Powered by Deep Web Technologies
Note: This page contains sample records for the topic "determination improved structure" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


1

Improvement in accuracy of protein local structure determination from NMR data  

Science Journals Connector (OSTI)

A method for determining the most probable conformations of amino acid residues from semiquantitatively estimated nuclear Overhauser effects (NOEs) and coupling constants was developed and coded in the FiSiNOE-2 program. This program is a new version of the FiSiNOE program, utilizing NMR data with complementary knowledge-based information on protein structures. In FiSiNOE-2 this information is conformational clusters of the dihedral angles (?, ?, gc1) derived from the Protein Data Bank. The FiSiNOE-2 method determines mathematical expectations and standard deviations for the angles ?, ?, and ?1, and provides direct determination of the local structure of proteins from NMR data before building and refining their spatial structure. The results of the FiSiNOE-2 program in combination with the results of the habas program may be used to provide stereospecific assignments of a pair of ?-methylene protons and to determine precisely allowed ranges of the ?, ?, and ?1 dihedral angles consistent with a given set of NMR data. To do this, a new procedure, combine, was developed. Computational experiments with the NMR data simulated from X-ray coordinates of the BPTI showed that use of the combine procedure, in comparison with results obtained when habas was used alone, increases by more than 30% the number of correct assignments for ?CH2 groups and reduces the total lengths of the combined angular intervals for ?, ?, and ?1 angles to 1.9, 2.4, and 1.8 times, respectively. In contrast to the redundant dihedral angle constraints (REDAC) strategy, that derives REDAC from preliminary calculations of the complete structure, the combine procedure reduces the length of the angular intervals before using the variable target function algorithm to determine spatial structures of proteins. This feature of the combine strategy may be especially beneficial in the cases when there is lack of long-range NOEs.

Simon Sherman; Stanley Sclove; Leonid Kirnarsky; Igor Tomchin; Oleg Shats

1996-01-01T23:59:59.000Z

2

Structure Determination of Echovirus 1  

Science Journals Connector (OSTI)

In the structure determination of echovirus 1, subtle interactions between crystallographic and non-crystallographic symmetries caused the space group to be ambiguous, but also allowed significant short cuts in the molecular-replacement calculations.

Filman, D.J.

1998-11-01T23:59:59.000Z

3

Structure determination of porcine haemoglobin  

Science Journals Connector (OSTI)

To investigate a potential candidate material for making artificial red blood cells for supplement blood transfusion, the crystal structure of porcine haemoglobin was determined up to 1.8 ? resolution.

Lu, T.-H.

2000-03-01T23:59:59.000Z

4

Determination, Control & Improvement of an SKA Radio  

E-Print Network (OSTI)

SKA core sites were chosen in a sparsely populated part of South Africa, in the Northern Cape ProvinceDetermination, Control & Improvement of an SKA Radio Environment in South Africa Three potential -200 -150 -100 -50 0 Frequency spectrum 150 to 174 MHz Spectralpowerflux-density Agg Signal Kalahari

Ellingson, Steven W.

5

Analytical Improvements in PV Degradation Rate Determination  

SciTech Connect

As photovoltaic (PV) penetration of the power grid increases, it becomes vital to know how decreased power output may affect cost over time. In order to predict power delivery, the decline or degradation rates must be determined accurately. For non-spectrally corrected data several complete seasonal cycles (typically 3-5 years) are required to obtain reasonably accurate degradation rates. In a rapidly evolving industry such a time span is often unacceptable and the need exists to determine degradation rates accurately in a shorter period of time. Occurrence of outliers and data shifts are two examples of analytical problems leading to greater uncertainty and therefore to longer observation times. In this paper we compare three methodologies of data analysis for robustness in the presence of outliers, data shifts and shorter measurement time periods.

Jordan, D. C.; Kurtz, S. R.

2011-02-01T23:59:59.000Z

6

Magnetic Structure Determination from Neutron Diffraction Data  

NLE Websites -- All DOE Office Websites (Extended Search)

logo logo Magnetic Structure Determination from Neutron Diffraction Data September 17 - 20, 2012 logo Oak Ridge National Laboratory - Oak Ridge, Tennessee, USA About the Workshop Program Lecture Notes Useful Links Organizers Travel & Lodging Wireless Networking Photos filler About the Workshop molecule The Magnetic Structure Determination Workshop 2012 concluded on September 20. The aim of this workshop was to enhance the community studying magnetism in materials by learning from experts the essential theoretical foundations to magnetic representation analysis and work through real examples to gain experience in solving and refining magnetic structures from neutron powder and single crystal diffraction data. Invited speakers: Juan Rodríguez-Carvajal (ILL, Grenoble)

7

Determining Benefits and Costs of Improved Water Heater Efficiencies  

NLE Websites -- All DOE Office Websites (Extended Search)

Determining Benefits and Costs of Improved Water Heater Efficiencies Determining Benefits and Costs of Improved Water Heater Efficiencies Title Determining Benefits and Costs of Improved Water Heater Efficiencies Publication Type Report LBNL Report Number LBNL-45618 Year of Publication 2000 Authors Lekov, Alexander B., James D. Lutz, Xiaomin Liu, Camilla Dunham Whitehead, and James E. McMahon Document Number LBNL-45618 Date Published May 4 Abstract Economic impacts on individual consumers from possible revisions to U.S. residential water heater energy-efficiency standards are examined using a life-cycle cost (LCC) analysis. LCC is the consumer's cost of purchasing and installing a water heater and operating it over its lifetime. This approach makes it possible to evaluate the economic impacts on individual consumers from the revised standards. The methodology allows an examination of groups of the population which benefit or lose from suggested efficiency standards. The results show that the economic benefits to consumers are significant. At the efficiency level examined in this paper, 35% of households with electric water heaters experience LCC savings, with an average savings of $106, while 4% show LCC losses, with an average loss of $40 compared to a pre-standard LCC average of $2,565. The remainder of the population (61%) are largely unaffected.

8

Granular Structure Determined by Terahertz Scattering  

E-Print Network (OSTI)

Light-scattering in the terahertz region is demonstrated for granular matter. A quantum-cascade laser is used in a benchtop setup to determine the angle-dependent scattering of spherical grains as well as coffee powder and sugar grains. For the interpretation of the form factors for the scattering from single particles one has to go beyond the usual Rayleigh-Gans-Debye theory and apply calculations within Mie theory. In addition to single scattering also collective correlations can be identified and extracted as a static structure factor.

Philip Born; Nick Rothbart; Matthias Sperl; Heinz-Wilhelm Hübers

2013-12-23T23:59:59.000Z

9

Determination of Structural Carbohydrates and Lignin in Biomass...  

NLE Websites -- All DOE Office Websites (Extended Search)

Determination of Structural Carbohydrates and Lignin in Biomass Laboratory Analytical Procedure (LAP) Issue Date: April 2008 Revision Date: August 2012 (Version 08-03-2012) A....

10

Local structures - key to improved gas adsorption in carbon materials |  

NLE Websites -- All DOE Office Websites (Extended Search)

Functional Materials for Energy Functional Materials for Energy Local structures - key to improved gas adsorption in carbon materials September 23, 2013 (Inset, top left) A simulated disordered carbon structure. (Inset, bottom right) Same structure, with dense colored regions showing the strongest adsorption positions. (Main figure) Isosteric heat of adsorption as a function of carbon density, showing the strong change of adsorption with pore size. Combined results from electron microscopy, neutron scattering, and theory, illustrate the link between local structures and adsorption properties in carbon materials. The achieved understanding at the atomic scale is a crucial step towards predicting and designing materials with enhanced gas adsorption properties, with important implications for applications such as

11

What Determines the Likelihood of Structural Reforms?  

Science Journals Connector (OSTI)

Abstract We use data for a panel of 60 countries over the period 1980-2005 to investigate the main drivers of the likelihood of structural reforms. We find that: (i) external debt crises are the main trigger of financial and banking reforms; (ii) inflation and banking crises are the key drivers of external capital account reforms; (iii) banking crises also hasten financial reforms; and (iv) economic recessions play an important role in promoting the necessary consensus for financial, capital, banking and trade reforms, especially in the group of OECD-countries. Additionally, we also observe that the degree of globalisation is relevant for financial reforms, in particular in the group of non-OECD countries. Moreover, an increase in the income gap accelerates the implementation of structural reforms, but increased political fragmentation does not seem to have a significant impact.

Luca Agnello; Vitor Castro; João Tovar Jalles; Ricardo M. Sousa

2014-01-01T23:59:59.000Z

12

Stress relief: improving structural strength of 3D printable objects  

Science Journals Connector (OSTI)

The use of 3D printing has rapidly expanded in the past couple of years. It is now possible to produce 3D-printed objects with exceptionally high fidelity and precision. However, although the quality of 3D printing has improved, both the time to print ... Keywords: 3D printing, physics-based modeling, structural analysis

Ondrej Stava; Juraj Vanek; Bedrich Benes; Nathan Carr; Radomír M?ch

2012-08-01T23:59:59.000Z

13

Automating the determination of 3D protein structure  

SciTech Connect

The creation of an automated method for determining 3D protein structure would be invaluable to the field of biology and presents an interesting challenge to computer science. Unfortunately, given the current level of protein knowledge, a completely automated solution method is not yet feasible, therefore, our group has decided to integrate existing databases and theories to create a software system that assists X-ray crystallographers in specifying a particular protein structure. By breaking the problem of determining overall protein structure into small subproblems, we hope to come closer to solving a novel structure by solving each component. By generating necessary information for structure determination, this method provides the first step toward designing a program to determine protein conformation automatically.

Rayl, K.D.

1993-12-31T23:59:59.000Z

14

Modern structural steels with improved properties through accelerated cooling  

SciTech Connect

The last decade has seen an enormous increase in the stringency of the demands placed on steels. The main characteristics involved are higher strength and toughness, better suitability for welding and, in certain cases, corrosion resistance. The reason for these heightened demands resides in the higher strains to which the material is exposed in structural applications and in a greater need for safety. In many areas, the steel industry has succeeded in offering appropriate solutions through improved metallurgical and rolling techniques. Accelerated cooled steel grades are one example.

Tschersich, H.J.; Schriever, U.; Bobbert, J.; Kuntze, C. [Thyssen Stahl AG, Duisburg (Germany)

1995-12-31T23:59:59.000Z

15

RECENT CRYSTAL STRUCTURE DETERMINATIONS BY NEUTRON DIFFRACTION AT OAK RIDGE  

E-Print Network (OSTI)

469. RECENT CRYSTAL STRUCTURE DETERMINATIONS BY NEUTRON DIFFRACTION AT OAK RIDGE By GEORGE M. BROWN and HENRI A. LEVY, Chemistry Division Oak Ridge National Laboratory (1), Oak Ridge, Tennessee, U. S. A ont été relevées grace au diffractomètre à neutrons d'Oak Ridge position- nant automatiquement les

Paris-Sud XI, Université de

16

Phylogeny versus body size as determinants of food web structure  

Science Journals Connector (OSTI)

...versus body size as determinants of food web structure Russell E. Naisbit 1 Rudolf...Changins-Wadenswil, 1260 Nyon, Switzerland. Food webs are the complex networks of trophic interactions...features. However, apparently realistic food webs can be generated by models invoking either...

2012-01-01T23:59:59.000Z

17

The Determination of Molecular Structure from Rotational Spectra  

DOE R&D Accomplishments (OSTI)

An analysis is presented concerning the average molecular configuration variations and their effects on molecular structure determinations. It is noted that the isotopic dependence of the zero-point is often primarily governed by the isotopic variation of the average molecular configuration. (J.R.D.)

Laurie, V. W.; Herschbach, D. R.

1962-07-00T23:59:59.000Z

18

DETERMINATION, CONTROL AND IMPROVEMENT OF AN SKA RADIO ENVIRONMENT IN SOUTH AFRICA  

E-Print Network (OSTI)

DETERMINATION, CONTROL AND IMPROVEMENT OF AN SKA RADIO ENVIRONMENT IN SOUTH AFRICA By Neël Smuts1 ABSTRACT South Africa, in its bid to host the SKA2 , has adopted a dual approach to determine, assess Recommendations and Resolutions and South African legal provisions. An overview of this process is provided. Even

Ellingson, Steven W.

19

Method and apparatus for determining material structural integrity  

DOE Patents (OSTI)

Disclosed are a nondestructive method and apparatus for determining the structural integrity of materials by combining laser vibrometry with damping analysis to determine the damping loss factor. The method comprises the steps of vibrating the area being tested over a known frequency range and measuring vibrational force and velocity vs time over the known frequency range. Vibrational velocity is preferably measured by a laser vibrometer. Measurement of the vibrational force depends on the vibration method: if an electromagnetic coil is used to vibrate a magnet secured to the area being tested, then the vibrational force is determined by the coil current. If a reciprocating transducer is used, the vibrational force is determined by a force gauge in the transducer. Using vibrational analysis, a plot of the drive point mobility of the material over the preselected frequency range is generated from the vibrational force and velocity data. Damping loss factor is derived from a plot of the drive point mobility over the preselected frequency range using the resonance dwell method and compared with a reference damping loss factor for structural integrity evaluation.

Pechersky, M.J.

1994-01-01T23:59:59.000Z

20

Recent developments in the PHENIX software for automated crystallographic structure determination  

Science Journals Connector (OSTI)

Recent developments in PHENIX, a new software system for automated crystallographic structure determination, are described.

Adams, P.D.

2003-11-28T23:59:59.000Z

Note: This page contains sample records for the topic "determination improved structure" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


21

Structural Determination of the Hydrophobic Hydration Shell of Kr  

Science Journals Connector (OSTI)

We report the first direct measurement by extended x-ray absorption fine structure spectroscopy of the hydrophobic hydration shell of the noble gas krypton. Measurements were made in aqueous solution at gas pressures in the range 20 to 100 bars and at a temperature of 320 K. Data of excellent quality were collected taking advantage of the high brilliance of a third generation synchrotron radiation source. An advanced data analysis procedure has been applied to determine the Kr-O partial radial distribution function in the short range.

Adriano Filipponi; Daniel T. Bowron; Colin Lobban; John L. Finney

1997-08-18T23:59:59.000Z

22

COBRA: Determining Atomic Positions in Thin-Film Structures and Interfaces  

NLE Websites -- All DOE Office Websites (Extended Search)

COBRA: Determining Atomic Positions in Thin-Film Structures and Interfaces COBRA: Determining Atomic Positions in Thin-Film Structures and Interfaces Coherent Bragg rod analyses (COBRA) experiments using synchrotron x-rays at Argonne's Advanced Photon Source (MHATT-CAT and PNC-CAT beamlines) directly revealed the sub-angstrom atomic interaction of epitaxial films with substrates. Information on how atoms in the adjoining layers of the film and substrate rearrange to mimic each other may lead to improvements in semiconductor manufacturing and the development of novel heterostructure materials, such as multilayer ferroelectrics, magnetic nanostructures and thin film superconductors. COBRA electron density map of a Gd2O3 film on a gallium arsenide substrate. The peaks correspond to folded Gd atomic positions parallel to the plane of the substrate.

23

Structural determinants of tobacco vein mottling virus protease substrate specificity  

SciTech Connect

Tobacco vein mottling virus (TVMV) is a member of the Potyviridae, one of the largest families of plant viruses. The TVMV genome is translated into a single large polyprotein that is subsequently processed by three virally encoded proteases. Seven of the nine cleavage events are carried out by the NIa protease. Its homolog from the tobacco etch virus (TEV) is a widely used reagent for the removal of affinity tags from recombinant proteins. Although TVMV protease is a close relative of TEV protease, they exhibit distinct sequence specificities. We report here the crystal structure of a catalytically inactive mutant TVMV protease (K65A/K67A/C151A) in complex with a canonical peptide substrate (Ac-RETVRFQSD) at 1.7-{angstrom} resolution. As observed in several crystal structures of TEV protease, the C-terminus ({approx}20 residues) of TVMV protease is disordered. Unexpectedly, although deleting the disordered residues from TEV protease reduces its catalytic activity by {approx}10-fold, an analogous truncation mutant of TVMV protease is significantly more active. Comparison of the structures of TEV and TVMV protease in complex with their respective canonical substrate peptides reveals that the S3 and S4 pockets are mainly responsible for the differing substrate specificities. The structure of TVMV protease suggests that it is less tolerant of variation at the P1{prime} position than TEV protease. This conjecture was confirmed experimentally by determining kinetic parameters k{sub cat} and K{sub m} for a series of oligopeptide substrates. Also, as predicted by the cocrystal structure, we confirm that substitutions in the P6 position are more readily tolerated by TVMV than TEV protease.

Sun, Ping; Austin, Brian P.; Tozer, Jozsef; Waugh, David (Debrecen); (NCI)

2010-10-28T23:59:59.000Z

24

Hierarchically Structured ZnO Nanorods-Nanosheets for Improved Quantum-Dot-Sensitized Solar Cells  

E-Print Network (OSTI)

). This hierarchical structure had two advantages in improving the power conversion efficiency (PCE) of the solar cells. INTRODUCTION The establishment of low-cost and high-performance solar cells for sustainable energy sourcesHierarchically Structured ZnO Nanorods-Nanosheets for Improved Quantum-Dot-Sensitized Solar Cells

Cao, Guozhong

25

E-Print Network 3.0 - assignment structure determination Sample...  

NLE Websites -- All DOE Office Websites (Extended Search)

structure determination... complete side- chain resonance ... Source: Donald, Bruce Randall - Departments of Biochemistry & Computer Science, Duke University Collection:...

26

Method for improving x-ray diffraction determinations of residual stress in nickel-base alloys  

DOE Patents (OSTI)

A process for improving the technique of measuring residual stress by x-ray diffraction in pieces of nickel-base alloys is discussed. Part of a predetermined area of the surface of a nickel-base alloy is covered with a dispersion. This exposes the covered and uncovered portions of the surface of the alloy to x-rays by way of an x-ray diffractometry apparatus, making x-ray diffraction determinations of the exposed surface, and measuring the residual stress in the alloy based on these determinations. The dispersion is opaque to x-rays and serves a dual purpose, since it masks off unsatisfactory signals such that only a small portion of the surface is measured, and it supplies an internal standard by providing diffractogram peaks comparable to the peaks of the nickel alloy so that the alloy peaks can be very accurately located regardless of any sources of error external to the sample. 2 figs.

Berman, R.M.; Cohen, I.

1988-04-26T23:59:59.000Z

27

Limits of NMR structure determination using variable target function calculations: ribonuclease T1, a case study  

Science Journals Connector (OSTI)

Limits of NMR structure determination using multidimensional NMR spectroscopy, variable target function calculations and relaxation matrix analysis were explored using the model protein ribonuclease T1(RNase T1). The enzyme consists of 104 amino acid residues and has a molecular mass of approximately 11 kDa. Primary experimental data comprise 1856 assigned NOE intensities, 493 3J coupling constants and 62 values of amid proton exchange rates. From these data, 2580 distance bounds, 168 allowed ranges for torsional angles and stereospecific assignments for 75% of ?-methylene protons as well as for 80% of diastereotopic methyl groups were derived. Whenever possible, the distance restraints were refined in a relaxation matrix analysis including amid proton exchange data for improvement of lower distance limits. Description of side-chain conformations were based on various models of motional averaging of 3J coupling constants. The final structure ensemble was selected from the starting ensemble comparing the global precision of structures with order parameters derived from 15N relaxation time measurements. Significant differences between the structure of \\{RNase\\} T1 in solution and in the crystal became apparent from a comparison of the two highly resolved structures.

Stefania Pfeiffer; Yasmin Karimi-Nejad; Heinz Rüterjans

1997-01-01T23:59:59.000Z

28

Improved substrate structures for InP-based devices  

SciTech Connect

A substrate structure for an InP-based semiconductor device having an InP-based film is disclosed. The substrate structure includes a substrate region having a light-weight bulk substrate and an upper GaAs layer. An interconnecting region is disposed between the substrate region and the InP-based device. The interconnecting region includes a compositionally graded intermediate layer substantially lattice matched at its one end to the GaAs layer and substantially lattice matched at its opposite end to the InP-based film. The interconnecting region further includes a dislocation mechanism disposed between the GaAs layer and the InP-based film in cooperation with the graded intermediate layer, the buffer mechanism blocking and inhibiting propagation of threading dislocations between the substrate region and the InP-based device. 1 fig.

Wanlass, M.; Sheldon, P.

1988-09-30T23:59:59.000Z

29

An improved thin film approximation to accurately determine the optical conductivity of graphene from infrared transmittance  

SciTech Connect

This work presents an improved thin film approximation to extract the optical conductivity from infrared transmittance in a simple yet accurate way. This approximation takes into account the incoherent reflections from the backside of the substrate. These reflections are shown to have a significant effect on the extracted optical conductivity and hence on derived parameters as carrier mobility and density. By excluding the backside reflections, the error for these parameters for typical chemical vapor deposited (CVD) graphene on a silicon substrate can be as high as 17% and 45% for the carrier mobility and density, respectively. For the mid- and near-infrared, the approximation can be simplified such that the real part of the optical conductivity is extracted without the need for a parameterization of the optical conductivity. This direct extraction is shown for Fourier transform infrared (FTIR) transmittance measurements of CVD graphene on silicon in the photon energy range of 370–7000?cm{sup ?1}. From the real part of the optical conductivity, the carrier density, mobility, and number of graphene layers are determined but also residue, originating from the graphene transfer, is detected. FTIR transmittance analyzed with the improved thin film approximation is shown to be a non-invasive, easy, and accurate measurement and analysis method for assessing the quality of graphene and can be used for other 2-D materials.

Weber, J. W.; Bol, A. A. [Department of Applied Physics, Eindhoven University of Technology, Den Dolech 2, P.O. Box 513, 5600 MB Eindhoven (Netherlands); Sanden, M. C. M. van de [Department of Applied Physics, Eindhoven University of Technology, Den Dolech 2, P.O. Box 513, 5600 MB Eindhoven (Netherlands); Dutch Institute for Fundamental Energy Research (DIFFER), Nieuwegein (Netherlands)

2014-07-07T23:59:59.000Z

30

Determining Factors Influencing Nuclear Envelope and Nuclear Pore Complex Structure.  

E-Print Network (OSTI)

The cell’s nuclear envelope (NE) has pores that are stabilized by nuclear pore complexes (NPC), large proteinaceous structures whose function is to mediate transport between the nucleus and cytoplasm. Although the transport process is well studied...

Gouni, Sushanth

2013-02-04T23:59:59.000Z

31

Computer-Supported Protein Structure Determination by NMR  

Science Journals Connector (OSTI)

The relationship between amino acid sequence, three-dimensional structure and biological function of proteins is one of the most intensely pursued areas of molecular biology and biochemistry. In this context, ...

Peter Güntert

1994-01-01T23:59:59.000Z

32

Determinants of Role Structure in Family Financial Management  

E-Print Network (OSTI)

Variables determining the role of husband and wife in family financial management are explored based on in-home, personal interviews. Financial tasks reflecting implementation activities and two groupings of decision ...

Rosen, Dennis L.; Granbois, Donald H.

1983-01-01T23:59:59.000Z

33

Improving angular acceptance of stationary low-concentration photovoltaic compound parabolic concentrators using acrylic lens-walled structure  

Science Journals Connector (OSTI)

Low-concentration photovoltaic compound parabolic concentrators (PV-CPC) are a significant addition of solar cell application especially in Building Integrated Photovoltaics because it does not need a tracking system and can be installed in a stationary condition. However higher concentrations correspond with the smaller half acceptance angle which is a limitation but can be improved by a lens-walled structure. In this paper to validate the rationale of this structure a low-concentration PV-CPC using an acrylic lens-walled structure module was designed and fabricated with low-cost materials. The corresponding simulation was also performed with different materials to determine whether the factor that the truncation had a significant effect. The observed outcome implied that the low-concentration PV-CPC using an acrylic lens-walled structure has a larger half acceptance angle than the mirror CPC and that a maximum optical efficiency of more than 80% can be achieved using Schott BK glass as the lens wall material. The lens-walled structure improved the angular acceptance of stationary low-concentration PV-CPC providing a basis for further research.

2014-01-01T23:59:59.000Z

34

Pairwise covariance adds little to secondary structure prediction but improves the prediction of non-canonical local structure  

SciTech Connect

Amino acid sequence probability distributions, or profiles, have been used successfully to predict secondary structure and local structure in proteins. Profile models assume the statistical independence of each position in the sequence, but the energetics of protein folding is better captured in a scoring function that is based on pairwise interactions, like a force field. I-sites motifs are short sequence/structure motifs that populate the protein structure database due to energy-driven convergent evolution. Here we show that a pairwise covariant sequence model does not predict alpha helix or beta strand significantly better overall than a profile-based model, but it does improve the prediction of certain loop motifs. The finding is best explained by considering secondary structure profiles as multivariant, all-or-none models, which subsume covariant models. Pairwise covariance is nonetheless present and energetically rational. Examples of negative design are present, where the covariances disfavor non-native structures. Measured pairwise covariances are shown to be statistically robust in cross-validation tests, as long as the amino acid alphabet is reduced to nine classes. We present an updated I-sites local structure motif library and web server that provide sequence covariance information for all types of local structure in globular proteins.

Bystroff, Christopher; Webb-Robertson, Bobbie-Jo M.

2009-05-06T23:59:59.000Z

35

Improved  

NLE Websites -- All DOE Office Websites (Extended Search)

Improved Improved cache performance in Monte Carlo transport calculations using energy banding A. Siegel a , K. Smith b , K. Felker c,∗ , P . Romano b , B. Forget b , P . Beckman c a Argonne National Laboratory, Theory and Computing Sciences and Nuclear Engineering Division b Massachusetts Institute of Technology, Department of Nuclear Science and Engineering c Argonne National Laboratory, Theory and Computing Sciences Abstract We present an energy banding algorithm for Monte Carlo (MC) neutral parti- cle transport simulations which depend on large cross section lookup tables. In MC codes, read-only cross section data tables are accessed frequently, ex- hibit poor locality, and are typically much too large to fit in fast memory. Thus, performance is often limited by long latencies to RAM, or by off-node communication latencies when the data footprint is very large and must be decomposed on

36

Radiation-Pattern Improvement of Patch Antennas Using a Compact Soft/Hard Surface (SHS) Structure  

E-Print Network (OSTI)

Radiation-Pattern Improvement of Patch Antennas Using a Compact Soft/Hard Surface (SHS) Structure is employed to surround the patch antenna for blocking the surface- wave propagation, thus alleviating-fired ceramics (LTCC) technology. It is shown that the gain of a patch antenna can be increased to near 9 d

Tentzeris, Manos

37

Improved determination of the astrophysical S(0) factor of the (15)N(p,alpha)(12)C reaction  

E-Print Network (OSTI)

RAPID COMMUNICATIONS PHYSICAL REVIEW C 80, 012801(R) (2009) Improved determination of the astrophysical S(0) factor of the 15N( p, ?)12C reaction M. La Cognata,1 V. Z. Goldberg,2 A. M. Mukhamedzhanov,2 C. Spitaleri,1,* and R. E. Tribble2 1DMFCI...

La Cognata, M.; Goldberg, V. Z.; Mukhamedzhanov, A. M.; Spitaleri, C.; Tribble, Robert E.

2009-01-01T23:59:59.000Z

38

Structural Basis of the Green–Blue Color Switching in Proteorhodopsin as Determined by NMR Spectroscopy  

Science Journals Connector (OSTI)

Structural Basis of the Green–Blue Color Switching in Proteorhodopsin as Determined by NMR Spectroscopy ... Consequently, the S0–S1 energy gap increases, resulting in the observed blue shift. ...

Jiafei Mao; Nhu-Nguyen Do; Frank Scholz; Lenica Reggie; Michaela Mehler; Andrea Lakatos; Yean-Sin Ong; Sandra J. Ullrich; Lynda J. Brown; Richard C. D. Brown; Johanna Becker-Baldus; Josef Wachtveitl; Clemens Glaubitz

2014-11-21T23:59:59.000Z

39

Methodology and applications of high resolution solid-state NMR to structure determination of proteins  

E-Print Network (OSTI)

A number of methodological developments and applications of solid-state NMR for assignment and high resolution structure determination of microcrystalline proteins and amyloid fibrils are presented. Magic angle spinning ...

Lewandowski, Józef Romuald

2008-01-01T23:59:59.000Z

40

Improved Structure and Fabrication of Large, High-Power KHPS Rotors - Final Scientific/Technical Report  

SciTech Connect

Verdant Power, Inc, working in partnership with the National Renewable Energy Laboratory (NREL), Sandia National Laboratories (SNL), and the University of Minnesota St. Anthony Falls Laboratory (SAFL), among other partners, used evolving Computational Fluid Dynamics (CFD) and Finite Element Analysis (FEA) models and techniques to improve the structure and fabrication of large, high-power composite Kinetic Hydropower System (KHPS) rotor blades. The objectives of the project were to: design; analyze; develop for manufacture and fabricate; and thoroughly test, in the lab and at full scale in the water, the improved KHPS rotor blade.

