitational field equations with nontrivial material sources. Special attention is paid to plane-fronted gravitational waves (in case of the Maxwell field source) and to the circularly symmetric as well as the anisotropic cosmological solutions which arise for the ideal fluid matter source.

Yuri N. Obukhov



Soil solution chemistry at different positions on slope in a conifer plantation forest  

Science Journals Connector (OSTI)

It is known that soil property varies along the slope. It suggests that soil solution chemistry also differs topographically. To determine the variation in soil solution chemistry within one watershed, soil so...

Naoko Tokuchi; Goro Iwatsubo



Functionalized Polymers For Binding To Solutes In Aqueous Solutions  

NLE Websites -- All DOE Office Websites (Extended Search)

Functionalized Polymers For Binding To Solutes In Aqueous Solutions Functionalized Polymers For Binding To Solutes In Aqueous Solutions Functionalized Polymers For Binding To Solutes In Aqueous Solutions A functionalized polymer for binding a dissolved molecule in an aqueous solution is presented. Available for thumbnail of Feynman Center (505) 665-9090 Email Functionalized Polymers For Binding To Solutes In Aqueous Solutions A functionalized polymer for binding a dissolved molecule in an aqueous solution is presented. The polymer has a backbone polymer to which one or more functional groups are covalently linked. The backbone polymer can be such polymers as polyethylenimine, polyvinylamine, polyallylamine, and polypropylamine. These polymers are generally water-soluble, but can be insoluble when cross-linked. The functional group can be for example diol



SciTech Connect

Until recently, the use of oxalic acid for chemically cleaning the Savannah River Site (SRS) radioactive waste tanks focused on using concentrated 4 and 8-wt% solutions. Recent testing and research on applicable dissolution mechanisms have concluded that under appropriate conditions, dilute solutions of oxalic acid (i.e., 1-wt%) may be more effective. Based on the need to maximize cleaning effectiveness, coupled with the need to minimize downstream impacts, SRS is now developing plans for using a 1-wt% oxalic acid solution. A technology gap associated with using a 1-wt% oxalic acid solution was a dearth of suitable corrosion data. Assuming oxalic acid's passivation of carbon steel was proportional to the free oxalate concentration, the general corrosion rate (CR) from a 1-wt% solution may not be bound by those from 8-wt%. Therefore, after developing the test strategy and plan, the corrosion testing was performed. Starting with the envisioned process specific baseline solvent, a 1-wt% oxalic acid solution, with sludge (limited to Purex type sludge-simulant for this initial effort) at 75 C and agitated, the corrosion rate (CR) was determined from the measured weight loss of the exposed coupon. Environmental variations tested were: (a) Inclusion of sludge in the test vessel or assuming a pure oxalic acid solution; (b) acid solution temperature maintained at 75 or 45 C; and (c) agitation of the acid solution or stagnant. Application of select electrochemical testing (EC) explored the impact of each variation on the passivation mechanisms and confirmed the CR. The 1-wt% results were then compared to those from the 8-wt%. The immersion coupons showed that the maximum time averaged CR for a 1-wt% solution with sludge was less than 25-mils/yr for all conditions. For an agitated 8-wt% solution with sludge, the maximum time averaged CR was about 30-mils/yr at 50 C, and 86-mils/yr at 75 C. Both the 1-wt% and the 8-wt% testing demonstrated that if the sludge was removed from the testing, there would be a significant increase in the CR. Specifically, the CR for an agitated 1-wt% pure oxalic acid solution at 45 or 75 C was about 4 to 10 times greater than those for a 1-wt% solution with sludge. For 8-wt% at 50 C, the effect was even larger. The lower CRs suggest that the cathodic reactions were altered by the sludge. For both the 1-wt% and 8-wt% solution, increasing the temperature did not result in an increased CR. Although the CR for a 1-wt% acid with sludge was considered to be non-temperature dependent, a stagnant solution with sludge resulted in a CR that was greater at 45 C than at 75 C, suggesting that the oxalate film formed at a higher temperature was better in mitigating corrosion. For both a 1 and an 8-wt% solution, agitation typically resulted in a higher CR. Overall, the testing showed that the general CR to the SRS carbon steel tanks from 1-wt% oxalic acid solution will remain bounded by those from an 8-wt% oxalic acid solution.

Ketusky, E.; Subramanian, K.



Regional Transmission Projects: Finding Solutions  

SciTech Connect

The Keystone Center convened and facilitated a year-long Dialogue on "Regional Transmission Projects: Finding Solutions" to develop recommendations that will help address the difficult and contentious issues related to expansions of regional electric transmission systems that are needed for reliable and economic transmission of power within and across regions. This effort brought together a cross-section of affected stakeholders and thought leaders to address the problem with the collective wisdom of their experience and interests. Transmission owners sat at the table with consumer advocates and environmental organizations. Representatives from regional transmission organizations exchanged ideas with state and federal regulators. Generation developers explored common interests with public power suppliers. Together, the Dialogue participants developed consensus solutions about how to begin unraveling some of the more intractable issues surrounding identification of need, allocation of costs, and reaching consensus on siting issues that can frustrate the development of regional transmission infrastructure. The recommendations fall into three broad categories: 1. Recommendations on appropriate institutional arrangements and processes for achieving regional consensus on the need for new or expanded transmission infrastructure 2. Recommendations on the process for siting of transmission lines 3. Recommendations on the tools needed to support regional planning, cost allocation, and siting efforts. List of Dialogue participants: List of Dialogue Participants: American Electric Power American Transmission Company American Wind Energy Association California ISO Calpine Corporation Cinergy Edison Electric Institute Environmental Defense Federal Energy Regulatory Commission Great River Energy International Transmission Company ISO-New England Iowa Public Utility Board Kanner & Associates Midwest ISO National Association of Regulatory Utility Commissioners National Association of State Utility Consumer Advocates National Grid Northeast Utilities PA Office of Consumer Advocates Pacific Gas & Electric Corporation Pennsylvania Public Utility Commission PJM Interconnection The Electricity Consumers Resource Council U.S. Department of Energy US Department of the Interior Van Ness Feldman Western Interstate Energy Board Wind on the Wires Wisconsin Public Service Commission Xcel Energy

The Keystone Center



CoreFlow Scientific Solutions Ltd | Open Energy Information  

Open Energy Info (EERE)

CoreFlow Scientific Solutions Ltd CoreFlow Scientific Solutions Ltd Jump to: navigation, search Name CoreFlow Scientific Solutions Ltd Place Yoqneam, Israel Zip 20692 Sector Solar Product Israel-based manufacturer of non-contact substrate processing, handling, and testing equipments for Flat Panel Display (FPD), semiconductor, and solar industries. References CoreFlow Scientific Solutions Ltd[1] LinkedIn Connections CrunchBase Profile No CrunchBase profile. Create one now! This article is a stub. You can help OpenEI by expanding it. CoreFlow Scientific Solutions Ltd is a company located in Yoqneam, Israel . References ↑ "CoreFlow Scientific Solutions Ltd" Retrieved from "http://en.openei.org/w/index.php?title=CoreFlow_Scientific_Solutions_Ltd&oldid=343913" Categories:


Process oil manufacturing process  

SciTech Connect

A method is described for producing a naphthenic process oil having reduced sulfur, nitrogen and polynuclear aromatics contents from a naphthenic feed containing same and having an atmospheric boiling range of about 650/sup 0/ to about 1200/sup 0/F. comprising: A. passing the feed into a first hydrotreating stage having a hydrotreating catalyst therein, the stage maintained at a temperature of about 600/sup 0/ to about 750/sup 0/F. and at a hydrogen partial pressure of about 400 to about 1500 psig, to convert at least a portion of the sulfur to hydrogen sulfide and the nitrogen to ammonia; B. passing the hydrotreated feed from the first hydrotreating stage in an intermediate stripping stage wherein hydrogen sulfide, ammonia, or both is removed; C. passing the hydrotreated feed from the intermediate stage into a second hydrotreating stage having therein a hydrotreating catalyst selected from the group consisting of nickel-molybdenum, cobalt-molybdenum, nickel-tungsten and mixtures thereof, the second hydrotreating stage maintained at a temperature lower than that of the first hydrotreating stage and at a hydrogen partial pressure ranging between about 400 and about 1,500 psig; D. monitoring the polynuclear aromatics content, the degree of saturation, or both of the product exiting the second hydrotreating stage; and, E. adjusting the temperature in the second hydrotreating stage to keep the polynuclear aromatics content, the degree of saturation, or both below a limit suitable for process oil.

Corman, B.G.; Korbach, P.F.; Webber, K.M.



CX-008733: Categorical Exclusion Determination | Department of...  

Energy Savers (EERE)

Determination CX-008733: Categorical Exclusion Determination Film Processing Project at Test Reactor Area (TRA)-678 CX(s) Applied: B6.1 Date: 05212012 Location(s): Idaho...


Ceramics by the Solution-Sol-Gel Route  

Science Journals Connector (OSTI)





CX-008993: Categorical Exclusion Determination | Department of...  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

Exclusion Determination "Continuous Processing of High Thermal Conductivity Polyethylene Fibers and Sheets CX(s) Applied: A9, B3.6 Date: 08222012 Location(s):...

Note: This page contains sample records for the topic "determination solution processable" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


CX-002268: Categorical Exclusion Determination | Department of...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

CX-002268: Categorical Exclusion Determination From Sensing to Enhancing the Brain Processes CX(s) Applied: B3.12 Date: 02252010 Location(s): Albuquerque, New Mexico...


CX-004680: Categorical Exclusion Determination | Department of...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

CX-004680: Categorical Exclusion Determination Pilot Scale Demonstration of Cowboy Coal Upgrading Process CX(s) Applied: B3.6 Date: 12082010 Location(s): Laramie, Wyoming...


Process for producing chalcogenide semiconductors  

DOE Patents (OSTI)

A process for producing chalcogenide semiconductor material is disclosed. The process includes forming a base metal layer and then contacting this layer with a solution having a low pH and containing ions from at least one chalcogen to chalcogenize the layer and form the chalcogenide semiconductor material.

Noufi, R.; Chen, Y.W.



Scaling Solution for Small Cosmic String Loops  

Science Journals Connector (OSTI)

The equation governing the time evolution of the number density of loops in a cosmic string network is a detailed balance determined by energy conservation. We solve this equation with the inclusion of the gravitational radiation effect, which causes the loops to shrink (and eventually decay) as time elapses. The solution approaches a scaling regime in which the total energy density in loops remains finite, converging both in the infrared and in the ultraviolet.

Jorge V. Rocha



Voluntary Protection Program Onsite Review, Washington River Protection Solutions, LLC, Hanford – Feb 2014  

Energy.gov (U.S. Department of Energy (DOE))

Evaluation to determine whether Washington River Protection Solutions, LLC, Hanford is performing at a level deserving DOE-VPP Star recognition.


Process Deviation  

NLE Websites -- All DOE Office Websites (Extended Search)

0 Process Deviation 11_0304 Page 1 of 6 0 Process Deviation 11_0304 Page 1 of 6 EOTA - Business Process Document Title: Process Deviation Document Number: P-010 Rev 11-0304 Document Owner: Elizabeth Sousa Backup Owner: Melissa Otero Approver(s): Melissa Otero Parent Document: Q-001, Quality Manual Notify of Changes: EOTA Employees Referenced Document(s): F-013 Process Deviation Form, P-008 Corrective/Preventive Action, F-014 Process Deviation Log, ADMP-001 Procurement Process P-010 Process Deviation 11_0304 Page 2 of 6 Revision History: Rev. Description of Change A Initial Release 08_0822 Process assigned to new owner. Process and flowchart modified to require completion of all items on F-013. 09_0122 Process and flowchart modified to reflect process modifications.


Technology Reports Solution Concentration Prediction for Pharmaceutical Crystallization Processes  

E-Print Network (OSTI)

Using Robust Chemometrics and ATR FTIR Spectroscopy Timokleia Togkalidou, Hsien-Hsin Tung,*, Yongkui Sun systems in the presence of impurities and over a wide range of temperature. To our best knowledge in pharmaceutical industry such as crystal size distribution (CSD) and crystal shape of the product pharmaceuticals

Braatz, Richard D.


Functional Polymer Architectures for Solution Processed Organic Light Emitting Diodes  

E-Print Network (OSTI)

through formation of the tetrazole from 4-bromobenzonitrile13 5-(4-Bromophenyl)tetrazole, 7 2-(4-tert- Butylphenyl)-5-(

Poulsen, Daniel Andrew



Solution-processed photovoltaics with advanced characterization and analysis  

E-Print Network (OSTI)

solar cell concepts, ranging from single-crystal silicon to thin-film technologies,solar cells. [4,5] With a highest demonstrated cell efficiency of 17.3%, CdTe- based photovoltaic technology

Duan, Hsin-Sheng



High-efficiency solution processable polymer photovoltaic cells by  

E-Print Network (OSTI)

. Polymer solar cells have shown potential to harness solar energy in a cost-effective way. Significant as a promising cost-effective alternative to silicon-based solar cells1­3 . Some of the important advantages, Los Angeles, California 90095, USA 2 National Renewable Energy Laboratory, Golden, Colorado 80401, USA


Functional Polymer Architectures for Solution Processed Organic Light Emitting Diodes  

E-Print Network (OSTI)

for high energy blue phosphorescent materials. Therefore,this high triplet energy block copolymer as host material, afind materials with sufficiently high triplet energy to be

Poulsen, Daniel Andrew



24 SOLUTIONS! for People, Processes and Paper COATING TECHNOLOGY  

E-Print Network (OSTI)

is available on www.tappi.org · See references at the end of this article NEW CURTAIN COATING TECHNOLOGY OFFERS

Fleming, Paul D. "Dan"


Solution-processed photovoltaics with advanced characterization and analysis  

E-Print Network (OSTI)

at the 37th IEEE Photovoltaics Specialists Conference (D. B. Mitzi, Prog. Photovoltaics 2011, 20, 6. [23] S. Bag,R. Noufi, IEEE J. Photovoltaics 2012, T. Todorov, J. Tang,

Duan, Hsin-Sheng



Processing Science  

NLE Websites -- All DOE Office Websites (Extended Search)

Processing Science Related to the Electron Beam Melting Additive Manufacturing Process October 14 th , 2014 Ryan Dehoff Metal Additive Manufacturing Thrust Lead Manufacturing...


Ultratrace determination of curium  

SciTech Connect

Development of a method for detection of curium at near single atom levels is being undertaken as a part of the Advanced Concepts Project at Argonne National Laboratory with funding from the US Department of Energy, Office of Arms Control and Nonproliferation. Ultratrace determination of curium, with the ability to quantify the fraction that is curium-242, provides a signature method of detecting clandestine reprocessing of recently irradiated uranium targets. Curium initially present in any of a variety of materials such as air filters, solid or liquid process waste, soil, flora, or fauna can be recovered via current chemical separations processing techniques. Using the ultratrace method being developed, such recovered curium will be quantified with thousand-fold higher sensitivity than the best currently available method which is alpha counting. This high sensitivity arises because, on average, a given trivalent curium (Cm{sup 3+}) ion can emit a very large number of fluorescence photons before alpha decay occurs.

Beitz, J.V.



Bearwall Energy Efficient Solutions  

E-Print Network (OSTI)

CATEE Conference November 20, 2014 ENERGY EFFICIENT SOLUTIONS ESL-KT-14-11-06 CATEE 2014: Clean Air Through Efficiency Conference, Dallas, Texas Nov. 18-20 Brief History of Bearwall… Who We Are: ? Manuel Sovero ? Luis Osorio Energy Conservation... Experience: ESL-KT-14-11-06 CATEE 2014: Clean Air Through Efficiency Conference, Dallas, Texas Nov. 18-20 Energy Programs… ESL-KT-14-11-06 CATEE 2014: Clean Air Through Efficiency Conference, Dallas, Texas Nov. 18-20 Bearwall Methodology… Introduction...




Nucleic acid isolation process  

DOE Patents (OSTI)

A method is provided for isolating DNA from eukaryotic cell and flow sorted chromosomes. When DNA is removed from chromosome and cell structure, detergent and proteolytic digestion products remain with the DNA. These products can be removed with organic extraction, but the process steps associated with organic extraction reduce the size of DNA fragments available for experimental use. The present process removes the waste products by dialyzing a solution containing the DNA against a solution containing polyethylene glycol (PEG). The waste products dialyze into the PEG leaving isolated DNA. The remaining DNA has been prepared with fragments containing more than 160 kb. The isolated DNA has been used in conventional protocols without affect on the protocol.

Longmire, Jonathan L. (Los Alamos, NM); Lewis, Annette K. (La Jolla, CA); Hildebrand, Carl E. (Los Alamos, NM)



Soy Solutions | Open Energy Information  

Open Energy Info (EERE)

Soy Solutions Place: Milford, Iowa Zip: 51351 Product: Manufacturer and distributor of 100 percent Soy-Based Biodiesel References: Soy Solutions1 This article is a stub. You can...


DEVELOPMENT Solutions | Open Energy Information  

Open Energy Info (EERE)

DEVELOPMENT Solutions DEVELOPMENT Solutions Jump to: navigation, search Name DEVELOPMENT Solutions Place Reading, England, United Kingdom Zip RG4 8UJ Sector Efficiency Product DEVELOPMENT Solutions (DS) supports investors to realise projects with sustainable applications, including in the areas of environment, energy efficiency, water resource management and other applications for sustainable development. References DEVELOPMENT Solutions[1] LinkedIn Connections CrunchBase Profile No CrunchBase profile. Create one now! This article is a stub. You can help OpenEI by expanding it. DEVELOPMENT Solutions is a company located in Reading, England, United Kingdom . References ↑ "DEVELOPMENT Solutions" Retrieved from "http://en.openei.org/w/index.php?title=DEVELOPMENT_Solutions&oldid=344207


Evaporation of Enriched Uranium Solutions Containing Organophosphates  

SciTech Connect

The Savannah River Site has enriched uranium (EU) solution which has been stored for almost 10 years since being purified in the second uranium cycle of the H area solvent extraction process. The preliminary SRTC data, in conjunction with information in the literature, is promising. However, very few experiments have been run, and none of the results have been confirmed with repeat tests. As a result, it is believed that insufficient data exists at this time to warrant Separations making any process or program changes based on the information contained in this report. When this data is confirmed in future testing, recommendations will be presented.

Pierce, R.A.


Note: This page contains sample records for the topic "determination solution processable" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Preparation of diallyl phthalate prepolymer solutions  

SciTech Connect

A process is claimed for preparing prepolymers of a diallyl phthalate at room temperature. The process is characterized by the fact that the solution of a diallyl phthalate alone or a diallyl phthalate and another copolymerizable monomer, in a liquid ketone at ambient temperature, is heated in the presence of a free radical-forming catalyst, preferably hydrogen peroxide, as well as in the presence of a small amount of a strong acid until at least 60% and advantageously at least 90% of the monomer initially present has been converted to the prepolymer.

Not Available



Chemically assisted mechanical refrigeration process  

DOE Patents (OSTI)

There is provided a chemically assisted mechanical refrigeration process including the steps of: mechanically compressing a refrigerant stream which includes vaporized refrigerant; contacting the refrigerant with a solvent in a mixer at a pressure sufficient to promote substantial dissolving of the refrigerant in the solvent in the mixer to form a refrigerant-solvent solution while concurrently placing the solution in heat exchange relation with a working medium to transfer energy to the working medium, said refrigerant-solvent solution exhibiting a negative deviation from Raoult's Law; reducing the pressure over the refrigerant-solvent solution in an evaporator to allow the refrigerant to vaporize and substantially separate from the solvent while concurrently placing the evolving refrigerant-solvent solution in heat exchange relation with a working medium to remove energy from the working medium to thereby form a refrigerant stream and a solvent stream; and passing the solvent and refrigerant stream from the evaporator. 5 figs.

Vobach, A.R.