Corren, Dean [Verdant Power, Inc.; Colby, Jonathan [Verdant Power, Inc.; Adonizio, Mary Ann [Verdant Power, Inc.

2013-01-29T23:59:59.000Z

Note: This page contains sample records for the topic "determination improved structure" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


41

Improved Measurement of the Muon Lifetime and Determination of the Fermi Constant  

E-Print Network (OSTI)

The MuLan collaboration has measured the lifetime of the positve muon to a precision of 1.0 parts per million. The Fermi constant is determined to a precision of 0.6 parts per million.

P. T. Debevec

2011-08-22T23:59:59.000Z

42

Improvements in Test Protocols for Electric Vehicles to Determine Range and Total Energy Consumption  

Science Journals Connector (OSTI)

As electric vehicles have entered the market fairly recently, ... tested the same way as the ICE-driven cars with the exception that determining range is ... However, the current procedures address mainly primary...

Juhani Laurikko; Jukka Nuottimäki…

2013-01-01T23:59:59.000Z

43

An improved method for the determination of the wellstream gas specific gravity for retrograde gases  

E-Print Network (OSTI)

solution of the equation. Th1s term, the additional gas production (AGP), accounts for the gas production from low pressure separators. Second, the vapor-equivalent of the primary separator liquid (VEQ) correlation has been improved. And third, AGP... and VEQ correlations were developed for both two-stage and three-stage separation systems. These correlat1ons were developed using the flash liberation results from 234 laboratory fluid analyses. The models wer e fit to the data using non-11near...

Gold, David Keith

1988-01-01T23:59:59.000Z

44

Input/Output of ab-initio nuclear structure calculations for improved performance and portability  

SciTech Connect

Many modern scientific applications rely on highly computation intensive calculations. However, most applications do not concentrate as much on the role that input/output operations can play for improved performance and portability. Parallelizing input/output operations of large files can significantly improve the performance of parallel applications where sequential I/O is a bottleneck. A proper choice of I/O library also offers a scope for making input/output operations portable across different architectures. Thus, use of parallel I/O libraries for organizing I/O of large data files offers great scope in improving performance and portability of applications. In particular, sequential I/O has been identified as a bottleneck for the highly scalable MFDn (Many Fermion Dynamics for nuclear structure) code performing ab-initio nuclear structure calculations. We develop interfaces and parallel I/O procedures to use a well-known parallel I/O library in MFDn. As a result, we gain efficient I/O of large datasets along with their portability and ease of use in the down-stream processing. Even situations where the amount of data to be written is not huge, proper use of input/output operations can boost the performance of scientific applications. Application checkpointing offers enormous performance improvement and flexibility by doing a negligible amount of I/O to disk. Checkpointing saves and resumes application state in such a manner that in most cases the application is unaware that there has been an interruption to its execution. This helps in saving large amount of work that has been previously done and continue application execution. This small amount of I/O provides substantial time saving by offering restart/resume capability to applications. The need for checkpointing in optimization code NEWUOA has been identified and checkpoint/restart capability has been implemented in NEWUOA by using simple file I/O.

Laghave, Nikhil

2010-12-15T23:59:59.000Z

45

Determination of transient atomic structure of laser-excited materials from time-resolved diffraction data  

SciTech Connect

The time evolution of the Bragg peaks of photo-excited gold nanofilms is measured using transmission ultrafast electron diffraction (UED) with 3.0 MeV electron pulses and the corresponding structure evolution is calculated using two-temperature molecular dynamics (2T-MD). The good agreement obtained between the measured and calculated Bragg peaks, over the full experimental timescale, enables the lattice temperature effects and the structural changes to be disentangled for the first time. The agreement demonstrates that 2T-MD is a reliable method for solving the inverse problem of structure determination of laser irradiated metals in UED measurements.

Giret, Yvelin [The Institute of Scientific and Industrial Research (ISIR), Osaka University, Mihogaoka 8-1, Ibaraki, Osaka 567-0047 (Japan) [The Institute of Scientific and Industrial Research (ISIR), Osaka University, Mihogaoka 8-1, Ibaraki, Osaka 567-0047 (Japan); Department of Physics and Astronomy, University College London, Gower Street, WC1E 6BT London (United Kingdom); Naruse, Nobuyasu; Murooka, Yoshie; Yang, Jinfeng; Tanimura, Katsumi [The Institute of Scientific and Industrial Research (ISIR), Osaka University, Mihogaoka 8-1, Ibaraki, Osaka 567-0047 (Japan)] [The Institute of Scientific and Industrial Research (ISIR), Osaka University, Mihogaoka 8-1, Ibaraki, Osaka 567-0047 (Japan); Daraszewicz, Szymon L.; Duffy, Dorothy M.; Shluger, Alexander L. [Department of Physics and Astronomy, University College London, Gower Street, WC1E 6BT London (United Kingdom)] [Department of Physics and Astronomy, University College London, Gower Street, WC1E 6BT London (United Kingdom)

2013-12-16T23:59:59.000Z

46

Stealth carriers for low-resolution structure determination of membrane proteins in solution  

Science Journals Connector (OSTI)

Specifically deuterated phospholipid bilayer nanodiscs have been developed which give a minimal contribution to neutron scattering data when used in 100% D2O. These provide an optimal platform for low-resolution structural determination of membrane proteins and their complexes in solution.

Maric, S.

2014-01-29T23:59:59.000Z

47

The determination of the in situ structure by nuclear spin contrast variation  

SciTech Connect

Polarized neutron scattering from polarized nuclear spins in hydrogenous substances opens a new way of contrast variation. The enhanced contrast due to proton spin polarization was used for the in situ structure determination of tRNA of the functional complex of the E.coli ribosome.

Stuhrmann, H.B. [GKSS Forschungszentrum, Geesthacht (Germany); Nierhaus, K.H. [Max-Planch-Institut fuer Molekulare Genetik, Berlin (Germany)

1994-12-31T23:59:59.000Z

48

A DATA-DRIVEN, SYSTEMATIC SEARCH ALGORITHM FOR STRUCTURE DETERMINATION OF DENATURED OR DISORDERED PROTEINS  

E-Print Network (OSTI)

laboratory-denatured and natively-disordered proteins, the number of restraints measured by the current NMR denatured and disordered proteins, we formulate the structure determination problem as the computation proteins are disordered or partially- disordered in their native state in solution. Such natively

Richardson, David

49

Lipid Bilayer Structure Determined by the Simultaneous Analysis of Neutron and X-Ray Scattering Data  

E-Print Network (OSTI)

Lipid Bilayer Structure Determined by the Simultaneous Analysis of Neutron and X-Ray Scattering) and dipalmitoylphosphatidylcholine (DPPC) bilayers by simultaneously analyzing x-ray and neutron scattering data. The neutron data electron and neutron scattering density profiles. A key result of the analysis is the molecular surface

Nagle, John F.

50

Application of electron microscopy and x-ray structural analysis for the determination of sizes of structural elements in nanocrystalline materials (Review)  

Science Journals Connector (OSTI)

The possibilities of determining the sizes of structural elements in various nanocrystalline materials by electron microscopy and X-ray structural analysis are analyzed. It is shown that these sizes depend on ...

Yu. D. Yagodkin; S. V. Dobatkin

2008-12-01T23:59:59.000Z

51

Control over structure-specific flexibility improves anatomical accuracy for point-based deformable registration in bladder cancer radiotherapy  

SciTech Connect

Purpose: Future developments in image guided adaptive radiotherapy (IGART) for bladder cancer require accurate deformable image registration techniques for the precise assessment of tumor and bladder motion and deformation that occur as a result of large bladder volume changes during the course of radiotherapy treatment. The aim was to employ an extended version of a point-based deformable registration algorithm that allows control over tissue-specific flexibility in combination with the authors' unique patient dataset, in order to overcome two major challenges of bladder cancer registration, i.e., the difficulty in accounting for the difference in flexibility between the bladder wall and tumor and the lack of visible anatomical landmarks for validation. Methods: The registration algorithm used in the current study is an extension of the symmetric-thin plate splines-robust point matching (S-TPS-RPM) algorithm, a symmetric feature-based registration method. The S-TPS-RPM algorithm has been previously extended to allow control over the degree of flexibility of different structures via a weight parameter. The extended weighted S-TPS-RPM algorithm was tested and validated on CT data (planning- and four to five repeat-CTs) of five urinary bladder cancer patients who received lipiodol injections before radiotherapy. The performance of the weighted S-TPS-RPM method, applied to bladder and tumor structures simultaneously, was compared with a previous version of the S-TPS-RPM algorithm applied to bladder wall structure alone and with a simultaneous nonweighted S-TPS-RPM registration of the bladder and tumor structures. Performance was assessed in terms of anatomical and geometric accuracy. The anatomical accuracy was calculated as the residual distance error (RDE) of the lipiodol markers and the geometric accuracy was determined by the surface distance, surface coverage, and inverse consistency errors. Optimal parameter values for the flexibility and bladder weight parameters were determined for the weighted S-TPS-RPM. Results: The weighted S-TPS-RPM registration algorithm with optimal parameters significantly improved the anatomical accuracy as compared to S-TPS-RPM registration of the bladder alone and reduced the range of the anatomical errors by half as compared with the simultaneous nonweighted S-TPS-RPM registration of the bladder and tumor structures. The weighted algorithm reduced the RDE range of lipiodol markers from 0.9-14 mm after rigid bone match to 0.9-4.0 mm, compared to a range of 1.1-9.1 mm with S-TPS-RPM of bladder alone and 0.9-9.4 mm for simultaneous nonweighted registration. All registration methods resulted in good geometric accuracy on the bladder; average error values were all below 1.2 mm. Conclusions: The weighted S-TPS-RPM registration algorithm with additional weight parameter allowed indirect control over structure-specific flexibility in multistructure registrations of bladder and bladder tumor, enabling anatomically coherent registrations. The availability of an anatomically validated deformable registration method opens up the horizon for improvements in IGART for bladder cancer.

Wognum, S.; Chai, X.; Hulshof, M. C. C. M.; Bel, A. [Department of Radiotherapy, Academic Medical Center, Meiberdreef 9, 1105 AZ Amsterdam (Netherlands); Bondar, L.; Zolnay, A. G.; Hoogeman, M. S. [Department of Radiation Oncology, Daniel den Hoed Cancer Center, Erasmus Medical Center, Groene Hilledijk 301, 3075 EA Rotterdam (Netherlands)

2013-02-15T23:59:59.000Z

52

Structural determination of Si(100)2×2-Al by tensor LEED  

Science Journals Connector (OSTI)

The structure of a Si(100)2×2-Al surface at 0.5 monolayers is determined by tensor low-energy electron diffraction. The parallel dimer model is more favorable than the orthogonal dimer model. The R factor for the optimized parallel dimer structure is 0.15. The bond length of the Al dimer is almost equal to the value expected from the Pauling covalent radii. All bond lengths in five surface layers including Si-Al and Si dimer bonds are within the range of 5% from the bulk value. The distortion extends at least through the first five layers into the bulk.

H. Sakama; K. Murakami; K. Nishikata; A. Kawazu

1993-08-15T23:59:59.000Z

53

Crystal structure of a triacylglycerol lipase from Penicillium expansum at 1.3 A determined by sulfur SAD  

SciTech Connect

Triacylglycerol lipases (EC 3.1.1.3) are present in many different organisms including animals, plants, and microbes. Lipases catalyze the hydrolysis of long-chain triglycerides into fatty acids and glycerol at the interface between the water insoluble substrate and the aqueous phase. Lipases can also catalyze the reverse esterification reaction to form glycerides under certain conditions. Lipases of microbial origin are of considerable commercial interest for wide variety of biotechnological applications in industries, including detergent, food, cosmetic, pharmaceutical, fine chemicals, and biodiesel. Nowadays, microbial lipases have become one of the most important industrial enzymes. PEL (Penicillium expansum lipase) is a fungal lipase from Penicillium expansum strain PF898 isolated from Chinese soil that has been subjected to several generations of mutagenesis to increase its enzymatic activity. PEL belongs to the triacylglycerol lipases family, and its catalytic characteristics have been studied. The enzyme has been used in Chinese laundry detergent industry for several years (http://www.leveking.com). However, the poor thermal stability of the enzyme limits its application. To further study and improve this enzyme, PEL was cloned and sequenced. Furthermore, it was overexpressed in Pichia pastoris. PEL contains GHSLG sequence, which is the lipase consensus sequence Gly-X1-Ser-X2-Gly, but has a low amino acid sequence identities to other lipases. The most similar lipases are Rhizomucor miehei (PML) and Rhizopus niveus (PNL) with a 21% and 20% sequence identities to PEL, respectively. Interestingly, the similarity of PEL with the known esterases is somewhat higher with 24% sequence identity to feruloyl esterase A. Here, we report the 1.3 {angstrom} resolution crystal structure of PEL determined by sulfur SAD phasing. This structure not only presents a new lipase structure at high resolution, but also provides a structural platform to analyze the published mutagenesis results. The structure may also open up new avenues for future protein engineering study on PEL.

Bian, Chuanbing; Yuan, Cai; Chen, Liqing; Meehan, Edward J.; Jiang, Longguang; Huang, Zixiang; Lin, Lin; Huang, Mingdong; (UAH); (Fujian); (Chinese Aca. Sci.)

2010-04-05T23:59:59.000Z

54

Determination of the structure of oxidised Desulfovibrio africanus ferredoxin I by 1H NMR spectroscopy and comparison of its solution structure with its crystal structure  

Science Journals Connector (OSTI)

The solution structure of the 64 amino acid Fe4S4ferredoxin I fromDesulfovibrio africanus has been determined using two-dimensional 1H NMR spectroscopy. Sequence-specific assignments were obtained for 59 amino acid residues and the structure determined with the program DIANA on the basis of 549 nuclear Overhauser enhancement (NOE) upper distance limits, and four dihedral angle and 52 distance constraints for the Fe4S4cluster. The NMR structure was refined using the simulated annealing and energy minimisation protocols of the program X-PLOR to yield a final family of 19 structures selected on the basis of good covalent geometry and minimal restraint violations. The r.m.s.d. values to the average structure for this family are 0.49(±0.07) Å and 0.94(±0.09) Å for the backbone and heavy-atoms of residues 3 to 62, respectively. The NMR structure has been compared to the previously reported X-ray structures for the two molecules within the asymmetric unit of the crystal, which have a network of seven hydrogen bonds between them. This intermolecular interface, involving residues 38, 40 to 43 and 46, has the same conformation in the solution structures showing that the crystal packing does not perturb the structure. There are three regions in which the NMR and X-ray structures differ: around the cluster, a turn involving residues 8 to 10, and a loop involving residues 29 to 32. In the family of solution structures the backbone of the loop region incorporating residues 29 to 32 is well-defined whilst in both of the X-ray molecules it is ill-defined. The small differences between the X-ray and NMR structures for the cluster environment and the turn between residues 8 to 10 probably reflects a lack of NMR constraints. The observation of relatively rapid amide NH hydrogen exchange of NH groups close to the cluster, together with rapid flipping for Phe25, which is also close to the cluster, indicates that the cluster environment is more dynamic than the corresponding regions of related Fe/S proteins.

Sharon L. Davy; Michael J. Osborne; Geoffrey R. Moore

1998-01-01T23:59:59.000Z

55

Ab initio Structure Determination of Mg10Ir19B16  

SciTech Connect

The ab initio structure determination of a novel unconventional noncentro-symmetric superconductor Mg{sub 10}Ir{sub 19}B{sub 16} (T{sub c} = 5 K) has been performed using a method that involves a combination of experimental data and calculations. Electron diffraction, X-ray powder diffraction, phase estimation routines, quantum mechanical calculations, high-resolution electron microscopy, and structural chemistry arguments are used. With the strengths of different methods used to eliminate the ambiguities encountered in others, the complete structure, including a very light B atom, has been determined with a high accuracy from impure polycrystalline powder samples, which suggests that the type of analysis described may be used to successfully address other similar intractable problems. The solved structure of Mg{sub 10}Ir{sub 19}B{sub 16} shows a complex nature that irregular coordination environments preclude a conversional description of compact packing of coordination polyhedra; however, it can be easier understood as ordered in an onion-skin-like series of nested polyhedra.

Xu, Qiang [Delft University of Technology, Delft, Netherlands; Klimczuk, T. [Princeton University; Gortenmulder, T. [Universitate Amsterdam; Jansen, J. [Delft University of Technology, Delft, Netherlands; McGuire, Michael A [ORNL; Cava, R. J. [Princeton University; Zandbergen, H [Delft University of Technology, Delft, Netherlands

2009-01-01T23:59:59.000Z

56

Characterizing the nano and micro structure of concrete to improve its durability  

SciTech Connect

New and advanced methodologies have been developed to characterize the nano and microstructure of cement paste and concrete exposed to aggressive environments. High resolution full-field soft X-ray imaging in the water window is providing new insight on the nano scale of the cement hydration process, which leads to a nano-optimization of cement-based systems. Hard X-ray microtomography images on ice inside cement paste and cracking caused by the alkali-silica reaction (ASR) enables three-dimensional structural identification. The potential of neutron diffraction to determine reactive aggregates by measuring their residual strains and preferred orientation is studied. Results of experiments using these tools will be shown on this paper.

Monteiro, P.J.M.; Kirchheim, A.P.; Chae, S.; Fischer, P.; MacDowell, A.A.; Schaible, E.; Wenk, H.R.

2008-10-22T23:59:59.000Z

57

Characterizing the Nano and Micro Structure of Concrete toImprove its Durability  

SciTech Connect

New and advanced methodologies have been developed to characterize the nano and microstructure of cement paste and concrete exposed to aggressive environments. High resolution full-field soft X-ray imaging in the water window is providing new insight on the nano scale of the cement hydration process, which leads to a nano-optimization of cement-based systems. Hard X-ray microtomography images of ice inside cement paste and cracking caused by the alkali?silica reaction (ASR) enables three-dimensional structural identification. The potential of neutron diffraction to determine reactive aggregates by measuring their residual strains and preferred orientation is studied. Results of experiments using these tools are shown on this paper.

Monteiro, P.J.M.; Kirchheim, A.P.; Chae, S.; Fischer, Peter; MacDowell, Alastair; Schaible, Eirc; Wenk, H.R.; Macdowell, Alastair A.

2009-01-13T23:59:59.000Z

58

Improvement of pin-type amorphous silicon solar cell performance by employing double silicon-carbide p-layer structure  

E-Print Network (OSTI)

Improvement of pin-type amorphous silicon solar cell performance by employing double silicon-carbide Received 30 October 2003; accepted 18 November 2003 We investigated a double silicon-carbide p-layer structure consisting of a undiluted p-type amorphous silicon-carbide (p-a-SiC:H) window layer and a hydrogen

Kim, Yong Jung

59

Determination of accidental forklift truck impact forces on drive-in steel rack structures  

Science Journals Connector (OSTI)

The paper addresses the problem of determining the accidental forklift truck impact forces on steel storage racks. Based on first principles of mechanics, simple models of a loaded forklift truck and a drive-in racking structure are presented. Model masses, as well as stiffness and damping coefficients are calibrated against experimental results obtained from tests of a forklift truck and a drive-in racking structure. Comparisons between experimental results and solutions obtained from the simple mechanical models show that the simple models accurately reproduce the static and dynamic behaviours of their associated structures. Based on the drive-in rack impact test results presented in a companion paper (Gilbert and Rasmussen, submitted for publication) [1] and the simple mechanical models for drive-in racks, actual impact forces are calculated and presented. Finally, using the impact test results and the simple mechanical models, the actual motion of the forklift truck body is calculated. This motion, being a common characteristic to all drive-in racking impacts, allows impact forces to be obtained for various pallet loads, impact elevations and rack characteristics. Thus, the paper concludes with a general method for calculating forces generated under forklift truck impact.

Benoit P. Gilbert; Kim J.R. Rasmussen

2011-01-01T23:59:59.000Z

60

Towards Structural Determination of the Water-splitting Enzyme PURIFICATION, CRYSTALLIZATION, AND PRELIMINARY CRYSTALLOGRAPHIC STUDIES OF PHOTOSYSTEM  

E-Print Network (OSTI)

Towards Structural Determination of the Water-splitting Enzyme PURIFICATION, CRYSTALLIZATION functions as a water/plastoquinone oxidoreductase in the thylakoid membrane of chloroplasts and cyanobacteria yielding oxygen, protons, and reduced plastoqui- none by the splitting of water. Powered

Roegner, Matthias

Note: This page contains sample records for the topic "determination improved structure" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


61

Report of the Ad Hoc Committee to Determine the Needs and Structure of UW-Madison's Research Enterprise  

E-Print Network (OSTI)

1 Report of the Ad Hoc Committee to Determine the Needs and Structure of UW-Madison's Research the University of Wisconsin-Madison's preeminence in research and graduate education. The ad hoc committee has

Sheridan, Jennifer

62

Solid state nuclear magnetic resonance methodology and applications to structure determination of peptides, proteins and amyloid fibrils  

E-Print Network (OSTI)

Several methodological developments and applications of multidimensional solid-state nuclear magnetic resonance to biomolecular structure determination are presented. Studies are performed in uniformly 3C, 15N isotope ...

Jaroniec, Christopher P

2003-01-01T23:59:59.000Z

63

Method of Determining the Extent to which a Nickel Structure has been Attached by a Fluorine-Containing Gas  

DOE Patents (OSTI)

The method of determining the extent to which a nickel structure has been attacked by a halogen containing gas to which it has been exposed which comprises preparing a quantity of water substantially free from dissolved oxygen, passing ammonia gas through a cuprammonium solution to produce ammonia substantially free from oxygen, dissolving said oxygen-free ammonia in said water to produce a saturated aqueous ammonia solution free from uncombined oxygen, treating at least a portion of said nickel structure of predetermined weight with said solution to dissolve nickel compounds from the surface of said structure without dissolving an appreciable amount of said nickel and analyzing the resulting solution to determine the quantity of said nickel compounds that was associated with said said portion of said structure to determine the proportion of combined nickel in said nickel structure.

Brusie, James P.

2004-07-13T23:59:59.000Z

64

A Laves phase-body-centered cubic structural relationship determined using high voltage electron microscopy  

SciTech Connect

High energy electron and ion irradiation of a TiCr{sub 2} Laves compound were found previously to result in a transformation to a body-centered cubic (bcc) solid solution. In the case of electron irradiation, the precipitating bcc phase exhibits preferential crystallographic orientation with respect to the initial compound crystal for irradiation temperatures above 200 K. This article presents an analysis of the electron diffraction data gathered in the course of the electron irradiation-induced Laves phase to bcc transformation in TiCr{sub 2}. A structural relationship between the bcc and Laves compound crystal lattices is determined which can account for all observations of preferentially oriented bcc precipitates. The significance of this mechanism for transformations between bcc and the Laves phases is discussed. In addition, the possible significance for deformation mechanisms of the Laves compounds is explored.

Sinkler, W. [GKSS Forschungszentrum, Geesthacht (Germany). Inst. fuer Werkstofforschung] [GKSS Forschungszentrum, Geesthacht (Germany). Inst. fuer Werkstofforschung

1996-04-01T23:59:59.000Z

65

Myosin head orientation: a structural determinant for the Frank-Starling relationship  

SciTech Connect

The cellular mechanism underlying the Frank-Starling law of the heart is myofilament length-dependent activation. The mechanism(s) whereby sarcomeres detect changes in length and translate this into increased sensitivity to activating calcium has been elusive. Small-angle X-ray diffraction studies have revealed that the intact myofilament lattice undergoes numerous structural changes upon an increase in sarcomere length (SL): lattice spacing and the I{sub 1,1}/I{sub 1,0} intensity ratio decreases, whereas the M3 meridional reflection intensity (I{sub M3}) increases, concomitant with increases in diastolic and systolic force. Using a short ({approx}10 ms) X-ray exposure just before electrical stimulation, we were able to obtain detailed structural information regarding the effects of external osmotic compression (with mannitol) and obtain SL on thin intact electrically stimulated isolated rat right ventricular trabeculae. We show that over the same incremental increases in SL, the relative changes in systolic force track more closely to the relative changes in myosin head orientation (as reported by IM3) than to the relative changes in lattice spacing. We conclude that myosin head orientation before activation determines myocardial sarcomere activation levels and that this may be the dominant mechanism for length-dependent activation.

Farman, Gerrie P.; Gore, David; Allen, Edward; Schoenfelt, Kelly; Irving, Thomas C.; de Tombe, Pieter P. (IIT); (UIC)

2011-09-06T23:59:59.000Z

66

Experimental determination of the effective structure-function parameter for atmospheric turbulence  

Science Journals Connector (OSTI)

The effective structure-function parameter for scattering by atmospheric turbulentvelocityfluctuations has normally been assumed to be C eff 2 =4C V 2 /c 0 2 where C V 2 is the velocitystructure-function parameter and c 0 the sound speed. However a new derivation by Ostashev [WavesRandom Media4 403–428 (1994)] which takes into account the vectorial nature of the wind velocity field suggests that C eff 2 =22C V 2 /3c 0 2 . An experiment was designed to determine the correct value of the coefficient. Sound-pressure amplitude variances were monitored for several discrete frequencies between 380 and 3800 Hz at distances up to 250 m. Cup and hot-wire anemometers were used to determine C V 2 . A theory for scattering by inertial-subrange turbulence was then used to calculate the C eff 2 coefficient from the amplitude variance and C V 2 . Datasets recorded under different atmospheric conditions yielded different relationships between the coefficients and failed to verify either the 4 or 22/3 value. Some possible explanations for this behavior are discussed including the need for more realistic meteorological modeling.

D. K. Wilson; D. I. Havelock; M. Heyd; M. J. Smith; J. M. Noble; H. J. Auvermann

1999-01-01T23:59:59.000Z

67

Improved resolution three-dimensional integral imaging using optimized irregular lens-array structure  

Science Journals Connector (OSTI)

A rigorous approach is proposed to improve the resolution of integral imaging (InI) by finding the appropriate form of irregularity in the arrangement of the InI lenslets. The...

Kavehvash, Zahra; Mehrany, Khashayar; Bagheri, Saeed

2012-01-01T23:59:59.000Z

68

Characterizing the Nano and Micro Structure of Concrete to Improve its Durability  

E-Print Network (OSTI)

M. Early formation of ettringite in tricalcium aluminate –admixtures (mainly ettringite). Cement and Concreteof the structure of ettringite by time-of-flight neutron

Monteiro, P.J.M.

2009-01-01T23:59:59.000Z

69

Characterizing the nano and micro structure of concrete to improve its durability  

E-Print Network (OSTI)

M. Early formation of ettringite in tricalcium aluminate –admixtures (mainly ettringite). Cement and Concreteof the structure of ettringite by time-of-flight neutron

Monteiro, P.J.M.

2008-01-01T23:59:59.000Z

70

Improved group-theoretical method for eigenvalue problems of special symmetric structures, using graph theory  

Science Journals Connector (OSTI)

Group-theoretical methods for decomposition of eigenvalue problems of skeletal structures with symmetry employ the symmetry group of the structures and block-diagonalize their matrices. In some special cases, such decompositions can further be continued. ... Keywords: Decomposition, Eigenvalues, Group theory, Laplacian matrix, Mass graph, Natural frequency, Representation theory, Stiffness graph, Symmetry

A. Kaveh; M. Nikbakht

2010-01-01T23:59:59.000Z

71

Methodical improvements of standard laboratory tests for determining the sideeffects of agrochemicals on predatory mites (Acari: Phytoseiidae)  

Science Journals Connector (OSTI)

In the course of the alignment of national registration procedures with general EU guidelines, changes, improvements and validation of current test guidelines are advisable. The following is intended to contri...

Dr. F. Louis; Dr. A. Ufer

1995-10-01T23:59:59.000Z

72

Surface structure determination from scattering and recoiling: W(211) and W(211)-p(1×2)-O  

Science Journals Connector (OSTI)

Time-of-flight scattering and recoiling spectrometry with detection of both neutrals and ions for structure determinations is presented and applied to the clean W(211)-p(1×1) and W(211)-p(1×2)-O structures. Experimental data are presented in the form of scattering and recoiling intensities versus beam incident angle and scattering and recoiling structural contour maps. The clean surface is relaxed both laterally and vertically from the bulk truncated structure. Oxygen atoms occupy threefold trough sites where they are bound to two first-layer and one second-layer W atoms.

J. W. Rabalais; O. Grizzi; M. Shi; H. Bu

1989-07-03T23:59:59.000Z

73

Case studies in DSM : utilizing the Design Structure Matrix to improve New Product Introduction  

E-Print Network (OSTI)

This thesis describes a project that applies the Design Structure Matrix (DSM) in support of the Manufacturing Excellence (MX) program at Cisco Systems, Inc to reduce the cycle time of new product development initiatives ...

Go, Julie W

2007-01-01T23:59:59.000Z

74

Trees and beyond : exploiting and improving tree-structured graphical models  

E-Print Network (OSTI)

Probabilistic models commonly assume that variables are independent of each other conditioned on a subset of other variables. Graphical models provide a powerful framework for encoding such conditional independence structure ...