Chemically assisted mechanical refrigeration process  

DOE Patents (OSTI)

There is provided a chemically assisted mechanical refrigeration process including the steps of: mechanically compressing a refrigerant stream which includes vaporized refrigerant; contacting the refrigerant with a solvent in a mixer at a pressure sufficient to promote substantial dissolving of the refrigerant in the solvent in the mixer to form a refrigerant-solvent solution while concurrently placing the solution in heat exchange relation with a working medium to transfer energy to the working medium, said refrigerant-solvent solution exhibiting a negative deviation from Raoult's Law; reducing the pressure over the refrigerant-solvent solution in an evaporator to allow the refrigerant to vaporize and substantially separate from the solvent while concurrently placing the evolving refrigerant-solvent solution in heat exchange relation with a working medium to remove energy from the working medium to thereby form a refrigerant stream and a solvent stream; and passing the solvent and refrigerant stream from the evaporator. 5 figs.

Vobach, A.R.



Numerical Simulation of Detonation Initiation by the Space-Time Conservation Element and Solution Element Method.  

E-Print Network (OSTI)

??This dissertation is focused on the numerical simulation of the detonation initiation process. The space-time Conservation Element and Solution Element (CESE) method, a novel numerical… (more)

Wang, Bao



Gender determination of avian embryo  

DOE Patents (OSTI)

Disclosed is a method for gender determination of avian embryos. During the embryo incubation process, the outer hard shells of eggs are drilled and samples of allantoic fluid are removed. The allantoic fluids are directly introduced into an ion mobility spectrometer (IMS) for analysis. The resulting spectra contain the relevant marker peaks in the positive or negative mode which correlate with unique mobilities which are sex-specific. This way, the gender of the embryo can be determined.

Daum, Keith A. (Idaho Falls, ID); Atkinson, David A. (Idaho Falls, ID)




SciTech Connect

Due to analytical limitations for the determination of fluoride (F) and chloride (Cl) in a previous anion exchange study, an additional study of the decontamination of Pu from F and Cl by oxalate precipitation, filtration and calcination was performed. Anion product solution from the previous impurity study was precipitated as an oxalate, filtered, and calcined to produce an oxide for analysis by pyrohydrolysis for total Cl and F. Analysis of samples from this experiment achieved the purity specification for Cl and F for the proposed AFS-2 process. Decontamination factors (DF's) for the overall process (including anion exchange) achieved a DF of {approx}5000 for F and a DF of {approx}100 for Cl. Similar experiments where both HF and HCl were spiked into the anion product solution to a {approx}5000 {micro}g /g Pu concentration showed a DF of 5 for F and a DF of 35 for Cl across the combined precipitation-filtration-calcination process steps.

Kyser, E.



Categorical Exclusion Determinations: Washington | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

December 14, 2012 December 14, 2012 CX-009689: Categorical Exclusion Determination Washington River Protection Solutions LLC - Disconnection of Utilities CX(s) Applied: B1.27 Date: 12/14/2012 Location(s): Washington Offices(s): River Protection-Richland Operations Office December 14, 2012 CX-009672: Categorical Exclusion Determination Washington River Protection Solutions LLC - Relocation of Buildings CX(s) Applied: B1.22 Date: 12/14/2012 Location(s): Washington Offices(s): River Protection-Richland Operations Office December 14, 2012 CX-009671: Categorical Exclusion Determination Washington River Protection Solutions LLC - Demolition and Disposal of Buildings CX(s) Applied: B1.23 Date: 12/14/2012 Location(s): Washington Offices(s): River Protection-Richland Operations Office December 14, 2012


Looking for Energy Solutions  

NLE Websites -- All DOE Office Websites (Extended Search)

Governments and Schools: Governments and Schools: Looking for Energy Solutions Turn to an ENERGY STAR ® Service and Product Provider Partner ENERGY STAR Service and Product Providers (SPPs) have the experience and access to the tools needed to implement energy- efficient strategies that are right for you. Following the U.S. Environmental Protection Agency's (EPA) Guidelines for Energy Management, a proven strategy developed from ENERGY STAR partner successes, your organization can gain control of energy expenses and demonstrate environmental leadership. SPPs can help you assess your energy performance and recommend low-cost upgrades, cost-effective investments, and longer-term strategies that make the most sense for you. ENERGY STAR SPPs make it easy for you to care for your constituents, your facilities, and your finances.


Various Boussinesq solitary wave solutions  

SciTech Connect

The generalized Boussinesq (gB) equations have been used to model nonlinear wave evolution over variable topography and wave interactions with structures. Like the KdV equation, the gB equations support a solitary wave solution which propagates without changing shape, and this solitary wave is often used as a primary test case for numerical studies of nonlinear waves using either the gB or other model equations. Nine different approximate solutions of the generalized Boussinesq equations are presented with simple closed form expressions for the wave elevation and wave speed. Each approximates the free propagation of a single solitary wave, and eight of these solutions are newly obtained. The author compares these solutions with the well known KdV solution, Rayleigh`s solution, Laitone`s higher order solution, and ``exact`` numerical integration of the gB equations. Existing experimental data on solitary wave shape and wave speed are compared with these models.

Yates, G.T. [Univ. of Hong Kong (Hong Kong). Dept. of Mechanical Engineering



Radioactive waste processing apparatus  

DOE Patents (OSTI)

Apparatus for use in processing radioactive waste materials for shipment and storage in solid form in a container is disclosed. The container includes a top, and an opening in the top which is smaller than the outer circumference of the container. The apparatus includes an enclosure into which the container is placed, solution feed apparatus for adding a solution containing radioactive waste materials into the container through the container opening, and at least one rotatable blade for blending the solution with a fixing agent such as cement or the like as the solution is added into the container. The blade is constructed so that it can pass through the opening in the top of the container. The rotational axis of the blade is displaced from the center of the blade so that after the blade passes through the opening, the blade and container can be adjusted so that one edge of the blade is adjacent the cylindrical wall of the container, to insure thorough mixing. When the blade is inside the container, a substantially sealed chamber is formed to contain vapors created by the chemical action of the waste solution and fixant, and vapors emanating through the opening in the container. The chamber may be formed by placing a removable extension over the top of the container. The extension communicates with the apparatus so that such vapors are contained within the container, extension and solution feed apparatus. A portion of the chamber includes coolant which condenses the vapors. The resulting condensate is returned to the container by the force of gravity.

Nelson, R.E.; Ziegler, A.A.; Serino, D.F.; Basnar, P.J.



Process Deviation  

NLE Websites -- All DOE Office Websites (Extended Search)

10 Course/Analysis Initiation Process 11_0512 Page 1 of 6 10 Course/Analysis Initiation Process 11_0512 Page 1 of 6 EOTA - Business Process Document Title: Course/Analysis Initiation Process Document Number: ISDP- 010 Rev 11_0512 Document Owner: Elizabeth Sousa Backup Owner: Vickie Pleau Approver(s): Melissa Otero Parent Document: ISDP-002, Training Production Process Notify of Changes: ISD, ITT, MGT Referenced Document(s): ISDF-001 Technical Direction, ISDF-035 Analysis Feasibility Assessment, ISDP-010, Course Analysis Initiation Process, ISDP-015, WBT/ILT/Ex Design Process ISDP-010 Course/Analysis Initiation Process 11_0512 Page 2 of 6 Revision History: Rev. Description of Change 10_0630 Initial Release 11_0512 Modified verbiage for clarification and updated referenced documents.


Process Deviation  

NLE Websites -- All DOE Office Websites (Extended Search)

4 Course Evaluation and Close-out Process 10_0630 Page 1 of 5 4 Course Evaluation and Close-out Process 10_0630 Page 1 of 5 EOTA - Business Process Document Title: Course Evaluation and Close-out Process Document Number: ISDP-014 Rev. 10_0630 Document Owner: Vickie Pleau Backup Owner: Melissa Otero Approver(s): Melissa Otero Parent Document: ISDP-002, Training Production Process Notify of Changes: ISD, ITT, MGT Referenced Document(s): ISDF-011, ISD History File Acceptance, ISDF-012, ISD History File Checklist ISDP-014 Course Evaluation and Close-out Process 10_0630 Page 2 of 5 Revision History: Rev. Description of Change 10_0630 Initial Release ISDP-014 Course Evaluation and Close-out Process 10_0630 Page 3 of 5 I. Purpose To effectively plan and control the process for evaluating and finalizing EOTA ILT, EX and WBT training products, assuring


Thermal Processes  

Energy.gov (U.S. Department of Energy (DOE))

Some thermal processes use the energy in various resources, such as natural gas, coal, or biomass, to release hydrogen, which is part of their molecular structure. In other processes, heat, in...


Photolytic Processes  

Energy.gov (U.S. Department of Energy (DOE))

Photolytic processes use the energy in sunlight to separate water into hydrogen and oxygen. These processes are in the very early stages of research but offer long-term potential for sustainable...


Microsoft Word - Advanced Solution Verification of CFD Solutions...  

NLE Websites -- All DOE Office Websites (Extended Search)

of a software implementation of a numerical algorithm is evaluated, typically by comparison against an exact solution. For t he p urpose o f comparison, the new verification...


Salinity gradient solar pond technology applied to potash solution mining  

SciTech Connect

A solution mining facility at the Eddy Potash Mine, Eddy County, New Mexico has been proposed that will utilize salinity gradient solar pond (SGSP) technology to supply industrial process thermal energy. The process will include underground dissolution of potassium chloride (KCl) from pillars and other reserves remaining after completion of primary room and pillar mining using recirculating solutions heated in the SGSP. Production of KCl will involve cold crystallization followed by a cooling pond stage, with the spent brine being recirculated in a closed loop back to the SGSP for reheating. This research uses SGSP as a renewable, clean energy source to optimize the entire mining process, minimize environmental wastes, provide a safe, more economical extraction process and reduce the need for conventional processing by crushing, grinding and flotation. The applications of SGSP technology will not only save energy in the extraction and beneficiation processes, but also will produce excess energy available for power generation, desalination, and auxiliary structure heating.

Martell, J.A.; Aimone-Martin, C.T.



Solar Choice Solutions Inc | Open Energy Information  

Open Energy Info (EERE)

Solutions Inc Jump to: navigation, search Name: Solar Choice Solutions Inc. Place: Calabasas, California Zip: 91302 Sector: Solar Product: Solar Choice Solutions Inc. is an...


Continuous countercurrent membrane column for the separation of solute/solvent and solvent/solvent systems  

DOE Patents (OSTI)

A reverse osmosis membrane process or hybrid membrane - complementary separator process for producing enriched product or waste streams from concentrated and dilute feed streams for both solvent/solvent and solute/solvent systems is described.

Nerad, Bruce A. (Longmont, CO); Krantz, William B. (Boulder, CO)



IID Energy - PV Solutions Rebate Program | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

PV Solutions Rebate Program PV Solutions Rebate Program IID Energy - PV Solutions Rebate Program < Back Eligibility Commercial Industrial Local Government Nonprofit Residential State Government Savings Category Solar Buying & Making Electricity Maximum Rebate PBI Incentive max: 550,000 for the 5-year period (110,000/year) Program Info State California Program Type Utility Rebate Program Rebate Amount 2013 program is closed Provider Imperial Irrigation District '''''IID accepted applications for the 2013 PV Solutions Program from Jan. 2, 2013 - Jan. 31, 2013. Winners were determined via lottery. The program is now closed for the remainder of 2013, but another funding round is expected in 2014. ''''' Through the PV Solutions Rebate Program, Imperial Irrigation District (IID) provides rebates to its residential and commercial customers who install


Magnetic Particle Process Improvement  

SciTech Connect

The magnetic particle testing process is performed to find linear, surface and near surface discontinuities in ferromagnetic test materials. A wet fluorescent method is used at Honeywell Federal Manufacturing & Technologies (FM&T). This method employs a liquid carrier mixed with iron oxide particles in suspension, and the particles used in the method are coated with a fluorescent dye to make them visible under a black light. The process in its current state employs the use of a tank of liquid solution of a mineral oil carrier with iron oxide particles in suspension. The change to the use of an aerosol delivery system with the same material reduces the amount of waste involved in the process while preserving the sensitivity of the testing, shortens the flowtime for the test, and saves labor and material costs.

Hubert, R.R.


Note: This page contains sample records for the topic "determination solution processable" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Process Deviation  

NLE Websites -- All DOE Office Websites (Extended Search)

5 WBT/ILT/EX Course Design Process 10_0630 Page 1 of 6 5 WBT/ILT/EX Course Design Process 10_0630 Page 1 of 6 EOTA - Business Process Document Title: WBT/ILT/EX Course Design Process Document Number: ISDP-015 Rev. 10_0630 Document Owner: Elizabeth Sousa Backup Owner: Melissa Otero Approver(s): Melissa Otero Parent Document: ISDP-002, Training Production Process Notify of Changes: ISD, ITT, MGT Referenced Document(s): ISDF-046 Training Design/Development Summary, ISDF-004 Design Document, ISDF-006A WBT Script Template, ISDF- 007 Lesson Plan Template, ISDF-012, ISD History File Checklist ISDP-015 WBT/ILT/EX Course Design Process 10_0630 Page 2 of 6 Revision History: Rev. Description of Change 10_0630 Initial Release ISDP-015 WBT/ILT/EX Course Design Process 10_0630 Page 3 of 6


Process Deviation  

NLE Websites -- All DOE Office Websites (Extended Search)

7 Exercise Development Process 11_0414 Page 1 of 8 7 Exercise Development Process 11_0414 Page 1 of 8 EOTA - Business Process Document Title: Exercise Development Process Document Number: ISDP-017 Revision 11_0414 Document Owner: Elizabeth Sousa Backup Owner: Melissa Otero Approver(s): Melissa Otero Parent Document: ISDP-002, Training Product Process Notify of Changes: ISD, ITT, MGT Referenced Document(s): ISDF-001 Technical Direction, ISDF-004 Design Document, ISDF-006 WBT Script Template, ISDF-007 Lesson Plan Template, ITTP-016 WBT Programming ISDP-017 Exercise Development Process 11_0414 Page 2 of 8 Revision History: Rev. Description of Change 10_0630 Initial Release 11_0223 Made changes to accurately reflect TPP. 11_0414 Added Derivative Classifier to step 12.0 ISDP-017 Exercise Development Process 11_0414 Page 3 of 8


Process Deviation  

NLE Websites -- All DOE Office Websites (Extended Search)

5 Website Development-Maintenance Process 11_0419Page 1 of 6 5 Website Development-Maintenance Process 11_0419Page 1 of 6 EOTA - Business Process Document Title: Website Development-Maintenance Process Document Number: ITTP-015 Rev. 11_0419 Document Owner: Benjamin Aragon Backup Owner: Melissa Otero Approver(s): Melissa Otero Parent Document: Q-001, Quality Manual Notify of Changes: ITT Referenced Document(s): ITTF-016 Website Development/Maintenance Log, ISDP-002 Training Production Process ITTP-015 Website Development-Maintenance Process 11_0419Page 2 of 6 Revision History: Rev. Description of Change A Initial Release 11_0419 Deleted decision point 2.1 and 2.2, incorporated Notifying Requester into step 2.0, modified verbiage for clarification. ITTP-015 Website Development-Maintenance Process 11_0419Page 3 of 6


Information Solutions: Database Applications  

NLE Websites -- All DOE Office Websites (Extended Search)

Database Applications Database Applications Argonne DOE-BES Central User Facility: A-Z People Query Data Warehouse Edits Registration | Registration Processing Security Admin Beamline Component Database System to manage beamline components. Beamline Downtime Report - UES Floor coordinator's downtime entry and reporting system. Beamline Directory | Beamline Entry Administration Links to the beamline websites and to detailed information about the equipment, techniques and contact information of a beamline. Beamline Usage and Scheduling System Long term schedule query and edit. Beamline schedule query and edit. Watchman and PSS data. Budget Proposal System Allows user to submit budget proposals via the web. Beamline Statistics Menu Query, entry and reporting of beamline statistics for ALD use only.


Global and Regional Solutions  

NLE Websites -- All DOE Office Websites (Extended Search)

Robyn Rock Robyn Rock Robyn Rock Manager, BNL Proposal Center rrock@bnl.gov, (631)-344-5468 Photo of Robyn Rock Responsibilities Robyn is responsible for establishing a new Brookhaven National Laboratory (BNL) Proposal Center to support the Laboratory's development of high-quality, competitive proposals to sponsor organizations; for providing oversight for BNL proposal process, organizational performance and optimization in proposal execution; supporting the Laboratory's growth initiative through collaborations with BNL's research organizations and with external funding organizations and partners. She is also responsible for providing leadership in advising BNL's research organizations on funding opportunity requirements. Experience Robyn's strengths include 15 years of experience in Government


Determining orientation and direction of DNA sequences  

DOE Patents (OSTI)

Determining orientation and direction of DNA sequences. A method by which fluorescence in situ hybridization can be made strand specific is described. Cell cultures are grown in a medium containing a halogenated nucleotide. The analog is partially incorporated in one DNA strand of each chromatid. This substitution takes place in opposite strands of the two sister chromatids. After staining with the fluorescent DNA-binding dye Hoechst 33258, cells are exposed to long-wavelength ultraviolet light which results in numerous strand nicks. These nicks enable the substituted strand to be denatured and solubilized by heat, treatment with high or low pH aqueous solutions, or by immersing the strands in 2.times.SSC (0.3M NaCl+0.03M sodium citrate), to name three procedures. It is unnecessary to enzymatically digest the strands using Exo III or another exonuclease in order to excise and solubilize nucleotides starting at the sites of the nicks. The denaturing/solubilizing process removes most of the substituted strand while leaving the prereplication strand largely intact. Hybridization of a single-stranded probe of a tandem repeat arranged in a head-to-tail orientation will result in hybridization only to the chromatid with the complementary strand present.

Goodwin, Edwin H. (Los Alamos, NM); Meyne, Julianne (Los Alamos, NM)



Is Nuclear Energy the Solution?  

E-Print Network (OSTI)

009-0270-y Is Nuclear Energy the Solution? Milton H. Saier &in the last 50 years, nuclear energy subsidies have totaledadministration, the Global Nuclear Energy Partnership (GNEP)

Saier, Milton H.; Trevors, Jack T.



SBY Solutions | Open Energy Information  

Open Energy Info (EERE)

Jump to: navigation, search Name: SBY Solutions Place: Israel Zip: 42836 Sector: Solar Product: Solar panel installer, mainly focusing on rooftops. References: SBY...


Goal-Driven business process derivation  

Science Journals Connector (OSTI)

Solutions to the problem of deriving business processes from goals are critical in addressing a variety of challenges facing the services and business process management community, and in particular, the challenge of quickly generating large numbers ... Keywords: business process, capabilities, goals, tasks

Aditya K. Ghose; Nanjangud C. Narendra; Karthikeyan Ponnalagu; Anurag Panda; Atul Gohad



The Radiolysis of AmVI Solutions  

SciTech Connect

The reduction of bismuthate-produced AmVI by 60Co gamma-rays was measured using post-irradiation UV/Vis spectroscopy. The reduction of AmVI by radiolysis was rapid, producing AmV as the sole product. Relatively low absorbed doses in the ~0.3 kGy range quantitatively reduced a solution of 2.5 x 10-4 M AmVI. The addition of bismuthate to samples during irradiation did not appear to protect AmVI from radiolytic reduction during these experiments. It was also shown here that AmV is very stable toward radiation. The quantitative reduction of the AmVI concentration here corresponds to 1.4 hours of exposure to a process solution, however the actual americium concentrations will be higher and the expected contact times short when using centrifugal contactors. Thus, the reduction rate found in these initial experiments may not be excessive.

Bruce J. Mincher



High conductivity electrolyte solutions and rechargeable cells incorporating such solutions  

DOE Patents (OSTI)

This invention relates generally to electrolyte solvents for use in liquid or rubbery polymer electrolyte solutions as are used, for example, in electrochemical devices. More specifically, this invention relates to sulfonyl/phospho-compound electrolyte solvents and sulfonyl/phospho-compound electrolyte solutions incorporating such solvents.