Choi, Myung Jin, Ph. D. Massachusetts Institute of Technology

2011-01-01T23:59:59.000Z

75

Ethylene adsorbed on Ni(110): An experimental and theoretical determination of the two-dimensional band structure  

Science Journals Connector (OSTI)

We have investigated the saturated ethylene layer on Ni(110) by low-energy electron diffraction (LEED), angle-resolved ultraviolet photoemission spectroscopy (ARUPS), and near-edge x-ray-absorption fine structure (NEXAFS). This layer exhibits a c(2×4) LEED pattern that corresponds to a structure containing two adsorbates per primitive unit cell. The ethylene molecules are adsorbed with the molecular plane parallel to the surface and the C-C axis preferentially aligned along the [11¯0] direction of the substrate, as is independently determined from the ARUPS and NEXAFS experiments. The two-dimensional (2D) adsorbate band structure is determined from the ARUPS spectra at various photon energies. Except for the ? orbital, all ethylene-derived bands show significant dispersion (up to 2 eV), but no splitting as would be expected for a structure with two molecules per unit cell. The experimentally determined band structure is reproduced in all details by extended-Hückel-theory calculations for an unsupported ethylene layer. The structural model derived from LEED, ARUPS, and NEXAFS is confirmed both by force field and by the 2D band-structure calculations. This indicates that the adsorbate-adsorbate interactions are essentially decoupled from the adsorbate-substrate interaction, that is responsible for the chemisorption bond.

M. Weinelt; W. Huber; P. Zebisch; H.-P. Steinrück; B. Reichert; U. Birkenheuer; N. Rösch

1992-07-15T23:59:59.000Z

76

Structures of resonators in a cavity for improving a sound insulation of a thin double-leaf panel  

Science Journals Connector (OSTI)

The specific acoustic problem of a double-leaf panel is a less sound insulation caused by a mass-air-mass resonance. For improving the sound insulation many studies have suggested Helmholtz resonators in the cavity which are tuned at the resonant frequency. They have measured and analyzed this problem of double-walls spaced with 100 mm thickness of air gap. They have suggested that the resonators improve the sound insulation to the resonant transmission and discussed its optimization for a gain by the resonators and structures set in the cavity. But it is unclear that those results can apply to sound insulation by a double grassing with 5 mm thickness of air gap which is often seen even as a thermal insulated window and whose air gap is quite thinner than that of the walls. Then this study measured effects of various resonators in the cavity for improving the sound insulation of thin double-leaf panels and discusses effects of structures and perforation ratio to the sound insulation.

2013-01-01T23:59:59.000Z

77

Structures of resonators in a cavity for improving a sound insulation of a thin double-leaf panel  

Science Journals Connector (OSTI)

The specific acoustic problem of a double-leaf panel is a less sound insulation caused by a mass-air-mass resonance. For improving the sound insulation many studies have suggested Helmholtz resonators in the cavity which are tuned at the resonant frequency. They have measured and analyzed this problem of double-walls spaced with 100 mm thickness of air gap. They have suggested that the resonators improve the sound insulation to the resonant transmission and discussed its optimization for a gain by the resonators and structures set in the cavity. But it is unclear that those results can apply to sound insulation by a double grassing with 5 mm thickness of air gap which is often seen even as a thermal insulated window and whose air gap is quite thinner than that of the walls. Then this study measured effects of various resonators in the cavity for improving the sound insulation of thin double-leaf panels and discusses effects of structures and perforation ratio to the sound insulation. Moreover for analyzing the effects of resonators this study discusses measured results with theoretical studies of sound absorption models for resonators.

2013-01-01T23:59:59.000Z

78

Methods used in the structure determination of bovine mitochondrial F1 ATPase  

Science Journals Connector (OSTI)

The structure of bovine mitochondrial F1 ATPase (372 kDa) was solved to 2.8 Å resolution using only one derivative compound. The structure solution depended on careful data collection and processing in conjunction with `solvent flipping'.

Abrahams, J.P.

1996-01-01T23:59:59.000Z

79

Primary Structure and Solution Conditions Determine Conformational Ensemble Properties of Intrinsically Disordered Proteins.  

E-Print Network (OSTI)

??Intrinsically disordered proteins (IDPs) are a class of proteins that do not exhibit well-defined three-dimensional structures. The absence of structure is intrinsic to their amino… (more)

Mao, Albert Hsuan-Han

2012-01-01T23:59:59.000Z

80

Improved self-absorption correction for extended x-ray absorption fine-structure measurements  

SciTech Connect

Extended x-ray absorption fine-structure (EXAFS) data collected in the fluorescence mode are susceptible to an apparent amplitude reduction due to the self-absorption of the fluorescing photon by the sample before it reaches a detector. Previous treatments have made the simplifying assumption that the effect of the EXAFS on the correction term is negligible, and that the samples are in the thick limit. We present a nearly exact treatment that can be applied for any sample thickness or concentration, and retains the EXAFS oscillations in the correction term.

Booth, C.H.; Bridges, F.

2003-06-04T23:59:59.000Z

Note: This page contains sample records for the topic "determination improved structure" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


81

Improving electronic structure methods to predict nano-optoelectronics and nano-catalyst functions.  

SciTech Connect

This report focuses on quantum chemistry and ab initio molecular dynamics (AIMD) calculations applied to elucidate the mechanism of the multi-step, 2-electron, electrochemical reduction of the green house gas molecule carbon dioxide (CO{sub 2}) to carbon monoxide (CO) in aqueous media. When combined with H{sub 2} gas to form synthesis ('syn') gas, CO becomes a key precursor to methane, methanol, and other useful hydrocarbon products. To elucidate the mechanism of this reaction, we apply computational electrochemistry which is a fledgling, important area of basic science critical to energy storage. This report highlights several approaches, including the calculation of redox potentials, the explicit depiction of liquid water environments using AIMD, and free energy methods. While costly, these pioneering calculations reveal the key role of hydration- and protonation-stabilization of reaction intermediates, and may inform the design of CO{sub 2}-capture materials as well as its electrochemical reduction. In the course of this work, we have also dealt with the challenges of identifying and applying electronic structure methods which are sufficiently accurate to deal with transition metal ion complex-based catalyst. Such electronic structure methods are also pertinent to the accurate modeling of actinide materials and therefore to nuclear energy research. Our multi-pronged effort towards achieving this titular goal of the LDRD is discussed.

Nielsen, Ida Marie B.; Marzari, Nicola (Massachusetts Institute of Technology); Shelnutt, John Allen; Kulik, Heather J. (Massachusetts Institute of Technology); Medforth, Craig John (University of New Mexico, Albuquerque, NM); Leung, Kevin

2009-10-01T23:59:59.000Z

82

Geometry of the Ag{001}-c (2×2)Cl structure as determined by He diffraction  

Science Journals Connector (OSTI)

The structure of the Ag{001}-c (2×2)Cl surface has been studied with He-atom diffraction. Two proposed Cl binding geometries have been considered as structural alternatives: the fourfold-hollow simple overlayer model and a mixed layer of coplanar Ag and Cl. We have calculated the repulsive He potential, based on self-consistent charge densities of the target, for both configurations. The two geometries are easily distinguished. The charge densities for the overlayer structure yield a corrugation which is in good agreement with the scattering data and lead to an unambiguous selection between the two structural models. We have further examined the possibility that the Cl overlayer undergoes a structural phase transition or irreversibly disorders at elevated temperatures. We find no change in the structure for temperatures up to 650 K, at which point Cl leaves the surface.

M. J. Cardillo, G. E. Becker, D. R. Hamann, J. A. Serri, L. Whitman, and L. F. Mattheiss

1983-07-15T23:59:59.000Z

83

Improved algorithms for the calculation of resolved resonance cross sections with applications to the structural Doppler effect in fast reactors  

SciTech Connect

Motivated by a need for an economical yet rigorous tool which can address the computation of the structural material Doppler effect, an extremely efficient improved RABANL capability has been developed utilizing the fact that the Doppler broadened line shape functions become essentially identical to the natural line shape functions or Lorentzian limits beyond about 100 Doppler widths from the resonance energy, or when the natural width exceeds about 200 Doppler widths. The computational efficiency has been further enhanced by preprocessing or screening a significant number of selected resonances during library preparation into composition and temperature independent smooth background cross sections. The resonances which are suitable for such pre-processing are those which are either very broad or those which are very weak. The former contribute very little to the Doppler effect and their self-shielding effect can readily be averaged into slowly varying background cross section data, while the latter contribute very little to either the Doppler or to self-shielding effects. To illustrate the accuracy and efficiency of the improved RABANL algorithms and resonance screening techniques, calculations have been performed for two systems, the first with a composition typical of the STF converter region and the second typical of an LMFBR core composition. Excellent agreement has been found for RABANL compared to the reference Monte Carlo solution obtained using the code VIM, and improved results have also been obtained for the narrow resonance approximation in the ultra-fine-group option of MC/sup 2/-2.

Hwang, R.N.; Toppel, B.J.; Henryson, H. II

1980-10-01T23:59:59.000Z

84

Facilitation of protein 3-D structure determination using enhanced peptide amide deuterium exchange mass spectrometry (DXMS)  

E-Print Network (OSTI)

hydrophobic interaction in protein folding. Proc Natl Acad1999;28:1-27. 15. Protein Folding, Dynamics, and StructuralHydrogen exchange and protein folding. Curr. Opin. Struct.

Pantazatos, Dennis Peter

2006-01-01T23:59:59.000Z

85

Determining the size-dependent structure of ligand-free gold-cluster ions  

Science Journals Connector (OSTI)

...size-dependence of the methanol C-O stretching frequency, as well as Car-Parrinello calculations of vibrational frequencies and structures...decahedral (5) can be clearly ruled out. Even the singly defective tetrahedral isomer (2) or the distorted fcc structure (4...

2010-01-01T23:59:59.000Z

86

Structure determination of thin CoFe films by anomalous x-ray diffraction  

SciTech Connect

This work reports on the investigation of structure-property relationships in thin CoFe films grown on MgO. Because of the very similar scattering factors of Fe and Co, it is not possible to distinguish the random A2 (W-type) structure from the ordered B2 (CsCl-type) structure with commonly used x-ray sources. Synchrotron radiation based anomalous x-ray diffraction overcomes this problem. It is shown that as grown thin films and 300 K post annealed films exhibit the A2 structure with a random distribution of Co and Fe. In contrast, films annealed at 400 K adopt the ordered B2 structure.

Gloskovskii, Andrei; Stryganyuk, Gregory; Ouardi, Siham [Institut fuer Anorganische und Analytische Chemie, Johannes Gutenberg-Universitaet, 55099 Mainz (Germany); Fecher, Gerhard H.; Felser, Claudia [Institut fuer Anorganische und Analytische Chemie, Johannes Gutenberg-Universitaet, 55099 Mainz (Germany); Max Planck Institute for Chemical Physics of Solids, D-01187 Dresden (Germany); Hamrle, Jaroslav; Pistora, Jaromir [Department of Physics and Nanotechnology Centre, VSB-Technical University of Ostrava, 70833 Ostrava (Czech Republic); Bosu, Subrojati; Saito, Kesami; Sakuraba, Yuya; Takanashi, Koki [Institute for Materials Research (IMR), Tohoku University, Sendai 980-8577 (Japan)

2012-10-01T23:59:59.000Z

87

2014-05-08 Issuance: Energy Efficiency Improvements in ANSI/ASHRAE/IES Standard 90.1-2013; Preliminary Determination  

Energy.gov (U.S. Department of Energy (DOE))

This document is a pre-publication Federal Register notice of preliminary determination regarding energy savings for ANSI/ASHRAE/IES 90.1-2013, as issued by the Deputy Assistant Secretary for Energy Efficiency on May 8, 2014. Though it is not intended or expected, should any discrepancy occur between the document posted here and the document published in the Federal Register, the Federal Register publication controls. This document is being made available through the Internet solely as a means to facilitate the public's access to this document.

88

Structure determination of human Fas apoptosis inhibitory molecule and identification of the critical residues linking the interdomain interaction to the anti-apoptotic activity  

Science Journals Connector (OSTI)

The structures of N-terminal and C-terminal domains of the human Fas apoptosis inhibitory molecule were determined. Structural and biochemical analyses of the two domains linked the interdomain interaction to the anti-apoptotic activity.

Li, G.

2014-06-29T23:59:59.000Z

89

Determining soft segment structure-property effects in the enhancement of segmented polyurethane performance  

E-Print Network (OSTI)

Liquid Crystalline Elastomer (LCE)-inspired segmented polyurethane elastomers possessing widely different extents of ordering were created to mimic the hierarchical structure of the continuous matrix and superior mechanical ...

Waletzko, Ryan Scott

2009-01-01T23:59:59.000Z

90

Identification of the first small-molecule ligand of the neuronal receptor sortilin and structure determination of the receptor-ligand complex  

Science Journals Connector (OSTI)

The identification of the first small-molecule ligand of the neuronal receptor sortilin and structure determination of the receptor-ligand complex are reported.

Andersen, J.L.

2014-01-29T23:59:59.000Z

91

NMR characterization and solution structure determination of the oxidized cytochrome c7 from Desulfuromonas?acetoxidans  

Science Journals Connector (OSTI)

...of heme proteins deposited in the Protein Data Bank. diana calculations, including the redundant angle strategy routine ( redac ) (30), were performed following the procedure and with the parameters already used by us for the determination of other...

Lucia Banci; Ivano Bertini; Mireille Bruschi; Pornthep Sompornpisut; Paola Turano

1996-01-01T23:59:59.000Z

92

Nuclear magnetic resonance solution structure of hirudin(1–51) and comparison with corresponding three-dimensional structures determined using the complete 65-residue hirudin polypeptide chain  

Science Journals Connector (OSTI)

The three-dimensional structure of the N-terminal 51-residue domain of recombinant hirudin in aqueous solution was determined by 1H nuclear magnetic resonance (NMR) spectroscopy, and the resulting high-quality solution structure was compared with corresponding structures obtained from studies with the intact, 65-residue polypeptide chain of hirudin. On the basis of 580 distance constraints derived from nuclear Overhauser effects and 109 dihedral angle constraints, a group of 20 conformers representing the solution structure of hirudin(1–51) was computed with the program DIANA and energyminimized with a modified version of the program AMBER. Residues 3 to 30 and 37 to 48 form a well-defined molecular core with two antiparallel ?-sheets composed of residues 14 to 16 and 20 to 22, and 27 to 31 and 36 to 40, and three reverse turns at residues 8 to 11 (type II), 17 to 20 (type II?) and 23 to 26 (type II). The average root-mean-square deviation of the individual NMR conformers relative to their mean co-ordinates is 0.38 Å for the backbone atoms and 0.77 Å for all heavy atoms of these residues. Increased structural disorder was found for the N-terminal dipeptide segment, the loop at residues 31 to 36, and the C-terminal tripeptide segment. The solution structure of hirudin(1–51) has the same molecular architecture as the corresponding polypeptide segment in natural hirudin and recombinant desulfatohirudin. It is also closely similar to the crystal structure of the N-terminal 51-residue segment of hirudin in a hirudin-thrombin complex, with root-mean-square deviations of the crystal structure relative to the mean solution structure of 0.61 Å for the backbone atoms and 0.91 Å for all heavy atoms of residues 3 to 30 and 37 to 48. Further coincidence is found for the loop formed by residues 31 to 36, which shows increased structural disorder in all available solution structures of hirudin, and of which residues 32 to 35 are not observable in the electron density map of the thrombin complex. Significant local structural differences between hirudin(1–51) in solution and hirudin in the crystalline thrombin complex were identified mainly for the N-terminal tripeptide segment and residues 17 to 21. These are further analyzed in an accompanying paper.

T. Szyperski; P. Güntert; S.R. Stone; K. Wüthrich

1992-01-01T23:59:59.000Z

93

Local structure of amorphous \\{MO50Ni50\\} determined by anomalous x-ray scattering using synchroton radiation  

Science Journals Connector (OSTI)

Anomalous (resonance) x-ray scattering technique using synchrotron radiation was applied to determine the compositionally resolved local structure of sputter deposited amorphous Mo50Ni50. The local environments of Mo atoms and Ni atoms were found to be significantly different from each other, but similar to the corresponding local environments in crystalline MoNi. The results compare favorably with those of the EXAFS measurement.

S. Aur; D. Kofalt; Y. Waseda; T. Egami; R. Wang; H.S. Chen; Boon-Keng Teo

1983-01-01T23:59:59.000Z

94

NMR Structure Determination for Larger Proteins Using Backbone-Only Data  

Science Journals Connector (OSTI)

...Zimmerman D. E. ., Automated analysis of protein...Montelione G. T. , Automated analysis of protein...interface for evaluating automated probabilistic peak...A web server for rapid NMR-based protein...protein structure modeling methodology...Proteins | Computer Simulation Models, Molecular...

Srivatsan Raman; Oliver F. Lange; Paolo Rossi; Michael Tyka; Xu Wang; James Aramini; Gaohua Liu; Theresa A. Ramelot; Alexander Eletsky; Thomas Szyperski; Michael A. Kennedy; James Prestegard; Gaetano T. Montelione; David Baker

2010-02-19T23:59:59.000Z

95

SUPPLEMENTARY MATERIAL Lipid bilayer structure determined by the simultaneous analysis of neutron  

E-Print Network (OSTI)

scattering intensities I(q) for both neutrons and x-rays using )()()()( qPqPqIqF TSLC= , (1.) where PLC in structure between oriented and spherical bilayers experimentally using both neutron and x-ray scattering in (2). Our study concluded no difference between the two for x-ray and neutron scattering data

Nagle, John F.

96

Device and nondestructive method to determine subsurface micro-structure in dense materials  

DOE Patents (OSTI)

A method and a device to detect subsurface three-dimensional micro-structure in a sample by illuminating the sample with light of a given polarization and detecting light emanating from the sample that has a different direction of polarization by means of a confocal optical system.

Sun, Jiangang (Westmont, IL)

2006-05-09T23:59:59.000Z

97

A combined fit of total scattering and extended x-ray absorption fine structure data for local-structure determination in crystalline materials  

SciTech Connect

Reverse Monte Carlo (RMC) refinements of local structure using a simultaneous fit of X-ray/neutron total scattering and extended X-ray absorption fine structure (EXAFS) data were developed to incorporate an explicit treatment of both single- and multiple-scattering contributions to EXAFS. The refinement algorithm, implemented as an extension to the public domain computer software RMCProfile, enables accurate modeling of EXAFS over distances encompassing several coordination shells around the absorbing species. The approach was first tested on Ni, which exhibits extensive multiple scattering in EXAFS, and then applied to perovskite-like SrAl{sub 1/2}Nb{sub 1/2}O{sub 3}. This compound crystal1izes with a cubic double-perovskite structure but presents a challenge for local-structure determination using a total pair-distribution function (PDF) alone because of overlapping peaks of the constituent partial PDFs (e.g. Al-O and Nb-O or Sr-O and O-O). The results obtained here suggest that the combined use of the total scattering and EXAFS data provides sufficient constraints for RMC refinements to recover fine details of local structure in complex perovskites. Among other results, it was found that the probability density distribution for Sr in SrAl{sub 1/2}Nb{sub 1/2}O{sub 3} adopts T{sub d} point-group symmetry for the Sr sites, determined by the ordered arrangement of Al and Nb, as opposed to a spherical distribution commonly assumed in traditional Rietveld refinements.

Proffen, Thomas E [Los Alamos National Laboratory; Krayzman, Victor [NIST; Levin, Igor [NIST; Tucker, Matt [ISIS, UK

2009-01-01T23:59:59.000Z

98

Structure determination of Ag-Ge-S glasses using neutron diffraction  

Science Journals Connector (OSTI)

The structure of the superionic glass system (Ag2S)x(GeS2)1-x, for three compositions x=0.3, 0.4, 0.5, has been studied using neutron diffraction, and isotopic-substitution neutron-diffraction experiments have been performed on three silver isotope-substituted (107Ag,natAg,109Ag) samples of the composition (Ag2S)0.5(GeS2)0.5. The average short-range orderings of Ge-S, Ag-S, and Ge-Ag correlations were identified in the radial distribution functions for the isotopically substituted system of (Ag2S)0.5(GeS2)0.5. From the first and second differences in the three sets of isotopic-substitution neutron-diffraction data, the other three partial correlations (Ag-Ag, Ge-Ge, and S-S), were also identified. By examining unusually broad peaks in the Ag-Ag correlation function, it was concluded that the Ag-Ag distribution was rather homogeneous. We were also able to obtain further information by combining the first and second difference analyses, resulting in a structural model of a slightly elongated GeS4 tetrahedron with the local environment of Ag+ ions being threefold coordination by nonbridging sulphur ions. The medium-range order of the host framework was found to be a chainlike structure of linked corner-sharing GeS4 tetrahedra. Substantial changes in the first and second peaks in the distinct scattering functions i(Q) were found with composition and also with isotopic substitution. It was possible to explain the trends in the changes of the heights of these peaks in the structure factor by applying the void model for the first sharp diffraction peak. © 1996 The American Physical Society.

J. H. Lee; A. P. Owens; A. Pradel; A. C. Hannon; M. Ribes; S. R. Elliott

1996-08-01T23:59:59.000Z

99

Progress in the Determination of the Partonic Structure of the Proton  

E-Print Network (OSTI)

We review the current state of the art in the determination of the parton substructure of the nucleon, as expressed in terms of parton distribution functions (PDFs), and probed in high-energy lepton-hadron and hadron-hadron collisions, and we assess their implications for current precision collider phenomenology, in particular at the Large Hadron Collider (LHC). We review the theoretical foundations of PDF determination: the way cross sections are expressed in terms of PDFs using perturbative QCD factorization and evolution, the methodology used to extract PDFs from experimental data, and the way in which different physical processes can be used to constrain different PDFs. We summarize current knowledge of PDFs and the limitations in accuracy currently entailed for the computation of hadron collider processes, in particular at the LHC. We discuss the current main sources of theoretical and phenomenological uncertainties, and the direction of progress towards their reduction in the future.

Stefano Forte; Graeme Watt

2013-01-28T23:59:59.000Z

100

Structural redundancy of data from wastewater treatment systems. Determination of individual balance equations  

Science Journals Connector (OSTI)

Abstract Although data reconciliation is intensely applied in process engineering, almost none of its powerful methods are employed for validation of operational data from wastewater treatment plants. This is partly due to some prerequisites that are difficult to meet including steady state, known variances of process variables and absence of gross errors. However, an algorithm can be derived from the classical approaches to data reconciliation that allows to find a comprehensive set of equations describing redundancy in the data when measured and unmeasured variables (flows and concentrations) are defined. This is a precondition for methods of data validation based on individual mass balances such as CUSUM charts. The procedure can also be applied to verify the necessity of existing or additional measurements with respect to the improvement of the data's redundancy. Results are given for a large wastewater treatment plant. The introduction aims at establishing a link between methods known from data reconciliation in process engineering and their application in wastewater treatment.

A. Spindler

2014-01-01T23:59:59.000Z

Note: This page contains sample records for the topic "determination improved structure" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


101

Atmospheric structure and variability in areas of convective storms determined from 3-h rawinsonde data  

E-Print Network (OSTI)

changes in TTI determined from charts in Fig. 58. . 101 60 61 62 Cumulative frequency distributions of changes in TTI in AVE II . . ~ . . . . . ~ Surface analysis at 2100 GMT, 11 May 1974 Satellite and radar composite at 2200 GMT, 11 May 1974 102... change in the probability of convective activity by a factor of 8 or more in 3 h. Between 30% and 60% of the total changes in parameters associated with convective activity over a 12-h period is shown to take place during a 3-h period. These large...

Wilson, Gregory Sims

2012-06-07T23:59:59.000Z

102

Crystal structure determination of the oxynitride Sr{sub 2}TaO{sub 3}N  

SciTech Connect

The crystal structure of the strontium tantalum oxynitride Sr{sub 2}TaO{sub 3}N has been resolved by Rietveld refinement using time-of-flight neutron powder diffraction data. The structure is of the K{sub 2}NiF{sub 4} type with a partially ordered anion sublattice (tetragonal, I4/mmm, a = 4.04127(3) {angstrom}, c = 12.6073(2) {angstrom}, c/a = 3.120, Z = 2). The tantalum atoms are at the center of TaO{sub 2}(O, N){sub 4} octahedra built up from two oxygen atoms at the apexes and four (N + O) atoms statistically forming the median plane. The strontium atoms have a coordination number of nine: SrO{sub 5}(O, N){sub 4}. The profile agreement factors are R{sub p} = 0.022, R{sub wp} = 0.016, R{sub exp} = 0.012, and R{sub 1} = 0.063.

Diot, N.; Marchand, R. [Univ. de Rennes 1 (France). Lab. Verres et Ceramiques] [Univ. de Rennes 1 (France). Lab. Verres et Ceramiques; Haines, J.; Leger, J.M. [CNRS, Meudon (France). Lab. de Physicochimie des Materiaux] [CNRS, Meudon (France). Lab. de Physicochimie des Materiaux; Macaudiere, P. [Centre de Recherches d`Aubervilliers (France)] [Centre de Recherches d`Aubervilliers (France); Hull, S. [Rutherford Appleton Lab., Didcot (United Kingdom). ISIS Science Div.] [Rutherford Appleton Lab., Didcot (United Kingdom). ISIS Science Div.

1999-09-01T23:59:59.000Z

103

Crystal structure determination of the oxynitride Sr[sub 2]TaO[sub 3]N  

SciTech Connect

The crystal structure of the strontium tantalum oxynitride Sr[sub 2]TaO[sub 3]N has been resolved by Rietveld refinement using time-of-flight neutron powder diffraction data. The structure is of the K[sub 2]NiF[sub 4] type with a partially ordered anion sublattice (tetragonal, I4/mmm, a = 4.04127(3) [angstrom], c = 12.6073(2) [angstrom], c/a = 3.120, Z = 2). The tantalum atoms are at the center of TaO[sub 2](O, N)[sub 4] octahedra built up from two oxygen atoms at the apexes and four (N + O) atoms statistically forming the median plane. The strontium atoms have a coordination number of nine: SrO[sub 5](O, N)[sub 4]. The profile agreement factors are R[sub p] = 0.022, R[sub wp] = 0.016, R[sub exp] = 0.012, and R[sub 1] = 0.063.

Diot, N.; Marchand, R. (Univ. de Rennes 1 (France). Lab. Verres et Ceramiques); Haines, J.; Leger, J.M. (CNRS, Meudon (France). Lab. de Physicochimie des Materiaux); Macaudiere, P. (Centre de Recherches d'Aubervilliers (France)); Hull, S. (Rutherford Appleton Lab., Didcot (United Kingdom). ISIS Science Div.)

1999-09-01T23:59:59.000Z

104

Determining the DUF55-domain structure of human thymocyte nuclear protein 1 from crystals partially twinned by tetartohedry  

SciTech Connect

Human thymocyte nuclear protein 1 (hTHYN1) contains a unique DUF55 domain of 167 residues (55-221), but its cellular function is unclear. Crystals of DUF55 belong to the trigonal space group P3{sub 1}, but twinning causes the data to approach an apparent 622 symmetry. Two datasets to 2.3 {angstrom} resolution were collected. Statistical analysis confirmed that both datasets were partially twinned by tetartohedry. Tetartohedral twin fractions were estimated. After the structure was determined, only one twofold axis of rotational pseudosymmetry was found in the crystal structure. Using the DALI program, a YTH domain, which is a potential RNA binding domain from human YTH domain-containing protein 2, was identified to have the most similar three-dimensional fold to DUF55. It is implied that DUF55 might be a potential RNA-related domain.

Yu, Feng; Song, Aixin; Xu, Chunyan; Sun, Lihua; Li, Jian; Tang, Lin; Yu, Minmin; Yeates, Todd O.; Hu, Hongyu; He, Jianhua

2009-06-06T23:59:59.000Z

105

Gas-Expanded Liquids: Synergism of Experimental and Computational Determinations of Local Structure  

SciTech Connect

This project focuses on the characterization of a new class of solvent systems called gas-expanded liquids (GXLs), targeted for green-chemistry processing. The collaboration has adopted a synergistic approach combining elements of molecular dynamics (MD) simulation and spectroscopic experiments to explore the local solvent behavior that could not be studied by simulation or experiment alone. The major accomplishments from this project are: • Applied MD simulations to explore the non-uniform structure of CO2/methanol and CO2/acetone GXLs and studied their dynamic behavior with self-diffusion coefficients and correlation functions • Studied local solvent structure and solvation behavior with a combination of spectroscopy and MD simulations • Measured transport properties of heterocyclic solutes in GXLs through Taylor-Aris diffusion techniques and compared these findings to those of MD simulations • Probed local polarity and specific solute-solvent interactions with Diels-Alder and SN2 reaction studies The broader scientific impact resulting from the research activities of this contract have been recognized by two recent awards: the Presidential Green Chemistry Award (Eckert & Liotta) and a fellowship in the American Association for the Advancement of Science (Hernandez). In addition to the technical aspects of this contract, the investigators have been engaged in a number of programs extending the broader impacts of this project. The project has directly supported the development of two postdoctoral researcher, four graduate students, and five undergraduate students. Several of the undergraduate students were co-funded by a Georgia Tech program, the Presidential Undergraduate Research Award. The other student, an African-American female graduated from Georgia Tech in December 2005, and was co-funded through an NSF Research and Education for Undergraduates (REU) award.