Angell, Charles Austen (Mesa, AZ); Zhang, Sheng-Shui (Tucson, AZ); Xu, Kang (Tempe, AZ)



High conductivity electrolyte solutions and rechargeable cells incorporating such solutions  

DOE Patents (OSTI)

This invention relates generally to electrolyte solvents for use in liquid or rubbery polymer electrolyte solutions as are used, for example, in electrochemical devices. More specifically, this invention relates to sulfonyl/phospho-compound electrolyte solvents and sulfonyl/phospho-compound electrolyte solutions incorporating such solvents. 9 figs.

Angell, C.A.; Zhang, S.S.; Xu, K.



Observables of Macdonald processes  

E-Print Network (OSTI)

We present a framework for computing averages of various observables of Macdonald processes. This leads to new contour--integral formulas for averages of a large class of multilevel observables, as well as Fredholm determinants for averages of two different single level observables.

Alexei Borodin; Ivan Corwin; Vadim Gorin; Shamil Shakirov



Categorical Exclusion Determination Form  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

n rgy n rgy Categorical Exclusion Determination Form Proposed Action Title: (0474-1555) University of Colorado - Boulder - Wafer-Level Sub-Module Integrated DCfDC Converter Program or Field Office: Advanced Research Projects Agency - Energy LocationCs) CCity/County/State): Colorado, Maine, Virginia Proposed Action Description: Funding will support development of a planar, wafer-level sub-module integrated converter (SubMIC) device that can be integrated into various types of photovoltaic (PV) modules to enable low-cost maximum power point tracking at high power processing efficiencies. Proposed work consists of indoor laboratory-based research and development (R&D), microfabrication activities, and analytical research, including: (1) simulated modeling and design of SubMIC components and integrated units, (2) development, fabrication, testing, and optimization


Categorical Exclusion Determination Form  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

of n y of n y Categorical Exclusion Determination Form Proposed Action Title: (0471-1607) University of Florida - Solar Thermochemical Fuel Production via a Novel Low Pressure, Magnetically Stabilized, Non-Volatile Iron Oxide Looping Process Program or Field Office: Advanced Research Projects Agency - Energy LocationCs) CCity/County/State): Gainesville, FL Proposed Action Description: University of Florida proposes to develop a novel solar thermochemical reactor with inputs of water, recycled carbon dioxide (C02), and concentrated solar energy to cost-effectively produce Syngas, a renewable, carbon-neutral fuel. Project activities will include: (1) modeling, design, and fabrication of a high efficiency 1 OkW reactor prototype; (2) test analysis of bench-scale


GE Lighting Solutions: Proposed Penalty (2013-SE-4901) | Department of  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

GE Lighting Solutions: Proposed Penalty (2013-SE-4901) GE Lighting Solutions: Proposed Penalty (2013-SE-4901) GE Lighting Solutions: Proposed Penalty (2013-SE-4901) March 5, 2013 DOE alleged in a Notice of Proposed Civil Penalty that General Electric Lighting Solutions manufactured and distributed noncompliant traffic signal modules in the U.S. Federal law subjects manufacturers and private labelers to civil penalties if those parties distribute in the U.S. products that do not meet applicable energy conservation standards. This civil penalty notice advises the company of the potential penalties and DOE's administrative process, including the company's right to a hearing. GE Lighting Solutions: Proposed Penalty (2013-SE-4901) More Documents & Publications Act One: NPCP (2013-CE-49001) Excellence Opto: Proposed Penalty (2013-CE-49002)


Engineered Solutions: Proposed Penalty (2010-CE-2112) | Department of  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Engineered Solutions: Proposed Penalty (2010-CE-2112) Engineered Solutions: Proposed Penalty (2010-CE-2112) Engineered Solutions: Proposed Penalty (2010-CE-2112) September 8, 2010 DOE alleged in a Notice of Proposed Civil Penalty that Engineered Solutions, Inc. failed to certify a dehumidifier as compliant with the applicable energy conservation standards. DOE regulations require a manufacturer (which includes importers) to submit reports certifying that its products have been tested and meet the applicable energy conservation standards. This civil penalty notice advises the company of the potential penalties and DOE's administrative process, including the company's right to a hearing. Engineered Solutions: Proposed Penalty (2010-CE-2112) More Documents & Publications Basement Systems: Proposed Penalty (2010-CE-2110)


Methods of pretreating comminuted cellulosic material with carbonate-containing solutions  

DOE Patents (OSTI)

Methods of pretreating comminuted cellulosic material with an acidic solution and then a carbonate-containing solution to produce a pretreated cellulosic material are provided. The pretreated material may then be further treated in a pulping process, for example, a soda-anthraquinone pulping process, to produce a cellulose pulp. The pretreatment solutions may be extracted from the pretreated cellulose material and selectively re-used, for example, with acid or alkali addition, for the pretreatment solutions. The resulting cellulose pulp is characterized by having reduced lignin content and increased yield compared to prior art treatment processes.

Francis, Raymond



Process Deviation  

NLE Websites -- All DOE Office Websites (Extended Search)

5 Functional/Job/Task Analysis Process 11_0718 Page 1 of 8 5 Functional/Job/Task Analysis Process 11_0718 Page 1 of 8 EOTA - Business Process Document Title: Functional/Job/Task Analysis Process Document Number: ISDP-005 Rev 11_0718 Document Owner: Elizabeth Sousa Backup Owner: Melissa Otero Approver(s): Melissa Otero Parent Document: Q-001, Quality Manual Notify of Changes: PM2 Referenced Document(s): ISDF-XXX Vision User Guide (currently being developed ) ISDP-005 Functional/Job/Task Analysis Process 11_0718 Page 2 of 8 Revision History: Rev. Description of Change 08_0410 Initial Release 10_0630 Process modified to match steps within the TPP 11_0718 Minor editorial changes; changed step 8.0 from Task-to-Training Matrix to "Analysis"-to-Training Matrix.


Unique Hardware and Software Data Acquisition and Processing...  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

Hardware and Software Data Acquisition and Processing Solutions in a Small Engine Test Cell for Enhanced Kinetic Engine Modeling Accuracy Unique Hardware and Software Data...

Note: This page contains sample records for the topic "determination solution processable" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Process for decomposing lignin in biomass  

SciTech Connect

A mild inexpensive process for treating lignocellulosic biomass involves oxidative delignification of wood using an aqueous solution prepared by dissolving a catalytic amount of manganese (III) acetate into water and adding hydrogen peroxide. Within 4 days and without agitation, the solution was used to convert poplar wood sections into a fine powder-like delignified, cellulose rich materials that included individual wood cells.

Rector, Kirk Davin; Lucas, Marcel; Wagner, Gregory Lawrence; Kimball, David Bryan; Hanson, Susan Kloek



Proposal Process  

NLE Websites -- All DOE Office Websites (Extended Search)

Testbed Results Current Testbed Research Proposal Process Terms and Conditions Dark Fiber Testbed Performance (perfSONAR) Software & Tools Development Partnerships...


Viscosity Determination by Means of Ultrasonics  

Science Journals Connector (OSTI)

It has been shown that the phenomenon of persistence of diffracted lines in water suspensions of starch at different temperatures and also in water solutions of sucrose at different concentrations and constant temperature is related to the viscosity coefficient of the medium in terms of diffusion theory. Therefore we propose a method for the determination of viscosity coefficients by means of ultrasonics.

F. Fittipaldi; E. Ragozzino



Northern Paths to Aboriginal Self-Determination  

E-Print Network (OSTI)

are at the forefront of solutions to accommodate the divide between these communities. Aboriginal peoples seek-determination. Since 1380, the Inuit of Greenland have been under Danish rule, and formally Greenland was a colony. The Sami Parliament, however, only has advisory powers to the Norwegian Storting (legislature) and does

Northern British Columbia, University of



SciTech Connect

Filtration within the Actinide Removal Process (ARP) currently limits the throughput in interim salt processing at the Savannah River Site. In this process, batches of salt solution with Monosodium Titanate (MST) sorbent are concentrated by crossflow filtration. The filtrate is subsequently processed to remove cesium in the Modular Caustic Side Solvent Extraction Unit (MCU) followed by disposal in saltstone grout. The concentrated MST slurry is washed and sent to the Defense Waste Processing Facility (DWPF) for vitrification. During recent ARP processing, there has been a degradation of filter performance manifested as the inability to maintain high filtrate flux throughout a multi-batch cycle. The objectives of this effort were to characterize the feed streams, to determine if solids (in addition to MST) are precipitating and causing the degraded performance of the filters, and to assess the particle size and rheological data to address potential filtration impacts. Equilibrium modelling with OLI Analyzer{sup TM} and OLI ESP{sup TM} was performed to determine chemical components at risk of precipitation and to simulate the ARP process. The performance of ARP filtration was evaluated to review potential causes of the observed filter behavior. Task activities for this study included extensive physical and chemical analysis of samples from the Late Wash Pump Tank (LWPT) and the Late Wash Hold Tank (LWHT) within ARP as well as samples of the tank farm feed from Tank 49H. The samples from the LWPT and LWHT were obtained from several stages of processing of Salt Batch 6D, Cycle 6, Batch 16.

Martino, C.; Herman, D.; Pike, J.; Peters, T.



Acquisition Savings Reporting Process Template  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Savings Reporting Process Savings Reporting Process Reporting Template 083112 FINAL 1 of 7 As of August 28, 2012 ` Process 1 STEP 1 - Select Savings Type You must first determine if the savings is through a Strategic Sourcing process or an Other Acquisition Savings process. If it is Strategic Sourcing, it must satisfy the 8 step definition. If it does not satisfy the eight steps, then it is an Other Acquisition Savings process. 2 STEP 2 - Select Savings Methodology (In Order of Preference) Regardless if it is Strategic Sourcing or an Other Acquisition Savings process, the next step is to determine the savings methodology that will be used to calculate the savings. You must select only one methodology. a. Transactions are not reported as savings in multiple categories.


CX-005496: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

6: Categorical Exclusion Determination 6: Categorical Exclusion Determination CX-005496: Categorical Exclusion Determination Energy Frontiers Research Center (EFRC) - Nanoscale Actinide Materials CX(s) Applied: B3.6 Date: 02/28/2011 Location(s): Aiken, South Carolina Office(s): Environmental Management, Savannah River Operations Office Savannah River National Laboratory will conduct fundamental studies into the solution chemistry of novel actinide complexes and nano-clusters. These studies will focus on the stability, reactivity, and electrochemistry of novel actinide compounds in aqueous and non-aqueous solutions. Spectroscopic, electrochemical and other techniques will be used to determine solution phase species. X-ray diffraction and electron microscopy will be used to identify solid phases that may form as a result of solution


Microfluidic-Based Robotic Sampling System for Radioactive Solutions  

SciTech Connect

A novel microfluidic based robotic sampling system has been developed for sampling and analysis of liquid solutions in nuclear processes. This system couples the use of a microfluidic sample chip with a robotic system designed to allow remote, automated sampling of process solutions in-cell and facilitates direct coupling of the microfluidic sample chip with analytical instrumentation. This system provides the capability for near real time analysis, reduces analytical waste, and minimizes the potential for personnel exposure associated with traditional sampling methods. A prototype sampling system was designed, built and tested. System testing demonstrated operability of the microfluidic based sample system and identified system modifications to optimize performance.

Jack D. Law; Julia L. Tripp; Tara E. Smith; Veronica J. Rutledge; Troy G. Garn; John Svoboda; Larry Macaluso



Caustic Recycle from Hanford Tank Waste Using NaSICON Ceramic Membrane Salt Splitting Process  

SciTech Connect

A family of inorganic ceramic materials, called sodium (Na) Super Ion Conductors (NaSICON), has been studied at Pacific Northwest National Laboratory (PNNL) to investigate their ability to separate sodium from radioactively contaminated sodium salt solutions for treating U.S. Department of Energy (DOE) tank wastes. Ceramatec Inc. developed and fabricated a membrane containing a proprietary NAS-GY material formulation that was electrochemically tested in a bench-scale apparatus with both a simulant and a radioactive tank-waste solution to determine the membrane performance when removing sodium from DOE tank wastes. Implementing this sodium separation process can result in significant cost savings by reducing the disposal volume of low-activity wastes and by producing a NaOH feedstock product for recycle into waste treatment processes such as sludge leaching, regenerating ion exchange resins, inhibiting corrosion in carbon-steel tanks, or retrieving tank wastes.

Fountain, Matthew S.; Kurath, Dean E.; Sevigny, Gary J.; Poloski, Adam P.; Pendleton, J.; Balagopal, S.; Quist, M.; Clay, D.



Modeling the reactive inorganic solute distributions in the groundwater flow systems of the Hanford Site using inverse analytical modeling techniques.  

E-Print Network (OSTI)

??Inverse analytical techniques were used to model solute distributions and determine transport parameters for two flow systems in the Yakima Basalt subgroup at the Hanford… (more)

Adamski, Mark Robert



Diffusion of small solutes in polymer-containing solutions  

Science Journals Connector (OSTI)

...Arsinogallane and Chemical Conversion to Gallium Arsenide ERIN K. BYRNE, LASZLO PARKANYI...yield the rn-V semiconductor gallium arsenide as a finely divided amorphous...the reaction small dusters of gallium arsenide were apparently present in solution...

KL Yam; DK Anderson; RE Buxbaum



What determines cell size?  

E-Print Network (OSTI)

as: Marshall WF, et al. : What determines cell size? BMC7007/10/101 FORUM Open Access What determines cell size?biologists have been wondering what determines the size of



Method of rapid determination of MHD equilibrium properties with the modified version of the SURFAS code  

SciTech Connect

Rapid determination of MHD eqilibrium properties of tokamak plasmas is carried out by means of an approximation method based on the use of database files. These are computed a priori from MHD equilibrium solutions obtained by performing reconstruction to match experimental measurements, which include motional Stark effect (MSE) data. The procedure carries out a single iteration of Newton`s method to determine the poloidal variation of the toroidal plasma current density in the equilibrium form j{sub {phi}} = {minus}2{pi}({mu}{sub 0}Rp{prime} + FF{prime}/R) by representing p{prime}({psi}) and F({psi})F{prime}({psi}) in series expansions of Chebyshev polynomials. The polynominal expansion coefficients are obtained through a least-squares data fitting process similar to that used in the equilibrium reconstruction. Knowing the current density j{phi} allows the determination of the internal q-profile from the MSE data. This important stability parameter is generally unavailable from a current filament model. Numerical results calculated in this approach are compared with those determined from an accurate solution of the Grad-Shafranov equation, subject to a similar set of magnetic and pressure measurement constraints.

Lee, D.K.; Hirshman, S.P. [Oak Ridge National Lab., TN (United States); Okabayashi, M.; Reusch, M.F.; Sun, Y.C. [Princeton Univ., NJ (United States). Plasma Physics Lab.



Monitoring variability of multivariate processes  

Science Journals Connector (OSTI)

The paper focuses on determining changes in process variability of multivariate processes. The problem is compounded by the fact that any of the elements in the variance-covariance matrix of variables could change, leading to a change in the process variability. While it may not be feasible to maintain individual control charts for each element of the variance-covariance matrix, some aggregate measure of the variability criteria could be monitored to initially determine if a change has occurred in the process variability. A couple of aggregate measures are proposed and the performance of these suggested measures is explored through a simulation procedure. Compared to the traditional method, which monitors the determinant of the variance-covariance matrix, these alternatives perform well. The performance measure used is the mean time to first detection of a change in the process variability.

Amitava Mitra; Mark Clark



New Solutions Require New Thinking  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Solutions Require Solutions Require New Thinking America's demand for power threatens to overburden an already congested electric system. The U.S. Department of Energy is addressing these energy challenges with innovative solutions to energy generation. Its Renewable and Distributed Systems Integration (RDSI) Program is helping to alleviate congestion, reduce greenhouse gas emissions, and improve reliability by investigating answers such as * Microgrid technologies * Distributed generation * Two-way communication systems * Demand response programs Reducing Peak Demand The RDSI program aims to reduce peak load on distribution feeders 20% by 2015. To help achieve this goal, RDSI is sponsoring demonstration projects nationwide. From California to New York, these projects are


K2 Energy Solutions formerly Peak Energy Solutions | Open Energy  

Open Energy Info (EERE)

Energy Solutions formerly Peak Energy Solutions Energy Solutions formerly Peak Energy Solutions Jump to: navigation, search Name K2 Energy Solutions (formerly Peak Energy Solutions) Place Henderson, Nevada Zip 89074 Product Nevada-based designer and fabricator of Lithium Iron Phosphate (LFP) batteries for such applications as EVs, power tools and larger-scale storage. Coordinates 38.83461°, -82.140509° Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"ROADMAP","zoom":14,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"350px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":38.83461,"lon":-82.140509,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}


Towards a methodology for the systematic analysis and design of efficient chemical processes: Part 1. From unit operations to elementary process functions  

Science Journals Connector (OSTI)

A successful intensification of a chemical process requires a holistic view of the process and a systematic debottlenecking, which is obtained by identifying and eliminating the main transport resistances that limit the overall process performance and thus can be considered as rate determining steps on the process level. In this paper, we will suggest a new approach that is not based on the classical unit operation concept, but on the analysis of the basic functional principles that are encountered in chemical processes. A review on the history of chemical engineering in general and more specifically on the development of the unit operation concept underlines the outstanding significance of this concept in chemical and process engineering. The unit operation concept is strongly linked with the idea of thinking in terms of apparatuses, using technology off the shelf. The use of such “ready solutions” is of course convenient in the analysis and design of chemical processes; however, it can also be a problem since it inherently reduces the possibilities of process intensification measures. Therefore, we break with the tradition of thinking in terms of “unit apparatuses” and suggest a new, more rigorous function-based approach that focuses on the underlying fundamental physical and chemical processes and fluxes. For this purpose, we decompose the chemical process into so-called functional modules that fulfill specific tasks in the course of the process. The functional modules itself can be further decomposed and represented by a linear combination of elementary process functions. These are basis vectors in thermodynamic state space. Within this theoretical framework we can individually examine possible process routes and identify resistances in individual process steps. This allows us to analyze and propose possible options for the intensification of the considered chemical process.

Hannsjörg Freund; Kai Sundmacher



Chemical process hazards analysis  

SciTech Connect

The Office of Worker Health and Safety (EH-5) under the Assistant Secretary for the Environment, Safety and Health of the US Department (DOE) has published two handbooks for use by DOE contractors managing facilities and processes covered by the Occupational Safety and Health Administration (OSHA) Rule for Process Safety Management of Highly Hazardous Chemicals (29 CFR 1910.119), herein referred to as the PSM Rule. The PSM Rule contains an integrated set of chemical process safety management elements designed to prevent chemical releases that can lead to catastrophic fires, explosions, or toxic exposures. The purpose of the two handbooks, ``Process Safety Management for Highly Hazardous Chemicals`` and ``Chemical Process Hazards Analysis,`` is to facilitate implementation of the provisions of the PSM Rule within the DOE. The purpose of this handbook ``Chemical Process Hazards Analysis,`` is to facilitate, within the DOE, the performance of chemical process hazards analyses (PrHAs) as required under the PSM Rule. It provides basic information for the performance of PrHAs, and should not be considered a complete resource on PrHA methods. Likewise, to determine if a facility is covered by the PSM rule, the reader should refer to the handbook, ``Process Safety Management for Highly Hazardous Chemicals`` (DOE- HDBK-1101-96). Promulgation of the PSM Rule has heightened the awareness of chemical safety management issues within the DOE. This handbook is intended for use by DOE facilities and processes covered by the PSM rule to facilitate contractor implementation of the PrHA element of the PSM Rule. However, contractors whose facilities and processes not covered by the PSM Rule may also use this handbook as a basis for conducting process hazards analyses as part of their good management practices. This handbook explains the minimum requirements for PrHAs outlined in the PSM Rule. Nowhere have requirements been added beyond what is specifically required by the rule.




Density Calculation of Sugar Solutions with the SAFT Model  

Science Journals Connector (OSTI)

Density Calculation of Sugar Solutions with the SAFT Model ... The density calculation has been carried out by applying statistical associating fluid theory (SAFT) equations of state. ... This new method made use of critical temperature, pressure, and volume as well as normal boiling temperature to determine the SAFT parameters for sugars and is now extended to determine the SAFT parameters for d-xylose, sucrose, and sorbitol. ...

Peijun Ji; Wei Feng; Tianwei Tan



HYDROLOGICAL PROCESSES Hydrol. Process. (2011)  

E-Print Network (OSTI)

HYDROLOGICAL PROCESSES Hydrol. Process. (2011) Published online in Wiley Online Library (wileyonlinelibrary.com). DOI: 10.1002/hyp.8056 Hydrological principles for sustainable management of forest of the cleanest and most plentiful freshwater supplies, sustaining many downstream communities. Given the ongoing

Note: This page contains sample records for the topic "determination solution processable" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Fully Solution-Processed Copper Chalcopyrite Thin Film Solar Cells: Materials Chemistry, Processing, and Device Physics  

E-Print Network (OSTI)

CuIn(Se,S) 2 solar cell with a PCE of 11.1% under dark andpower conversion efficiency (PCE) of around 20% among thinAchievement of such high PCE can be largely ascribed to the

Chung, Choong-Heui



Fully Solution-Processed Copper Chalcopyrite Thin Film Solar Cells: Materials Chemistry, Processing, and Device Physics  

E-Print Network (OSTI)

energy sources, the potential of solar energy is the mostuse of solar cells as an energy source [2]. Therefore, thinspread use of solar cells as a renewable energy source [2].

Chung, Choong-Heui



CX-012025: Categorical Exclusion Determination | Department of...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Categorical Exclusion Determination Recovery Act: Slipstream Testing of a Membrane Carbon Dioxide Capture Process for Existing Coal-Fired Power Plants CX(s) Applied: A1, A9,...


CX-012024: Categorical Exclusion Determination | Department of...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Categorical Exclusion Determination Recovery Act: Slipstream Testing of a Membrane Carbon Dioxide Capture Process for Existing Coal-Fired Power Plants CX(s) Applied: A1, A9,...


CX-008998: Categorical Exclusion Determination | Department of...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Categorical Exclusion Determination "Sustainable Manufacturing via Multi-scale Physics-based Process Modeling and Manufacturing-informed Design CX(s) Applied: A9, B3.6...


CX-010908: Categorical Exclusion Determination | Department of...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Determination Bench-Scale Development of a Non-Aqueous Solvent (NAS) Carbon Dioxide (CO2) Capture Process for Coal-Fired Power Plants CX(s) Applied: B3.6 Date: 09252013...


CX-010909: Categorical Exclusion Determination | Department of...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Determination Bench-Scale Development of a Non-Aqueous Solvent (NAS) Carbon Dioxide (CO2) Capture Process for Coal-Fired Power Plants CX(s) Applied: A9, A11 Date: 09252013...


CX-011452: Categorical Exclusion Determination | Department of...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Exclusion Determination Pilot-Scale Evaluation of an Advanced Carbon Sorbent-Based Process for Post-Combustion Carbon Capture CX(s) Applied: A9 Date: 11122013 Location(s):...


Process Deviation  

NLE Websites -- All DOE Office Websites (Extended Search)

2 ILT Course Implementation 11_0512 Page 1 of 8 2 ILT Course Implementation 11_0512 Page 1 of 8 EOTA - Business Process Document Title: ILT Course Implementation Document Number: ISDP-012 Rev. 11_0512 Document Owner: Elizabeth Sousa Backup Owner: Melissa Otero Approver(s): Melissa Otero Parent Document: ISDP-002, Training Production Process Notify of Changes: ISD, ITT, MGT Referenced Document(s): ISDF-007 Lesson Plan Template, ISDF-014 Course Announcement, ISDF-010, After Action Report, ISDF-008 ILT Student Feedback Survey, ISDF-009, Design/Development Review Checklist, ITTF-014 Publication Review and Approval, ISDF-048, After Action Report Calculation Template, ISDP-011, Exercise Course Implementation Process, ITTP-015 Website Development/Maintenance Process, ISDF-015, ILT/EX Course Support Checklist


Macdonald processes  

E-Print Network (OSTI)

Macdonald processes are probability measures on sequences of partitions defined in terms of nonnegative specializations of the Macdonald symmetric functions and two Macdonald parameters q,t ? [0,1). We prove several results ...

Borodin, Alexei


Ionic Processes  

Science Journals Connector (OSTI)

Processes based on the properties of ions, encountered in brackish and seawater, are described and discussed in this chapter. Whereas in distillation the amount and kind of salts contained in the raw feed wate...

Anthony A. Delyannis; Eurydike A. Delyannis



Final Report - Montana State University - Microbial Activity and Precipitation at Solution-Solution Mixing Zones in Porous Media  

SciTech Connect

Background. The use of biological and chemical processes that degrade or immobilize contaminants in subsurface environments is a cornerstone of remediation technology. The enhancement of biological and chemical processes in situ, involves the transport, displacement, distribution and mixing of one or more reactive agents. Biological and chemical reactions all require diffusive transport of solutes to reaction sites at the molecular scale and accordingly, the success of processes at the meter-scale and larger is dictated by the success of phenomena that occur at the micron-scale. However, current understanding of scaling effects on the mixing and delivery of nutrients in biogeochemically dynamic porous media systems is limited, despite the limitations this imposes on the efficiency and effectiveness of the remediation challenges at hand. Objectives. We therefore proposed to experimentally characterize and computationally describe the growth, evolution, and distribution of microbial activity and mineral formation as well as changes in transport processes in porous media that receive two or more reactive amendments. The model system chosen for this project was based on a method for immobilizing 90Sr, which involves stimulating microbial urea hydrolysis with ensuing mineral precipitation (CaCO3), and co-precipitation of Sr. Studies at different laboratory scales were used to visualize and quantitatively describe the spatial relationships between amendment transport and consumption that stimulate the production of biomass and mineral phases that subsequently modify the permeability and heterogeneity of porous media. Biomass growth, activity, and mass deposition in mixing zones was investigated using two-dimensional micro-model flow cells as well as flow cells that could be analyzed using synchrotron-based x-ray tomography. Larger-scale flow-cell experiments were conducted where the spatial distribution of media properties, flow, segregation of biological activity and impact on ancillary constituents (i.e., Sr) was determined. Model simulations accompanied the experimental efforts. Benefits and Outcomes of the Project. The research contributed towards defining the key physical, chemical, and biological processes influencing the form and mobility of DOE priority contaminants (e.g., 60Co, 90Sr, U) in the subsurface. The work conducted and reported herein, will in the future (i) contribute to controlling the juxtaposition of microbial activity, contaminants and amendments, (ii) promote new strategies for delivering amendments, and (iii) allow new approaches for modifying permeability and flow in porous media. We feel that the work has already translated directly to improving the efficiency of amendment based remediation strategies. Products. The results of the project have been published in a number of peer reviewed journal articles. The abstracts and citations to those articles, given in section 2.0 below, make up the bulk of this final report.

Gerlach, Robin [Montana State University



Waste immobilization process development at the Savannah River Plant  

SciTech Connect

Processes to immobilize various wasteforms, including waste salt solution, transuranic waste, and low-level incinerator ash, are being developed. Wasteform characteristics, process and equipment details, and results from field/pilot tests and mathematical modeling studies are discussed.

Charlesworth, D L




E-Print Network (OSTI)

QUANTIFYING THE CONVERGENCE TIME OF DISTRIBUTED DESIGN PROCESSES Erich Devendorf Research Engineer design processes. In distributed design, large systems are decomposed into smaller, coupled design individual objectives. The number of iterations required to reach equilibrium solutions in distributed design

Lewis, Kemper E.


Hara Environmental and Energy Management Solution | Open Energy Information  

Open Energy Info (EERE)

Hara Environmental and Energy Management Solution Hara Environmental and Energy Management Solution Jump to: navigation, search Tool Summary Name: Hara Environmental and Energy Management Solution Agency/Company /Organization: Hara Phase: Create a Vision, Determine Baseline, "Evaluate Options and Determine Feasibility" is not in the list of possible values (Bring the Right People Together, Create a Vision, Determine Baseline, Evaluate Options, Develop Goals, Prepare a Plan, Get Feedback, Develop Finance and Implement Projects, Create Early Successes, Evaluate Effectiveness and Revise as Needed) for this property., Develop Goals, "Perpare a Plan" is not in the list of possible values (Bring the Right People Together, Create a Vision, Determine Baseline, Evaluate Options, Develop Goals, Prepare a Plan, Get Feedback, Develop Finance and Implement Projects, Create Early Successes, Evaluate Effectiveness and Revise as Needed) for this property., "Implement the Plan" is not in the list of possible values (Bring the Right People Together, Create a Vision, Determine Baseline, Evaluate Options, Develop Goals, Prepare a Plan, Get Feedback, Develop Finance and Implement Projects, Create Early Successes, Evaluate Effectiveness and Revise as Needed) for this property., "Evaluate Effectiveness and Revise" is not in the list of possible values (Bring the Right People Together, Create a Vision, Determine Baseline, Evaluate Options, Develop Goals, Prepare a Plan, Get Feedback, Develop Finance and Implement Projects, Create Early Successes, Evaluate Effectiveness and Revise as Needed) for this property.


Sol Solution | Open Energy Information  

Open Energy Info (EERE)

Solution Solution Jump to: navigation, search Name Sol Solution Place Los Gatos, California Zip 95030 Sector Solar Product Rainbow Concentrator, Current matching multijunction Solar Cell Year founded 2008 Website http://www.Sol-Solution.net Coordinates 37.216351719361°, -121.9694852829° Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"ROADMAP","zoom":14,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"350px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":37.216351719361,"lon":-121.9694852829,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}


Natural Solutions | Open Energy Information  

Open Energy Info (EERE)

Natural Solutions Natural Solutions Jump to: navigation, search Logo: Natural Solutions Name Natural Solutions Address 3715 Briarwood Dr. Place Cedar Falls, Iowa Zip 50613 Sector Solar Product solar and wind systems Phone number 319-277-7842 Website http://www.naturalsolutions-sk Coordinates 42.5048475°, -92.434048° Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"ROADMAP","zoom":14,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"350px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":42.5048475,"lon":-92.434048,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}


Heinsight Solutions | Open Energy Information  

Open Energy Info (EERE)

Heinsight Solutions Heinsight Solutions Jump to: navigation, search Logo: Heinsight Solutions Name Heinsight Solutions Address 217 Pine Street Place Fort Collins, Colorado Zip 80524 Sector Efficiency Product Skylight and solar water heating installation Website http://www.heinsightsolutions. Coordinates 40.5891279°, -105.0765009° Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"ROADMAP","zoom":14,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"350px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":40.5891279,"lon":-105.0765009,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}


Aqueous Solutions and Neutron Scattering  

Science Journals Connector (OSTI)

The application of neutron diffraction techniques to aqueous solutions is described, and a framework involving the use of isotopic substitution is set up to illustrate the scope of the method. Specific applications described include a study of glassy ...

G. W. Neilson; J. E. Enderby



Is Nuclear Energy the Solution?  

E-Print Network (OSTI)

10.1007/s11270-009-0270-y Is Nuclear Energy the Solution?MHS) attended a lecture on “Nuclear Responsibility” on theof the Alliance for Nuclear Responsibility. The information

Saier, Milton H.; Trevors, Jack T.


Note: This page contains sample records for the topic "determination solution processable" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Set-valued solutions for non-ideal detonation  

E-Print Network (OSTI)

The existence and structure of steady gaseous detonation propagating in a packed bed of solid inert particles are analyzed in the one-dimensional approximation by taking into consideration frictional and heat losses between the gas and the particles. A new formulation of the governing equations is introduced that eliminates the well-known difficulties with numerical integration across the sonic singularity in the reactive Euler equations. The new algorithm allows us to determine that the detonation solutions as the loss factors are varied have a set-valued nature at low detonation velocities when the sonic constraint disappears from the solutions. These set-valued solutions correspond to a continuous spectrum of the eigenvalue problem that determines the velocity of the detonation.

Semenko, Roman; Kasimov, Aslan; Ermolaev, Boris



Removal of mercury from solids using the potassium iodide/iodine leaching process  

SciTech Connect

Potassium iodide (KI) and iodine (I{sub 2}) leaching solutions have been evaluated for use in a process for removing mercury from contaminated mixed waste solids. Most of the experimental work was completed using surrogate waste. During the last quarter of fiscal year 1995, this process was evaluated using an actual mixed waste (storm sewer sediment from the Oak Ridge Y-12 Site). The mercury content of the storm sewer sediment was measured and determined to be approximately 35,000 mg/kg. A solution consisting of 0.2 M I{sub 2} and 0.4 M KI proved to be the most effective leachant used in the experiments when applied for 2 to 4 h at ambient temperature. Over 98% of the mercury was removed from the storm sewer sediment using this solution. Iodine recovery and recycle of the leaching agent were also accomplished successfully. Mathematical model was used to predict the amount of secondary waste in the process. Both surrogate waste and actual waste were used to study the fate of radionuclides (uranium) in the leaching process.

Klasson, K.T.; Koran, L.J. Jr.; Gates, D.D.; Cameron, P.A.



Demianski-Newman solution revisited  

E-Print Network (OSTI)

The derivation of the Demianski-Newman solution within the framework of the Ernst complex formalism is considered. We show that this solution naturally arises as a two-soliton specialization of the axisymmetric multi-soliton electrovacuum metric, and we work out the full set of the corresponding metrical fields and electromagnetic potentials. Some limits and physical properties of the DN space-time are briefly discussed.

J. A. Aguilar-Sanchez; A. A. Garcia; V. S. Manko



Organoactinide chemistry: synthesis, structure, and solution dynamics  

SciTech Connect

This thesis considers three aspects of organoactinide chemistry. In chapter one, a bidentate phosphine ligand was used to kinetically stabilize complexes of the type Cp/sub 2/MX/sub 2/. Ligand redistribution processes are present throughout the synthetic work, as has often been observed in uranium cyclopentadienyl chemistry. The effects of covalent M-L bonding on the solution and solid state properties of U(III) coordination complexes are considered. In particular, the nature of the more subtle interaction between the metal and the neutral ligand are examined. Using relative basicity data obtained in solution, and solid state structural data (and supplemented by gas phase photoelectron measurements), it is demonstrated that the more electron rich U(III) centers engage in significant U ..-->.. L ..pi..-donation. Trivalent uranium is shown to be capable of acting either as a one- or two-electron reducing agent toward a wide variety of unsaturated organic and inorganic molecules, generating molecular classes unobtainable via traditional synthetic approaches, as well as offering an alternative synthetic approach to molecules accessible via metathesis reactions. Ligand redistribution processes are again observed, but given the information concerning ligand lability, this reactivity pattern is applied to the synthesis of pure materials inaccessible from redox chemistry. 214 refs., 33 figs., 10 tabs.

Brennan, J.G.



A Robust Solution Searching Scheme in Genetic Shigeyoshi Tsutsui1  

E-Print Network (OSTI)

of aerospace control system, nuclear power control system, where a kind of robustness against the perturbation of the environmental features are important. In nature, the phenotypic feature of an organism is determined from develop a genetic search scheme which can produce robust solutions. The proposed approach uses the effect

Tsutsui, Shigeyoshi


Elasticity solutions for plane anisotropic functionally graded beams  

E-Print Network (OSTI)

Elasticity solutions for plane anisotropic functionally graded beams H.J. Ding a , D.J. Huang a This paper considers the plane stress problem of generally anisotropic beams with elastic compliance of anisotropic functionally graded plane beams, with the integral constants completely determined from boundary

Wang, Ji


U.S. Department of Energy Categorical Exclusion Determination Form  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Characterization of Process Solutions and Solids Characterization of Process Solutions and Solids Savannah River Site Aiken/Aiken/South Carolina K-area Materials Storage and H-Area Completion continue to request flowsheets for processing solids and liquids in H-Canyon and HB-Line facilities. Laboratory operations involved in flowsheet development include characterization, mixing, and neutralization of aqueous process and product solutions, heating of solids at elevated temperatures, and characterization and dissolution of solids in aqueous solutions. Heating, characterization, and dissolution studies will be performed in radhoods and gloveboxes located in C-wing and F-wing laboratories in 773-A. Characterization studies are also being conducted for MOX and off-site customers. B3.6 - Small-scale research and development, laboratory operations, and pilot projects


Molecular Dynamics Simulations of Solutions at Constant Chemical Potential  

E-Print Network (OSTI)

Molecular Dynamics studies of chemical processes in solution are of great value in a wide spectrum of applications, that range from nano-technology to pharmaceutical chemistry. However, these calculations are affected by severe finite-size effects, such as the solution being depleted as the chemical process proceeds, that influence the outcome of the simulations. To overcome these limitations, one must allow the system to exchange molecules with a macroscopic reservoir, thus sampling a Grand-Canonical ensemble. Despite the fact that different remedies have been proposed, this still represents a key challenge in molecular simulations. In the present work we propose the C$\\mu$MD method, which introduces an external force that controls the environment of the chemical process of interest. This external force, drawing molecules from a finite reservoir, maintains the chemical potential constant in the region where the process takes place. We have applied the C$\\mu$MD method to the paradigmatic case of urea crystall...

Perego, Claudio; Parrinello, Michele



CX-000813: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

813: Categorical Exclusion Determination 813: Categorical Exclusion Determination CX-000813: Categorical Exclusion Determination Energy Frontiers Research Center - Nanoscale Actinide Materials CX(s) Applied: B3.6 Date: 12/16/2009 Location(s): Aiken, South Carolina Office(s): Environmental Management, Savannah River Operations Office Savannah River National Laboratory will conduct fundamental studies into the solution chemistry of novel actinide complexes and nano-clusters. These studies will focus on the stability, reactivity, and electrochemistry of novel actinide compounds in aqueous and non-aqueous solutions. Spectroscopic, electrochemical and other techniques will be used to determine solution phase species. The collective body of work will determine if the chemical and electrochemical properties of the novel


Removal of radium from acidic solutions containing same by adsorption on coal fly ash  

DOE Patents (OSTI)

The invention is a process for the removal of radium from acidic aqueous solutions. In one aspect, the invention is a process for removing radium from an inorganic-acid solution. The process comprises contacting the solution with coal fly ash to effect adsorption of the radium on the ash. The radium-containing ash then is separated from the solution. The process is simple, comparatively inexpensive, and efficient. High radium-distribution coefficients are obtained even at room temperature. Coal fly ash is an inexpensive, acid-resistant, high-surface-area material which is available in large quantities throughout the United States. The invention is applicable, for example, to the recovery of .sup.226 Ra from nitric acid solutions which have been used to leach radium from uranium-mill tailings.

Scheitlin, Frank M. (Oak Ridge, TN)



Process for recovery of palladium from nuclear fuel reprocessing wastes  

DOE Patents (OSTI)

Palladium is selectively removed from spent nuclear fuel reprocessing waste by adding sugar to a strong nitric acid solution of the waste to partially denitrate the solution and cause formation of an insoluble palladium compound. The process includes the steps of: (a) adjusting the nitric acid content of the starting solution to about 10 M; (b) adding 50% sucrose solution in an amount sufficient to effect the precipitation of the palladium compound; (c) heating the solution at reflux temperature until precipitation is complete; and (d) centrifuging the solution to separate the precipitated palladium compound from the supernatant liquid.

Campbell, D.O.; Buxton, S.R.