Charles A. Eckert; Charles L. Liotta; Rigoberto Hernandez

2007-06-26T23:59:59.000Z

106

Surface structure determinations of crystalline ionic thin films grown on transition metal single crystal surfaces by low energy electron diffraction  

SciTech Connect

The surface structures of NaCl(100), LiF(100) and alpha-MgCl2(0001) adsorbed on various metal single crystals have been determined by low energy electron diffraction (LEED). Thin films of these salts were grown on metal substrates by exposing the heated metal surface to a molecular flux of salt emitted from a Knudsen cell. This method of investigating thin films of insulators (ionic salts) on a conducting substrate (metal) circumvents surface charging problems that plagued bulk studies, thereby allowing the use of electron-based techniques to characterize the surface.

Roberts, J.G.

2000-05-01T23:59:59.000Z

107

Generalized Debye series expansion to improve the non-destructive testing and health monitoring of cylindrical structures by guided waves  

Science Journals Connector (OSTI)

Many structures in civil engineering notably bridges and nuclear power plants must be regularly strictly and carefully tested to avoid any human or environmental catastrophe. Among the NDT techniques which can be applied ultrasonic guided waves are a good candidate to monitor bars and cables. However its multimodal and dispersive behaviors can limit its performances. Theoretical modeling is sometimes needed to understand the behavior of the traveling waves to improve the testing/monitoring and made a right in-situ decision. The aim of this paper is to derive the space-time velocity field in a cylindrical waveguide perfectly embedded in an infinite solid matrix and generated by an inside bounded beam. This beam is generated by an off-axis source. Vector Hankel transform and Fourier series are combined to decompose the inside field into infinity of elementary cylindrical waves propagating in radial direction and planar waves propagating in axial direction. Global resolution method and Generalized Debye series expansion are used both to calculate the 3D global cylindrical reflection/transmission coefficients. The method is demonstrated through a steel bar embedded in cement matrix. Simulated frequency–wavenumber diagrams show that the embedding material acts like filter for different frequency ranges. Other results will be presented.

Nico F. Declercq

2013-01-01T23:59:59.000Z

108

Biochemical Characterization and Structure Determination of a Prolyl 4-Hydroxylase-like Protein from Bacillus anthracis  

E-Print Network (OSTI)

Assay 64 3.2.5.2 UV-Vis Spectroscopy Coupled Assay 65 3.2.5.3 O 2 Electrode Assay 66 3.2.6 Anaerobic UV-vis Spectroscopy Monitoring Anthrax-P4H Cofactor Binding 67 3.2.7 UV-vis Spectroscopic Titration of Anthrax-P4H with !KG 68 3.2.8 Determination.../Fe(II)-Oxygenases 83 3.3.7 O 2 Electrode Assay for Anthrax-P4H Activity 85 3.3.8 pH-Dependency of Uncoupled Reaction Catalyzed by Anthrax-P4H 88 3.3.9 Anaerobic UV-Vis Spectroscopy Monitoring Anthrax-P4H Binding 89 3.3.10 Recombinant Bacillus (Collagen...

Culpepper, Megen

2009-06-05T23:59:59.000Z

109

The Molecular Structure of a Phosphatidylserine Bilayer Determined by Scattering and Molecular Dynamics Simulations  

SciTech Connect

Phosphatidylserine (PS) lipids play essential roles in biological processes, including enzyme activation and apoptosis. We report on the molecular structure and atomic scale interactions of a fluid bilayer composed of 1-palmitoyl-2-oleoyl-sn-glycero-3-phosphatidylserine (POPS). A scattering density profile model, aided by molecular dynamics (MD) simulations, was developed to jointly refine different contrast small-angle neutron and X-ray scattering data, which yielded a lipid area of 62.7 A2 at 25 C. MD simulations with POPS lipid area constrained at different values were also performed using all-atom and aliphatic united-atom models. The optimal simulated bilayer was obtained using a model-free comparison approach. Examination of the simulated bilayer, which agrees best with the experimental scattering data, reveals a preferential interaction between Na+ ions and the terminal serine and phosphate moieties. Long-range inter-lipid interactions were identified, primarily between the positively charged ammonium, and the negatively charged carboxylic and phosphate oxygens. The area compressibility modulus KA of the POPS bilayer was derived by quantifying lipid area as a function of surface tension from area-constrained MD simulations. It was found that POPS bilayers possess a much larger KA than that of neutral phosphatidylcholine lipid bilayers. We propose that the unique molecular features of POPS bilayers may play an important role in certain physiological functions.

Pan, Jianjun [University of South Florida, Tampa (USF)] [University of South Florida, Tampa (USF); Cheng, Xiaolin [ORNL] [ORNL; Monticelli, Luca [Institut National de la Santé et de la Recherche Médicale (INSERM) and INTS, France] [Institut National de la Santé et de la Recherche Médicale (INSERM) and INTS, France; Heberle, Frederick A [ORNL] [ORNL; Kucerka, Norbert [Atomic Energy of Canada Limited (AECL), Canadian Neutron Beam Centre (CNBC) and Comenius University,] [Atomic Energy of Canada Limited (AECL), Canadian Neutron Beam Centre (CNBC) and Comenius University,; Tieleman, D. Peter [University of Calgary, ALberta, Canada] [University of Calgary, ALberta, Canada; Katsaras, John [ORNL] [ORNL

2014-01-01T23:59:59.000Z

110

Determination of the three-dimensional solution structure of Raphanus sativus Antifungal Protein 1 by 1H NMR  

Science Journals Connector (OSTI)

Raphanus sativus Antifungal Protein 1 (Rs-AFP1) is a 51 amino acid residue plant defensin isolated from radish (Raphanus sativusL.) seeds. The three-dimensional structure in aqueous solution has been determined from two-dimensional 1H NMR data recorded at 500 \\{MHz\\} using the DIANA/REDAC calculation protocols. Experimental constraints consisted of 787 interproton distances extracted from NOE cross-peaks, 89 torsional constraints from 106 vicinal interproton coupling constants and 32 stereospecific assignments of prochiral protons. Further refinement by simulated annealing resulted in a set of 20 structures having pairwise root-mean-square differences of 1.35(±0.35) Å over the backbone heavy atoms and 2.11(±0.46) Å over all heavy atoms. The molecule adopts a compact globular fold comprising an ?-helix from Asn18 till Leu28 and a triple-stranded ?-sheet (?1=Lys2-Arg6, ?2=His33-Tyr38 and ?3=His43-Pro50). The central strand of this ?-sheet is connected by two disulfide bridges (Cys21–Cys45 and Cys25–Cys47) to the ?-helix. The connection between ?-strand 2 and 3 is formed by a type \\{VIa\\} ?-turn. Even the loop (Pro7 to Asn17) between ?-strand 1 and the ?-helix is relatively well defined. The structure of Raphanus sativus Antifungal Protein 1 features all the characteristics of the “cysteine stabilized ?? motif”. A comparison of the complete structure and of the regions important for interaction with the fungal receptor according to a mutational study, is made with the structure of ?-thionin, a plant defensin that has no antifungal activity. It is concluded that this interaction is both electrostatic and specific, and some possible scenarios for the mode of action are given.

Franky Fant; Wim Vranken; Willem Broekaert; Frans Borremans

1998-01-01T23:59:59.000Z

111

WHAT DETERMINES THE DENSITY STRUCTURE OF MOLECULAR CLOUDS? A CASE STUDY OF ORION B WITH HERSCHEL  

SciTech Connect

A key parameter to the description of all star formation processes is the density structure of the gas. In this Letter, we make use of probability distribution functions (PDFs) of Herschel column density maps of Orion B, Aquila, and Polaris, obtained with the Herschel Gould Belt survey (HGBS). We aim to understand which physical processes influence the PDF shape, and with which signatures. The PDFs of Orion B (Aquila) show a lognormal distribution for low column densities until A{sub V} {approx} 3 (6), and a power-law tail for high column densities, consistent with a {rho}{proportional_to}r {sup -2} profile for the equivalent spherical density distribution. The PDF of Orion B is broadened by external compression due to the nearby OB stellar aggregates. The PDF of a quiescent subregion of the non-star-forming Polaris cloud is nearly lognormal, indicating that supersonic turbulence governs the density distribution. But we also observe a deviation from the lognormal shape at A{sub V} > 1 for a subregion in Polaris that includes a prominent filament. We conclude that (1) the point where the PDF deviates from the lognormal form does not trace a universal A{sub V} -threshold for star formation, (2) statistical density fluctuations, intermittency, and magnetic fields can cause excess from the lognormal PDF at an early cloud formation stage, (3) core formation and/or global collapse of filaments and a non-isothermal gas distribution lead to a power-law tail, and (4) external compression broadens the column density PDF, consistent with numerical simulations.

Schneider, N.; Andre, Ph.; Koenyves, V.; Motte, F.; Arzoumanian, D.; Didelon, P.; Hennemann, M.; Hill, T.; Palmeirim, P.; Peretto, N.; Roy, A. [IRFU/SAp CEA/DSM, Laboratoire AIM CNRS, Universite Paris Diderot, F-91191 Gif-sur-Yvette (France); Bontemps, S. [OASU/LAB-UMR5804, CNRS, Universite Bordeaux 1, F-33270 Floirac (France); Federrath, C. [MoCA, School of Mathematical Sciences, Monash University, VIC 3800 (Australia); Ward-Thompson, D. [Jeremiah Horrocks Institute, UCLAN, Preston, Lancashire PR1 2HE (United Kingdom); Benedettini, M.; Pezzuto, S.; Rygl, K. L. J. [IAPS-INAF, Fosso del Cavaliere 100, I-00133 Roma (Italy); Bressert, E. [CSIRO Astronomy and Space Science, Epping (Australia); Di Francesco, J. [NRCC, Herzberg Institute of Astrophysics, University of Victoria (Canada); Griffin, M. [University School of Physics and Astronomy, Cardiff (United Kingdom); and others

2013-04-01T23:59:59.000Z

112

The Crystal Structure of the Ivy delta4-16:0-ACP Desaturase Reveals Structural Details of the Oxidized Active Site and Potential Determinants of Regioselectivity  

SciTech Connect

The multifunctional acyl-acyl carrier protein (ACP) desaturase from Hedera helix (English ivy) catalyzes the {Delta}{sup 4} desaturation of 16:0-ACP and the{Delta}{sup 9} desaturation of 18:0-ACP and further desaturates{Delta}{sup 9}-16:1 or {Delta}{sup 9}-18:1 to the corresponding {Delta}{sup 4,9} dienes. The crystal structure of the enzyme has been solved to 1.95{angstrom} resolution, and both the iron-iron distance of 3.2{angstrom} and the presence of a {mu}-oxo bridge reveal this to be the only reported structure of a desaturase in the oxidized FeIII-FeIII form. Significant differences are seen between the oxidized active site and the reduced active site of the Ricinus communis (castor) desaturase; His{sup 227} coordination to Fe2 is lost, and the side chain of Glu{sup 224}, which bridges the two iron ions in the reduced structure, does not interact with either iron. Although carboxylate shifts have been observed on oxidation of other diiron proteins, this is the first example of the residue moving beyond the coordination range of both iron ions. Comparison of the ivy and castor structures reveal surface amino acids close to the annulus of the substrate-binding cavity and others lining the lower portion of the cavity that are potential determinants of their distinct substrate specificities. We propose a hypothesis that differences in side chain packing explains the apparent paradox that several residues lining the lower portion of the cavity in the ivy desaturase are bulkier than their equivalents in the castor enzyme despite the necessity for the ivy enzyme to accommodate three more carbons beyond the diiron site.

Guy,J.; Whittle, E.; Kumaran, D.; Lindqvist, Y.; Shanklin, J.

2007-01-01T23:59:59.000Z

113

Microwave Determination of the Structure of Borine Carbonyl and of the Nuclear Moments of the Stable Boron Isotopes  

Science Journals Connector (OSTI)

From measurements on the J=1?2 and the J=2?3 rotational transitions of borine carbonyl its molecular structure has been determined as follows: dBH=1.194A, dBC=1.540A, dCO=1.131A, and ?HBH = 113°52?. The moments of inertia (which assume h=6.6242×10-27 erg. sec.) in g cm2×10-40 are: 93.4266 for B10H3C12O, 96.9092 for B11H3C12O, 111.4113 for B10D3C12O, and 114.3540 for B11D3C12O. Nuclear quadrupole couplings determined are 3.36±0.10 mc/sec. for B10 and 1.55±0.08 mc/sec. for B11. Approximate values of the nuclear quadrupole moments are 0.06×10-24 cm2 for B10 and 0.03×10-24 cm2 for B11. The nuclear spin of B10 is determined as 3 and that of B11 as 3/2.

Walter Gordy; Harold Ring; Anton B. Burg

1950-06-01T23:59:59.000Z

114

Application of polarized neutron reflectometry and X-ray resonant magnetic reflectometry for determining the inhomogeneous magnetic structure in Fe/Gd multilayers  

Science Journals Connector (OSTI)

The evolution of the magnetic structure of multilayer [Fe (35 Å)/Gd (50 Å)5...] with variation in temperature and an applied magnetic field was determined using a complementary approach combining polarized neutron

E. A. Kravtsov; D. Haskel…

2010-10-01T23:59:59.000Z

115

The determination of the void structure of microporous coals by small?angle neutron scattering: Void geometry and structure in Illinois No. 6 bituminous coal  

Science Journals Connector (OSTI)

The access of solvents and reactants to the microvoid volume in porous materials such as coal plays an important role in determining the overall chemistry which takes place during a variety of chemical transformations including oxidation combustion and pyrolysis. The structure and surface composition of these voids were studied using small?angle neutron scattering techniques to examine selectively the subset of the overall void volume distribution which comprises the microvoid volume. Powdered Illinois No. 6 coal containing approximately 20% void volume was slurried in several different aqueous and cyclohexane solutions. The solutions used had various hydrogen?to?deuterium ratios in order to contrast match most of the open pore volume thereby making the microvoid volume visible. The microvoid volume observed is characterized as elongated voids having a fairly well?defined diameter and surface composition. The scattering intensity from the microvoid volume shows a well?defined Porod region indicating that the smallest void dimension is resolved by the instrumental configuration employed. A Guinier region exhibiting Q ? 1 behavior which is characteristic of elongated structures is also observed. The average radius of a circular cross section of these voids is found to be 25.4 Å. The microvoids are found to be completely filled by aqueous solutions so that the residual neutron scattering which is not eliminated by the contrast?matching aqueous solution is due to the organic matrix structure. Nonaqueous mixtures of cyclohexane cannot fill the entire microvoid volume as effectively as the aqueous mixtures. The scattering differences observed between the aqueous and nonaqueous filled coal indicates that the surface of the microvoids is predominantly aliphatic in character with the principal compositional variation being the presence or absence of acidic functionality on the surface.

Jon S. Gethner

1986-01-01T23:59:59.000Z

116

IMPROVED Ti II log(gf) VALUES AND ABUNDANCE DETERMINATIONS IN THE PHOTOSPHERES OF THE SUN AND METAL-POOR STAR HD 84937  

SciTech Connect

Atomic transition probability measurements for 364 lines of Ti II in the UV through near-IR are reported. Branching fractions from data recorded using a Fourier transform spectrometer (FTS) and a new echelle spectrometer are combined with published radiative lifetimes to determine these transition probabilities. The new results are in generally good agreement with previously reported FTS measurements. Use of the new echelle spectrometer, independent radiometric calibration methods, and independent data analysis routines enables a reduction of systematic errors and overall improvement in transition probability accuracy over previous measurements. The new Ti II data are applied to high-resolution visible and UV spectra of the Sun and metal-poor star HD 84937 to derive new, more accurate Ti abundances. Lines covering a range of wavelength and excitation potential are used to search for non-LTE effects. The Ti abundances derived using Ti II for these two stars match those derived using Ti I and support the relative Ti/Fe abundance ratio versus metallicity seen in previous studies.

Wood, M. P.; Lawler, J. E. [Department of Physics, University of Wisconsin, Madison, WI 53706 (United States); Sneden, C. [Department of Astronomy and McDonald Observatory, University of Texas, Austin, TX 78712 (United States); Cowan, J. J., E-mail: mpwood@wisc.edu, E-mail: jelawler@wisc.edu, E-mail: chris@verdi.as.utexas.edu, E-mail: cowan@nhn.ou.edu [Homer L. Dodge Department of Physics and Astronomy, University of Oklahoma, Norman, OK 73019 (United States)

2013-10-01T23:59:59.000Z

117

N-terminal determinants of human cytomegalovirus IE1 protein in nuclear targeting and disrupting PML-associated subnuclear structures  

SciTech Connect

The 72-kDa IE1 protein of human cytomegalovirus disrupts PML-associated subnuclear structures (PODs) by inducing PML desumoylation. This process correlates with the functions of IE1 in transcriptional regulation and efficient viral replication. Here, we defined the N-terminal regions of IE1 required for nuclear targeting and POD-disrupting activity. Although the 24 N-terminal amino acids encoded by exon 2, which were previously shown to be essential for nuclear targeting, did not appear to contain typical basic nuclear localization signals, these residues were able to efficiently convey the GFP protein into the nucleus, suggesting a role in promoting nuclear translocation. In assays using a series of N-terminal truncation IE1 mutants, which were forced to enter the nucleus, exon 2 was completely dispensable for POD disruption. However, the predicted two {alpha}-helix regions in exon 3 were identified as important structural determinants for protein stability and for the correlating activities in POD disruption and PML desumoylation.

Lee, Hye-Ra [Department of Molecular Cell Biology, Samsung Biomedical Research Institute, Sungkyunkwan University School of Medicine, 300 Cheoncheondong, Jangangu, Suwon, Gyeonggido 440-746 (Korea, Republic of); Huh, Yong Ho [Department of Molecular Cell Biology, Samsung Biomedical Research Institute, Sungkyunkwan University School of Medicine, 300 Cheoncheondong, Jangangu, Suwon, Gyeonggido 440-746 (Korea, Republic of); Kim, Young-Eui [Department of Molecular Cell Biology, Samsung Biomedical Research Institute, Sungkyunkwan University School of Medicine, 300 Cheoncheondong, Jangangu, Suwon, Gyeonggido 440-746 (Korea, Republic of); Lee, Karim [Institute of Molecular Biology and Genetics, School of Biological Sciences, Seoul National University, Seoul (Korea, Republic of); Kim, Sunyoung [Institute of Molecular Biology and Genetics, School of Biological Sciences, Seoul National University, Seoul (Korea, Republic of); Ahn, Jin-Hyun [Department of Molecular Cell Biology, Samsung Biomedical Research Institute, Sungkyunkwan University School of Medicine, 300 Cheoncheondong, Jangangu, Suwon, Gyeonggido 440-746 (Korea, Republic of)]. E-mail: jahn@med.skku.ac.kr

2007-05-04T23:59:59.000Z

118

Application of polarized neutron reflectometry and x-ray resonant magnetic reflectometry for determining the inhomogeneous magnetic structure in Fe/Gd multilayers.  

SciTech Connect

The evolution of the magnetic structure of multilayer [Fe (35 {angstrom})/Gd (50 {angstrom}){sub 5}] with variation in temperature and an applied magnetic field was determined using a complementary approach combining polarized neutron and X-ray resonant magnetic reflectometry. Self-consistent simultaneous analysis of X-ray and neutron spectra allowed us to determine the elemental and depth profiles in the multilayer structure with unprecedented accuracy, including the identification of an inhomogeneous intralayer magnetic structure with near-atomic resolution.

Kravtsov, E. A.; Haskel, D.; te Velthuis, S. G. E.; Jiang, J. S.; Kirby, B. J. (Materials Science Division); ( XSD); (Russian Academy of Sciences and Ural Federal Univ.); (Ural State Technical Univ.); (NIST Center for Neutron Research)

2010-01-01T23:59:59.000Z

119

Communication: Determining the structure of the N{sub 2}Ar van der Waals complex with laser-based channel-selected Coulomb explosion  

SciTech Connect

We experimentally reconstructed the structure of the N{sub 2}Ar van der Waals complex with the technique of laser-based channel-selected Coulomb explosion imaging. The internuclear distance between the N{sub 2} center of mass and the Ar atom, i.e., the length of the van der Waals bond, was determined to be 3.88 Å from the two-body explosion channels. The angle between the van der Waals bond and the N{sub 2} principal axis was determined to be 90° from the three-body explosion channels. The reconstructed structure was contrasted with our high level ab initio calculations. The agreement demonstrated the potential application of laser-based Coulomb explosion in imaging transient molecular structure, particularly for floppy van der Waals complexes, whose structures remain difficult to be determined by conventional spectroscopic methods.

Wu, Chengyin, E-mail: cywu@pku.edu.cn; Liu, Yunquan; Gong, Qihuang [State Key Laboratory for Mesoscopic Physics, Department of Physics, Peking University, Beijing 100871 (China) [State Key Laboratory for Mesoscopic Physics, Department of Physics, Peking University, Beijing 100871 (China); Collaborative Innovation Center of Quantum Matter, Beijing (China); Wu, Cong; Xie, Xiguo; Li, Min; Deng, Yongkai [State Key Laboratory for Mesoscopic Physics, Department of Physics, Peking University, Beijing 100871 (China)] [State Key Laboratory for Mesoscopic Physics, Department of Physics, Peking University, Beijing 100871 (China); Song, Di; Su, Hongmei, E-mail: hongmei@iccas.ac.cn [State Key Laboratory of Molecular Reaction Dynamics, Beijing National Laboratory for Molecular Sciences, Institute of Chemistry, Chinese Academy of Sciences, Beijing 100190 (China)] [State Key Laboratory of Molecular Reaction Dynamics, Beijing National Laboratory for Molecular Sciences, Institute of Chemistry, Chinese Academy of Sciences, Beijing 100190 (China)

2014-04-14T23:59:59.000Z

120

Improved efficiency of protein structure calculations from NMR data using the program DIANA with redundant dihedral angle constraints  

Science Journals Connector (OSTI)

A new strategy for NMR structure calculations of proteins with the variable target function method (Braun, W. and Go, N. (1985)J. Mol. Biol.,186..., 611) is described, which makes use of redundant dihedral angle ...

Peter Güntert; Kurt Wüthrich

1991-11-01T23:59:59.000Z

Note: This page contains sample records for the topic "determination improved structure" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


121

Recent Progress in the Structure Determination of GPCRs, a Membrane Protein Family with High Potential as Pharmaceutical Targets  

SciTech Connect

G protein-coupled receptors (GPCRs) constitute a highly diverse and ubiquitous family of integral membrane proteins, transmitting signals inside the cells in response to an assortment of disparate extra-cellular stimuli. Their strategic location on the cell surface and their involvement in crucial cellular and physiological processes turn these receptors into highly important pharmaceutical targets. Recent technological developments aimed at stabilization and crystallization of these receptors have led to significant breakthroughs in GPCR structure determination efforts. One of the successful approaches involved receptor stabilization with the help of a fusion partner combined with crystallization in lipidic cubic phase (LCP). The success of using an LCP matrix for crystallization is generally attributed to the creation of a more native, membrane-like stabilizing environment for GPCRs just prior to nucleation and to the formation of type I crystal lattices, thus generating highly ordered and strongly diffracting crystals. Here they describe protocols for reconstituting purified GPCRs in LCP, performing pre-crystallization assays, setting up crystallization trials in manual mode, detecting crystallization hits, optimizing crystallization conditions, harvesting, and collecting crystallographic data. The protocols provide a sensible framework for approaching crystallization of stabilized GPCRs in LCP, however, as in any crystallization experiment, extensive screening and optimization of crystallization conditions as well as optimization of protein construct and purification steps are required. The process remains risky and these protocols do not necessarily guarantee success.

Cherezov, Vadim; Abola, Enrique; Stevens, Raymond C.

2012-05-09T23:59:59.000Z

122

Precision Atomic Spectroscopy for Improved Limits on Variation of the Fine Structure Constant and Local Position Invariance  

E-Print Network (OSTI)

Alamos National Laboratory, Los Alamos, New Mexico 87545, USA 2 Time and Frequency Division MS 847 in normalized solar gravitational potential. The same frequency ratio is also used to obtain 20-fold improvement between well-resolved and relatively unperturbed atomic energy levels currently report among the highest

123

Improved estimates of separation distances to prevent unacceptable damage to nuclear power plant structures from hydrogen detonation for gaseous hydrogen storage. Technical report  

SciTech Connect

This report provides new estimates of separation distances for nuclear power plant gaseous hydrogen storage facilities. Unacceptable damage to plant structures from hydrogen detonations will be prevented by having hydrogen storage facilities meet separation distance criteria recommended in this report. The revised standoff distances are based on improved calculations on hydrogen gas cloud detonations and structural analysis of reinforced concrete structures. Also, the results presented in this study do not depend upon equivalencing a hydrogen detonation to an equivalent TNT detonation. The static and stagnation pressures, wave velocity, and the shock wave impulse delivered to wall surfaces were computed for several different size hydrogen explosions. Separation distance equations were developed and were used to compute the minimum separation distance for six different wall cases and for seven detonating volumes (from 1.59 to 79.67 lbm of hydrogen). These improved calculation results were compared to previous calculations. The ratio between the separation distance predicted in this report versus that predicted for hydrogen detonation in previous calculations varies from 0 to approximately 4. Thus, the separation distances results from the previous calculations can be either overconservative or unconservative depending upon the set of hydrogen detonation parameters that are used. Consequently, it is concluded that the hydrogen-to-TNT detonation equivalency utilized in previous calculations should no longer be used.

Not Available

1994-05-01T23:59:59.000Z

124

Improved determination of variation of rate of rotation of oscillation plane of a paraconic pendulum during the solar eclipse in Mexico on July 11, 1991  

Science Journals Connector (OSTI)

An improved value of the variation in the rate of rotation of the oscillation plane of a paraconic pendulum during the solar eclipse in Mexico on July 11, 1991 is obtained....

L. A. Savrov

2009-04-01T23:59:59.000Z

125

The Structure of Sindbis Virus Produced from Vertebrate and Invertebrate Hosts as Determined by Small-Angle Neutron Scattering  

Science Journals Connector (OSTI)

...Determined by Small-Angle Neutron Scattering Published ahead of print on...Raleigh, North Carolina 27695 3 Neutron Scattering Sciences Division, Oak Ridge...determined by small-angle neutron scattering (SANS), a nondestructive...

Lilin He; Amanda Piper; Flora Meilleur; Dean A. A. Myles; Raquel Hernandez; Dennis T. Brown; William T. Heller

2010-03-10T23:59:59.000Z

126

Structure Determination of Polyunsaturated Fatty Acids by Gas Chromatography-Mass Spectrometry—A Comparison of Fragmentation Patterns of Various Derivatives  

Science Journals Connector (OSTI)

......C - C I I 0 0 B Since boron does not participate...tributing system and alkyl-boron cleavage does not take...the corres- ponding isotope peaks observed at m...fragment ions containing two boron atoms. On the basis...diagnostic value for structure determination of polyenoate derivatives......

Veronika Dommes; Ferdinand Wirtz-Peitz; Wolf-H. Kunau

1976-08-01T23:59:59.000Z

127

Determining the crystal structure of SseB, a product of the Salmonella Pathogenicity Island II Type III Secretion System of Salmonella typhimurium  

E-Print Network (OSTI)

-epithelial cells. The aim of the research project is to clone, purify the SseB protein from Salmonella typhimurium and obtain a diffracting-quality crystal that will give high resolution data so that the structure of the protein can be determined using x...

Patel, Bhavini Narendrakumar

2008-03-20T23:59:59.000Z

128

Moisture determination and structure investigation of native and dried Argonne premium coals. A hydrogen-1 solid-state NMR relaxation study  

Science Journals Connector (OSTI)

Moisture determination and structure investigation of native and dried Argonne premium coals. ... This work has been undertaken aiming to estimate the size of pores in moist coals on the basis of the nuclear magnetic resonance relaxation characteristics of water sorbed in the pores as the molecular probe. ...

X. Yang; A. R. Garcia; J. W. Larsen; B. G. Silbernagel

1992-09-01T23:59:59.000Z

129

Improvements in the structural and optical properties of a-Si:H by a dense plasma focus  

Science Journals Connector (OSTI)

Abstract Crystallization of hydrogenated amorphous silicon thin films with irradiation by using a dense plasma focus ion beam source has been investigated. The effects of the energetic ion beam irradiation on the surface morphological, structural and optical properties of the as-prepared a-Si:H thin films were investigated with field emission scanning electron microscopy, high resolution transmission electron microscopy, Raman scattering spectroscopy and mapping, and photoluminescence (PL) spectroscopy. The results show that irradiation of the energetic ion beam leads to the agglomeration of the Si grains with formation of Si nanocrystallites embedded within the amorphous matrix. This significantly enhances the optical properties of the film that it exhibits a wide range of PL emission spectra at room temperature.