Categorical Exclusion Determinations: Delaware | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Delaware Delaware Categorical Exclusion Determinations: Delaware Location Categorical Exclusion Determinations issued for actions in Delaware. DOCUMENTS AVAILABLE FOR DOWNLOAD August 12, 2013 CX-011107: Categorical Exclusion Determination High Efficiency Thin Film Fe2SiS4 and Fe2GeS4-based Cells Prepared from Low-Cost Solution CX(s) Applied: B3.6 Date: 08/12/2013 Location(s): Delaware Offices(s): Golden Field Office September 18, 2012 CX-010528: Categorical Exclusion Determination Durability Investigation for Quarternary Phosphonium-based Polymer Hydroxide Exchange Membranes CX(s) Applied: B3.6 Date: 09/18/2012 Location(s): Delaware Offices(s): Advanced Research Projects Agency-Energy September 6, 2012 CX-009147: Categorical Exclusion Determination Delaware State Energy Program Formula Grant Application


DOE Cites Washington TRU Solutions for Nuclear Safety Violations |  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Washington TRU Solutions for Nuclear Safety Violations Washington TRU Solutions for Nuclear Safety Violations DOE Cites Washington TRU Solutions for Nuclear Safety Violations December 22, 2005 - 4:53pm Addthis WASHINGTON, D.C. -- The Department of Energy (DOE) today notified Washington TRU Solutions (WTS) that it will fine the company $192,500 for violations of the department's nuclear safety requirements. The Preliminary Notice of Violation (PNOV) issued today cites a number of deficiencies that led to a series of low-level plutonium uptakes by workers at a WTS mobile facility (MOVER) stationed at the Lawrence Livermore National Laboratory (LLNL) in Livermore, Calif. The violations reflected WTS' limited understanding of the design and operational limitations of the MOVER facility, a portable waste processing facility designed to be


Deposition Process  

NLE Websites -- All DOE Office Websites (Extended Search)

Pulsed Plasma Processing Pulsed Plasma Processing NEW: Downloadable: Invited Talk "Pulsed Metal Plasmas," presented at the 2006 AVS Meeting, San Francisco, California, November 15, 2006. (PDF, file size 8 MB). Plasma Sources for Window Coatings Deposition processes for low-emittance and solar control coatings can be improved through the use of advanced plasma technology developed at LBNL. A new type of constricted glow-discharge plasma source was selected for the 1997 R&D 100 Award. Invented by LBNL researchers Andre Anders, Mike Rubin, and Mike Dickinson, the source was designed to be compatible with industrial vacuum deposition equipment and practice. Construction is simple, rugged and inexpensive. It can operate indefinitely over a wide range of chamber pressure without any consumable parts such as filaments or grids. Several different gases including Argon, Oxygen and Nitrogen have been tested successfully.


Process Deviation  

NLE Websites -- All DOE Office Websites (Extended Search)

3 WBT Course Implementation 11_0512 Page 1 of 7 3 WBT Course Implementation 11_0512 Page 1 of 7 EOTA - Business Process Document Title: WBT Course Implementation Document Number: ISDP-013 Rev. 11_0512 Document Owner: Elizabeth Sousa Backup Owner: Vickie Pleau Approver(s): Melissa Otero Parent Document: ISDP-002, Training Product Process Notify of Changes: ISD, ITT, MGT Referenced Document(s): ISDF-014, Course Announcement Template, ITTF-014, Publication Review and Approval, ISDF-010 After Action Report, ISDF-042 Validation & Acceptance, ISDF-048, After Action Report Calculation Template, ITTP-015, Website Development Maintenance ISDP-013 WBT Course Implementation 11_0512 Page 2 of 7 Revision History: Rev. Description of Change 10_0630 Initial Release 11_0405 Added ISDF-048, After Action Report Calculation Template to process.


Batch sorption of lead (II) from aqueous solutions using natural kaolinite  

Science Journals Connector (OSTI)

The potential to remove lead (II) ions from aqueous solutions using natural kaolinite was investigated. The effects of several parameters including solution pH, adsorbent dose, ionic strength and solution temperature on adsorption were examined. The sorption data followed the Freundlich, Langmuir and Dubinin-Radushkevich isotherms. The adsorption process was spontaneous and endothermic in nature. Dynamics of the sorption process were studied and the values of rate constant of adsorption were calculated. The kaolinite can be used to remove lead (II) ions from aqueous solutions.

Xue-Song Wang




SciTech Connect

This technology overview provides a high-level summary of technologies being investigated and developed by Washington River Protection Solutions (WRPS) to advance Hanford Site tank waste retrieval and processing. Technology solutions are outlined, along with processes and priorities for selecting and developing them.




Two-frequency radiative transfer and asymptotic solution  

E-Print Network (OSTI)

radiative transfer equation has been derived with full mathematical rigor [13,14]. In the case the wave nature of the process and is not just about energy transport. Hence the governing equation cannotTwo-frequency radiative transfer and asymptotic solution Albert C. Fannjiang* Department

Fannjiang, Albert


Diverse neural net solutions to a fault diagnosis problem \\Lambda  

E-Print Network (OSTI)

system solution to a problem of fault diagnosis in a four­stroke marine diesel engine; that of early detection of faulty combustion in an engine cylinder. Recognition of faulty combustion usually requires the intervention of a skilled marine engineer, to undertake the time­ consuming and fallible process of comparing

Sharkey, Amanda


Optimization For Grade Transitions In Polyethylene Solution Polymerization  

E-Print Network (OSTI)

Optimization For Grade Transitions In Polyethylene Solution Polymerization Jun Shi1, Intan Hamdan2 Engineering Carnegie Mellon University 2The Dow Chemical Company #12;Dynamic Optimization Models Grade Transition for LLDPE · Continuous Stirred-Tank Reactor (CSTR) (represents two actual processes) · Assume

Grossmann, Ignacio E.

Note: This page contains sample records for the topic "determination solution processable" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.



E-Print Network (OSTI)

VERIFIABLE ELECTRONIC VOTING SYSTEM: AN OPEN SOURCE SOLUTION Halina Kaminski* and Mark Perry over existing network system. KEY WORDS Free Libre Open Source Software; Electronic Voting; Security in managing the election process through the use of electronic voting systems. While computer scientists

Perry, Mark


Numerical simulation of corneal transport processes  

Science Journals Connector (OSTI)

...describe how these ionic species are interrelated and interact on each other (Kuang et...stroma are derived based on the transport processes developed for electrolytic solutions...from the thermodynamics of irreversible processes. The influence of the flow across the...




SciTech Connect

This report outlines progress in the second 3 months of the first year of the DOE project ''High Resolution Prediction of Gas Injection Process Performance for Heterogeneous Reservoirs.'' The development of an automatic technique for analytical solution of one-dimensional gas flow problems with volume change on mixing is described. The aim of this work is to develop a set of ultra-fast compositional simulation tools that can be used to make field-scale predictions of the performance of gas injection processes. To achieve the necessary accuracy, these tools must satisfy the fundamental physics and chemistry of the displacement from the pore to the reservoir scales. Thus this project focuses on four main research areas: (1) determination of the most appropriate methods of mapping multicomponent solutions to streamlines and streamtubes in 3D; (2) development of techniques for automatic generation of analytical solutions for one-dimensional flow along a streamline; (3) experimental investigations to improve the representation of physical mechanisms that govern displacement efficiency along a streamline; and (4) theoretical and experimental investigations to establish the limitations of the streamline/streamtube approach. In this report they briefly review the status of the research effort in each area. They then give a more in depth discussion of their development of techniques for analytic solutions along a streamline including volume change on mixing for arbitrary numbers of components.

Franklin M. Orr, Jr.



Salmonella detection and critical control point determination during poultry processing  

E-Print Network (OSTI)

was significantly (P control points in turkey plants are warranted prior to implementation of intervention strategies...

Young, Suzanne D.



Exergy analysis of absorber using water/lithium bromide solution  

Science Journals Connector (OSTI)

It is necessary to understand the heat and mass transfer processes and determine the variation of the exergy destruction in the absorber for improving the performance. In this study, the exergy analysis of a coil...

O. Kaynakli



Powerit Solutions | Open Energy Information  

Open Energy Info (EERE)

Powerit Solutions Powerit Solutions Jump to: navigation, search Name Powerit Solutions Address 568 First Ave South Place Seattle, Washington Zip 98104 Sector Efficiency Product Allows business customers to control their energy usage online Website http://www.poweritsolutions.co Coordinates 47.5977906°, -122.3341632° Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"ROADMAP","zoom":14,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"350px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":47.5977906,"lon":-122.3341632,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}


Solar amp Electric Solutions | Open Energy Information  

Open Energy Info (EERE)

amp Electric Solutions Jump to: navigation, search Name: Solar & Electric Solutions Place: Santa Cruz, California Zip: 95062 Sector: Solar Product: Small solar installation firm in...


FT Solutions LLC | Open Energy Information  

Open Energy Info (EERE)

FT Solutions LLC Jump to: navigation, search Name: FT Solutions LLC Place: South Jordan, Utah Zip: 84095 Product: JV between Headwaters Technology Innovation Group and Rentech to...


Washington TRU Solutions Inc | Open Energy Information  

Open Energy Info (EERE)

Solutions Inc Jump to: navigation, search Name: Washington TRU Solutions, Inc. Place: Carlsbad, New Mexico Zip: 88220 Product: New Mexico-based managing and operating contractor...


Interested Parties - Energy Solutions | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

- Energy Solutions EnergySolutions.pdf More Documents & Publications Interested Parties - NRG Energy Interested Parties - Myriant Interested Parties - 1603 Program Discussion...


Funding Opportunity Webinar - Advancing Solutions To Improve...  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

Funding Opportunity Webinar - Advancing Solutions To Improve the Energy Efficiency of US Commercial Buildings Funding Opportunity Webinar - Advancing Solutions To Improve the...


Energy Options Solutions | Open Energy Information  

Open Energy Info (EERE)

Energy Options & Solutions Place: Ann Arbor, Michigan Zip: 48103 Product: Michigan-based alternative energy consultant. References: Energy Options & Solutions1 This article is a...


Blueprint for Sustainability - Sustainable Solutions for Every...  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

Blueprint for Sustainability - Sustainable Solutions for Every Consumer Blueprint for Sustainability - Sustainable Solutions for Every Consumer Highlights of Ford's near, mid, and...


WM Solutions Inc | Open Energy Information  

Open Energy Info (EERE)

Name: WM Solutions Inc Place: Los Angeles, California Product: Owns and operates a landfill gas plant located at Bradley Landfill. References: WM Solutions Inc1 This article...


Categorical Exclusion Determinations: National Energy Technology Laboratory  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

30, 2013 30, 2013 CX-010824: Categorical Exclusion Determination Manufacturing Process for Organic Light-Emitting Diode (OLED) Integrated Substrate CX(s) Applied: B3.6 Date: 07/30/2013 Location(s): New Jersey Offices(s): National Energy Technology Laboratory July 30, 2013 CX-010823: Categorical Exclusion Determination Manufacturing Process for Organic Light-Emitting Diode (OLED) Integrated Substrate CX(s) Applied: B3.6 Date: 07/30/2013 Location(s): Pennsylvania Offices(s): National Energy Technology Laboratory July 30, 2013 CX-010822: Categorical Exclusion Determination Manufacturing Process for Organic Light-Emitting Diode (OLED) Integrated Substrate CX(s) Applied: B3.6 Date: 07/30/2013 Location(s): Illinois Offices(s): National Energy Technology Laboratory July 30, 2013 CX-010821: Categorical Exclusion Determination


Process Deviation  

NLE Websites -- All DOE Office Websites (Extended Search)

1 Exercise Course Implementation 10_0630 Page 1 of 8 1 Exercise Course Implementation 10_0630 Page 1 of 8 EOTA - Business Process Document Title: Exercise Course Implementation Document Number: ISDP-011 Rev. 10_0630 Document Owner: Elizabeth Sousa Backup Owner: Melissa Otero Approver(s): Melissa Otero Parent Document: ISDP-002, Training Production Process Notify of Changes: ISD, ITT, MGT Referenced Document(s): ISDF-004 Design Document, ISDF-006 WBT Script Template, ISDF-007 Lesson Plan Template, ISDP-012, ILT Course Implementation, ISDF-008 ILT Student Feedback Survey, ISDF-010 After Action Report ISDP-011 Exercise Course Implementation 10_0630 Page 2 of 8 Revision History: Rev. Description of Change 10_0630 Initial Release ISDP-011 Exercise Course Implementation 10_0630 Page 3 of 8


Electrolytic Processes  

Energy.gov (U.S. Department of Energy (DOE))

Electrolysis is the process of using electricity to split water into hydrogen and oxygen. This reaction takes place in a unit called an electrolyzer. Electrolyzers can be small, appliance-size equipment and well-suited for small-scale distributed hydrogen production. Research is also under way to examine larger-scale electrolysis that could be tied directly to renewable or other non-greenhouse gas emitting electricity production. Hydrogen production at a wind farm generating electricity is an example of this.


Hydrodynamic solutions for a sonoluminescing gas bubble  

Science Journals Connector (OSTI)

Analytic solutions for a sonoluminescing gas bubble have been obtained which provide density pressure and temperature distributions for the gas inside a bubble oscillating under the ultrasonic field. The solutions have revealed that sonoluminescence should occur just prior to the bubble collapse and its duration is less than 300 ps and that increase and subsequent decrease in the bubble wall acceleration induces the quenching of gas followed by the substantial temperature rise up to 100?000 K which can be regarded as a thermal spike. The gas temperature inside the bubble near collapse is determined primarily by the amount of radiation heat loss. Shock formation during the bubble collapse is questionable because gas density as well as pressure at the bubble center are much greater than those at the bubble wall during this stage. It also turns out that the number of electrons ionized the ion species and the kinetic energy of electrons affect the spectrum of light emission crucially. The spectralradiance calculated is in good agreement with the observed data qualitatively which suggests that the origin of sonoluminescences is bremsstrahlung rather than thermal blackbody radiation. [Work supported by Korea Science and Engineering Foundation.

Ho?Young Kwak; Jung?Hee Na



Issues evaluation process at Rocky Flats Plant  

SciTech Connect

This report describes the issues evaluation process for Rocky Flats Plant as established in July 1990. The issues evaluation process was initiated February 27, 1990 with a Charter and Process Overview for short-term implementation. The purpose of the process was to determine the projects required for completion before the Phased Resumption of Plutonium Operations. To determine which projects were required, the issues evaluation process and emphasized risk mitigation, based on a ranking system. The purpose of this report is to document the early design of the issues evaluation process to record the methodologies used that continue as the basis for the ongoing Issues Management Program at Rocky Flats Plant.

Smith, L.C.



Criticality safety of an annular tank for fissile solution  

SciTech Connect

Experiments performed to determine the criticality safety of annular tanks for storing fissile solutions are described. Six annular tanks were built in four nesting sizes to obtain experimental criticality data which could be used to validate computer codes employed in the design of such a safe storage system for an industrial plant. Each tank had an annular solution region thickness of 38 mm. The height of this region was 2.13 m, held 0.3 m off the floor by a stainless steel skirting. Walls were 6.4 mm-thick type 304L stainless steel. The uranyl nitrate solution contained 357 g U/l and had a density of 1.5 kg/m/sup 3/. The uranium was enriched to 93.2% /sup 235/U with other isotopes: 5.4% /sup 238/U, 1.0% /sup 234/U, and 0.4% /sup 236/U. The solution contained 0.5 molar nitric acid and a total impurity content of less than 1500 ppM. Important neutron absorbers, boron and cadmium, averaged 10 ppM and 30 ppM, respectively. Boron-loaded concrete and boron-loaded plaster were selected for the neutron moderator/absorber interior to the annular tank. Three configurations of tanks and reflector were taken to criticality and are reported. The critical uranium solution height in all tanks containing solution as a function of boron content in earthen interior material, tank array configuration, and other variables. (LCL)

Rothe, R.E.


Note: This page contains sample records for the topic "determination solution processable" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


On a class of exact solutions of the equations of motion of a second grade fluid  

Science Journals Connector (OSTI)

By means of Fourier sine transform, the velocity field corresponding to a flow of a suddenly moved flat plate in a second grade fluid is determined. The adequate solution for the Rayleigh-Stokes problem for th...

Prof. Dr. C. Fetec?u; Prof. J. Zierep



Building America Technology Solutions for New and Existing Homes: Duct Sealing Using Injected Spray Sealant  

Energy.gov (U.S. Department of Energy (DOE))

In this project, the Raleigh Housing Authority worked with Building America team, the Advanced Residential Integrated Solutions Collaborative to determine the most cost-effective ways to reduce duct leakage in its low-rise housing units.


A study of structure and dynamics of polyelectrolyte solutions using flow birefringence measurements  

E-Print Network (OSTI)

Stress optical data from polyelectrolytes (sodium polystyrenesulfonate) in aqueous solutions have been determined using flow birefringence. The stress optical rule was found to be violated in the semidilute unentangled concentration regime...

Chen, Shih Ping



Three-Dimensional Solution Structure of Saccharomyces cerevisiae Reduced Iso-1-cytochrome c  

Science Journals Connector (OSTI)

DIANA calculations, including the use of the redundant angle strategy routine (REDAC) (Güntert & Wüthrich, 1991), were performed following the procedure and with the parameters already used by us for the determination of other solution structures (Banci et al., 1994, 1995). ...

Paolo Baistrocchi; Lucia Banci; Ivano Bertini; Paola Turano; Kara L. Bren; Harry B. Gray



Attractive Interactions between Reverse Aggregates and Phase Separation in Concentrated Malonamide Extractant Solutions  

Science Journals Connector (OSTI)

Using small angle X-ray scattering, conductivity, and phase behavior determination, we show that concentrated solutions of molanamide extractants, dimethyldibutyltetradecylmalonamide (DMDBTDMA), are organized in reverse oligomeric aggregates which have ...

C. Erlinger; L. Belloni; Th. Zemb; C. Madic




E-Print Network (OSTI)

THE EXACT RIEMANN SOLUTIONS TO SHALLOW WATER EQUATIONS EE HAN AND GERALD WARNECKE Abstract. We determine completely the exact Riemann solutions for the shallow water equations with a bottom step on the subcritical and supercritical Froude number of the Riemann initial data as well as the jump of the bottom step


Effective Darcy-scale contact angles in porous media imbibing solutions of various surface tensions  

E-Print Network (OSTI)

Effective Darcy-scale contact angles in porous media imbibing solutions of various surface tensions was to develop and test a methodology to determine whether these surface tension effects predictably alter of 25° for the NaNO3 solution solely on the basis of surface tension contrast. The results of this study

Selker, John


Ozone decomposition in water solutions  

E-Print Network (OSTI)

. Hewes, III; B. S. , Texas ASH University Directed by Dr. R. R. Davison The rate of the decomposition of ozone in water solutions at various pH's and temperatures were ob- tained by an iodometrical method. The orders of the reactions and the reaction...

Hewes, Cecil Grayson



Solutions for a cultivated planet  

Science Journals Connector (OSTI)

... Increasing population and consumption are placing unprecedented demands on agriculture and natural resources. Today, approximately a billion people are chronically malnourished while our agricultural systems are ... substantially while, at the same time, agriculture’s environmental footprint must shrink dramatically. Here we analyse solutions to this dilemma, showing that tremendous progress could be made by halting ...