Boon Tong Goh; Siew Kien Ngoi; Seong Ling Yap; Chiow San Wong; Saadah Abdul Rahman

2013-01-01T23:59:59.000Z

130

Structure determination and analysis of helix parameters in the DNA decamer d(CATGGCCATG)2 comparison of results from NMR and crystallography  

Science Journals Connector (OSTI)

The solution structure of the DNA decamer (CATGGCCATG)2 has been determined by NMR spectroscopy and restrained molecular dynamic and distance geometry calculations. The restrainted data set includes interproton distances and torsion angles for the deoxyribose sugar ring which were obtained by nuclear Overhauser enhancement intensities and quantitative simulation of cross-peaks from double quantum filtered correlation spectroscopy. The backbone torsion angles were constrained using experimental data from NOE cross-peaks, 1H-1H and 1H-31P-coupling constants. The NMR structure and the crystal structure of the DNA decamer deviates from the structure of the canonical form of B-DNA in a number of observable characteristics. Particularly, both structures display a specific pattern of stacking interaction in the central GGC base triplet. Furthermore, a specific local conformation of the TG/CA base-pair step is present in NMR and crystal structure, highlighting the unusually high flexibility of this DNA duplex part. The solution structure of the TG/CA base-pair step obtained by our high resolution NMR study is characterized by a positive roll angle, whereas in crystal this base-pair step tends to adopt remarkably high twist angles.

Utz Dornberger; Joachim Flemming; Hartmut Fritzsche

1998-01-01T23:59:59.000Z

131

Single-particle structure determination by correlations of snapshot X-ray diffraction patterns (CXIDB ID 20)  

DOE Data Explorer (OSTI)

This deposition includes the diffraction images generated by the paired polystyrene spheres in random orientations. These images were used to determine and phase the single particle diffraction volume from their autocorrelation functions.

Starodub, D.

132

Determination of energy release rate and mode mix in three-dimensional layered structures using plate theory  

Science Journals Connector (OSTI)

A plate theory-based method for determining energy release rates is presented for general loadings ... which certain other restrictions apply. Predictions for energy release rate and mode mix for typical problems...

Barry D. Davidson; LiJie Yu; Hurang Hu

2000-09-01T23:59:59.000Z

133

ATP requirement for Prp5p function is determined by Cus2p and the structure of U2 small nuclear RNA  

E-Print Network (OSTI)

ATP requirement for Prp5p function is determined by Cus2p and the structure of U2 small nuclear RNA is the first ATP-dependent step in splicing, and it requires the DEXD H box ATPase Prp5p. However, prespli- ceosome formation occurs without ATP in extracts lacking the U2 snRNP protein Cus2p. Here we show that Prp

Ares Jr., Manny

134

Improved Description of One- and Two-Hole States after Electron Capture in 163 Holmium and the Determination of the Neutrino Mass  

E-Print Network (OSTI)

The atomic pair 163 Holmium and 163 Dysprosium$ seems due to the small Q value of about 2.3 to 2.8 keV the best case to determine the neutrino mass by electron capture. The bolometer spectrum measures the full deexcitation energy of Dysprosium by X rays, by Auger electrons and by the recoil of Holmium. The spectrum has an upper energy limit given by the Q value minus the neutrino mass. Till now this spectrum has been calculated allowing in Dysprosium excitations with 3s1/2, 3p1/2, 4s1/2, 4p1/2, 5s1/2, 5p1/2 holes only. Robertson calculated recently also the spectrum with two electron hole excitations in Dy. He took the probability for the excitation for the second electron hole from work of Carlson and Nestor for Z=54 Xenon. He claims, that the bolometer spectrum with two holes is "not well enough understood to permit a sensitive determination of the neutrino mass in this way." The purpose of the present work is to determine the theoretical bolometer spectrum with two hole excitations more reliably. In additi...

Faessler, Amand

2015-01-01T23:59:59.000Z

135

Structural Determinant of Human La Protein Critical for Internal Initiation of Translation of Hepatitis C Virus RNA  

Science Journals Connector (OSTI)

...peptide. This not only reduces the entropic cost of binding to the receptor (disorder-to-order...activities were measured and plotted in the graph. The relative FLuc activities were represented...recognition motif coupled to a helical nuclear retention element. Structure 11: 833-843...

Tanmoy Mondal; Upasana Ray; Asit Kumar Manna; Romi Gupta; Siddhartha Roy; Saumitra Das

2008-10-01T23:59:59.000Z

136

Structure determination of three furan-substituted benzimidazoles and calculation of - and C-H inter­action energies  

Science Journals Connector (OSTI)

The structures of 2-(furan-2-yl)-1-(furan-2-ylmeth­yl)-1H-benzimidazole, its hydro­chloride monohydrate, and the hydro­bromide salt of 5,6-dimethyl-2-(furan-2-yl)-1-(furan-2-ylmeth­yl)-1H-benzimidazole exhibit a combination of - and C-H inter­molecular inter­actions. DFT calculations were used to estimate the strength of these inter­actions.

Geiger, D.K.

2014-11-06T23:59:59.000Z

137

Metalloproteins: Structure Determination (HADH), Inhibition (P4H), and Biomimetic Systems (P-1[Ru(NO)(Cl)])  

E-Print Network (OSTI)

A) Phen-2-GKDEL B)Phen-2 157 -E(EDANS)VKDEL Figure 3.5. Dipsi spectrum of phen-2-GKDEL on Bruker 50 MHz 158 NMR Figure 3.6. Dipsi spectrum of phen-2-E(EDANS)VKDEL on Bruker 159 50 MHz NMR Figure 3.7. Fluorescence imaging of HF...-P4H. Figure 3.10. Colagen production by HF cels with no inhibitor (red 166 boxes) and phen-GKDEL (gren diamonds). x Figure 3.1. The chemical structure of the dye that covalently links 167 to colagen types I through V in the Sircol...

Reed, Timothy Michael

2008-01-01T23:59:59.000Z

138

Improved aethalometer  

DOE Patents (OSTI)

An improved aethalometer having a single light source and a single light detector and two light paths from the light source to the light detector. A quartz fiber filter is inserted in the device, the filter having a collection area in one light path and a reference area in the other light path. A gas flow path through the aethalometer housing allows ambient air to flow through the collection area of the filter so that aerosol particles can be collected on the filter. A rotating disk with an opening therethrough allows light for the light source to pass alternately through the two light paths. The voltage output of the detector is applied to a VCO and the VCO pulses for light transmission separately through the two light paths, are counted and compared to determine the absorption coefficient of the collected aerosol particles. 5 figs.

Hansen, A.D.

1988-01-25T23:59:59.000Z

139

Determine Institutional Change Sustainability Goals | Department...  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

Determine Institutional Change Sustainability Goals Determine Institutional Change Sustainability Goals Institutional Change Continuous Improvement Cycle The first step in the...

140

CX-011597: Categorical Exclusion Determination | Department of...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Determination CX-011597: Categorical Exclusion Determination Mission Support Alliance Annual Categorical Exclusion for Facility Safety and Environmental Improvements under...

Note: This page contains sample records for the topic "determination improved structure" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


141

CX-009656: Categorical Exclusion Determination | Department of...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Determination CX-009656: Categorical Exclusion Determination Mission Support Alliance Annual Categorical Exclusion for Facility Safety and Environmental Improvements...

142

Structure  

NLE Websites -- All DOE Office Websites (Extended Search)

Structure Structure functions 1 NOTE: THE FIGURES IN THIS SECTION ARE INTENDED TO SHOW THE REPRESENTATIVE DATA. THEY ARE NOT MEANT TO BE COMPLETE COMPILATIONS OF ALL THE WORLD'S RELIABLE DATA. Q 2 (GeV 2 ) F 2 (x,Q 2 ) * 2 i x H1 ZEUS BCDMS E665 NMC SLAC 10 -3 10 -2 10 -1 1 10 10 2 10 3 10 4 10 5 10 6 10 7 10 8 10 9 10 -1 1 10 10 2 10 3 10 4 10 5 10 6 Figure 16.6: The proton structure function F p 2 measured in electromagnetic scattering of positrons on protons (collider experiments ZEUS and H1), in the kinematic domain of the HERA data, for x > 0.00006 (cf. Fig. 16.9 for data at smaller x and Q 2 ), and for electrons (SLAC) and muons (BCDMS, E665, NMC) on a fixed target. Statistical and systematic errors added in quadrature are shown. The data are plotted as a function of Q 2 in bins of fixed x. Some points have been slightly offset in Q 2 for clarity. The ZEUS binning in x is used in this plot; all other data are rebinned to the x values of

143

High-Pressure Synthesis and Structure Determination of K6(SeO4)(SeO5), The First Potassium Orthoselenate(VI)  

SciTech Connect

The authors report on the first synthesis of a potassium orthoselenate(VI), K{sub 6}(SeO{sub 4})(SeO{sub 5}), and the structure determination from synchrotron powder diffraction data. The title compound crystallizes in the tetragonal space group P4{sub 1}2{sub 1}2 with a = 8.1259(1) {angstrom}, c = 17.4953(2) {angstrom}, V = 1155.21(2) {angstrom}{sup 3}, and Z = 4. Selenium displays two different complex anions, tetrahedral SeO{sub 4}{sup 2-} and trigonal-bipyramidal SeO{sub 5}{sup 4-}. When the formula is reduced to A{sub 3}B, the spatial arrangement of the constituting building units can be derived from the Li{sub 3}Bi type of structure.

Orosel,D.; Dinnebeier, R.; Jansen, M.

2006-01-01T23:59:59.000Z

144

X-ray absorption fine structure spectroscopic determination of plutonium speciation at the Rocky Flats environmental technology  

SciTech Connect

X-ray Absorption Fine Structure spectroscopy was used to probe the speciation of the ppm level Pu in thirteen soil and concrete samples from the Rocky Flats Environmental Technology Site in support of the site remediation effort that has been successfully completed since these measurements. In addition to X-ray Absorption Near Edge Spectra, two of the samples yielded Extended X-ray Absorption Fine Structure spectra that could be analyzed by curve-fits. Most of these spectra exhibited features consistent with PU(IV), and more specificaJly, PuO{sub 2+x}-type speciation. Two were ambiguous, possibly indicating that Pu that was originally present in a different form was transforming into PuO{sub 2+x}, and one was interpreted as demonstrating the presence of an unusual Pu(VI) compound, consistent with its source being spills from a PUREX purification line onto a concrete floor and the resultant extreme conditions. These experimental results therefore validated models that predicted that insoluble PuO{sub 2+x} would be the most stable form of Pu in equilibrium with air and water even when the source terms were most likely Pu metal with organic compounds or a Pu fire. A corollary of these models' predictions and other in situ observations is therefore that the minimal transport of Pu that occurred on the site was via the resuspension and mobilization of colloidal particles. Under these conditions, the small amounts of diffusely distributed Pu that were left on the site after its remediation pose only a negligible hazard.

Lezama-pacheco, Juan S [Los Alamos National Laboratory; Conradson, Steven D [Los Alamos National Laboratory; Clark, David L [Los Alamos National Laboratory

2008-01-01T23:59:59.000Z

145

Modeling the determinants of Medicaid home care payments for children with special health care needs: A structural equation model approach  

Science Journals Connector (OSTI)

AbstractBackground The management of children with special needs can be very challenging and expensive. Objective To examine direct and indirect cost drivers of home care expenditures for this vulnerable and expensive population. Methods We retrospectively assessed secondary data on children, ages 4–20, receiving Medicaid Personal Care Services (PCS) (n = 2760). A structural equation model assessed direct and indirect effects of several child characteristics, clinical conditions and functional measures on Medicaid home care payments. Results The mean age of children was 12.1 years and approximately 60% were female. Almost half of all subjects reported mild, moderate or severe ID diagnosis. The mean ADL score was 5.27 and about 60% of subjects received some type of rehabilitation services. Caseworkers authorized an average of 25.5 h of PCS support per week. The SEM revealed three groups of costs drivers: indirect, direct and direct + indirect. Cognitive problems, health impairments, and age affect expenditures, but they operate completely through other variables. Other elements accumulate effects (externalizing behaviors, PCS hours, and rehabilitation) and send them on a single path to the dependent variable. A few elements exhibit a relatively complex position in the model by having both significant direct and indirect effects on home care expenditures – medical conditions, intellectual disability, region, and ADL function. Conclusions The most important drivers of home care expenditures are variables that have both meaningful direct and indirect effects. The only one of these factors that may be within the sphere of policy change is the difference among costs in different regions.

Omolola E. Adepoju; Yichen Zhang; Charles D. Phillips

2014-01-01T23:59:59.000Z

146

Roadway Improvement Project Cost Allocation  

E-Print Network (OSTI)

Roadway Improvement Project Cost Allocation CTS 21st Annual Transportation Research Conference costs #12;Potential Applications · Roadway Project Feasibility Studies ­ Identified potential roadway infrastructure improvement ­ Documentation of estimated project costs ­ Determine property assessments

Minnesota, University of

147

DOE ER63951-3 Final Report: An Integrated Assessment of Geochemical and Community Structure Determinants of Metal Reduction Rates in Subsurface Sediments  

SciTech Connect

The objective of this research was to examine the importance of microbial community structure in influencing uranium reduction rates in subsurface sediments. If the redox state alone is the key to metal reduction, then any organisms that can utilize the oxygen and nitrate in the subsurface can change the geochemical conditions so metal reduction becomes an energetically favored reaction. Thus, community structure would not be critical in determining rates or extent of metal reduction unless community structure influenced the rate of change in redox. Alternatively, some microbes may directly catalyze metal reduction (e.g., specifically reduce U). In this case the composition of the community may be more important and specific types of electron donors may promote the production of communities that are more adept at U reduction. Our results helped determine if the type of electron donor or the preexisting community is important in the bioremediation of metal-contaminated environments subjected to biostimulation. In a series of experiments at the DOE FRC site in Oak Ridge we have consistently shown that all substrates promoted nitrate reduction, while glucose, ethanol, and acetate always promoted U reduction. Methanol only occasionally promoted extensive U reduction which is possibly due to community heterogeneity. There appeared to be limitations imposed on the community related to some substrates (e.g. methanol and pyruvate). Membrane lipid analyses (phospholipids and respiratory quinones) indicated different communities depending on electron donor used. Terminal restriction fragment length polymorphism and clone libraries indicated distinct differences among communities even in treatments that promoted U reduction. Thus, there was enough metabolic diversity to accommodate many different electron donors resulting in the U bioimmobilization.

Susan Pfiffner

2010-06-28T23:59:59.000Z

148

Solution structure of a fragment of the dimerization domain of DP-1 determined by 1H-nuclear magnetic resonance and distance geometry  

Science Journals Connector (OSTI)

The structure of a synthesized peptide with the sequence of NHILPNESAYDQKNIRRRVYDALNVLMAMNIISK that corresponds to residues 151–184 of transcription factor DP-1 (Girling et al., Nature 362 (1993) 83–87) was determined by 1H-nuclear magnetic resonance in water and 40% d3-trifluoroethanol/water, respectively. Nuclear Overhauser effect cross peaks, ?H chemical shifts and J-coupling constants of ?H–NH show that the peptide consists a helix from Ser-8 to Ser-33 in solution. Fifty structures were constructed with 288 upper distance limits and 21 angle constraints by DIANA (Guntert et al., J. Mol. Biol. 217 (1991) 517–530). Although the N-terminal of the peptide exhibits a random conformation, the 20 best structures show a root mean square deviation of 0.89±0.36 Å for backbone atoms and 1.80±0.34 Å for heavy atoms from residue Ser-8 to Ser-33. This result supports the proposal that DP-1 and E2F-1 may dimerize with a coiled-coil type interaction.

Shouhong Guang; Jihui Wu; Tianning Yu; Youlin Xia; Yunyu Shi

1998-01-01T23:59:59.000Z

149

Solution structure of a fragment of the dimerization domain of E2F-1 determined by circular dichroism, 1H nuclear magnetic resonance and distance geometry  

Science Journals Connector (OSTI)

The structure of a synthesized peptide with the sequence GVVDLNWAAEVLKVQKRRIYDITNVLEGIQ which corresponds to residues 149–178 of transcription factor E2F-1 was determined by 1H nuclear magnetic resonance in 40% d3-TFE/water. NOE cross peaks and ?H chemical shifts indicate that the peptide consists of a helix from Ala-8 to Leu-26 in this solution. Circular dichroism measurements confirm the presence of nearly 45% helix in TFE/water solution but show no evidence of helicity in water solution of this peptide. Fifty structures were constructed with 329 upper distance limits by DIANA. The 20 best conformers show a RMSD of 0.78 Å for backbone atoms and 1.78 Å for heavy atoms from residue Ala-8 to Leu-26. This result, together with our previous work on the solution structure of a fragment of DP-1, supports the proposal that E2F-1 and DP-1 may dimerize with a coiled-coil type interaction.

Shouhong Guang; Jihui Wu; Limei Tao; Youlin Xia; Yunyu Shi

1998-01-01T23:59:59.000Z

150

FD-BPM for Optical Waveguide Structures with Second Order Accuracy An improved FD-BPM was developed which is based on the generalized transmission line(GTL) equa-  

E-Print Network (OSTI)

FD-BPM for Optical Waveguide Structures with Second Order Accuracy R. Pregla An improved FD-BPMRHH) for discretized transverse fields E and H. This BPM is a wide angle algorithm and also full vectorial a second term on the right sides (for details see [3]). Usually, BPM algorithms are based on the wave

Jahns, Jürgen

151

CX-000163: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

3: Categorical Exclusion Determination 3: Categorical Exclusion Determination CX-000163: Categorical Exclusion Determination Hawaii City Honolulu CX(s) Applied: A9, B5.1 Date: 10/23/2009 Location(s): Hawaii Office(s): Energy Efficiency and Renewable Energy, Golden Field Office Energy Efficiency and Conservation Block Grant for: Kalihi-Palama Bus Maintenance Facility - Installation of Photovoltaic System, Kalihi-Palama Bus Maintenance Building Lighting Improvements, Kalihi-Palama Bus Administration Building Lighting Retrofit, Pearl City Bus Maintenance Facility - Installation of Photovoltaic system, Kapolei Hale Lighting Improvements, Neal Blaisdell Center Exhibition Hall Air conditioning system Improvements, Neal Blaisdell Center Administrative Offices Air Conditioning System Improvements, Neal Blaisdell Center Municipal Parking Structure

152

Proline 107 Is a Major Determinant in Maintaining the Structure of the Distal Pocket and Reactivity of the High-Spin Heme of MauG  

SciTech Connect

The diheme enzyme MauG catalyzes a six-electron oxidation required for posttranslational modification of a precursor of methylamine dehydrogenase (preMADH) to complete the biosynthesis of its protein-derived tryptophan tryptophylquinone (TTQ) cofactor. Crystallographic studies had shown that Pro107, which resides in the distal pocket of the high-spin heme of MauG, changes conformation upon binding of CO or NO to the heme iron. In this study, Pro107 was converted to Cys, Val, and Ser by site-directed mutagenesis. The structures of each of these MauG mutant proteins in complex with preMADH were determined, as were their physical and catalytic properties. P107C MauG was inactive, and the crystal structure revealed that Cys107 had been oxidatively modified to a sulfinic acid. Mass spectrometry revealed that this modification was present prior to crystallization. P107V MauG exhibited spectroscopic and catalytic properties that were similar to those of wild-type MauG, but P107V MauG was more susceptible to oxidative damage. The P107S mutation caused a structural change that resulted in the five-coordinate high-spin heme being converted to a six-coordinate heme with a distal axial ligand provided by Glu113. EPR and resonance Raman spectroscopy revealed this heme remained high-spin but with greatly increased rhombicity as compared to that of the axial signal of wild-type MauG. P107S MauG was resistant to reduction by dithionite and reaction with H{sub 2}O{sub 2} and unable to catalyze TTQ biosynthesis. These results show that the presence of Pro107 is critical in maintaining the proper structure of the distal heme pocket of the high-spin heme of MauG, allowing exogenous ligands to bind and directing the reactivity of the heme-activated oxygen during catalysis, thus minimizing the oxidation of other residues of MauG.

Feng, Manliang; Jensen, Lyndal M.R.; Yukl, Erik T.; Wei, Xiaoxi; Liu, Aimin; Wilmot, Carrie M.; Davidson, Victor L. (Central Florida); (GSU); (Tougaloo); (UMM)

2012-05-09T23:59:59.000Z

153

Categorical Exclusion Determinations: Bonneville Power Administration |  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

November 2, 2009 November 2, 2009 CX-000008: Categorical Exclusion Determination Raver-Paul #1 Access Road Improvement and Bridge Replacement CX(s) Applied: B1.3 Date: 11/02/2009 Location(s): Pierce County, Washington Office(s): Bonneville Power Administration October 27, 2009 CX-000007: Categorical Exclusion Determination Spirit Tap to Colville-Boundary #1 Landings and Access Roads Construction CX(s) Applied: B1.3, B1.13 Date: 10/27/2009 Location(s): Stevens County, Washington Office(s): Bonneville Power Administration October 8, 2009 CX-000004: Categorical Exclusion Determination Lane-Wendson #1 Structure 10/5 Access Road Improvement and Pole Replacement Project CX(s) Applied: B1.3 Date: 10/08/2009 Location(s): Lane County, Oregon Office(s): Bonneville Power Administration October 8, 2009

154

Categorical Exclusion Determinations: Bonneville Power Administration |  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

March 16, 2010 March 16, 2010 CX-001179: Categorical Exclusion Determination Lancaster-Noxon Number 1 Mile 46-50 Access Road Improvement and Bridge Replacement Project CX(s) Applied: B1.3 Date: 03/16/2010 Location(s): Bonner County, Idaho Office(s): Bonneville Power Administration March 15, 2010 CX-001180: Categorical Exclusion Determination Monroe-Custer Number 1 and 2 500-Kilovolt Transmission Line Structure 16/2 Access Road Improvement and Bridge Replacement Project CX(s) Applied: B1.3 Date: 03/15/2010 Location(s): Snohomish County, Washington Office(s): Bonneville Power Administration March 12, 2010 CX-001181: Categorical Exclusion Determination Santiam Substation Renovation CX(s) Applied: B1.16 Date: 03/12/2010 Location(s): Linn County, Oregon Office(s): Bonneville Power Administration

155

Polypeptide backbone resonance assignments and secondary structure of Bacillus subtilis enzyme III sup glc determined by two-dimensional and three-dimensional heteronuclear NMR spectroscopy  

SciTech Connect

The enzyme III{sup glc}-like domain of Bacillus subtilis II{sup glc} (III{sup glc}; 162 residues, 17.4 kDa) has been cloned and overexpressed in Escherichia coli. Sequence-specific assignment of the backbone {sup 1}H and {sup 15}N resonances has been carried out with a combination of mohonuclear and heteronuclear two-dimensional and heteronuclear three-dimensional (3D) NMR spectroscopy. Amide proton solvent exchange rate constants have been determined from a series of {sup 1}H-{sup 15}N heteronuclear single-quantum coherence (HSQC) spectra acquired following dissolution of the protein in D{sub 2}O. Major structural features of III{sup glc} have been inferred from the pattern of short-, medium- and long-range NOEs in 3D heteronuclear {sup 1}H nuclear Overhauser effect {sup 1}H-{sup 15}N multiple-quantum coherence (3D NOESY-HMQC) spectra, together with the exchange rate constants. III{sup glc} contains three antiparallel {beta}-sheets comprised of eight, three, and two {beta}-strands. In addition, five {beta}-bulges were identified. no evidence of regular helical structure was found. The N-terminal 15 residues of the protein appear disordered, which is consistent with their being part of the Q-linker that connects the C-terminal enzyme III{sup glc}-like domain to the membrane-bound II{sup glc} domain. Significantly, two histidine residues, His 68 and His 83, which are important for phosphotransferase function, are found from NOE measurements to be in close proximity at the ends of adjacent strands in the major {beta}-sheet.

Fairbrother, W.J.; Cavanagh, J.; Dyson, H.J.; Palmer, A.G. III; Wright, P.E. (Research Inst. of Scripps Clinic, La Jolla, CA (United States)); Sutrina, S.L.; Reizer, J.; Saier, M.H. Jr. (Univ. of California, San Diego (United States))

1991-07-16T23:59:59.000Z

156

Structural Genomics  

Science Journals Connector (OSTI)

Structural Genomics ... Structural genomics is the field of science focused on the systematic determination of the three-dimensional structure of the proteins encoded into genomes. ... Structural genomics is spreading the philosophy of high throughput in all fields of science and making available new tools to speed up research procedures. ...

Ivano Bertini

2003-03-01T23:59:59.000Z

157

Effect of radial transport on compressor tip clearance flow structures and enhancement of stable flow range  

E-Print Network (OSTI)

The relation between tip clearance flow structure and axial compressor stall is interrogated via numerical simulations, to determine how casing treatment can result in improved flow range. Both geometry changes and flow ...

Nolan, Sean Patrick Rock

2005-01-01T23:59:59.000Z

158

Phase Structure of Thermal QCD/QED:A Gauge Invariant Solution of the HTL Resummed Improved Ladder Dyson-Schwinger Equation  

E-Print Network (OSTI)

Based on the hard-thermal-loop resummed improved ladder Dyson-Schwinger quation for the fermion mass function, we propose a procedure how we can get the gauge invariant solution in the sense it satisfies the Ward-Takahashi identity. Results of the numerical analysis are shown and properties of the ``gauge-invariant'' solutions are discussed.

Hisao Nakkagawa; Hiroshi Yokota; Koji Yoshida

2007-07-06T23:59:59.000Z

159

Categorical Exclusion Determinations: Savannah River Operations Office |  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

July 20, 2012 July 20, 2012 CX-009070: Categorical Exclusion Determination A-Area Alternate Fire Water Supply CX(s) Applied: B1.3 Date: 07/20/2012 Location(s): South Carolina Offices(s): Savannah River Operations Office July 20, 2012 CX-009069: Categorical Exclusion Determination Remove and Dispose of 107 A & B Tanks and Support Structure CX(s) Applied: B6.1 Date: 07/20/2012 Location(s): South Carolina Offices(s): Savannah River Operations Office July 20, 2012 CX-009068: Categorical Exclusion Determination Hydrogen Charging Tritium Contaminated Metals CX(s) Applied: B3.6 Date: 07/20/2012 Location(s): South Carolina Offices(s): Savannah River Operations Office July 16, 2012 CX-009077: Categorical Exclusion Determination F-Area Infrasturcture Improvement CX(s) Applied: B1.23 Date: 07/16/2012

160

CX-010405: Categorical Exclusion Determination | Department of...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Exclusion Determination CX-010405: Categorical Exclusion Determination Idalia Substation Grounding and Drainage Improvements CX(s) Applied: B4.6 Date: 05222013...

Note: This page contains sample records for the topic "determination improved structure" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


161

CX-000698: Categorical Exclusion Determination | Department of...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Categorical Exclusion Determination CX-000698: Categorical Exclusion Determination Connecticut - State Building Energy Improvements: 79 Elm Street CX(s) Applied: B1.3, B1.4,...

162

CX-002679: Categorical Exclusion Determination | Department of...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Determination CX-002679: Categorical Exclusion Determination Eastern Avenue Branch Library Improvements CX(s) Applied: B5.1 Date: 06032010 Location(s): Davenport, Iowa...

163

CX-010020: Categorical Exclusion Determination | Department of...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Determination CX-010020: Categorical Exclusion Determination F-08 Industrial Wastewater Outfall Flow Measurement Improvements CX(s) Applied: B3.1 Date: 01282013...

164

CX-001182: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

82: Categorical Exclusion Determination 82: Categorical Exclusion Determination CX-001182: Categorical Exclusion Determination Access Road Improvement Project for Structure 12/1 of the Snoking Tap to Echo Lake-Monroe Number 1 Transmission Line CX(s) Applied: B1.13 Date: 03/12/2010 Location(s): Snohomish, Washington Office(s): Bonneville Power Administration Bonneville Power Administration (BPA) proposes to construct a permanent access road to improve vehicle access to the 115 kilovolt Snoking Tap to Echo Lake-Monroe Number 1 Transmission Line. The project would involve constructing an approximately 760-foot long by 14-foot wide access road to structure 12/1. The project would also involve the installation of three culverts to help preserve the site's existing hydrology and increase the longevity of the proposed access road. Project activities would occur in

165

CX-006786: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

6: Categorical Exclusion Determination 6: Categorical Exclusion Determination CX-006786: Categorical Exclusion Determination Ross Control House Seismic Upgrades CX(s) Applied: B2.5 Date: 09/02/2011 Location(s): Vancouver, Washington Office(s): Bonneville Power Administration Bonneville Power Administration (BPA) proposes to retrofit the Ross Control House, located on the J.D. Ross Complex to address existing structural concerns that limit the building?s ability to withstand a seismic event. The work involves a series of modifications to the 1939 stucco-clad concrete shell and hollow clay tile interior walls that will provide increased lateral support to the structural walls. Other improvements will reinforce the existing flat roof to further strengthen the volume, while additionally allowing improved energy efficiencies and an enhanced working

166

CX-006296: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

6296: Categorical Exclusion Determination 6296: Categorical Exclusion Determination CX-006296: Categorical Exclusion Determination Cardwell-Cowlitz 2011 Access Road Maintenance CX(s) Applied: B1.3 Date: 07/21/2011 Location(s): Cowlitz County, Washington Office(s): Bonneville Power Administration Bonneville Power Administration (BPA) proposes to perform routine road maintenance and reconstruction activities along existing access roads, both on and off the right-of-way. The work involves approximately 4.7 miles of road reconstruction or improvement work on or leading to the Cardwell-Cowlitz No. 1, 115- kilovolt transmission line right-of-way between Cardwell Substation and structure 7/8. The roadwork is needed to improve access for crews that will be replacing the transmission line support structures within the transmission line corridor.