Jonathan A. Foley; Navin Ramankutty; Kate A. Brauman; Emily S. Cassidy; James S. Gerber; Matt Johnston; Nathaniel D. Mueller; Christine O’Connell; Deepak K. Ray; Paul C. West; Christian Balzer; Elena M. Bennett; Stephen R. Carpenter; Jason Hill; Chad Monfreda; Stephen Polasky; Johan Rockström; John Sheehan; Stefan Siebert; David Tilman; David P. M. Zaks



RWE Solutions | Open Energy Information  

Open Energy Info (EERE)

RWE Solutions RWE Solutions Jump to: navigation, search Name RWE Solutions Place Neu-Isenburg, Germany Zip 63263 Sector Solar Product Germany-based, subsidiary of RWE AG plans, builds and manages energy infrastructure for utilities (power, gas, water, steam, heat and cooling). RWE Solutions through its subsidiaries is invovled in the solar sector Coordinates 50.05652°, 8.695144° Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"ROADMAP","zoom":14,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"350px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":50.05652,"lon":8.695144,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}


Categorical Exclusion Determinations: Savannah River Operations Office |  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

April 16, 2013 April 16, 2013 CX-010322: Categorical Exclusion Determination Research and Development Welding and Brazing Sample Preparation and Activities in Building 723-A CX(s) Applied: B3.6 Date: 04/16/2013 Location(s): South Carolina Offices(s): Savannah River Operations Office April 16, 2013 CX-010321: Categorical Exclusion Determination Destructive Evaluation of Plutonium Storage Can Bundles CX(s) Applied: B3.6 Date: 04/16/2013 Location(s): South Carolina Offices(s): Savannah River Operations Office April 16, 2013 CX-010320: Categorical Exclusion Determination Corrosion Testing in Aqueous Solutions CX(s) Applied: B3.6 Date: 04/16/2013 Location(s): South Carolina Offices(s): Savannah River Operations Office April 15, 2013 CX-010324: Categorical Exclusion Determination 772-F Chase 174 Sprinkler Modification


Categorical Exclusion Determinations: Washington | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

February 1, 2012 February 1, 2012 CX-007984: Categorical Exclusion Determination Explosives Research Capability Expansion, 300 Area, Hanford Site CX(s) Applied: B3.6 Date: 02/01/2012 Location(s): Washington Offices(s): River Protection-Richland Operations Office January 30, 2012 CX-007955: Categorical Exclusion Determination Exe-Guard (Formerly Whitelist) Antivirus Project CX(s) Applied: A1, A9, A11, B1.2, B1.7 Date: 01/30/2012 Location(s): Washington Offices(s): National Energy Technology Laboratory January 27, 2012 CX-007880: Categorical Exclusion Determination Evergreen State Solar Partnership CX(s) Applied: A9, A11 Date: 01/27/2012 Location(s): Washington Offices(s): Golden Field Office January 13, 2012 CX-007980: Categorical Exclusion Determination Washington River Protection Solutions LLC - Proposed Actions For Calendar


Categorical Exclusion Determinations: Savannah River Operations Office |  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

November 29, 2010 November 29, 2010 CX-004808: Categorical Exclusion Determination Flowsheet Evaluation for the Neutralization of High Aluminum ? Low Uranium Used Nuclear Fuel (UNF) Solution CX(s) Applied: B3.6 Date: 11/29/2010 Location(s): Aiken, South Carolina Office(s): Savannah River Operations Office November 29, 2010 CX-004809: Categorical Exclusion Determination Reactive Gas Reprocessing of Used Nuclear Fuel Simulants CX(s) Applied: B3.6 Date: 11/29/2010 Location(s): Aiken, South Carolina Office(s): Savannah River Operations Office November 29, 2010 CX-004806: Categorical Exclusion Determination Volume Measurement of Solids by Gas Pycnometry CX(s) Applied: B3.6 Date: 11/29/2010 Location(s): Aiken, South Carolina Office(s): Savannah River Operations Office November 12, 2010 CX-004805: Categorical Exclusion Determination


Categorical Exclusion Determinations: Oregon | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

December 14, 2011 December 14, 2011 CX-007413: Categorical Exclusion Determination Transforming Photovoltaic Installations Toward Discpatchable, Schedulable Energy Solutions CX(s) Applied: A9, B3.6 Date: 12/14/2011 Location(s): Oregon Offices(s): Golden Field Office December 2, 2011 CX-007355: Categorical Exclusion Determination Modification of Metering Systems in Canby, Oregon CX(s) Applied: B1.7 Date: 12/02/2011 Location(s): Oregon Offices(s): Bonneville Power Administration December 2, 2011 CX-007354: Categorical Exclusion Determination Integration of the Farm Power Tillamook Generating Facility CX(s) Applied: B1.7 Date: 12/02/2011 Location(s): Oregon Offices(s): Bonneville Power Administration December 1, 2011 CX-007358: Categorical Exclusion Determination Integration of the University of Oregon's Cogeneration Project


Categorical Exclusion Determinations: Washington | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

July 26, 2010 July 26, 2010 CX-003272: Categorical Exclusion Determination Washington-City-Everett CX(s) Applied: A1, A9, A11, B1.32, B5.1 Date: 07/26/2010 Location(s): Everett, Washington Office(s): Energy Efficiency and Renewable Energy July 26, 2010 CX-003170: Categorical Exclusion Determination Innovative Phase Change Thermal Energy Storage Solution for Baseload Power CX(s) Applied: B3.6 Date: 07/26/2010 Location(s): Washington Office(s): Energy Efficiency and Renewable Energy, Golden Field Office July 22, 2010 CX-003234: Categorical Exclusion Determination Demolition of Vacant House at Bonneville Power Administration's Ross Complex CX(s) Applied: B1.23 Date: 07/22/2010 Location(s): Clark County, Washington Office(s): Bonneville Power Administration July 21, 2010 CX-003236: Categorical Exclusion Determination


ORISE: Process and Program Evaluation  

NLE Websites -- All DOE Office Websites (Extended Search)

Process and Program Evaluation Process and Program Evaluation As an integral part of producing effective health and safety programs, the Oak Ridge Institute for Science and Education (ORISE) conducts scientific-based process and program evaluation to provide government agencies and organizations with the tools to improve the health of workers and the general public. Whether the goal is to change awareness, attitudes, beliefs, behaviors, policies or systems, ORISE helps determine the right evaluation methods based on specific needs and resources, including: Formative evaluations to assess the problem, target audience needs and guide successful process implementation Assessments to identify unmet needs in programs, organizations or communities Audience evaluations to learn about targeted populations


Optimal data processing for quantum measurements  

E-Print Network (OSTI)

We consider the general measurement scenario in which the ensemble average of an operator is determined via suitable data-processing of the outcomes of a quantum measurement described by a POVM. We determine the optimal processing that minimizes the statistical error of the estimation.

Giacomo Mauro D'Ariano; Paolo Perinotti



Energy solutions—Director Eric Isaacs  

SciTech Connect

Argonne's Director Eric Isaacs talks about the laboratory's efforts for creating new, clean energy solutions.

Eric ISaacs



Energy solutions?Director Eric Isaacs  

ScienceCinema (OSTI)

Argonne's Director Eric Isaacs talks about the laboratory's efforts for creating new, clean energy solutions.

Eric ISaacs



Benchmark Evaluation of Plutonium Nitrate Solution Arrays  

SciTech Connect

In October and November of 1981 thirteen approach-to-critical experiments were performed on a remote split table machine (RSTM) in the Critical Mass Laboratory of Pacific Northwest Laboratory (PNL) in Richland, Washington, using planar arrays of polyethylene bottles filled with plutonium (Pu) nitrate solution. Arrays of up to sixteen bottles were used to measure the critical number of bottles and critical array spacing with a tight fitting Plexiglas{reg_sign} reflector on all sides of the arrays except the top. Some experiments used Plexiglas shells fitted around each bottles to determine the effect of moderation on criticality. Each bottle contained approximately 2.4 L of Pu(NO3)4 solution with a Pu content of 105 g Pu/L and a free acid molarity H+ of 5.1. The plutonium was of low 240Pu (2.9 wt.%) content. These experiments were performed to fill a gap in experimental data regarding criticality limits for storing and handling arrays of Pu solution in reprocessing facilities. Of the thirteen approach-to-critical experiments eleven resulted in extrapolations to critical configurations. Four of the approaches were extrapolated to the critical number of bottles; these were not evaluated further due to the large uncertainty associated with the modeling of a fraction of a bottle. The remaining seven approaches were extrapolated to critical array spacing of 3-4 and 4-4 arrays; these seven critical configurations were evaluation for inclusion as acceptable benchmark experiments in the International Criticality Safety Benchmark Evaluation Project (ICSBEP) Handbook. Detailed and simple models of these configurations were created and the associated bias of these simplifications was determined to range from 0.00116 and 0.00162 {+-} 0.00006 ?keff. Monte Carlo analysis of all models was completed using MCNP5 with ENDF/BVII.0 neutron cross section libraries. A thorough uncertainty analysis of all critical, geometric, and material parameters was performed using parameter perturbation methods. It was found that uncertainty in the impurities in the polyethylene bottles, reflector position, bottle outer diameter, and critical array spacing had the largest effect. The total uncertainty ranged from 0.00651 to 0.00920 ?keff. Evaluation methods and results will be presented and discussed in greater detail in the full paper.

M. A. Marshall; J. D. Bess


Note: This page contains sample records for the topic "determination solution processable" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Alkaline solution absorption of carbon dioxide method and apparatus  

DOE Patents (OSTI)

Disclosed is a method for measuring the concentration of hydroxides (or pH) in alkaline solutions, using the tendency of hydroxides to adsorb CO{sub 2}. The method comprises passing CO{sub 2} over the surface of an alkaline solution in a remote tank before and after measurements of the CO{sub 2} concentration. Comparison of the measurements yields the adsorption fraction from which the hydroxide concentration can be calculated using a correlation of hydroxide or pH to adsorption fraction. A schematic is given of a process system according to a preferred embodiment of the invention. 2 figs.

Hobbs, D.T.



Interactions of Cl? and OH Radical in Aqueous Solution  

Science Journals Connector (OSTI)

There is a considerable controversy surrounding the nature of the Cl?/OH complex in aqueous solution, which appears as a byproduct of the irradiation of salt solutions in nuclear reactor operation, radioactive waste storage, medicine, and environmental problems. ... A similar process in the interfacial environment has been implicated in the production of molecular chlorine from sea salt aerosol, which ultimately could lead to enhanced ozone levels in the marine boundary layer. ... (2, 3) A detailed understanding of this reaction is hindered by uncertainty regarding the nature of the complex between OH and Cl? in aqueous environments. ...

Marat Valiev; Raffaella D’Auria; Douglas J. Tobias; Bruce C. Garrett



Clean Energy Solutions Center | Open Energy Information  

Open Energy Info (EERE)

Clean Energy Solutions Center Clean Energy Solutions Center Jump to: navigation, search Logo: Clean Energy Solutions Center Name Clean Energy Solutions Center Agency/Company /Organization Clean Energy Ministerial Sector Energy Focus Area Non-renewable Energy, Energy Efficiency, Transportation Topics Low emission development planning, -LEDS, -NAMA, -Roadmap, -TNA, Market analysis Resource Type Case studies/examples, Guide/manual, Lessons learned/best practices, Publications, Training materials, Webinar Website http://cleanenergysolutions.or Program Start 2011 References Clean Energy Solutions Center Website[1] Clean Energy Solutions Center Screenshot The Clean Energy Solutions Center helps governments turn clean energy visions into reality. We share policy best practices, data, and analysis


Randa Energy Solutions LLC R A Energy Solutions | Open Energy Information  

Open Energy Info (EERE)

Randa Energy Solutions LLC R A Energy Solutions Randa Energy Solutions LLC R A Energy Solutions Jump to: navigation, search Name Randa Energy Solutions, LLC (R&A Energy Solutions) Place North Ridgeville, Ohio Zip 44039 Product String representation "Ohio-based prov ... alue add power." is too long. References Randa Energy Solutions, LLC (R&A Energy Solutions)[1] LinkedIn Connections CrunchBase Profile No CrunchBase profile. Create one now! This article is a stub. You can help OpenEI by expanding it. Randa Energy Solutions, LLC (R&A Energy Solutions) is a company located in North Ridgeville, Ohio . References ↑ "[ Randa Energy Solutions, LLC (R&A Energy Solutions)]" Retrieved from "http://en.openei.org/w/index.php?title=Randa_Energy_Solutions_LLC_R_A_Energy_Solutions&oldid=350191


One Monopole?Antimonopole Pair Solutions  

Science Journals Connector (OSTI)

We present new classical generalized one monopole?antimonopole pair solutions of the SU(2) Yang?Mills?Higgs theory with the Higgs field in the adjoint representation. We show that in general the one monopole?antimonopole solution need not be solved by imposing m ??winding number to be integer greater than one. We also show that this solution can be solved when m?=?1 by transforming the large distance asymptotic solutions to general solutions that depend on a parameter p. Secondly we show that these large distance asymptotic solutions can be further generalized to the Jacobi elliptic functions. We focus our numerical calculation on the Jacobi elliptic functions solution when the n ??winding number is one and show that this generalized Jacobi elliptic 1?MAP solution possesses lower energy. All these solutions are numerical finite energy non?BPS solutions of the Yang?Mills?Higgs field theory.

Rosy Teh; Khai?Ming Wong



A reverse osmosis treatment process for produced water: optimization, process control, and renewable energy application  

E-Print Network (OSTI)

resources (wind and solar) are analyzed as potential power sources for the process, and an overview of reverse osmosis membrane fouling is presented. A computer model of the process was created using a dynamic simulator, Aspen Dynamics, to determine energy...

Mareth, Brett



Combined transuranic-strontium extraction process  

DOE Patents (OSTI)

The transuranic (TRU) elements neptunium, plutonium and americium can be separated together with strontium from nitric acid waste solutions in a single process. An extractant solution of a crown ether and an alkyl(phenyl)-N,N-dialkylcarbanylmethylphosphine oxide in an appropriate diluent will extract the TRU's together with strontium, uranium and technetium. The TRU's and the strontium can then be selectively stripped from the extractant for disposal.

Horwitz, E. Philip (Naperville, IL); Dietz, Mark L. (Evanston, IL)



Ultrasonic studies in binary solutions of pyridine with water, methanol, and ethanol  

Science Journals Connector (OSTI)

The velocity and absorption of ultrasound at 19.5 MHz were studied as a function of the concentration in binary solutions of pyridine with water methanol and ethanol. In addition the compressibility and volume viscosity were calculated. Molecular processes are suggested to explain the variation of the ultrasonic properties of these binary solutions with respect to concentration.

K. N. Thomas; F. B. Stumpf



High Performance Building Facade Solutions: PIER Final Project Report  

NLE Websites -- All DOE Office Websites (Extended Search)

High Performance Building Facade Solutions: PIER Final Project Report High Performance Building Facade Solutions: PIER Final Project Report Title High Performance Building Facade Solutions: PIER Final Project Report Publication Type Report LBNL Report Number LBNL-4583E Year of Publication 2009 Authors Lee, Eleanor S., Stephen E. Selkowitz, Dennis L. DiBartolomeo, Joseph H. Klems, Robert D. Clear, Kyle Konis, Robert J. Hitchcock, Mehry Yazdanian, Robin Mitchell, and Maria Konstantoglou Date Published 12/2009 Abstract Building façades directly influence heating and cooling loads and indirectly influence lighting loads when daylighting is considered, and are therefore a major determinant of annual energy use and peak electric demand. façades also significantly influence occupant comfort and satisfaction, making the design optimization challenge more complex than many other building systems.


High Performance Building Façade Solutions  

NLE Websites -- All DOE Office Websites (Extended Search)

High Performance Building Façade Solutions High Performance Building Façade Solutions High Performance Building Façade Solutions Buildings Technology Department, Environmental Energy Technologies Division, Lawrence Berkeley National Laboratory Glazing and façade systems have very large impacts on all aspects of commercial building performance. They directly influence peak heating and cooling loads, and indirectly influence lighting loads when daylighting is considered. In addition to being a major determinant of annual energy use, they can have significant impacts on peak cooling system sizing, electric load shape, and peak electric demand. Because they are prominent architectural and design elements and because they influence occupant preference, satisfaction and comfort, the design optimization challenge is


Process for separation and preconcentration of radium from water  

DOE Patents (OSTI)

A process for preconcentrating and separating radium from a contaminated solution containing at least water and radium includes the steps of adding a quantity of a water-soluble macrocyclic polyether to the contaminated solution to form a combined solution. An acid is added to the combined solution to form an acidic combined solution having an [H{sup +}] concentration of about 0.5M. The acidic combined solution is contacted with a sulfonic acid-based strong acid cation exchange medium or a organophilic sulfonic acid medium having a plurality of binding sites thereon to bind the radium thereto and to form a radium-depleted solution. The radium-depleted solution is separated from the strong acid cation exchange medium or organophilic sulfonic acid medium. The radium remaining bound to the exchange medium or organophilic reagent is then stripped from the exchange medium or organophilic medium and the activity of the radium is measured. 24 figs.

Dietz, M.; Horwitz, E.P.; Chiarizia, R.; Bartsch, R.A.



Removing arsenic from aqueous solution and long-term product storage  

Science Journals Connector (OSTI)

The removal of arsenic from hydrometallurgical solutions, waste waters, and acid drainage mine waters has ... and co-precipitation processes; and, on the long-term outdoor storage of the arsenic bearing products.

L. G. Twidwell; J. W. McCloskey



Extended solid solution and nonequilibrium phase diagram for Ni-Al alloy formed during laser cladding  

Science Journals Connector (OSTI)

Due to rapid solidification in laser cladding, the composition of the solute in the cladding alloy often exceeds the solid solubility limit ... various process parameters on the composition of the cladding alloy ...

A. Kar; J. Mazumder



Soil engineering in vivo: harnessing natural biogeochemical systems for sustainable, multi-functional engineering solutions  

Science Journals Connector (OSTI)

...biological processes provide an innovative solution for remediation of metal-contaminated ground...non-engineered, and their remediation is practically and fiscally...g. land and ground water remediation). Extensive site-specific...



Draft General Conformity Determination  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

I I Draft General Conformity Determination U.S. Department of the Interior Minerals Management Service MMS Cape Wind Energy Project January 2009 Final EIS Appendix I Draft General Conformity Determination Draft General Conformity Determination Cape Wind Energy Project Prepared by Minerals Management Service Herndon, VA November 2008 i TABLE OF CONTENTS 1.0 INTRODUCTION TO THE PROPOSED ACTION............................................................... 1 2.0 GENERAL CONFORMITY REGULATORY BACKGROUND .......................................... 2 2.1 GENERAL CONFORMITY REQUIREMENTS.................................................................... 2 2.2 GENERAL CONFORMITY APPLICABILITY.....................................................................


Automated structure solution with the PHENIX suite  

SciTech Connect

Significant time and effort are often required to solve and complete a macromolecular crystal structure. The development of automated computational methods for the analysis, solution, and completion of crystallographic structures has the potential to produce minimally biased models in a short time without the need for manual intervention. The PHENIX software suite is a highly automated system for macromolecular structure determination that can rapidly arrive at an initial partial model of a structure without significant human intervention, given moderate resolution, and good quality data. This achievement has been made possible by the development of new algorithms for structure determination, maximum-likelihood molecular replacement (PHASER), heavy-atom search (HySS), template- and pattern-based automated model-building (RESOLVE, TEXTAL), automated macromolecular refinement (phenix. refine), and iterative model-building, density modification and refinement that can operate at moderate resolution (RESOLVE, AutoBuild). These algorithms are based on a highly integrated and comprehensive set of crystallographic libraries that have been built and made available to the community. The algorithms are tightly linked and made easily accessible to users through the PHENIX Wizards and the PHENIX GUI.

Terwilliger, Thomas C [Los Alamos National Laboratory; Zwart, Peter H [LBNL; Afonine, Pavel V [LBNL; Grosse - Kunstleve, Ralf W [LBNL



Automated Structure Solution with the PHENIX Suite  

SciTech Connect

Significant time and effort are often required to solve and complete a macromolecular crystal structure. The development of automated computational methods for the analysis, solution and completion of crystallographic structures has the potential to produce minimally biased models in a short time without the need for manual intervention. The PHENIX software suite is a highly automated system for macromolecular structure determination that can rapidly arrive at an initial partial model of a structure without significant human intervention, given moderate resolution and good quality data. This achievement has been made possible by the development of new algorithms for structure determination, maximum-likelihood molecular replacement (PHASER), heavy-atom search (HySS), template and pattern-based automated model-building (RESOLVE, TEXTAL), automated macromolecular refinement (phenix.refine), and iterative model-building, density modification and refinement that can operate at moderate resolution (RESOLVE, AutoBuild). These algorithms are based on a highly integrated and comprehensive set of crystallographic libraries that have been built and made available to the community. The algorithms are tightly linked and made easily accessible to users through the PHENIX Wizards and the PHENIX GUI.

Zwart, Peter H.; Zwart, Peter H.; Afonine, Pavel; Grosse-Kunstleve, Ralf W.; Hung, Li-Wei; Ioerger, Tom R.; McCoy, A.J.; McKee, Eric; Moriarty, Nigel; Read, Randy J.; Sacchettini, James C.; Sauter, Nicholas K.; Storoni, L.C.; Terwilliger, Tomas C.; Adams, Paul D.