167

CX-100004: Categorical Exclusion Determination | Department of...  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

Categorical Exclusion Determination Leveraging a Fundamental Understanding of Fracture Flow, Dynamic Permeability Enhancement, and Induced Seismicity to Improve Geothermal...

168

Determination of the structure of 2(benzene-1,3,5-tricarboxylic acid)·1.5(pyrene)·2(methanol) and comparison with that of 2(benzene-1,3,5-tricarboxylic acid)·pyrene·2(ethanol)  

Science Journals Connector (OSTI)

A detailed comparison is made of the structures of 2(benzene-1,3,5-tricarboxylic acid)·1.5(pyrene)·2(methanol) (new determination) and of 2(benzene-1,3,5-tricarboxylic acid)·pyrene·2(ethanol) (data from the literature).

Herbstein, F.H.

2001-09-29T23:59:59.000Z

169

Groundwater and surface water supplies in the Williston and Powder River structural basins are necessary for future development in these regions. To help determine  

E-Print Network (OSTI)

#12;i Abstract Groundwater and surface water supplies in the Williston and Powder River structural of streams, and quantify reservoir interaction in the Williston and Powder River structural basins the loss to underlying aquifers was 7790 ft3 /s. Both the Powder River and Williston basins contain gaining

Torgersen, Christian

170

Categorical Exclusion Determinations: B2.1 | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

1 1 Categorical Exclusion Determinations: B2.1 Existing Regulations B2.1: Workplace enhancements Modifications within or contiguous to an existing structure, in a previously disturbed or developed area, to enhance workplace habitability (including, but not limited to, installation or improvements to lighting, radiation shielding, or heating/ventilating/air conditioning and its instrumentation, and noise reduction). Previous Regulations Categorical Exclusion Determinations dated before November 14th, 2011 were issued under previous DOE NEPA regulations. See the Notice of Final Rulemaking (76 FR 63763, 10/13/2011) for information changes to this categorical exclusion. DOCUMENTS AVAILABLE FOR DOWNLOAD September 11, 2013 CX-011028: Categorical Exclusion Determination

171

Refractory Improvement  

NLE Websites -- All DOE Office Websites (Extended Search)

Refractory Improvement Refractory Improvement NETL Office of Research and Development Project Number: FWP-2012.03.03 Task 2 Project Description Industry would like gasifier on-line availability of 85-95% for utility applications and 95% for applications such as chemical production. Gasification facilities' are currently unable to meet these requirements, which have created a potential roadblock to widespread acceptance and commercialization of gasification technologies. Refractory liners and syngas coolers are among key components of the gasification process previously identified as negatively impacting gasifier availability. Ash originating from impurities in the gasifier's carbon feedstock is the root cause of many problems impacting gasifier RAM (Reliability Availability Maintainability). At the high temperatures of gasification, ash changes to liquid, gas, and solid phases which wear down refractory materials and can cause fouling, either of which can lead to unplanned shutdowns for system repair, replacement, or cleaning.

172

Surveillance Guides - Continous Improvement  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

CONTINUOUS IMPROVEMENT CONTINUOUS IMPROVEMENT 1.0 Objective The objective of this surveillance is to verify that contractor personnel are effectively managing environment, safety, and health issues in a manner that fosters continuous improvement. The activities included in this surveillance help the Facility Representative determine whether safety issues identified through internal contractor, and external DOE or Defense Nuclear Facilities Safety Board evaluation programs are resolved consistent with the level of safety importance. 2.0 References 2.1 DOE O 414.1, Quality Assurance 2.2 DOE O 232.1, Occurrence Reporting and Processing of Operations Information 2.3 DOE-STD-1045-93, Guide to Good Practices for Notifications and Investigations of Abnormal Events 2.4 48 CFR 1970.5204, Department of Energy Acquisition

173

CX-006290: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

0: Categorical Exclusion Determination 0: Categorical Exclusion Determination CX-006290: Categorical Exclusion Determination Cardwell-Cowlitz 2011 Wood Pole Replacements CX(s) Applied: B1.3 Date: 07/25/2011 Location(s): Cowlitz County, Washington Office(s): Bonneville Power Administration Bonneville Power Administration (BPA) is proposing to replace all of the aging wood pole transmission line support structures along the Cardwell-Cowlitz No. 1, 115 kilovolt (kV) transmission line. Due to the age of the wood poles, the work is necessary to improve the safety, operation, and reliability of the transmission line. All wooden pole structures, hardware, and support structures will be replaced in the original location. DOCUMENT(S) AVAILABLE FOR DOWNLOAD CX-006290.pdf More Documents & Publications

174

CX-003084: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

3084: Categorical Exclusion Determination 3084: Categorical Exclusion Determination CX-003084: Categorical Exclusion Determination Maintenance of and Improvements to the Access Roads from Structure 53/3 through 66/3 of the Fairview-Rogue Number 1 Transmission Line Corridor CX(s) Applied: B1.3 Date: 06/21/2010 Location(s): Curry County, Oregon Office(s): Bonneville Power Administration Bonneville Power Administration (BPA) proposes to perform road maintenance activities along the access roads of the southern 13 miles of the Fairview-Rogue transmission line from Structure 53/3 to Structure 66/3. There are roughly 32 miles of access roads in this section of transmission line. The proposed access road project is part of ongoing operations and maintenance along this line and this work is proposed for 2010 and 2011.

175

CX-005410: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

410: Categorical Exclusion Determination 410: Categorical Exclusion Determination CX-005410: Categorical Exclusion Determination North Bonneville-Alcoa Number 1 and 2 Transmission Line Corridor CX(s) Applied: B1.3 Date: 03/03/2011 Location(s): Clark County, Washington Office(s): Bonneville Power Administration Bonneville Power Administration (BPA) proposes to perform road reconstruction work to improve vehicle access to structures 16/6, 16/7 and 17/1 of the North Bonneville-Alcoa Number 1 and 2 transmission line corridor from southeast 37th Street to the right-of-way, then to structure 16/6 to the east, and structure 17/1 to the west. The total distance of this project is approximately 2200 feet. Project work may include, but is not limited to: vegetation removal to clear a 20-foot width, grading and

176

Using SSR markers to determine the population genetic structure of wild apricot (Prunus armeniaca L.) in the Ily Valley of West China  

Science Journals Connector (OSTI)

Genetic structure of three wild populations (Xinyuan, Gongliu and Daxigou) of apricot in the Ily Valley, Xinjiang Uygur Autonomous Region of China, was investigated with microsatellite (simple sequence repeat,...

He Tian-Ming; Chen Xue-Sen; Xu Zheng…

2007-05-01T23:59:59.000Z

177

The impact of market structure on price determination : a simulation approach using multi-agent reinforcement learning in continuous state and action space  

E-Print Network (OSTI)

This thesis proposes a simulation tool to study the question of how market structure and market players' behavior affect price movements. The adaptive market simulation system consists of multiple agents and a centralized ...

Shu, Buliao

2014-01-01T23:59:59.000Z

178

Determination of the structural changes by Raman and {sup 13}C CP/MAS NMR spectroscopy on native corn starch with plasticizers  

SciTech Connect

The plasticizing - antiplasticizing effect of water and glycerol contents on native corn starch samples is investigated by FT-Raman and {sup 13}C CP/MAS NMR spectroscopy. The presence of both amorphous and crystalline structural phases was evidenced in pure native corn starch and also in the samples containing plasticizers. Among the crystalline starch structures, the A- and V- types were suggested by CP/MAS NMR spectra.

Cozar, O. [Academy of Romanian Scientists, Splaiul Independentei 54, 050094, Bucharest, Romania and National Institute of Research-Development for Machines and Installations Designed to Agriculture and Food Industry - INMA Bucure?ti - Cluj-Napoca Branch (Romania)] [Academy of Romanian Scientists, Splaiul Independentei 54, 050094, Bucharest, Romania and National Institute of Research-Development for Machines and Installations Designed to Agriculture and Food Industry - INMA Bucure?ti - Cluj-Napoca Branch (Romania); Filip, C.; Tripon, C. [National Institute for Research and Development of Isotopic and Molecular Technologies, 65-103 Donath, 400293 Cluj-Napoca (Romania)] [National Institute for Research and Development of Isotopic and Molecular Technologies, 65-103 Donath, 400293 Cluj-Napoca (Romania); Cioica, N.; Co?a, C.; Nagy, E. M. [National Institute of Research-Development for Machines and Installations Designed to Agriculture and Food Industry - INMA Bucure?ti - Cluj-Napoca Branch, RO-400458 Cluj-Napoca (Romania)] [National Institute of Research-Development for Machines and Installations Designed to Agriculture and Food Industry - INMA Bucure?ti - Cluj-Napoca Branch, RO-400458 Cluj-Napoca (Romania)

2013-11-13T23:59:59.000Z

179

Development of improved processing and evaluation methods for high reliability structural ceramics for advanced heat engine applications, Phase 1. Final report  

SciTech Connect

The program goals were to develop and demonstrate significant improvements in processing methods, process controls and non-destructive evaluation (NDE) which can be commercially implemented to produce high reliability silicon nitride components for advanced heat engine applications at temperatures to 1,370{degrees}C. The program focused on a Si{sub 3}N{sub 4}-4% Y{sub 2}O{sub 3} high temperature ceramic composition and hot-isostatic-pressing as the method of densification. Stage I had as major objectives: (1) comparing injection molding and colloidal consolidation process routes, and selecting one route for subsequent optimization, (2) comparing the performance of water milled and alcohol milled powder and selecting one on the basis of performance data, and (3) adapting several NDE methods to the needs of ceramic processing. The NDE methods considered were microfocus X-ray radiography, computed tomography, ultrasonics, NMR imaging, NMR spectroscopy, fluorescent liquid dye penetrant and X-ray diffraction residual stress analysis. The colloidal consolidation process route was selected and approved as the forming technique for the remainder of the program. The material produced by the final Stage II optimized process has been given the designation NCX 5102 silicon nitride. According to plan, a large number of specimens were produced and tested during Stage III to establish a statistically robust room temperature tensile strength database for this material. Highlights of the Stage III process demonstration and resultant database are included in the main text of the report, along with a synopsis of the NCX-5102 aqueous based colloidal process. The R and D accomplishments for Stage I are discussed in Appendices 1--4, while the tensile strength-fractography database for the Stage III NCX-5102 process demonstration is provided in Appendix 5. 4 refs., 108 figs., 23 tabs.

Pujari, V.K.; Tracey, D.M.; Foley, M.R.; Paille, N.I.; Pelletier, P.J.; Sales, L.C.; Wilkens, C.A.; Yeckley, R.L. [Norton Co., Northboro, MA (United States)

1993-08-01T23:59:59.000Z

180

CX-011653: Categorical Exclusion Determination | Department of...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Determination CX-011653: Categorical Exclusion Determination Saguaro-Tucson 115 Kilovolt Transmission Line Structure Replacement CX(s) Applied: B1.3 Date: 12032013 Location(s):...

Note: This page contains sample records for the topic "determination improved structure" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


181

CX-012092: Categorical Exclusion Determination | Department of...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Determination CX-012092: Categorical Exclusion Determination Tucson-Apache 115-Kilovolt Transmission Line Structure Stabilization Project CX(s) Applied: B1.3 Date: 09062013...

182

CX-010545: Categorical Exclusion Determination | Department of...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Exclusion Determination CX-010545: Categorical Exclusion Determination Gila Knob Transmission Line Crossarm Replacement at Structure 183 CX(s) Applied: B4.6 Date: 0603...

183

CX-010547: Categorical Exclusion Determination | Department of...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Determination CX-010547: Categorical Exclusion Determination Parker-Gila 161 Kilovolt Transmission Line Maintenance Project, Structure 921 to 949 CX(s) Applied: B1.3 Date:...

184

CX-008693: Categorical Exclusion Determination | Department of...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

693: Categorical Exclusion Determination CX-008693: Categorical Exclusion Determination Wood Pole Structure Replacements on the Chehalis-Centralia No. 2 115 Kilovolt Transmission...

185

Structure determination of a 20 amino acid peptide by NMR The twenty amino acid peptide contains over 100 unique protons that are potentially observable by  

E-Print Network (OSTI)

, depending on its local chemical environment within the peptide structure. The frequency of the RF energy of the peptide will be needed. NOE is an abbreviation for "nuclear Overhauser effect". The 2-D NOE spectrum proton within the peptide can absorb or emit radiofrequency (RF) energy at a specific frequency

186

Determination of nanoparticle structure type, size and strain distribution from X-ray data for monatomic f.c.c.-derived non-crystallographic nanoclusters  

Science Journals Connector (OSTI)

Whole-profile-fitting least-squares techniques are successfully applied to simulated and experimental diffraction patterns of monatomic f.c.c.-derived non-crystallographic nanoclusters, with the aim of extracting information about structure-type concentration, size and strain distribution.

Cervellino, A.

2003-09-08T23:59:59.000Z

187

CX-007901: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

01: Categorical Exclusion Determination 01: Categorical Exclusion Determination CX-007901: Categorical Exclusion Determination Improving Atmospheric Models for Offshore Wind Resource Mapping and Prediction Using LIDAR, Aircraft, and In-Ocean Observations CX(s) Applied: A9, A11, B3.1, B3.2 Date: 02/22/2012 Location(s): New York Offices(s): Golden Field Office DOE is proposing to provide federal funding to State University of New York (SUNY) to develop, research, model, and collect data of environmental factors that influence wind turbine structures along the Atlantic coast. This study would include information gathering, data analysis and modeling, mapping, and reporting. CX-007901.pdf More Documents & Publications CX-009575: Categorical Exclusion Determination CX-009130: Categorical Exclusion Determination

188

CX-000004: Categorical Exclusion Determination  

Energy.gov (U.S. Department of Energy (DOE))

Lane-Wendson #1 Structure 10/5 Access Road Improvement and Pole Replacement ProjectCX(s) Applied: B1.3Date: 10/08/2009Location(s): Lane County, OregonOffice(s): Bonneville Power Administration

189

CX-008681: Categorical Exclusion Determination  

Energy.gov (U.S. Department of Energy (DOE))

Ostrander-Troutdale No. 1, Structure 16/1, Access Road Improvement Project CX(s) Applied: B1.3 Date: 07/18/2012 Location(s): Oregon Offices(s): Bonneville Power Administration

190

Global Structure of a Three-Way Junction in a Phi29 Packaging RNA Dimer Determined Using Site-Directed Spin Labeling  

SciTech Connect

The condensation of bacteriophage phi29 genomic DNA into its preformed procapsid requires the DNA packaging motor, which is the strongest known biological motor. The packaging motor is an intricate ring-shaped protein/RNA complex, and its function requires an RNA component called packaging RNA (pRNA). Current structural information on pRNA is limited, which hinders studies of motor function. Here, we used site-directed spin labeling to map the conformation of a pRNA three-way junction that bridges binding sites for the motor ATPase and the procapsid. The studies were carried out on a pRNA dimer, which is the simplest ring-shaped pRNA complex and serves as a functional intermediate during motor assembly. Using a nucleotide-independent labeling scheme, stable nitroxide radicals were attached to eight specific pRNA sites without perturbing RNA folding and dimer formation, and a total of 17 internitroxide distances spanning the three-way junction were measured using Double Electron-Electron Resonance spectroscopy. The measured distances, together with steric chemical constraints, were used to select 3662 viable three-way junction models from a pool of 65 billion. The results reveal a similar conformation among the viable models, with two of the helices (HT and HL) adopting an acute bend. This is in contrast to a recently reported pRNA tetramer crystal structure, in which HT and HL stack onto each other linearly. The studies establish a new method for mapping global structures of complex RNA molecules, and provide information on pRNA conformation that aids investigations of phi29 packaging motor and developments of pRNA-based nanomedicine and nanomaterial.

Zhang, Xiaojun; Tung, Chang-Shung; Sowa, Glenna; Hatmal, Ma'mon M.; Haworth, Ian S.; Qin, Peter Z.

2012-02-08T23:59:59.000Z

191

Categorical Exclusion (CX) Determinations By Date | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

December 5, 2011 December 5, 2011 CX-007511: Categorical Exclusion Determination Record of Categorical Exclusion for Repair Erosion Problems at Big Hill Raw Water Intake Structure CX(s) Applied: B1.3 Date: 12/05/2011 Location(s): Texas Offices(s): Strategic Petroleum Reserve Field Office December 5, 2011 CX-007789: Categorical Exclusion Determination Associated Electric Cooperative, Inc. Substation Improvements CX(s) Applied: B4.6 Date: 12/05/2011 Location(s): Missouri Offices(s): Southwestern Power Administration December 5, 2011 CX-007390: Categorical Exclusion Determination Hot Carrier Collection in Thin Film Silicon with Tailored Nanocrystalline/Amorphous Structure CX(s) Applied: B3.15, A9, B3.6 Date: 12/05/2011 Location(s): Colorado Offices(s): Golden Field Office December 5, 2011

192

CX-004899: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

9: Categorical Exclusion Determination 9: Categorical Exclusion Determination CX-004899: Categorical Exclusion Determination Gila-Yuma Tap (Transmission Line Reconstruction) CX(s) Applied: B4.6 Date: 07/19/2010 Location(s): Yuma County, Arizona Office(s): Western Area Power Administration-Desert Southwest Region Western Area Power Administration proposes to rebuild and upgrade approximately 9.8 miles of the existing Gila-Yuma Tap 34.5-kilovolt transmission line to maintain and improve the reliability of electrical service to customers in the Yuma, Arizona, area. The work involves removing the existing wood structures and conductor; and installing steel pole structures, 69-kilovolt conductor, and overhead ground wire. DOCUMENT(S) AVAILABLE FOR DOWNLOAD CX-004899.pdf More Documents & Publications

193

CX-007142: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

07142: Categorical Exclusion Determination 07142: Categorical Exclusion Determination CX-007142: Categorical Exclusion Determination Electrical District 5 - Saguaro Structure Maintenance CX(s) Applied: B1.3 Date: 02/09/2011 Location(s): Pinal County, Arizona Office(s): Western Area Power Administration-Desert Southwest Region Western plans to conduct maintenance work to maintain or improve the reliability and safety of electrical transmission along 17 miles of the Test Track (formerly Maricopa)-Saguaro 115-kilovolt Transmission Line between Electrical District 5 and Saguaro Steam Plant Substations. The work includes replacing wood poles, cross arms, and knee braces in-kind at 27 structures because the wood poles failed stability tests, cross arms are beyond repair and arms and braces need to be changed to a more modern

194

ConsiderIt: Improving Structured Public Deliberation  

E-Print Network (OSTI)

a voters' guide for the 2010 election in Washington. ConsiderIt is a new method of integrating the thoughts General Terms Design, Human Factors The Living Voters Guide (LVG) In election seasons, voters are exposed guides, campaign ads, mass media, and other guides. Our design consciously tries to mitigate common

Anderson, Richard

195

Improving the accuracy of macromolecular structure refinement  

NLE Websites -- All DOE Office Websites (Extended Search)

and subsequent refinement is challenging at low resolution. We compared refinement methods using synchrotron diffraction data of photosystem I at 7.4 resolution, starting...

196

Neutron reflecting supermirror structure  

DOE Patents (OSTI)

An improved neutron reflecting supermirror structure comprising a plurality of stacked sets of bilayers of neutron reflecting materials. The improved neutron reflecting supermirror structure is adapted to provide extremely good performance at high incidence angles, i.e. up to four time the critical angle of standard neutron mirror structures. The reflection of neutrons striking the supermirror structure at a high critical angle provides enhanced neutron throughput, and hence more efficient and economical use of neutron sources. 2 figs.

Wood, J.L.

1992-12-01T23:59:59.000Z

197

Neutron reflecting supermirror structure  

DOE Patents (OSTI)

An improved neutron reflecting supermirror structure comprising a plurality of stacked sets of bilayers of neutron reflecting materials. The improved neutron reflecting supermirror structure is adapted to provide extremely good performance at high incidence angles, i.e. up to four time the critical angle of standard neutron mirror structures. The reflection of neutrons striking the supermirror structure at a high critical angle provides enhanced neutron throughput, and hence more efficient and economical use of neutron sources.

Wood, James L. (Drayton Plains, MI)

1992-01-01T23:59:59.000Z

198

Characterization of interface states in Al{sub 2}O{sub 3}/AlGaN/GaN structures for improved performance of high-electron-mobility transistors  

SciTech Connect

We have investigated the relationship between improved electrical properties of Al{sub 2}O{sub 3}/AlGaN/GaN metal-oxide-semiconductor high-electron-mobility transistors (MOS-HEMTs) and electronic state densities at the Al{sub 2}O{sub 3}/AlGaN interface evaluated from the same structures as the MOS-HEMTs. To evaluate Al{sub 2}O{sub 3}/AlGaN interface state densities of the MOS-HEMTs, two types of capacitance-voltage (C-V) measurement techniques were employed: the photo-assisted C-V measurement for the near-midgap states and the frequency dependent C-V characteristics for the states near the conduction-band edge. To reduce the interface states, an N{sub 2}O-radical treatment was applied to the AlGaN surface just prior to the deposition of the Al{sub 2}O{sub 3} insulator. As compared to the sample without the treatment, the N{sub 2}O-radical treated Al{sub 2}O{sub 3}/AlGaN/GaN structure showed smaller frequency dispersion of the C-V curves in the positive gate bias range. The state densities at the Al{sub 2}O{sub 3}/AlGaN interface were estimated to be 1?×?10{sup 12}?cm{sup ?2}?eV{sup ?1} or less around the midgap and 8?×?10{sup 12}?cm{sup ?2}?eV{sup ?1} near the conduction-band edge. In addition, we observed higher maximum drain current at the positive gate bias and suppressed threshold voltage instability under the negative gate bias stress even at 150?°C. Results presented in this paper indicated that the N{sub 2}O-radical treatment is effective both in reducing the interface states and improving the electrical properties of the Al{sub 2}O{sub 3}/AlGaN/GaN MOS-HEMTs.

Hori, Y.; Yatabe, Z. [Research Center for Integrated Quantum Electronics (RCIQE) and Graduate School of Information Science and Technology, Hokkaido University, North 13 West 8, Sapporo, 060-8628 Hokkaido (Japan); Hashizume, T., E-mail: hashi@rciqe.hokudai.ac.jp [Research Center for Integrated Quantum Electronics (RCIQE) and Graduate School of Information Science and Technology, Hokkaido University, North 13 West 8, Sapporo, 060-8628 Hokkaido (Japan); Japan Science and Technology Agency (JST), CREST, Tokyo 102-0075 (Japan)

2013-12-28T23:59:59.000Z

199

CX-006127: Categorical Exclusion Determination | Department of...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Exclusion Determination Wisconsin Biofuels Retail Availability Improvement Network (BRAIN) - Wautoma Kwik Trip CX(s) Applied: B5.1 Date: 06232011 Location(s): Wautoma,...

200

CX-006183: Categorical Exclusion Determination | Department of...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Exclusion Determination Wisconsin Biofuels Retail Availability Improvement Network (BRAIN) - Neenah Kwik Trip CX(s) Applied: B5.1 Date: 07112011 Location(s): Neenah,...

Note: This page contains sample records for the topic "determination improved structure" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


201

CX-006264: Categorical Exclusion Determination | Department of...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Exclusion Determination Wisconsin Biofuels Retail Availability Improvement Network (BRAIN) - Marshall Kwik Trip CX(s) Applied: B5.1 Date: 07112011 Location(s): Marshall,...

202

CX-006126: Categorical Exclusion Determination | Department of...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Exclusion Determination Wisconsin Biofuels Retail Availability Improvement Network (BRAIN) - Waupaca Kwik Trip CX(s) Applied: B5.1 Date: 06232011 Location(s): Waupaca,...

203

CX-003728: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

28: Categorical Exclusion Determination 28: Categorical Exclusion Determination CX-003728: Categorical Exclusion Determination Improved Structure and Fabrication of Large, High-Power Kinetic Hydropower System Rotors - Year 2 CX(s) Applied: A9, B3.1, B5.1 Date: 09/16/2010 Location(s): New York Office(s): Energy Efficiency and Renewable Energy, Golden Field Office Verdant Power will use the Department of Energy funding to design and test, both in lab and in-water, a next generation advanced waterpower technology: large, high power Kinetic Hydropower System rotors. This determination is being made for the project's Phase 2 tasks which include prototype fabrication; test stand and in-water testing at the Roosevelt Island Tidal Energy Project site; and project management activities. DOCUMENT(S) AVAILABLE FOR DOWNLOAD

204

Categorical Exclusion (CX) Determinations By Date | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

5, 2011 5, 2011 CX-007789: Categorical Exclusion Determination Associated Electric Cooperative, Inc. Substation Improvements CX(s) Applied: B4.6 Date: 12/05/2011 Location(s): Missouri Offices(s): Southwestern Power Administration December 5, 2011 CX-007390: Categorical Exclusion Determination Hot Carrier Collection in Thin Film Silicon with Tailored Nanocrystalline/Amorphous Structure CX(s) Applied: B3.15, A9, B3.6 Date: 12/05/2011 Location(s): Colorado Offices(s): Golden Field Office December 5, 2011 CX-007500: Categorical Exclusion Determination Carbon Absorber Retrofit Equipment (CARE) CX(s) Applied: B3.6 Date: 12/05/2011 Location(s): Colorado Offices(s): National Energy Technology Laboratory December 3, 2011 CX-008674: Categorical Exclusion Determination ATK - A High Efficiency Inertial Carbon Dioxide Extraction System

205

CX-002774: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

74: Categorical Exclusion Determination 74: Categorical Exclusion Determination CX-002774: Categorical Exclusion Determination Vera Tap to Trentwood Valley Way #1 Project CX(s) Applied: B4.6, B4.13 Date: 06/03/2010 Location(s): Trentwood, Washington Office(s): Bonneville Power Administration Bonneville Power Administration proposes to add a disconnect switch and 2 wood poles between two existing pole structures on its Vera Tap to Trentwood Valley Way Number 1, 115-kilovolt transmission line in eastern Washington. The project will improve system reliability for its customer, Vera Water and Power, by allowing better sectionalizing of the transmission line for maintenance. DOCUMENT(S) AVAILABLE FOR DOWNLOAD CX-002774.pdf More Documents & Publications CX-005009: Categorical Exclusion Determination

206

Categorical Exclusion Determinations: B2.5 | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

B2.5 B2.5 Categorical Exclusion Determinations: B2.5 Existing Regulations B2.5: Facility safety and environmental improvements Safety and environmental improvements of a facility (including, but not limited to, replacement and upgrade of facility components) that do not result in a significant change in the expected useful life, design capacity, or function of the facility and during which operations may be suspended and then resumed. Improvements include, but are not limited to, replacement/upgrade of control valves, in-core monitoring devices, facility air filtration systems, or substation transformers or capacitors; addition of structural bracing to meet earthquake standards and/or sustain high wind loading; and replacement of aboveground or belowground tanks and related

207

9 - Structures in Matlab  

Science Journals Connector (OSTI)

This chapter explains both structures and vectors of structures in Matlab. The chapter starts by explaining the need for a structure class in programming usage and how structures can be used to improve the readability of Matlab programs. A number of examples that explain structures in Matlab are given here. The chapter concludes with the fox and rabbit game project. The reader is encouraged here to program this game using structures in order to gain an in-depth understanding of their use and value. Keywords Structures, vectors of structures, fox and rabbit game

Munther Gdeisat; Francis Lilley

2013-01-01T23:59:59.000Z

208

Structural Determination of Marine Bacteriogenic Manganese Oxides  

NLE Websites -- All DOE Office Websites (Extended Search)

fig 2 Figure 2. (A) X-ray diffraction intensity data for bacteriogenic manganese oxides produced in sea water. The bottom pattern is for clean cells. (B) X-ray diffraction...

209

Improved recovery demonstration for Williston Basin carbonates. Quarterly technical progress report, October--December 1996  

SciTech Connect

The purpose of this project is to demonstrate targeted infill and extension drilling opportunities, better determinations of oil-in-place, methods for improved completion efficiency and the suitability of waterflooding in certain shallow-shelf carbonate reservoirs in the Williston Basin, Montana, North Dakota and South Dakota. Improved reservoir characterization utilizing 3-dimensional (3D) and multi-component seismic are being investigated for identification of structural and stratigraphic reservoir compartments. These seismic characterization tools are integrated with geological and engineering studies. Improved completion efficiency is being tested with short-lateral and horizontal drilling technologies. Improved completion efficiency, additional wells at closer spacing and better estimates of oil-in-place will result in additional oil production by primary and enhanced recovery processes.