SMUD's Residential Summer Solutions Study  

NLE Websites -- All DOE Office Websites (Extended Search)

SMUD's Residential Summer Solutions Study SMUD's Residential Summer Solutions Study Speaker(s): Karen Herter Date: August 26, 2011 - 12:00pm Location: 90-3122 Seminar Host/Point of Contact: Janie Page In 2009, the DRRC and SMUD teamed up to test the use of dynamic pricing and communicating thermostats in the small commercial sector. The final results showed summer energy savings of 20%, event impacts of 14%, and bill savings of 25%. In 2011, the same team will conduct a similar study involving residential customers with interval meters. The study is designed to inform the transition to the Sacramento smart grid through experimentation with real-time energy use data and communicating thermostats, both with and without dynamic pricing. Three randomly chosen groups of residential customers were offered one of three equipment configuration treatments: (a)


Protein Puzzles and Scientific Solutions  

Office of Science (SC) Website

Articles » 2014 » Protein Articles » 2014 » Protein Puzzles and Scientific Solutions News Featured Articles 2014 2013 2012 2011 2010 2009 2008 2007 2006 2005 Science Headlines Presentations & Testimony News Archives Contact Information Office of Science U.S. Department of Energy 1000 Independence Ave., SW Washington, DC 20585 P: (202) 586-5430 01.06.14 Protein Puzzles and Scientific Solutions Researchers at SLAC National Accelerator Laboratory solve fiendishly complicated structures using X-ray savvy and serious computing power. Print Text Size: A A A Subscribe FeedbackShare Page Click to enlarge photo. Enlarge Photo The Coherent X-ray Imaging experimental station at SLAC's Linac Coherent Light Source. Photo courtesy of Brad Plummer/SLAC In crystallography experiments at the Coherent X-ray Imaging experimental


Energy Solutions Using Wireless Telemetry  

NLE Websites -- All DOE Office Websites (Extended Search)

Solutions Using Wireless Telemetry Solutions Using Wireless Telemetry Speaker(s): Andy Green Date: June 12, 2001 - 12:00pm Location: Bldg. 90 Seminar Host/Point of Contact: Satkartar K. Kinney This talk will address the following: * Introduction to wireless data networks * What are cellular control channels and why do I care? * Telemetry using wireless short packet data * Aeris technologies * Energy applications - Automatic meter reading - HVAV-R monitoring and control - Home gateways and remote thermostat control - Load management and curtailment - Distribution automation - Supply monitoring/management * The future For more information on this topic, you're invited to visit Aeris.Net at: http://www.aeris.net For more information about this seminar, please contact: Satkartar Kinney(510) 495-2365

Note: This page contains sample records for the topic "determination solution processable" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Fissile solution dynamics: Student research  

SciTech Connect

There are two research projects in criticality safety at the University of Arizona: one in dynamic simulation of hypothetical criticality accidents in fissile solutions, and one in criticality benchmarks using transport theory. We have used the data from nuclear excursions in KEWB, CRAC, and SILENE to help in building models for solution excursions. An equation of state for liquids containing gas bubbles has been developed and coupled to point-reactor dynamics in an attempt to predict fission rate, yield, pressure, and kinetic energy. It appears that radiolytic gas is unimportant until after the first peak, but that it does strongly affect the shape of the subsequent power decrease and also the dynamic pressure.

Hetrick, D.L.



Electrochromic Salts, Solutions, and Devices  

DOE Patents (OSTI)

Electrochromic salts. Electrochromic salts of dicationic viologens such as methyl viologen and benzyl viologen associated with anions selected from bis(trifluoromethylsulfonyl)imide, bis(perfluoroethylsulfonyl)imide, and tris(trifluoromethylsulfonyl)methide are produced by metathesis with the corresponding viologen dihalide. They are highly soluble in molten quarternary ammonium salts and together with a suitable reductant provide electrolyte solutions that are used in electrochromic windows.

Burrell, Anthony K. (Los Alamos, NM); Warner, Benjamin P. (Los Alamos, NM); McClesky, T. Mark (Los Alamos, NM)



Electrochromic Salts, Solutions, and Devices  

DOE Patents (OSTI)

Electrochromic salts. Electrochromic salts of dicationic viologens such as methyl viologen and benzyl viologen associated with anions selected from bis(trifluoromethylsulfonyl)imide, bis(perfluoroethylsulfonyl)imide, and tris(trifluoromethylsulfonyl)methide are produced by metathesis with the corresponding viologen dihalide. They are highly soluble in molten quarternary ammonium salts and together with a suitable reductant provide electrolyte solutions that are used in electrochromic windows.

Burrell, Anthony K. (Los Alamos, NM); Warner, Benjamin P. (Los Alamos, NM); McClesky, T. Mark (Los Alamos, NM)



Electrochromic salts, solutions, and devices  

DOE Patents (OSTI)

Electrochromic salts. Electrochromic salts of dicationic viologens such as methyl viologen and benzyl viologen associated with anions selected from bis(trifluoromethylsulfonyl)imide, bis(perfluoroethylsulfonyl)imide, and tris(trifluoromethylsulfonyl)methide are produced by metathesis with the corresponding viologen dihalide. They are highly soluble in molten quarternary ammonium salts and together with a suitable reductant provide electrolyte solutions that are used in electrochromic windows.

Burrell, Anthony K. (Los Alamos, NM); Warner, Benjamin P. (Los Alamos, NM); McClesky,7,064,212 T. Mark (Los Alamos, NM)



U.S. Department of Energy Categorical Exclusion Determination Form  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Energy Frontiers Research Center (EFRC) - Nanoscale Actinide Materials Energy Frontiers Research Center (EFRC) - Nanoscale Actinide Materials Savannah River Site Aiken/Aiken/South Carolina SRNL will conduct fundamental studies into the solution chemistry of novel actinide complexes and nano-clusters. These studies will focus on the stability, reactivity, and electrochemistry of novel actinide compounds in aqueous and non-aqueous solutions. Spectroscopic, electrochemical and other techniques will be used to determine solution phase species. X-ray diffraction and electron microscopy will be used to identify solid phases that may form as a result of solution phase chemical reactions. These studies will be in collaboration with other participants in the Energy Frontiers Research Center (EFRC). The collective body of work will determine if the chemical and electrochemical properties of the novel actinide


Evaluation of engine coolant recycling processes: Part 2  

SciTech Connect

Engine coolant recycling continues to provide solutions to both economic and environmental challenges often faced with the disposal of used engine coolant. General Motors` Service Technology Group (STG), in a continuing effort to validate the general practice of recycling engine coolants, has conducted an in-depth study on the capabilities of recycled coolants. Various recycling processes ranging from complex forms of fractional distillation to simple filtration were evaluated in this study to best represent the current state of coolant recycling technology. This study incorporates both lab and (limited) fleet testing to determine the performance capabilities of the recycled coolants tested. While the results suggest the need for additional studies in this area, they reveal the true capabilities of all types of engine coolant recycling technologies.

Bradley, W.H. [General Motors, Warren, MI (United States). Service Technology Group



Radiation-induced accumulation of carboxylic acids in solution of tributyl phosphate in dodecane  

SciTech Connect

A study has been made of the molecular composition and concentrations of carboxylic acids formed upon irradiation of the system 30% TBP in dodecane-3 M HNO{sub 3}. Based on these data, a model solution of carboxylic acids in dodecane has been formulated and compared with the irradiated solution in the interfacial tension on the organic phase-alkaline solution interface. Coefficients of carboxylic acid distribution between TBP in dodecane and aqueous solutions of HNO{sub 3}, NaHCO{sub 3} have been determined.

Bykov, G.L. [Institute of Physical Chemistry, Moscow (Russian Federation)



Lithium-aluminum-carbonate-hydroxide hydrate coatings on aluminum alloys: Composition, structure, and processing bath chemistry  

SciTech Connect

A new corrosion resistant coating, being designed for possible replacement of chromate conversion coatings on aluminum alloys, was investigated for composition, structure, and solubility using a variety of techniques. The stoichiometry of the material, prepared by immersion of 1100 Al alloy into a lithium carbonate-lithium hydroxide solution, was approximately Li{sub 2}Al{sub 4}CO{sub 3}(OH){sub 12}{center_dot}3H{sub 2}O. Processing time was shown to be dependent upon the bath pH, and consistent coating formation required supersaturation of the coating bath with aluminum. The exact crystal structure of this hydrotalcite material, hexagonal or monoclinic, was not determined. It was shown that both the bulk material and coatings with the same nominal composition and crystal structure could be formed by precipitation from an aluminum supersatured solution of lithium carbonate. {copyright} {ital 1996 Materials Research Society.}

Drewien, C.A.; Eatough, M.O.; Tallant, D.R.; Hills, C.R.; Buchheit, R.G. [Materials and Process Sciences Center, Sandia National Laboratories, Albuquerque, New Mexico 87185 (United States)



GE Lighting Solutions: Proposed Penalty (2013-SE-4901) | Department of  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Proposed Penalty (2013-SE-4901) Proposed Penalty (2013-SE-4901) GE Lighting Solutions: Proposed Penalty (2013-SE-4901) March 5, 2013 DOE alleged in a Notice of Proposed Civil Penalty that General Electric Lighting Solutions manufactured and distributed noncompliant traffic signal modules in the U.S. Federal law subjects manufacturers and private labelers to civil penalties if those parties distribute in the U.S. products that do not meet applicable energy conservation standards. This civil penalty notice advises the company of the potential penalties and DOE's administrative process, including the company's right to a hearing. GE Lighting Solutions: Proposed Penalty (2013-SE-4901) More Documents & Publications Watermark: Proposed Penalty (2011-SW-2908) Act One: NPCP (2013-CE-49001)


Organic thin film prehistory: looking towards solution phase aggregation |  

NLE Websites -- All DOE Office Websites (Extended Search)

Organic thin film prehistory: looking towards solution phase aggregation Organic thin film prehistory: looking towards solution phase aggregation Wednesday, November 6, 2013 - 3:00pm SLAC, Redtail Hawk Conference Room 108A Christopher Tassone, SSRL Polymer bulk heterojunction (BHJ) solar cells have attracted significant attention in industry and academia because of their potential for achieving large-area, light-weight, and flexible photovoltaic devices through cost-effective solution deposition techniques. These devices consist of a blend of an absorbing polymer and an electron accepting fullerene, the molecular packing and phase segregation of which heavily influence power conversion efficiency by effecting important processes such as exciton splitting, charge transport, and recombination. Understanding and utilization of molecular interactions to predicatively control the


Exact Solution of a Field Theory Model of Frontal Photopolymerization  

E-Print Network (OSTI)

Frontal photopolymerization (FPP) provides a versatile method for the rapid fabrication of solid polymer network materials by exposing photosensitive molecules to light. Dimensional control of structures created by this process is crucial in applications ranging from microfluidics and coatings to dentistry, and the availability of a predictive mathematical model of FPP is needed to achieve this control. Previous work has relied on numerical solutions of the governing kinetic equations in validating the model against experiments because of the intractability of the governing nonlinear equations. The present paper provides exact solutions to these equations in the general case in which the optical attenuation decreases (photobleaching) or increases (photodarkening) with photopolymerization. These exact solutions are of mathematical and physical interest because they support traveling waves of polymerization that propagate logarithmically or linearly in time, depending on the evolution of optical attenuation of the photopolymerized material.

James A. Warren; Joao T. Cabral; Jack F. Douglas



Pretreatment of americium/curium solutions for vitrification  

SciTech Connect

Vitrification will be used to stabilize an americium/curium (Am/Cm) solution presently stored in F-Canyon for eventual transport to the heavy isotope programs at Oak Ridge National Laboratory. Prior to vitrification, an in-tank oxalate precipitation and a series of oxalic/nitric acid washes will be used to separate these elements and lanthanide fission products from the bulk of the uranium and metal impurities present in the solution. Pretreatment development experiments were performed to understand the behavior of the lanthanides and the metal impurities during the oxalate precipitation and properties of the precipitate slurry. The results of these experiments will be used to refine the target glass composition allowing optimization of the primary processing parameters and design of the solution transfer equipment.

Rudisill, T.S. [Westinghouse Savannah River Company, AIKEN, SC (United States)



Tube Width Fluctuations in F-Actin Solutions  

Science Journals Connector (OSTI)

We determine the statistics of the local tube width in F-actin solutions, beyond the usually reported mean value. Our experimental observations are explained by a segment fluid theory based on the binary collision approximation. In this systematic generalization of the standard mean-field approach, effective polymer segments interact via a potential representing the topological constraints. The analytically predicted universal tube width distribution with a stretched tail is in good agreement with the data.

J. Glaser; D. Chakraborty; K. Kroy; I. Lauter; M. Degawa; N. Kirchgeßner; B. Hoffmann; R. Merkel; M. Giesen



CX-007979: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

7979: Categorical Exclusion Determination 7979: Categorical Exclusion Determination CX-007979: Categorical Exclusion Determination Washington River Protection Solutions LLC - Proposed Actions For Calendar Year 2012 Scheduled To Take Place CX(s) Applied: B1.17 Date: 01/13/2012 Location(s): Washington Offices(s): River Protection-Richland Operations Office Washington River Protection Solutions LLC (WRPS) will remove polychlorinated biphenyls (PCBs) on and near the Hanford Site during Calendar Year 2012. WRPS will perform all activities in accordance with the categorical exclusion (CX) limitations set forth in 10 CFR 1021, Appendices A and B to Subpart D, and CX B1.17. CX-007979.pdf More Documents & Publications CX-009676: Categorical Exclusion Determination CX-007981: Categorical Exclusion Determination


Extraction of americium and europium from perchloric acid solutions with N,N?-dialkyl-and N,N,N?,N?-tetraalkylpyridine-2,6-dicarboxamides  

Science Journals Connector (OSTI)

Extraction of americium and europium from perchloric acid solutions with pyridine-2,6-dicarboxamides was studied. The solvate numbers and Am/Eu separation factors were determined.

M. Yu. Alyapyshev; V. A. Babain; N. G. Antonov…



Process management using component thermal-hydraulic function classes  

DOE Patents (OSTI)

A process management expert system where following malfunctioning of a component, such as a pump, for determining system realignment procedures such as for by-passing the malfunctioning component with on-line speeds to maintain operation of the process at full or partial capacity or to provide safe shut down of the system while isolating the malfunctioning component. The expert system uses thermal-hydraulic function classes at the component level for analyzing unanticipated as well as anticipated component malfunctions to provide recommended sequences of operator actions. Each component is classified according to its thermal-hydraulic function, and the generic and component-specific characteristics for that function. Using the diagnosis of the malfunctioning component and its thermal hydraulic class, the expert system analysis is carried out using generic thermal-hydraulic first principles. One aspect of the invention employs a qualitative physics-based forward search directed primarily downstream from the malfunctioning component in combination with a subsequent backward search directed primarily upstream from the serviced component. Generic classes of components are defined in the knowledge base according to the three thermal-hydraulic functions of mass, momentum and energy transfer and are used to determine possible realignment of component configurations in response to thermal-hydraulic function imbalance caused by the malfunctioning component. Each realignment to a new configuration produces the accompanying sequence of recommended operator actions. All possible new configurations are examined and a prioritized list of acceptable solutions is produced. 5 figs.

Morman, J.A.; Wei, T.Y.C.; Reifman, J.



Process management using component thermal-hydraulic function classes  

DOE Patents (OSTI)

A process management expert system where following malfunctioning of a component, such as a pump, for determining system realignment procedures such as for by-passing the malfunctioning component with on-line speeds to maintain operation of the process at full or partial capacity or to provide safe shut down of the system while isolating the malfunctioning component. The expert system uses thermal-hydraulic function classes at the component level for analyzing unanticipated as well as anticipated component malfunctions to provide recommended sequences of operator actions. Each component is classified according to its thermal-hydraulic function, and the generic and component-specific characteristics for that function. Using the diagnosis of the malfunctioning component and its thermal hydraulic class, the expert system analysis is carried out using generic thermal-hydraulic first principles. One aspect of the invention employs a qualitative physics-based forward search directed primarily downstream from the malfunctioning component in combination with a subsequent backward search directed primarily upstream from the serviced component. Generic classes of components are defined in the knowledge base according to the three thermal-hydraulic functions of mass, momentum and energy transfer and are used to determine possible realignment of component configurations in response to thermal-hydraulic function imbalance caused by the malfunctioning component. Each realignment to a new configuration produces the accompanying sequence of recommended operator actions. All possible new configurations are examined and a prioritized list of acceptable solutions is produced.

Morman, James A. (Woodridge, IL); Wei, Thomas Y. C. (Downers Grove, IL); Reifman, Jaques (Western Springs, IL)



The inverse problems of wing panel manufacture processes  

SciTech Connect

It is shown that inverse problems of steady-state creep bending of plates in both the geometrically linear and nonlinear formulations can be represented in a variational formulation. Steady-state values of the obtained functionals corresponding to the solutions of the problems of inelastic deformation and springback are determined by applying a finite element procedure to the functionals. Optimal laws of creep deformation are formulated using the criterion of minimizing damage in the functionals of the inverse problems. The formulated problems are reduced to the problems solved by the finite element method using MSC.Marc software. Currently, forming of light metals poses tremendous challenges due to their low ductility at room temperature and their unusual deformation characteristics at hot-cold work: strong asymmetry between tensile and compressive behavior, and a very pronounced anisotropy. We used the constitutive models of steady-state creep of initially transverse isotropy structural materials the kind of the stress state has influence. The paper gives basics of the developed computer-aided system of design, modeling, and electronic simulation targeting the processes of manufacture of wing integral panels. The modeling results can be used to calculate the die tooling, determine the panel processibility, and control panel rejection in the course of forming.

Oleinikov, A. I., E-mail: a.i.oleinikov@mail.ru [Komsomolsk-on-Amur State Technical University, Lenina prospect 27, Komsomolsk-on-Amur, 681013, Russian Federation, and Institute of Machinery and Metallurgy Far Eastern Branch of the Russian Academy of Sciences, Metallurgov Street 1, Komsomolsk-on-Am (Russian Federation); Bormotin, K. S., E-mail: cvmi@knastu.ru [Komsomolsk-on-Amur State Technical University, Lenina prospect 27, Komsomolsk-on-Amur, 681013, Russian Federation (Russian Federation)



Symplectic approach to the amplification process in a nonlinear fiber  

E-Print Network (OSTI)

We analyze the amplification processes occurring in a nonlinear fiber, either driven with one or two pumps. After determining the solution for the signal and idler fields resulting from these amplification processes, we analyze the physical transformations that these fields undergo. To this aim, we use a Bloch-Messiah decomposition for the symplectic transformation governing the fields evolution. Although conceptually equivalent to other works in this area [McKinstrie and Karlsson, Opt. Expr. 21, 1374 (2013)], this analysis is intended to be particularly simple, gathering results spread in the literature, which is useful for guiding practical implementations. Furthermore, we present a study of the correlations of the signal-idler fields at the amplifier output. We show that these fields are correlated, study their correlations as a function of the pump power, and stress the impact of these correlations on the amplifier noise figure. Finally, we address the effect of losses. We determine whether it is advantageous to consider a link consisting in an amplifying non-linear fiber, followed by a standard fiber based lossy transmission line, or whether the two elements should be reversed, by comparing the respective noise figures.