Sippel, M.A.; Carrell, L.A.

1997-04-01T23:59:59.000Z

210

Improved recovery demonstration for Williston Basin carbonates. Annual report, June 10, 1995--June 9, 1996  

SciTech Connect

The purpose of this project is to demonstrate targeted infill and extension drilling opportunities, better determinations of oil-in-place, methods for improved completion efficiency and the suitability of waterflooding in Red River and Ratcliffe shallow-shelf carbonate reservoirs in the Williston Basin, Montana, North Dakota and South Dakota. Improved reservoir characterization utilizing three-dimensional and multi-component seismic are being investigated for identification of structural and stratigraphic reservoir compartments. These seismic characterization tools are integrated with geological and engineering studies. Improved completion efficiency is being tested with extended-reach jetting lance and other ultra-short-radius lateral technologies. Improved completion efficiency, additional wells at closer spacing and better estimates of oil in place will result in additional oil recovery by primary and enhanced recovery processes.

Carrell, L.A.; Sippel, M.A.

1996-09-01T23:59:59.000Z

211

CX-004036: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

4036: Categorical Exclusion Determination 4036: Categorical Exclusion Determination CX-004036: Categorical Exclusion Determination Dimensionally Stable High Performance Membrane CX(s) Applied: B3.6, B5.1 Date: 09/14/2010 Location(s): Newton, Massachusetts Office(s): Energy Efficiency and Renewable Energy In Phase III of the program, Giner Electrochemical Systems, LLC (GES) will take the molding methods that were generated in Phase II and apply them to a roll-good process. A number of different methods will be used to generate the molds. The Phase III tasks for scaling up the fabrication of patterned porous polymer membrane support structures using micro-molding technology is designed around six tasks: improve process parameters for Polydimethylsiloxane (PDMS) micromolding from the Phase II program; seek

212

CX-001110: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

110: Categorical Exclusion Determination 110: Categorical Exclusion Determination CX-001110: Categorical Exclusion Determination Fracture Network and Fluid Flow Imaging for Engineered Geothermal Systems Applications from Multi-Dimensional Electrical Resistivity Structure CX(s) Applied: A9 Date: 03/10/2010 Location(s): Utah Office(s): Energy Efficiency and Renewable Energy, Golden Field Office The University of Utah is proposing a project to advance three-dimensional MT imaging by developing the capability to include topographic variations into the models through deformable finite element or finite difference meshes. The intention is to improve and advance individual or combinations of non-invasive exploration technologies for resolving geothermal resources that lack surface manifestations. DOCUMENT(S) AVAILABLE FOR DOWNLOAD

213

CX-005138: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

8: Categorical Exclusion Determination 8: Categorical Exclusion Determination CX-005138: Categorical Exclusion Determination Forest Grove Substation Expansion CX(s) Applied: B4.6 Date: 02/01/2011 Location(s): Washington County, Oregon Office(s): Bonneville Power Administration Bonneville Power Administration is proposing to expand Forest Grove Substation located in Washington County, Oregon. The purpose of this project is to improve load service and reliability within the Portland vicinity as per the North American Electric Reliability Corporation reliability standards. Within the existing Forest Grove Substation, the switchyard fence line would be expanded to the north to make room for a new bay. Additionally, structure 12/1 of the Keeler-Tillamook #1 transmission line would be relocated approximately 10-feet ahead online in order to

214

Categorical Exclusion (CX) Determinations By Date | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

2, 2010 2, 2010 CX-001181: Categorical Exclusion Determination Santiam Substation Renovation CX(s) Applied: B1.16 Date: 03/12/2010 Location(s): Linn County, Oregon Office(s): Bonneville Power Administration March 12, 2010 CX-001147: Categorical Exclusion Determination Implementation of Process Simulation Tools and Temperature Control Methods for Metal Oxide Chemical Vapor Deposition Growth CX(s) Applied: B3.6 Date: 03/12/2010 Location(s): Somerset, New Jersey Office(s): Energy Efficiency and Renewable Energy, National Energy Technology Laboratory March 12, 2010 CX-001182: Categorical Exclusion Determination Access Road Improvement Project for Structure 12/1 of the Snoking Tap to Echo Lake-Monroe Number 1 Transmission Line CX(s) Applied: B1.13 Date: 03/12/2010 Location(s): Snohomish, Washington

215

CX-005700: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

700: Categorical Exclusion Determination 700: Categorical Exclusion Determination CX-005700: Categorical Exclusion Determination California-City-Oxnard CX(s) Applied: A1, A9, B1.32, B2.5, B5.1 Date: 04/08/2011 Location(s): Oxnard, California Office(s): Energy Efficiency and Renewable Energy Energy Efficiency and Conservation Block Grant Program. 1) City wide energy audit of city buildings; 2) Installation of intelligent transportation system; 3) Replace illuminated street signs with reflective signs; and 4) Building retrofits to include lighting systems and exit signs, installation of sensors and timers, install heating, ventilation and air conditioning (HVAC) and chiller improvements?buildings include: Public Safety Building, Downtown Parking Structure, City Hall, City Hall Annex, Main Library,

216

Categorical Exclusion (CX) Determinations By Date | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

9, 2010 9, 2010 CX-007135: Categorical Exclusion Determination Coolidge-Oracle Crossarm Replacement CX(s) Applied: B1.3 Date: 07/29/2010 Location(s): Pinal County, Arizona Office(s): Western Area Power Administration-Desert Southwest Region July 29, 2010 CX-004891: Categorical Exclusion Determination Coolidge-Oracle (Structure Maintenance) CX(s) Applied: B1.3 Date: 07/29/2010 Location(s): Pinal County, Arizona Office(s): Western Area Power Administration-Desert Southwest Region July 29, 2010 CX-003340: Categorical Exclusion Determination An Innovative Reactor Technology to Improve Indoor Air Quality CX(s) Applied: B3.6 Date: 07/29/2010 Location(s): Lexington, Massachusetts Office(s): Energy Efficiency and Renewable Energy, National Energy Technology Laboratory July 29, 2010

217

CX-004844: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

44: Categorical Exclusion Determination 44: Categorical Exclusion Determination CX-004844: Categorical Exclusion Determination B-Wing High Activity Drain Exhaust (HADE) Filter Housing CX(s) Applied: B1.3 Date: 12/17/2010 Location(s): Aiken, South Carolina Office(s): Savannah River Operations Office B-Wing High Activity Drain Exhaust (HADE) filter housing is old, corroded and add leakpoints to the system, thus contributing to the less optimum operation of the system. The design configuration of the filter housing is obsolete, where inlet air flow from the top to bottom creates more condensation, which contributed to the corrosion of the housing. To improve the system, the old filter housing and related components such as moisture separator, valves, piping, instrumentation, and component structural

218

CX-001180: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

1180: Categorical Exclusion Determination 1180: Categorical Exclusion Determination CX-001180: Categorical Exclusion Determination Monroe-Custer Number 1 and 2 500-Kilovolt Transmission Line Structure 16/2 Access Road Improvement and Bridge Replacement Project CX(s) Applied: B1.3 Date: 03/15/2010 Location(s): Snohomish County, Washington Office(s): Bonneville Power Administration Bonneville Power Administration (BPA) proposes to replace an existing dilapidated bridge across Little Pilchuck Creek, install three culverts in drainage ditches near the bridge, and repair 2,000 feet of existing on and off right-of-way (ROW) access roads along mile 16 of the Monroe-Custer Number 1 and Number 2 transmission Lines. Project work includes: excavation for bridge removal and installation, grading and shaping of roads, placing

219

CX-001179: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

179: Categorical Exclusion Determination 179: Categorical Exclusion Determination CX-001179: Categorical Exclusion Determination Lancaster-Noxon Number 1 Mile 46-50 Access Road Improvement and Bridge Replacement Project CX(s) Applied: B1.3 Date: 03/16/2010 Location(s): Bonner County, Idaho Office(s): Bonneville Power Administration Bonneville Power Administration (BPA) has a need to construct and repair approximately 4.1 miles of access road and build tower landings along the Lancaster-Noxon Number 1 Transmission Line. As a result of wet conditions at the site, there is currently no vehicle access between structures 46/3-50/1 during much of the year. Proposed project work includes: vegetation removal, grading and shaping of roads, installation of geo-textile material, placing and compacting of road surfacing, bridge

220

CX-003220: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

0: Categorical Exclusion Determination 0: Categorical Exclusion Determination CX-003220: Categorical Exclusion Determination Hot Pot Project CX(s) Applied: A9, B3.1 Date: 08/05/2010 Location(s): Nevada Office(s): Energy Efficiency and Renewable Energy, Golden Field Office Oski Energy, LLC would improve geothermal well target selection and reduce drilling risk through the application of an innovative and advanced method for interpreting seismic survey data to locate deep geothermal structures. Once the seismic data is analyzed, two moderate depth slim hole wells and a resource confirmation well would be drilled and tested. Project work would take place on public lands in Nevada regulated by the Winnemucca District of the Bureau of Land Management. No laboratory work is anticipated for this project.

Note: This page contains sample records for the topic "determination improved structure" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


221

Categorical Exclusion (CX) Determinations By Date | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

17, 2011 17, 2011 CX-005428: Categorical Exclusion Determination Improved Structure and Fabrication of Large High-Power Kinetic Hydropower System Rotors -Year 2 CX(s) Applied: A9, B3.1, B5.1 Date: 03/17/2011 Location(s): New York Office(s): Energy Efficiency and Renewable Energy, Golden Field Office March 17, 2011 CX-005407: Categorical Exclusion Determination State Energy Program -Farm Audit Implementation CX(s) Applied: B5.1 Date: 03/17/2011 Location(s): Michigan Office(s): Energy Efficiency and Renewable Energy, Golden Field Office March 17, 2011 CX-005398: Categorical Exclusion Determination Energy Efficiency and Conservation Block Grant - Illinois-City-Schaumburg, Village of CX(s) Applied: A1, A9, B2.5, B5.1 Date: 03/17/2011 Location(s): Schaumburg, Illinois Office(s): Energy Efficiency and Renewable Energy

222

CX-011438: Categorical Exclusion Determination | Department of...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Energy Technology Laboratory Samples are scanned with X-rays and the diffracted beams are analyzed to determine the crystalline structure and other properties of the...

223

CX-008862: Categorical Exclusion Determination | Department of...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Exclusion Determination Variable Frequency Drivers for Raw Water Intake Structure Pumps Government Furnished Equipment CX(s) Applied: B1.3 Date: 08162012 Location(s):...

224

CX-010410: Categorical Exclusion Determination | Department of...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

CX-010410: Categorical Exclusion Determination Oracle to Tucson 115 Kilovolt Transmission Line, Cross Arm Replacements at Structure 25 and 73 CX(s) Applied: B1.3...

225

CX-002644: Categorical Exclusion Determination | Department of...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

CX-002644: Categorical Exclusion Determination Photoactive, Organic-Inorganic Hybrid Porous Structures for Photocatalytic Carbon Dioxide Reduction CX(s) Applied: B3.6...

226

2014-05-08 Issuance: Energy Efficiency Improvements in ANSI/ASHRAE...  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

05-08 Issuance: Energy Efficiency Improvements in ANSIASHRAEIES Standard 90.1-2013; Preliminary Determination 2014-05-08 Issuance: Energy Efficiency Improvements in ANSIASHRAE...

227

Structural insights into the novel ARM-repeat protein CTNNBL1 and its association with the hPrp19-CDC5L complex  

Science Journals Connector (OSTI)

The crystal structure of the dimer form of CTNNBL1 was determined, and the CDC5L binding site was also identified. Based on the structural and the biochemical experiments of CTNNBL1, an improved molecular architecture of the Prp19-CDC5L complex was presented.

Ahn, J.-W.

2014-02-22T23:59:59.000Z

228

Structural Aging Program to evaluate continued performance of safety-related concrete structures in nuclear power plants  

SciTech Connect

This report discusses the Structural Aging (SAG) Program which is being conducted at the Oak Ridge National Laboratory (ORNL) for the United States Nuclear Regulatory commission (USNRC). The SAG Program is addressing the aging management of safety-related concrete structures in nuclear power plants for the purpose of providing improved technical bases for their continued service. The program is organized into three technical tasks: Materials Property Data Base, Structural Component Assessment/Repair Technologies, and Quantitative Methodology for continued Service Determinations. Objectives and a summary of recent accomplishments under each of these tasks are presented.

Naus, D.J.; Oland, C.B. [Oak Ridge National Lab., TN (United States); Ellingwood, B.R. [Johns Hopkins Univ., Baltimore, MD (United States)

1994-03-01T23:59:59.000Z

229

Improved sample size determination for attributes and variables sampling  

SciTech Connect

Earlier INMM papers have addressed the attributes/variables problem and, under conservative/limiting approximations, have reported analytical solutions for the attributes and variables sample sizes. Through computer simulation of this problem, we have calculated attributes and variables sample sizes as a function of falsification, measurement uncertainties, and required detection probability without using approximations. Using realistic assumptions for uncertainty parameters of measurement, the simulation results support the conclusions: (1) previously used conservative approximations can be expensive because they lead to larger sample sizes than needed; and (2) the optimal verification strategy, as well as the falsification strategy, are highly dependent on the underlying uncertainty parameters of the measurement instruments. 1 ref., 3 figs.

Stirpe, D.; Picard, R.R.

1985-01-01T23:59:59.000Z

230

Improving the Scalability of Reduct Determination in Rough Sets.  

E-Print Network (OSTI)

??Rough Set Data Analysis (RSDA) is a non-invasive data analysis approach that solely relies on the data to find patterns and decision rules. Despite its… (more)

Mahmood, Shahid

2013-01-01T23:59:59.000Z

231

Towards improved methods for determining porous media multiphase flow functions  

E-Print Network (OSTI)

multiphase property. Three synthetic experiments are used to show the erroneous estimation of flow functions associated with the homogeneity assumption. A proposal approach is used to predict the relative permeability of wetting phase using NMR relaxation... . . . . . 25 a. Total Flow Rate Specified at the Boundary . . . . 33 b. Pressure Specified at the Boundary . . . . . . . . 36 D. Two-Dimensional Comparison Test . . . . . . . . . . . . . 42 E. Synthetic Experiments and Estimations . . . . . . . . . . . 46 1...

Xue, Song

2004-09-30T23:59:59.000Z

232

Energy efficiency improvement and cost saving opportunities for petroleum refineries  

E-Print Network (OSTI)

Improve Steam Turbine Efficiency. Hydrocarbon Processing 6cycle gas turbines with an electric efficiency of 32%. 5.The efficiency of the steam turbine is determined by the

Worrell, Ernst; Galitsky, Christina

2005-01-01T23:59:59.000Z

233

Improve Motor Operation at Off-Design Voltages | Department of...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Selection and Application Guide - A Handbook for Industry Improving Motor and Drive System Performance - A Sourcebook for Industry Determining Electric Motor Load and Efficiency...

234

Combining Modeling Methodologies for Improved Understanding of Smart Material Characteristics  

E-Print Network (OSTI)

Combining Modeling Methodologies for Improved Understanding of Smart Material Characteristics Material Systems and Structures February 2, 1998 ABSTRACT Smart materials are complex materials performance capabilities but the synergistic response of the smart material and companion structure. Behavior

Lindner, Douglas K.

235

Neutron reflecting supermirror structure  

DOE Patents (OSTI)

An improved neutron reflecting supermirror structure comprising a plurality of stacked sets of bilayers of neutron reflecting materials. The improved neutron reflecting supermirror structure is adapted to provide extremely good performance at high incidence angles, i.e. up to four time the critical angle of standard neutron mirror structures. The reflection of neutrons striking the supermirror structure at a high critical angle provides enhanced neutron throughput, and hence more efficient and economical use of neutron sources. One layer of each set of bilayers consist of titanium, and the second layer of each set of bilayers consist of an alloy of nickel with carbon interstitially present in the nickel alloy.

Wood, James L. (Drayton Plains, MI)

1992-01-01T23:59:59.000Z

236

Improving Interpersonal Communication  

E-Print Network (OSTI)

By improving interpersonal communication skills, we can improve our relationships with others. Better communication comes from understanding one's self, understanding other people, learning to empathize, being a good listener and practicing...

Warren, Judith L.

2000-02-16T23:59:59.000Z

237

Progress towards of a superconducting traveling wave accelerating structure  

SciTech Connect

In the ILC project the required accelerating gradient is higher than 30 MeV/m. For current technology the maximum acceleration gradient in SC structures is determined mainly by the value of the surface RF magnetic field. In order to increase the gradient, the RF magnetic field is distributed homogeneously over the cavity surface (low-loss structure), and coupling to the beam is improved by introducing aperture 'noses' (reentrant structure). These features allow gradients in excess of 50 MeV/m to be obtained for a singe-cell cavity. Further improvement of the coupling to the beam may be achieved by using a TW SC structure with small phase advance per cell. We have demonstrated that an additional gradient increase by up to 46% may be possible if a {pi}/2 TW SC structure is employed. However, a TW SC structure requires a SC feedback waveguide to return the few GW of circulating RF power from the structure output back to the structure input. The test cavity with the feedback is designed to demonstrate the possibility of achieving a significantly higher gradient than existing SC structures.

Yakovlev, V.; /Yale U.; Avrakhov, P.; Kanareykin, A.; Kazakov, S.; /KEK, Tsukuba; Solyak, N.; /Fermilab

2007-06-01T23:59:59.000Z

238

Categorical Exclusion Determinations: B6.3 | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

3 3 Categorical Exclusion Determinations: B6.3 Existing Regulations B6.3: Improvements to environmental control systems Improvements to environmental monitoring and control systems of an existing building or structure (such as changes to scrubbers in air quality control systems or ion-exchange devices and other filtration processes in water treatment systems), provided that during subsequent operations (1) any substance collected by the environmental control systems would be recycled, released, or disposed of within existing permitted facilities and (2) there are applicable statutory or regulatory requirements or permit conditions for disposal, release, or recycling of any hazardous substance or CERCLA-excluded petroleum or natural gas products that are collected or

239

Refines Efficiency Improvement  

SciTech Connect

Refinery processes that convert heavy oils to lighter distillate fuels require heating for distillation, hydrogen addition or carbon rejection (coking). Efficiency is limited by the formation of insoluble carbon-rich coke deposits. Heat exchangers and other refinery units must be shut down for mechanical coke removal, resulting in a significant loss of output and revenue. When a residuum is heated above the temperature at which pyrolysis occurs (340 C, 650 F), there is typically an induction period before coke formation begins (Magaril and Aksenova 1968, Wiehe 1993). To avoid fouling, refiners often stop heating a residuum before coke formation begins, using arbitrary criteria. In many cases, this heating is stopped sooner than need be, resulting in less than maximum product yield. Western Research Institute (WRI) has developed innovative Coking Index concepts (patent pending) which can be used for process control by refiners to heat residua to the threshold, but not beyond the point at which coke formation begins when petroleum residua materials are heated at pyrolysis temperatures (Schabron et al. 2001). The development of this universal predictor solves a long standing problem in petroleum refining. These Coking Indexes have great potential value in improving the efficiency of distillation processes. The Coking Indexes were found to apply to residua in a universal manner, and the theoretical basis for the indexes has been established (Schabron et al. 2001a, 2001b, 2001c). For the first time, a few simple measurements indicates how close undesired coke formation is on the coke formation induction time line. The Coking Indexes can lead to new process controls that can improve refinery distillation efficiency by several percentage points. Petroleum residua consist of an ordered continuum of solvated polar materials usually referred to as asphaltenes dispersed in a lower polarity solvent phase held together by intermediate polarity materials usually referred to as resins. The Coking Indexes focus on the amount of these intermediate polarity species since coke formation begins when these are depleted. Currently the Coking Indexes are determined by either titration or solubility measurements which must be performed in a laboratory. In the current work, various spectral, microscopic, and thermal techniques possibly leading to on-line analysis were explored for measuring the Coking Indexes.

WRI

2002-05-15T23:59:59.000Z

240

CX-005588: Categorical Exclusion Determination | Department of...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Determination Investigation of Improved Conductivity and Proppant Applications in the Bakken Formation CX(s) Applied: B3.6 Date: 04112011 Location(s): Grand Forks, North Dakota...

Note: This page contains sample records for the topic "determination improved structure" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


241

CX-009581: Categorical Exclusion Determination | Department of...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

CX-009581: Categorical Exclusion Determination Manufacturing Improvement Program for the Oil and Gas Industry Supply Chain CX(s) Applied: A9, A11, B3.6 Date: 12142012...

242

Method and system for improved resolution of a compensated calorimeter detector  

DOE Patents (OSTI)

An improved method and system for a depleted uranium calorimeter detector used in high energy physics experiments. In a depleted uranium calorimeter detector, the energy of a particle entering the calorimeter detector is determined and the output response of the calorimeter detector is compensated so that the ratio of the integrated response of the calorimeter detector from a lepton to the integrated response of the calorimeter detector from a hadron of the same energy as the lepton is approximately equal to 1. In the present invention, the energy of a particle entering the calorimeter detector is determined as a function of time and the hadron content of the response of the calorimeter detector is inferred based upon the time structure of the energy pulse measured by the calorimeter detector. The energy measurement can be corrected based on the inference of the hadron content whereby the resolution of the calorimeter can be improved.

Dawson, John W. (Willowbrook, IL)

1991-01-01T23:59:59.000Z

243

Airfoil structure  

DOE Patents (OSTI)

Past airfoil configurations have been used to improve aerodynamic performance and engine efficiencies. The present airfoil configuration further increases component life and reduces maintenance by reducing internal stress within the airfoil itself. The airfoil includes a chord and a span. Each of the chord and the span has a bow being summed to form a generally "C" configuration of the airfoil. The generally "C" configuration includes a compound bow in which internal stresses resulting from a thermal temperature gradient are reduced. The structural configuration reduces internal stresses resulting from thermal expansion.

Frey, Gary A. (Poway, CA); Twardochleb, Christopher Z. (Alpine, CA)

1998-01-01T23:59:59.000Z

244

Airfoil structure  

DOE Patents (OSTI)

Past airfoil configurations have been used to improve aerodynamic performance and engine efficiencies. The present airfoil configuration further increases component life and reduces maintenance by reducing internal stress within the airfoil itself. The airfoil includes a chord and a span. Each of the chord and the span has a bow being summed to form a generally ``C`` configuration of the airfoil. The generally ``C`` configuration includes a compound bow in which internal stresses resulting from a thermal temperature gradient are reduced. The structural configuration reduces internal stresses resulting from thermal expansion. 6 figs.

Frey, G.A.; Twardochleb, C.Z.

1998-01-13T23:59:59.000Z

245

Combining NMR, PRE, and EPR Methods For Homodimer Protein Structure...  

NLE Websites -- All DOE Office Websites (Extended Search)

NMR, PRE, and EPR Methods For Homodimer Protein Structure Determination. Combining NMR, PRE, and EPR Methods For Homodimer Protein Structure Determination. Abstract: Homo-oligomer...

246

Improving Lives. Improving Texas. Agency Strategic Plan  

E-Print Network (OSTI)

. Williams Administration Building 7101 TAMU September 2009 College Station, TX 77843-7101 Phone: 979. In the context of this broad mission, the priorities for Extension education are: Ensure a sustainable and management. Build local capacity for economic development in Texas communities. Improve the health

247

Agricultural Improvement Loan Program  

Energy.gov (U.S. Department of Energy (DOE))

The Agricultural Improvement Loan Program is administered by the Minnesota Department of Agriculture through the Minnesota Rural Finance Authority (RFA) and provides loans to farmers for...

248

HUD Home Improvements  

Energy.gov (U.S. Department of Energy (DOE))

Provides a collection of information, resources, and updates related to home improvements and insurance for manufactured housing. Author: U.S. Department of Housing and Urban Development

249

Improved recovery demonstration for Williston basin carbonates. Quarterly technical progress report, October 1, 1995--December 31, 1995  

SciTech Connect

The purpose of this project is to demonstrate targeted infill and extension drilling opportunities, better determinations of oil-in-place, methods for improved completion efficiency and the suitability of waterflooding in certain shallow-shelf carbonate reservoirs in the Williston Basin, Montana, North Dakota and South Dakota. Improved reservoir characterization utilizing 3-dimensional and multi-component seismic area is being investigated for identification of structural and stratigraphic reservoir compartments. These seismic characterization tools are integrated with geological and engineering studies. Improved completion efficiency is being tested with extended-reach jetting lance and other ultra-short radius lateral technologies. Improved completion efficiency, additional wells at closer spacing and better estimates of oil-in-place will result in additional oil production by primary and enhanced recovery processes.

NONE

1996-02-01T23:59:59.000Z

250

Improved wire chamber  

DOE Patents (OSTI)

An improved gas mixture for use with proportional counter devices, such as Geiger-Mueller tubes and drift chambers. The improved gas mixture provides a stable drift velocity while eliminating wire aging caused by prior art gas mixtures. The new gas mixture is comprised of equal parts argon and ethane gas and having approximately 0.25% isopropyl alcohol vapor. 2 figs.

Atac, M.

1987-05-12T23:59:59.000Z

251

Improved solid aerosol generator  

DOE Patents (OSTI)

An improved solid aerosol generator used to produce a gas borne stream of dry, solid particles of predetermined size and concentration. The improved solid aerosol generator nebulizes a feed solution of known concentration with a flow of preheated gas and dries the resultant wet heated aerosol in a grounded, conical heating chamber, achieving high recovery and flow rates. 2 figs.

Prescott, D.S.; Schober, R.K.; Beller, J.

1988-07-19T23:59:59.000Z

252

Measurement, Analysis, and Improvement  

NLE Websites -- All DOE Office Websites (Extended Search)

6 Measurement, Analysis, and Improvement Process 11_0304 Page 1 of 6 6 Measurement, Analysis, and Improvement Process 11_0304 Page 1 of 6 EOTA - Business Process Document Title: Measurement, Analysis, and Improvement Process Document Number: P-006 Rev 11_0304 Document Owner: Elizabeth Sousa Backup Owner: Melissa Otero Approver(s): Melissa Otero Parent Document: Q-001, Quality Manual Notify of Changes: EOTA Employees Referenced Document(s): P-008 Corrective-Preventive Action Process, P-004 Business System Management Review and REG-003 Records Register P-006 Measurement, Analysis, and Improvement Process 11_0304 Page 2 of 6 Revision History: Rev. Description of Change A Initial Release 08_0416 Changed verbiage in Step 6 to, "CAR/PAR/IO using P-008, Corrective-Preventive Action & Improvement Opportunity"

253

Milestone Plan Process Improvement  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Milestone Plan Process Improvement Milestone Plan Process Improvement Milestone Plan Process Improvement Background In response to our community's concern over the milestone plan (MP) process within the system, the STRIPES Project Office initiated an in-depth evaluation of the required steps and issues surrounding this process. We concluded that the MP process could be improved for most users by tuning the system configuration. With the approval of both the STRIPES Executive Steering Committee and the STRIPES Project Office, we launched the MP Process Improvement Initiative. After many meetings with members of the STRIPES Team and Working Group, we are ready to "go-live" with this initiative. On October 1 st , 2012 the new MP process will be implemented for use by most field offices.

254

RECORD OF CATEGORICAL EXCLUSION DETERMINATION  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

vegetation removal betweeen vegetation removal betweeen structures 0/3 and 0/4, liS and 1/6, 3/1 and 3/2, 412 and 4/3, a round structure 418, between structures S/l and S/2 and around structure S/4 along the existing Saguaro -Oracle 11S-kV transmission line, Pinal County, Arizona RECORD OF CATEGORICAL EXCLUSION DETERMINATION A. Proposed Action: Western proposes to conduct vegetation removal between structures 0/3 and 0/4, 1/5 and 1/6, 3/1 and 3/2, 4/2 and 4/3, around structure 4/8, between structures 5/1 and 5/2 and around structure 5/4 of its Saguaro-Oracle 115- kV transmission line, within Western's existing right-of-way. Western will access the vegetation removal areas using crew trucks along the existing access roads. Western will use a front end loader with a cut shredder attachment to knock down

255

JGI - Structural Genomics Program  

NLE Websites -- All DOE Office Websites (Extended Search)

Structural Genomics Program Structural Genomics Program The structural characterization of proteins of unknown function can be described as structural genomics, an approach in which structure determination by X-ray crystallography supplies key functional information. This is exemplified by studies of the carboxysome. The structures of the first carboxysome shell proteins (Kerfeld et al., Science 2005) confirmed earlier hypotheses that they are indeed the basic building blocks of the carboxysome shell; the quaternary structure and the higher order assemblies of the proteins in the crystals provided insight into how they assemble into shell facets. Likewise, our structure of the carboxysome component CsoS3 revealed that it was a member of the beta-carbonic family, despite having no detectable sequence homology at the level of primary structure

256

RECORD OF CATEGORICAL EXCLUSION DETERMINATION  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

addition of addition of aerial marker balls along the existing Prescott -Pinnacle Peak & Pinnacle Peak-Rogers 230-kV Transmission Line right-of-ways located in Maricopa County, Arizona. RECORD OF CATEGORICAL EXCLUSION DETERMINATION A. Proposed Action: Western proposes removing 2 existing marker balls at structures 0/4 & 0/5 of the Pinnacle Peak-Rogers #1 & #2 230-kV double circuit transmission line & installing aerial marker ball equipment on all static wires (overhead ground wires) of the Prescott-Pinnacle Peak 230-kV transmission line on the north side of structures 216/1-216/3 & the southeast side of structures 0/3-0/5 on the Pinnacle Peak-Rogers #1 & #2 230-kV double circuit transmission line. The diverters will be installed using a hot stick by accessing the structure using existing access roads and

257

Improved Dragline Utilization  

E-Print Network (OSTI)

The cause of energy conservation can be served by increasing the efficiency of large draglines used in surface coal mining. The topic is the application of a training simulator, computer instrumentation and computer simulation to improve dragline...