G. Ferrini; I. Fsaifes; T. Labidi; F. Goldfarb; N. Treps; F. Bretenaker



CX-000578: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

8: Categorical Exclusion Determination 8: Categorical Exclusion Determination CX-000578: Categorical Exclusion Determination Solubility of Synthesized Iron and Lead Sulfide Minerals CX(s) Applied: B3.6 Date: 12/10/2009 Location(s): Albuquerque, New Mexico Office(s): Sandia Site Office Sandia National Laboratories/New Mexico proposes to prepare aqueous solutions of Na2S.9H2O (sodium sulfide nonahydrate) in an anoxic glove box, and combine the solution with aqueous solutions of iron/lead, to synthesize iron/lead sulfide minerals. The solubility of these minerals in brine would be measured. DOCUMENT(S) AVAILABLE FOR DOWNLOAD CX-000578.pdf More Documents & Publications US-Japan rare elements meeting Tank Waste Corporate Board Meeting 11/18/10 Radionuclide Interaction and Transport in Representative Geologic Media

Note: This page contains sample records for the topic "determination solution processable" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


CX-002879: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

879: Categorical Exclusion Determination 879: Categorical Exclusion Determination CX-002879: Categorical Exclusion Determination Em-31 Phosphate Management CX(s) Applied: B3.6 Date: 06/09/2010 Location(s): Aiken, South Carolina Office(s): Environmental Management, Savannah River Operations Office This task will investigate the precipitation/crystallization of phosphate from solution as sodium salts. Two general approaches will be considered: 1) precipitation/crystallization by controlled lowering of the temperature of super-saturated solutions and 2) precipitation as double salts, such as the sodium fluorophosphate double salt, Na7F(PO4)2-19H2O. In both cases, evaporation may be considered as a means to increase the yield of phosphate precipitation. Simplified solutions will be produced by dissolving various


Categorical Exclusion Determinations: Office of River Protection-Richland  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

January 13, 2012 January 13, 2012 CX-007980: Categorical Exclusion Determination Washington River Protection Solutions LLC - Proposed Actions For Calendar Year 2012 Scheduled To Take Place CX(s) Applied: B1.22 Date: 01/13/2012 Location(s): Washington Offices(s): River Protection-Richland Operations Office January 13, 2012 CX-007979: Categorical Exclusion Determination Washington River Protection Solutions LLC - Proposed Actions For Calendar Year 2012 Scheduled To Take Place CX(s) Applied: B1.17 Date: 01/13/2012 Location(s): Washington Offices(s): River Protection-Richland Operations Office January 13, 2012 CX-007978: Categorical Exclusion Determination Washington River Protection Solutions LLC - Proposed Actions For Calendar Year 2012 CX(s) Applied: B1.16 Date: 01/13/2012 Location(s): Washington


Anion Exchange Resins for the Selective Separation of Technetium from Uranium in Carbonate Solutions  

Science Journals Connector (OSTI)

(8) The recovered 99Tc can subsequently be converted to metal or into other waste forms suitable for long-term storage or geological disposal. ... Anion exchange resins have been shown to be viable candidates for removing TcO4– from acidic solutions, from groundwater, and also from caustic solutions such as Hanford tank wastes (where the U has been largely removed using the PUREX process). ... The 1st 4 terms describe the contribution to retention from neutral components of solutes, and the 5th term represents the contribution to retention from solute's ionization. ...

Kristy M. Long; George S. Goff; Stuart D. Ware; Gordon D. Jarvinen; Wolfgang H. Runde



The removal of mercury from solid mixed waste using chemical leaching processes  

SciTech Connect

The focus of this research was to evaluate chemical leaching as a technique to treat soils, sediments, and glass contaminated with either elemental mercury or a combination of several mercury species. Potassium iodide/iodine solutions were investigated as chemical leaching agents for contaminated soils and sediments. Clean, synthetic soil material and surrogate storm sewer sediments contaminated with mercury were treated with KI/I{sub 2} solutions. It was observed that these leaching solutions could reduce the mercury concentration in soil and sediments by 99.8%. Evaluation of selected posttreatment sediment samples revealed that leachable mercury levels in the treated solids exceeded RCRA requirements. The results of these studies suggest that KI/I{sub 2} leaching is a treatment process that can be used to remove large quantities of mercury from contaminated soils and sediments and may be the only treatment required if treatment goals are established on Hg residual concentrations in solid matrices. Fluorescent bulbs were used to simulate mercury contaminated glass mixed waste. To achieve mercury contamination levels similar to those found in larger bulbs such as those used in DOE facilities a small amount of Hg was added to the crushed bulbs. The most effective agents for leaching mercury from the crushed fluorescent bulbs were KI/I{sub 2}, NaOCl, and NaBr + acid. Radionuclide surrogates were added to both the EPA synthetic soil material and the crushed fluorescent bulbs to determine the fate of radionuclides following chemical leaching with the leaching agents determined to be the most promising. These experiments revealed that although over 98% of the dosed mercury solubilized and was found in the leaching solution, no Cerium was measured in the posttreatment leaching solution. This finding suggest that Uranium, for which Ce was used as a surrogate, would not solubilize during leaching of mercury contaminated soil or glass.

Gates, D.D.; Chao, K.K.; Cameron, P.A.



Categorical Exclusion Determinations: Savannah River Operations Office |  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

June 23, 2009 June 23, 2009 CX-000497: Categorical Exclusion Determination F-Canyon Complex Deactivation CX(s) Applied: B1.28 Date: 06/23/2009 Location(s): Aiken, South Carolina Office(s): Environmental Management, Savannah River Operations Office June 15, 2009 CX-000495: Categorical Exclusion Determination M-Area Chemical Oxidation (MACO) - Installation of Southern Sector Coreholes and Monitoring Wells Date: 06/15/2009 Location(s): Aiken, South Carolina Office(s): Environmental Management, Savannah River Operations Office June 15, 2009 CX-000496: Categorical Exclusion Determination F Area Hazardous Waste Management Facility Silver Chloride Solution Injection Wells CX(s) Applied: B6.2 Date: 06/15/2009 Location(s): Aiken, South Carolina Office(s): Environmental Management, Savannah River Operations Office


Categorical Exclusion Determinations: National Energy Technology Laboratory  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

3, 2010 3, 2010 CX-002486: Categorical Exclusion Determination Flow Battery Solution for Smart Grid Renewable Energy Applications CX(s) Applied: B3.6, B4.6, A1, B4.11 Date: 06/03/2010 Location(s): Sunnyvale, California Office(s): Electricity Delivery and Energy Reliability, National Energy Technology Laboratory June 2, 2010 CX-002945: Categorical Exclusion Determination Pennsylvania Green Energy Works Targeted Grant - Native Energy Biogas Project CX(s) Applied: B1.15, B1.24, B1.31, A9, B5.1 Date: 06/02/2010 Location(s): Franklin County, Pennsylvania Office(s): Energy Efficiency and Renewable Energy, National Energy Technology Laboratory June 2, 2010 CX-002505: Categorical Exclusion Determination Energy Efficiency Program for Municipalities, Schools, Hospitals, Public Colleges


Categorical Exclusion Determinations: American Recovery and Reinvestment  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

5, 2011 5, 2011 CX-004864: Categorical Exclusion Determination Geothermal Incentive Program CX(s) Applied: A9, A11, B5.1 Date: 01/05/2011 Location(s): Newtown, Connecticut Office(s): Energy Efficiency and Renewable Energy, National Energy Technology Laboratory January 4, 2011 CX-004863: Categorical Exclusion Determination Arkansas Energy Technology Loan Program - General Energy Solutions Anaerobic Digester Loan Request Date: 01/04/2011 Location(s): Clarksville, Arkansas Office(s): Energy Efficiency and Renewable Energy, National Energy Technology Laboratory January 4, 2011 CX-004859: Categorical Exclusion Determination Multi-Family Housing Weatherization CX(s) Applied: A9, A11, B5.1 Date: 01/04/2011 Location(s): Kansas Office(s): Energy Efficiency and Renewable Energy, Golden Field Office


Electrodialysis Treatment of Phosphate Solutions  

Science Journals Connector (OSTI)

An effective way to prevent corrosion of metals and alloys is to coat the substrate material. The phosphating process is usually used to provide a phosphate layer for subsequent application of organic coating ...

Daniel Arsand; Andréa Moura Bernardes



Cold Climate Building Enclosure Solutions  

Office of Scientific and Technical Information (OSTI)

at http:www.osti.govbridge Available for a processing fee to U.S. Department of Energy and its contractors, in paper, from: U.S. Department of Energy Office of Scientific...


CX-006641: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

1: Categorical Exclusion Determination 1: Categorical Exclusion Determination CX-006641: Categorical Exclusion Determination Defense Waste Processing Facility Simulations Using Radioactive Material and the Alternative Reductant Flowsheet CX(s) Applied: B3.6 Date: 08/16/2011 Location(s): Aiken, South Carolina Office(s): Savannah River Operations Office Waste Solidification Engineering has requested that Savannah River National Laboratory (SRNL) simulate Defense Waste Processing Facility processing utilizing radioactive sludge and the alternative reductant flowsheet. This will include characterization of slurry already in the SRNL facility followed by chemical additions and further characterization. DOCUMENT(S) AVAILABLE FOR DOWNLOAD CX-006641.pdf More Documents & Publications CX-002882: Categorical Exclusion Determination


Training & Technology Solutions Queens College ~ Office of Converging Technologies ~ Training & Technology Solutions  

E-Print Network (OSTI)

Training & Technology Solutions Queens College ~ Office of Converging Technologies ~ Training & Technology Solutions 718-997-4875 ~ training@qc.cuny.edu ~ I-Bldg 214 Advisor Center Navigation: Login #12;Training & Technology Solutions Queens College ~ Office of Converging Technologies ~ Training

Johnson Jr.,, Ray


Singlet exciton fission in solution  

E-Print Network (OSTI)

is more pronounced for the excimer than in the crystal, as the crystal geometry (at the origin of Fig. 6b) gives a smaller energetic stabilisation than we observe in solution. Though slip- stacked geometries are implicated in J-type coupling between... fission and fusion in a covalently linked tetracene dimer. Chemical Physics Letters 421, 518–522 (2006). 39. Müller, A. M., Avlasevich, Y. S., Schoeller, W. W., Müllen, K. & Bardeen, C. J. Exciton fission and fusion in bis(tetracene) molecules...

Walker, Brian J.; Musser, Andrew J.; Beljonne, David; Friend, Richard H.



Stellar Energy Solutions Inc | Open Energy Information  

Open Energy Info (EERE)

Stellar Energy Solutions Inc Stellar Energy Solutions Inc Jump to: navigation, search Name Stellar Energy Solutions Inc Place Healdsburg, California Zip 95448 Sector Renewable Energy, Solar Product Turn-key renewable energy solutions provider specializing in solar electric roofing. References Stellar Energy Solutions Inc[1] LinkedIn Connections CrunchBase Profile No CrunchBase profile. Create one now! This article is a stub. You can help OpenEI by expanding it. Stellar Energy Solutions Inc is a company located in Healdsburg, California . References ↑ "Stellar Energy Solutions Inc" Retrieved from "http://en.openei.org/w/index.php?title=Stellar_Energy_Solutions_Inc&oldid=351700" Categories: Clean Energy Organizations Companies Organizations Stubs What links here Related changes


Agri Energy Funding Solutions | Open Energy Information  

Open Energy Info (EERE)

Agri Energy Funding Solutions Agri Energy Funding Solutions Jump to: navigation, search Name Agri-Energy Funding Solutions Place Omaha, Nebraska Zip 68137-2495 Sector Biomass, Wind energy Product AGRI-ENERGY FUNDING SOLUTIONS is a market consultant for BioDiesel, Ethanol as well as Biomass and Wind Energy projects both nationally and internationally and is based in Omaha, Nebraska. References Agri-Energy Funding Solutions[1] LinkedIn Connections CrunchBase Profile No CrunchBase profile. Create one now! This article is a stub. You can help OpenEI by expanding it. Agri-Energy Funding Solutions is a company located in Omaha, Nebraska . References ↑ "Agri-Energy Funding Solutions" Retrieved from "http://en.openei.org/w/index.php?title=Agri_Energy_Funding_Solutions&oldid=341887


Solutions to Yang-Mills equations  

E-Print Network (OSTI)

This article gives explicit solutions to the Yang-Mills equations. The solutions have positive energy that can be made arbitrarily small by selection of a parameter showing that Yang-Mills field theories do not have a mass gap.

Jorma Jormakka



2015 Midwest Energy Solutions | Department of Energy  

Office of Environmental Management (EM)

2015 Midwest Energy Solutions 2015 Midwest Energy Solutions January 28, 2015 9:00AM EST to January 30, 2015 5:00PM EST Chicago, Illinois Learn more....


Correction-solution partielle des Feuilles 1 8 Exercice 1.1 : Solutions  

E-Print Network (OSTI)

STIA3 Correction-solution partielle des Feuilles 1 à 8 Exercice 1.1 : Solutions : Df = R+ Dg = Rn 5

Mas, André


Corrosion Testing of Carbon Steel in Acid Cleaning Solutions  

SciTech Connect

High level waste is stored in carbon steel tanks at the Savannah River Site (SRS). The site is currently in the process of waste removal from, and ultimately closure of, these tanks. One of the most time consuming steps in the waste removal process is cleaning the sludge heel from the bottom of the tanks to an acceptable residual quantity. The sludge consists primarily of metal oxides that formed after waste from the canyons was neutralized with sodium hydroxide. Since the canyon waste was originally a nitric acid solution, this acid is a prime candidate for sludge heel dissolution.

Wiersma, B.J.



Ultrafast studies of solution dynamics  

SciTech Connect

This is the final report of a one-year, Laboratory Directed Research and Development (LDRD) project at Los Alamos National Laboratory (LANL). Fast chemical dynamics generally must be initiated photochemically. This limits the applicability of modern laser methods for following the structural changes that occur during chemical and biological reactions to those systems that have an electronic chromophore that has a significant yield of photoproduct when excited. This project has developed a new and entirely general approach to ultrafast initiation of reactions in solution: laser-induced temperature jump (T-jump). The results open entire new fields of study of ultrafast molecular dynamics in solution. The authors have demonstrated the T-jump technique on time scales of 50 ps and longer, and have applied it to study of the fast events in protein folding. They find that a general lifetime of alpha-helix formation is ca 100 ns, and that tertiary folds (in apomyoglobin) form in ca 100 {mu}s.

Woodruff, W.H.; Dyer, R.B. [Los Alamos National Lab., NM (United States); Callender, R.H. [City Univ. of New York, NY (United States). Dept. of Physics



Magnetic Critical Solutions in Holography  

E-Print Network (OSTI)

The AdS/CFT correspondence is a realization of the holographic principle in the context of string theory. It is a map between a quantum field theory and a string theory living in one or more extra dimensions. Holography provides new tools to the study of strongly coupled systems. It has important applications in quantum chromodynamics (QCD) and condensed matter (CM) systems, which are usually complicated and strongly coupled. Quantum critical CM theories have scaling symmetries and can be connected to higher-dimensional scale invariant space-times. The Effective Holographic Theory paradigm may be used to describe the low-energy (IR) holographic dynamics of quantum critical systems at the two-derivative level by the Einstein-Maxwell-Dilaton (EMD) theory. We find the magnetic critical scaling solutions of an EMD theory containing an extra parity-odd term $F\\wedge F$. Previous studies in the absence of magnetic fields have shown the existence of quantum critical lines separated by quantum critical points. We find this is also true in the presence of a magnetic field. The critical solutions are characterized by the triplet of critical exponents ($\\theta,z,\\zeta$), the first two describing the geometry, while the latter describes the charge density.

N. Angelinos


Note: This page contains sample records for the topic "determination solution processable" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.



E-Print Network (OSTI)

Solution Composition Solid Phases msa 4 Halite + 'Sylvite +Glaserite + Schoenite Halite + Leonite +Sylvite + Schoenite Halite Sylvite Leonite Kainite Halite +

Pitzer, Kenneth S.



Geodesic Form of Schwarzschild's External Solution  

Science Journals Connector (OSTI)

... ) an arbitrary differentiable function of p. It is found to be a transform of Schwarzschild's external solution: (7)




Presentation: Better Buildings Residential Program Solution Center  

Energy.gov (U.S. Department of Energy (DOE))

Presentation: Better Buildings Residential Program Solution Center, from the U.S. Department of Energy, Better Buildings Neighborhood Program.


Categorical Exclusion Determinations: West Valley Demonstration Project |  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Valley Demonstration Valley Demonstration Project Categorical Exclusion Determinations: West Valley Demonstration Project Categorical Exclusion Determinations issued by West Valley Demonstration Project. DOCUMENTS AVAILABLE FOR DOWNLOAD July 11, 2013 CX-010718: Categorical Exclusion Determination Replacement Ventilation System for the Main Plant Process Building CX(s) Applied: B6.3 Date: 07/11/2013 Location(s): New York Offices(s): West Valley Demonstration Project December 20, 2012 CX-009527: Categorical Exclusion Determination WVDP-2012-02 Routine Maintenance CX(s) Applied: B1.3 Date: 12/20/2012 Location(s): New York Offices(s): West Valley Demonstration Project August 2, 2012 CX-009528: Categorical Exclusion Determination WVDP-2012-01 WVDP Reservoir Interconnecting Canal Maintenance Activities


Categorical Exclusion Determinations: California | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

California California Categorical Exclusion Determinations: California Location Categorical Exclusion Determinations issued for actions in California. DOCUMENTS AVAILABLE FOR DOWNLOAD September 25, 2013 CX-010910: Categorical Exclusion Determination Hybrid Membrane-Absorption Carbon Dioxide (CO2) Capture Process CX(s) Applied: B3.6 Date: 09/25/2013 Location(s): California Offices(s): National Energy Technology Laboratory September 23, 2013 CX-010928: Categorical Exclusion Determination Harsh Environment Adaptable Thermionic (HEAT) Sensor CX(s) Applied: B3.6 Date: 09/23/2013 Location(s): California Offices(s): National Energy Technology Laboratory September 18, 2013 CX-010933: Categorical Exclusion Determination High Energy Density Lithium (Li)-ion Cells for Electric Vehicles (EV) Based


Categorical Exclusion Determinations: Texas | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Texas Texas Categorical Exclusion Determinations: Texas Location Categorical Exclusion Determinations issued for actions in Texas. DOCUMENTS AVAILABLE FOR DOWNLOAD September 25, 2013 CX-010911: Categorical Exclusion Determination Hybrid Membrane-Absorption Carbon Dioxide (CO2) Capture Process CX(s) Applied: B3.6 Date: 09/25/2013 Location(s): Texas Offices(s): National Energy Technology Laboratory September 16, 2013 CX-010976: Categorical Exclusion Determination Thermal-Hydrological-Chemical-Mechanical (THCM) Coupled Model for Hydrate-Bearing Sediments: Data Analysis and Design of New Field Experiments CX(s) Applied: A9 Date: 09/16/2013 Location(s): Texas Offices(s): National Energy Technology Laboratory September 16, 2013 CX-010972: Categorical Exclusion Determination "Clean Start" - Development of a National Liquid Propane (Autogas)


Categorical Exclusion Determinations: Alabama | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Alabama Alabama Categorical Exclusion Determinations: Alabama Location Categorical Exclusion Determinations issued for actions in Alabama. DOCUMENTS AVAILABLE FOR DOWNLOAD September 17, 2013 CX-010947: Categorical Exclusion Determination Robust and Energy Efficient Dual-Stage Membrane-Based Process for Enhanced Carbon Dioxide (CO2) Recovery CX(s) Applied: B3.6 Date: 09/17/2013 Location(s): Alabama Offices(s): National Energy Technology Laboratory September 17, 2013 CX-010944: Categorical Exclusion Determination Daikin Advanced Lithium Ion Battery Technology - High Voltage Electrolyte CX(s) Applied: B3.6 Date: 09/17/2013 Location(s): Alabama Offices(s): National Energy Technology Laboratory September 16, 2013 CX-010967: Categorical Exclusion Determination Novel Flow Sheet for Low Energy Carbon Dioxide (CO2) Capture Enabled by


Simulating Adsorptive Expansion of Zeolites: Application to Biomass-Derived Solutions in Contact with Silicalite  

Science Journals Connector (OSTI)

(2) Research on generating these new second-generation biofuels requires the study of catalytic and separation processes for transforming plant material composed mainly of cellulose, hemicelluloses, and lignin into more useful platform chemicals. ... For the furfural and HMF solutes, the ideal solution equation of state gives the following relationship between the solute chemical potential in solution and its concentration:where ?i is the chemical potential of the ith species in solution, Ci is the concentration, Co is a reference concentration, R is the gas constant, T is absolute temperature, and ?solv?i(C0) is the molar Gibbs free energy of solvation from gas to solution phase at the reference concentration and temperature T. ... Physical Chemistry Chemical Physics (2008), 10 (32), 4817-4826 CODEN: PPCPFQ; ISSN:1463-9076. ...

Julian E. S