Keller, K. J.

1980-01-01T23:59:59.000Z

258

Improving Project Management  

Energy.gov (U.S. Department of Energy (DOE))

On December 19, 2014, the Energy Department released its "Improving Project Management" report, a roadmap to transformation in funding, culture, project ownership, independent oversight and front-end planning from experienced project management leaders.

259

Design and demonstration of an improved stretched-membrane heliostat  

SciTech Connect

Improvements to a stretched-membrane heliostat have been designed and implemented under contract with Sandia National Laboratories. Specific improvements were made to the mirror module to improve performance and reduce costs. The performance of the heliostat in windy conditions was improved by adding a restraint to the rear membrane. An open-section ring was used to increase structural efficiency. The rear structure was redesigned to take advantage of common manufacturing techniques and lower cost materials. The control system was improved, and a means of achieving passive defocus was achieved. Finally, membrane preload was applied with nonconsumable tooling. An 8% reduction in mirror-module cost was realized. The improved design was successfully demonstrated with a 50-m{sup 2} prototype. This prototype had improved optical stability in fluctuating winds. Its slope error in calm winds was measured to be 1.3 mrad. 17 refs., 68 figs., 8 tabs.

Not Available

1989-12-01T23:59:59.000Z

260

Improved roof stabilization technologies  

SciTech Connect

Decontamination and decommissioning (D and D) activities require that personnel have access to all areas of structures, some of which are more than 40 years old. In many cases, these structures have remained in a standby condition for up to 10 years; few preventative maintenance activities have been performed on them because of lack of funding or a defined future plan of action. This situation has led to deteriorated building conditions, resulting in potential personnel safety hazards. In addition, leaky roofs allow water to enter the buildings, which can cause the spread of contamination and increase building deterioration, worsening the already unsafe working conditions. To ensure worker safety and facilitate building dismantlement, the assessment of roof stabilization techniques applicable to US Department of Energy (DOE) structures has become an important issue. During Fiscal year 1997 (FY97), a comprehensive reliability-based model for the structural stabilization analysis of roof system in complex structures was developed. The model consists of three major components: a material testing method, a deterministic structural computer model, and a reliability-based optimization, and probabilistic analyses of roof structures can be implemented. Given site-specific needs, this model recommends the most appropriate roof stabilization system. This model will give not only an accurate evaluation of the existing roof system in complex structures, but it will also be a reliable method to aid the decision-making process. This final report includes in its appendix a Users` Manual for the Program of Deterministic and Reliability Analysis of Roof Structures.

Ebadian, M.A.

1998-01-01T23:59:59.000Z

Note: This page contains sample records for the topic "determination improved structure" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


261

Improved recovery demonstration for Williston Basin carbonates. Final report  

SciTech Connect

The purpose of this project was to demonstrate targeted infill and extension drilling opportunities, better determinations of oil-in-place, and methods for improved completion efficiency. The investigations and demonstrations were focussed on Red River and Ratcliffe reservoirs in the Williston Basin within portions of Montana, North Dakota and South Dakota. Both of these formations have been successfully explored with conventional 2-dimensional (2D) seismic. Improved reservoir characterization utilizing 3-dimensional (3D) seismic was investigated for identification of structural and stratigraphic reservoir compartments. These seismic characterizations were integrated with geological and engineering studies. The project tested lateral completion techniques, including high-pressure jetting lance technology and short-radius lateral drilling to enhance completion efficiency. Lateral completions should improve economics for both primary and secondary oil where low permeability is a problem and higher-density drilling of vertical infill wells is limited by drilling cost. New vertical wells were drilled to test bypassed oil in ares that were identified by 3D seismic. These new wells are expected to recover as much or greater oil than was produced by nearby old wells. The project tested water injection through vertical and horizontal wells in reservoirs where application of waterflooding has been limited. A horizontal well was drilled for testing water injection. Injection rates were tested at three times that of a vertical well. This demonstration well shows that water injection with horizontal completions can improve injection rates for economic waterflooding. This report is divided into two sections, part 1 covers the Red River and part 2 covers the Ratcliffe. Each part summarizes integrated reservoir characterizations and outlines methods for targeting by-passed oil reserves in the respective formation and locality.

Sippel, M.A.

1998-07-01T23:59:59.000Z

262

Improved rubber nanofillers  

SciTech Connect

During this task, Silane functionalized TiO2 and HK3Ti4O4(SiO4)3 were sent to Goodyear (GY) for testing. These materials were characterized based on their interaction with the model elastomer, squalene. The Van der Waals interactions and Hamaker Constants for ZnO particles in squalene and rubber materials were characterized and it was determined that a 10-20 nm spacing was necessary between primary filler particles to maintain a stable nanocomposite. Contact angle measurements on the ZnO and ZnO-silane materials indicated that the solvent should wet the particles, and solvophobic attractions should not be present. These studies showed that the surface modification with sulfosilane coupling agents was successful, and high levels of dispersion of the particles remained possible. Further, a novel surface charging phenomenon where negative surface charging is developed in the squalene environment was observed and corroborated by measurements of particle size and of the surface modified materials in squalene. This impacts the dispersion of the particles according to the traditional colloidal interpretation of electrostatic repulsive forces between particles. Additionally, thin nanocomposite fibers were developed using electrospinning. The size and shape of the oxides did not change during the electrospinning process, although the shape of the fiber and the distribution of the particles, particularly for ZnO, was not ideal. There was an obvious increase in elastic modulus and hardness from the addition of the oxides, but differentiating the oxides, and particularly the surfactants, was difficult. The A-1289 lead to the greatest dispersion of the filler particles, while the A-1589 and the NXT produced clustered particle aggregates. This agrees with previous study of these materials in low molecular weight squalene solvent studies reported earlier. The behavior of the nanoparticle ZnO and the microparticle silica is different as well, with the ZnO being contained within the elastomer, and the SiO2 forming monolayers at the surface of the elastomer. The dynamic mechanical analysis did not show clear trends between the surface modification and the aggregate structure. In the silica particles, the NXT led to the least particle interaction, followed by the A-1289 and highest particle interaction found for the A-1589. For the nanosized ZnO, the best dispersion was found for the A-1589, with both the A-1289 and NXT exhibiting frequency dependent responses.

Boyle, T. J.

2012-03-01T23:59:59.000Z

263

Identification of a novel polyfluorinated compound as a lead to inhibit the human enzymes aldose reductase and AKR1B10: structure determination of both ternary complexes and implications for drug design  

Science Journals Connector (OSTI)

The polyfluorinated compound 2,2',3,3',5,5',6,6'-octafluoro-4,4'-biphenyldiol (JF0064) is a potent inhibitor (IC50 1 ?M) of both aldose reductase and AKR1B10. X-ray structures of ternary complexes of both enzymes with JF0064 allow it to be inferred that this lead compound binds to the enzyme active site through an acidic phenol group and allow the extraction of important hints for structure-based drug design.

Cousido-Siah, A.

2014-02-27T23:59:59.000Z

264

Improvement of isentropic efficiency of a magnetohydrodynamic power generator by radio-frequency preionization  

Science Journals Connector (OSTI)

We describe the effect of a radio-frequency (rf) power application on the performance of a magnetohydrodynamic(MHD) electrical power generator as determined through shock-tunnel-based experiments and quasi-three-dimensional numerical simulations. The temporal plasma-fluid behavior the one-dimensional plasma-fluid structure the enthalpy-entropy diagram the quality of the energy conversion efficiency and the energy flow in the power-generating system are investigated. Preionization assistance by a small amount of rf power drastically changes the entire MHD power-generating system; the MHD extraction length is considerably extended and the isentropic efficiency is significantly improved.

Tomoyuki Murakami; Yoshihiro Okuno

2009-01-01T23:59:59.000Z

265

CX-011200: Categorical Exclusion Determination | Department of...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

CX-011200: Categorical Exclusion Determination Blast and Paint West Hackberry Meter Skid, Prover Piping and Structure CX(s) Applied: B1.3 Date: 09092013 Location(s):...

266

CX-011228: Categorical Exclusion Determination | Department of...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

CX-011228: Categorical Exclusion Determination Structure 112-4 LIBPAD1 230-kilovolt Transmission Line "Live Line" Maintenance Training CX(s) Applied: B1.2 Date: 10252013...

267

Determining solar abundances using helioseismology  

E-Print Network (OSTI)

The recent downward revision of solar photospheric abundances of Oxygen and other heavy elements has resulted in serious discrepancies between solar models and solar structure as determined through helioseismology. In this work we investigate the possibility of determining the solar heavy-element abundance without reference to spectroscopy by using helioseismic data. Using the dimensionless sound-speed derivative in the solar convection zone, we find that the heavy element abundance, Z, of 0.0172 +/- 0.002, which is closer to the older, higher value of the abundances.

H. M. Antia; Sarbani Basu

2006-02-28T23:59:59.000Z

268

Detection of structural degradation  

SciTech Connect

A time domain method developed for determining dynamic system characteristics is applied to structural monitoring and/or flaw detection. The potential usefulness for monitoring is evaluated based on several criteria, which include sensitivity to structural changes, location of flaws, and dependence upon excitation signals. The strengths and weaknesses of the methods are discussed. Also, structural monitoring using a signal's singular values is presented and evaluated. 2 refs., 4 figs., 2 tabs.

Endebrock, E.G.

1991-01-01T23:59:59.000Z

269

Improving steam turbine efficiency  

SciTech Connect

This paper describes the condition of a significant number of fossil steam turbines operating in the United States and the maintenance practices used to improve their performance. Through the use of steam path audits conducted by the authors` company and by several utilities, a large data base of information on turbine heat rate, casing efficiency, and maintenance practices is available to help the power generation industry understand how different maintenance practices and steam path damage impact turbine performance. The data base reveals that turbine cycle heat rate is typically 5.23% poorer than design just prior to major outages. The degraded condition of steam turbines presents an opportunity for utilities to improve heat rate and reduce emissions without increasing fuel costs. The paper describes what losses typically contribute to the 5.23% heat rate degradation and how utilities can recover steam turbine performance through maintenance actions aimed at improving steam path efficiency.

Cioffi, D.H.; Mitchell, D.R.; Whitecar, S.C. [Encotech, Inc., Schenectady, NY (United States)

1995-06-01T23:59:59.000Z

270

OIT geothermal system improvements  

SciTech Connect

The Oregon Institute of Technology campus has been heated by the direct use of geothermal fluids since 1964. The 11 building campus uses geothermal energy for space heating/cooling, domestic water heating, the swimming pool and sidewalk snow melt. The hydronic system was designed to use the geothermal fluids directly in heating units. In the 1970s, problems were experienced with the design and operation of the well pumps, buried piping and heating equipment. Beginning in the early 1980`s, many improvements were made to the system due to equipment performance problems and resource management requirements. This paper discusses those improvements that included the distribution system, cooling, well pumps, cascading of geothermal fluids, installation of isolation plate heat exchangers in each building and drilling of two injection wells. Plans for future improvements include better controls to manage energy use and data monitoring systems for individual buildings, and instrumentation to monitor well pump performance.

Lienau, P.J.

1996-12-31T23:59:59.000Z

271

ACCELERATED IMPROVEMENT A CONCENTRATED APPROACH  

E-Print Network (OSTI)

ACCELERATED IMPROVEMENT A CONCENTRATED APPROACH FOR CONTINUOUS IMPROVEMENT #12;Accelerated.quality.wisc.edu O F F I C E O F Q U A L I T Y I M P R O V E M E N T Accelerated Improvement This guide to improving resources. You will find helpful information needed to conduct an Accelerated Improvement project

Shapiro, Vadim

272

What determines cell size?  

E-Print Network (OSTI)

as: Marshall WF, et al. : What determines cell size? BMC7007/10/101 FORUM Open Access What determines cell size?biologists have been wondering what determines the size of

2012-01-01T23:59:59.000Z

273

High Performance Healthcare Buildings: A Roadmap to Improved Energy Efficiency  

E-Print Network (OSTI)

Efficiency 11-Sept-2009 9. Economic and Organizationaland Organizational Issues 9.1. Strategies to overcome structural challenges to energy efficiencyorganizational scheme to facilitate discussion of challenges to improving energy efficiency

Singer, Brett C.

2010-01-01T23:59:59.000Z

274

Improved vortex reactor system  

DOE Patents (OSTI)

An improved vortex reactor system for affecting fast pyrolysis of biomass and Refuse Derived Fuel (RDF) feed materials comprising: a vortex reactor having its axis vertically disposed in relation to a jet of a horizontally disposed steam ejector that impels feed materials from a feeder and solids from a recycle loop along with a motive gas into a top part of said reactor.

Diebold, James P. (Lakewood, CO); Scahill, John W. (Evergreen, CO)

1995-01-01T23:59:59.000Z

275

CAMPUS IMPROVEMENT PROGRAM 201420  

E-Print Network (OSTI)

(CIP) 2014­20? The Campus Improvement Program (CIP) is a concept proposal for the delivery of new-Darlington campus to 2020 through land uses and building envelopes. The CIP is not a proposal for the detailed design and construction of new buildings. See point 9. 2. What are the objectives of the CIP? The CIP

Viglas, Anastasios

276

The crystal structure of the interrupted framework silicate K{sub 9.6}Ca{sub 1.2}Si{sub 12}O{sub 30} determined from laboratory X-ray diffraction data  

SciTech Connect

The crystal structure of a potassium calcium silicate with composition K{sub 9.6}Ca{sub 1.2}Si{sub 12}O{sub 30} (or K{sub 8}CaSi{sub 10}O{sub 25}) has been solved by direct methods aided by distance least squares optimization from laboratory X-ray powder diffraction data. The trigonal compound adopts the non-centrosymmetric space group R3c with the following basic crystallographic data: a=11.13623(5)A, c=21.9890(2)A, V=2361.63(2)A{sup 3}, Z=3, D{sub calc}=2.617gcm{sup -3}. The crystal structure can be classified as an interrupted framework with exclusively Q{sup 3}-units. It can be thought of as being built from layers parallel to (001) containing isolated six-membered tetrahedral rings in UDUDUD conformation. Corner sharing of tetrahedra belonging to adjacent sheets results in a tetrahedral framework. The framework density of the structure is 15.2 T-atoms/1000A{sup 3}. The coordination sequences are identical for both silicon atoms in the asymmetric unit: 3-6-11-20-32-46-60-80-102-122. The vertex symbols for the two tetrahedral centers are 10{sub 2}.10{sub 2}.6{sub 1}. Topologically, the structure can be described as an Archimedean three-dimensional 3-connected net. It can be derived from the diamond or cristobalite net by removing 20% of the knots. Charge compensation in the structure is achieved by the incorporation of mono- and divalent M-cations (M: K, Ca). These extra-framework ions are coordinated by six to nine oxygen ligands. Ca/K distributions for the five symmetrically independent M-sites were obtained from a combination of bond distance considerations, site occupancy refinements and the bulk chemical composition. The structural characterization is completed by a detailed Raman spectroscopic study. Furthermore, possible implications of the structural chemistry of interrupted framework silicates for the field of silicate glass research are addressed.

Kahlenberg, V. [Institute of Mineralogy and Petrography, University of Innsbruck, Innrain 52, A-6020 Innsbruck (Austria)]. E-mail: volker.kahlenberg@uibk.ac.at; Kaindl, R. [Institute of Mineralogy and Petrography, University of Innsbruck, Innrain 52, A-6020 Innsbruck (Austria); Christian-Doppler-Laboratory for Advanced Hard Coatings at the Institute of Mineralogy and Petrography, University of Innsbruck, Innrain 52, A-6020 Innsbruck (Austria); Toebbens, D.M. [Institute of Mineralogy and Petrography, University of Innsbruck, Innrain 52, A-6020 Innsbruck (Austria)

2006-07-15T23:59:59.000Z

277

RECORD OF CATEGORICAL EXCLUSION DETERMINATION  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

maintenance and avian nesting removal maintenance and avian nesting removal between structures 180/1 & 188/2 of the existing Mead-Perkins 500-kV transmission line in Maricopa County, Arizona. RECORD OF CATEGORICAL EXCLUSION DETERMINATION A. Proposed Action: Western proposes to conduct access road maintenance between structures 180/1 & 188/2 of the existing Mead-Perkins 500-kV transmission line. This will consist of blading and leveling out areas of the existing access road using dozers, bucket trucks, crew trucks and pickup trucks. This work is needed to facilitate avian nest removal at structures 180/1, 182/2, 186/2 & 188/2. This work is necessary to maintain the safety and reliability of the bulk electrical system. The attached A1ap shows the project areas are situated within Sections 13 & 24

278

RECORD OF CATEGORICAL EXCLUSION DETERMINATION  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

maintenance maintenance along the exis!ing Blythe-Knob 161-kV transmission Ime in Maricopa County. Arizona RECORD OF CATEGORICAL EXCLUSION DETERMINATION A. Proposed Action: Western proposes to replace broken crossarms at structures 32/3,6312 and cross brace repair at structure 31/2 along the existing Blythe - Knob 161-kV transmission line. Western will access structures using crew trucks and pickup trucks along existing access roads. This work is necessary to maintain the safety and reliability of the bulk electrical system. The attached maps show the project area is situated within Sections 15 & 21 Township 11 South Range 20 East & Section 10 Township 16 South Range 21 East on the San Bernardino Meridian, Imperial County, California. The corresponding

279

u.s. DEPARTIvIENT OF ENERGY EERE PROJECT MANAGEMENT CENTER NEPA DETERMINATION  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

DETERMINATION DETERMINATION RECIPIENT:Colorado Govemor's Energy Office PROJECT TITLE; COLORADO SEP ARRA - Capitallnvesl - Simla NEED grant Page 1 of2 STATE: CO Funding Opportunity Announcement Number DE-FOA-OOOOOS2 Procurement Instrument Number NEPA Control Number CID Number GFO -10-607 0 Based on my review of the information concerning the proposed action, as NEPA Compliance Officer (authorized under DO .. : Order 451.1 A), I have made the following determination: ex, EA, EIS APPENDIX AND NUMBER: Description: B1.4 Installation or modification of air conditioning systems required for temperature control for operation of existing equipment B2.1 Modifications of an existing structure to enhance workplace habitability (including, but not limited to: improvements to

280

Seismic assessment strategies for masonry structures  

E-Print Network (OSTI)

Masonry structures are vulnerable to earthquakes, but their seismic assessment remains a challenge. This dissertation develops and improves several strategies to better understand the behavior of masonry structures under ...

DeJong, Matthew J. (Matthew Justin)

2009-01-01T23:59:59.000Z

Note: This page contains sample records for the topic "determination improved structure" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


281

Method For Determining And Modifying Protein/Peptide Solubilty  

DOE Patents (OSTI)

A solubility reporter for measuring a protein's solubility in vivo or in vitro is described. The reporter, which can be used in a single living cell, gives a specific signal suitable for determining whether the cell bears a soluble version of the protein of interest. A pool of random mutants of an arbitrary protein, generated using error-prone in vitro recombination, may also be screened for more soluble versions using the reporter, and these versions may be recombined to yield variants having further-enhanced solubility. The method of the present invention includes "irrational" (random mutagenesis) methods, which do not require a priori knowledge of the three-dimensional structure of the protein of interest. Multiple sequences of mutation/genetic recombination and selection for improved solubility are demonstrated to yield versions of the protein which display enhanced solubility.

Waldo, Geoffrey S. (Espanola, NM)

2005-03-15T23:59:59.000Z

282

ORISE: Peer Review Process Improvement  

NLE Websites -- All DOE Office Websites (Extended Search)

Process Improvement Two men discuss ways to improve peer review processes After finding academic reviewers and conducting peer reviews, the Oak Ridge Institute for Science and...

283

Improved dose estimates for nuclear criticality accidents: Preliminary results  

SciTech Connect

A method for the determination of radiation doses resulting from a hypothetical crticality accident is presented. The method is an improvement over the slide-rule method cuurently used. The improved method calculates doses for low eneriched uranium as well as highly enriched solutions.

Wilkinson, A.; Basoglu, B.; Bentley, C.; Dunn, M.; Plaster, M.; Yamamoto, T.; Dodds, H. [Univ. of Tennessee, Knoxville, TN (United States); Hopper, C. [Oak Ridge National Lab., TN (United States)

1994-12-31T23:59:59.000Z

284

Categorical Exclusion Determinations: National Energy Technology Laboratory  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

25, 2012 25, 2012 CX-008305: Categorical Exclusion Determination Carolina Blue Skies Initiative CX(s) Applied: B5.22 Date: 04/25/2012 Location(s): North Carolina Offices(s): National Energy Technology Laboratory April 25, 2012 CX-008304: Categorical Exclusion Determination Installation of Retail Biofuel Infrastructure Supporting I-75 Green Corridor Project CX(s) Applied: A1, B5.22 Date: 04/25/2012 Location(s): Michigan Offices(s): National Energy Technology Laboratory April 25, 2012 CX-008303: Categorical Exclusion Determination Interstate Electrification Improvement CX(s) Applied: B5.1, B5.23 Date: 04/25/2012 Location(s): Ohio Offices(s): National Energy Technology Laboratory April 25, 2012 CX-008302: Categorical Exclusion Determination Interstate Electrification Improvement

285

Categorical Exclusion Determinations: National Energy Technology Laboratory  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

28, 2011 28, 2011 CX-006119: Categorical Exclusion Determination Autonomous Inspection of Subsea Facilities (Phase II) CX(s) Applied: B3.6 Date: 06/28/2011 Location(s): Port Fourchon, Louisiana Office(s): Fossil Energy, National Energy Technology Laboratory June 28, 2011 CX-006117: Categorical Exclusion Determination Flooring Improvements CX(s) Applied: B2.1, B2.5 Date: 06/28/2011 Location(s): Morgantown, West Virginia Office(s): Fossil Energy, National Energy Technology Laboratory June 23, 2011 CX-006129: Categorical Exclusion Determination Optical Sensors Laboratory CX(s) Applied: B3.6 Date: 06/23/2011 Location(s): Morgantown, West Virginia Office(s): Fossil Energy, National Energy Technology Laboratory June 23, 2011 CX-006127: Categorical Exclusion Determination Wisconsin Biofuels Retail Availability Improvement Network (BRAIN) -

286

Categorical Exclusion Determinations: Savannah River Operations Office |  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

July 20, 2010 July 20, 2010 CX-003668: Categorical Exclusion Determination Subsurface Soils Exploration for Potential Pit Disassembly and Conversion Project Sandfilter Footprint CX(s) Applied: B3.1 Date: 07/20/2010 Location(s): Aiken, South Carolina Office(s): Savannah River Operations Office July 7, 2010 CX-003670: Categorical Exclusion Determination Improvements to L Area Sidewalks CX(s) Applied: B1.3 Date: 07/07/2010 Location(s): Aiken, South Carolina Office(s): Savannah River Operations Office July 7, 2010 CX-002984: Categorical Exclusion Determination Improvements to L Area Sidewalks CX(s) Applied: B1.3 Date: 07/07/2010 Location(s): Aiken, South Carolina Office(s): Environmental Management, Savannah River Operations Office June 25, 2010 CX-003671: Categorical Exclusion Determination

287

Improving Floating Point Compression  

NLE Websites -- All DOE Office Websites (Extended Search)

Improving Improving Floating Point Compression through Binary Masks Leonardo A. Bautista Gomez Argonne National Laboratory Franck Cappello Argonne National Laboratory Abstract-Modern scientific technology such as particle accel- erators, telescopes and supercomputers are producing extremely large amounts of data. That scientific data needs to be processed using systems with high computational capabilities such as supercomputers. Given that the scientific data is increasing in size at an exponential rate, storing and accessing the data is becoming expensive in both, time and space. Most of this scientific data is stored using floating point representation. Scientific applications executed in supercomputers spend a large amount of CPU cycles reading and writing floating point values, making data compression techniques an interesting way to increase computing efficiency.

288

Improving Services, Effectiveness, and Efficiency at The University of North Carolina at Greensboro  

E-Print Network (OSTI)

1 Improving Services, Effectiveness, and Efficiency at The University of North Carolina of people across the campus) #12;2 Improving Services, Effectiveness, and Efficiency at UNCG Table ......................................................................................................................... 28 C. Organizational Structure

Saidak, Filip

289

Improved vortex reactor system  

DOE Patents (OSTI)

An improved vortex reactor system is described for affecting fast pyrolysis of biomass and Refuse Derived Fuel (RDF) feed materials comprising: a vortex reactor having its axis vertically disposed in relation to a jet of a horizontally disposed steam ejector that impels feed materials from a feeder and solids from a recycle loop along with a motive gas into a top part of said reactor. 12 figs.

Diebold, J.P.; Scahill, J.W.

1995-05-09T23:59:59.000Z

290

Categorical Exclusion Determinations: American Recovery and Reinvestment  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Categorical Exclusion Determinations: American Recovery and Categorical Exclusion Determinations: American Recovery and Reinvestment Act Related Categorical Exclusion Determinations: American Recovery and Reinvestment Act Related Categorical Exclusion Determinations issued for actions related to the the American Recovery and Reinvestment Act of 2009. DOCUMENTS AVAILABLE FOR DOWNLOAD June 28, 2010 CX-002841: Categorical Exclusion Determination Texas Propane Fleet Pilot Program (Summary Categorical Exclusion) CX(s) Applied: A7, B5.1 Date: 06/28/2010 Location(s): Texas Office(s): Energy Efficiency and Renewable Energy, National Energy Technology Laboratory June 25, 2010 CX-003086: Categorical Exclusion Determination Improvement of Access Roads on the Cougar-Thurston Number 1 115-Kilovolt and the Thurston-McKenzie Number 1 115-Kilovolt Transmission Lines

291

NEMS Freight Transportation Module Improvement Study  

Reports and Publications (EIA)

The U.S. Energy Information Administration (EIA) contracted with IHS Global, Inc. (IHS) to analyze the relationship between the value of industrial output, physical output, and freight movement in the United States for use in updating analytic assumptions and modeling structure within the National Energy Modeling System (NEMS) freight transportation module, including forecasting methodologies and processes to identify possible alternative approaches that would improve multi-modal freight flow and fuel consumption estimation.

2015-01-01T23:59:59.000Z

292

Improved Geometrical Scaling at the LHC  

Science Journals Connector (OSTI)

We show that geometrical scaling exhibited by the pT spectra measured by the CMS Collaboration at the LHC is substantially improved if the exponent ? of the saturation scale depends on pT. This dependence is shown to be the same as the dependence of small x exponent of F2 structure function in deep inelastic scattering taken at the scale pT?Q/2.

Michal Praszalowicz

2011-04-05T23:59:59.000Z

293

Improved cycling cryopump  

DOE Patents (OSTI)

The present invention is designed to achieve continuous high efficiency cryopumping of a vacuum vessel by improving upon and combining in a novel way the cryopumping in a novel way the cryopumping methods. The invention consists of a continuous operation cryopump, with movable louvres, with a high efficiency pumping apparatus. The pumping apparatus includes three cryogenic tubes. They are constructed of a substance of high thermal conductivity, such as aluminum and their exterior surfaces are cryogenic condensing surfaces. Through their interior liquid or gaseous helium from two reservoirs can be made to flow, alternately promoting extreme cooling or allowing some warming.

Batzer, T.H.; Call, W.R.

1984-12-04T23:59:59.000Z

294

E-Print Network 3.0 - antibiotics improve chemotactic Sample...  

NLE Websites -- All DOE Office Websites (Extended Search)

research... that this crystallographic work will guide improved structure-based drug design ... Source: Martin, Jan M.L. - Department of Organic Chemistry, Weizmann Institute of...

295

CX-000262: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

62: Categorical Exclusion Determination 62: Categorical Exclusion Determination CX-000262: Categorical Exclusion Determination Ohio City Columbus CX(s) Applied: A1, B5.1 Date: 12/21/2009 Location(s): Columbus, Ohio Office(s): Energy Efficiency and Renewable Energy, Golden Field Office Energy Efficiency and Conservation Block Grant for: Downtown Bike Infrastructure Improvements, Cultural Arts Center Lighting Efficiency Improvements, Central Safety Building Energy Retrofit, Fire Stations High Efficiency Lighting Retrofit, Business Energy Efficiency Revolving Loan Program, Pedestrian Signal Upgrade to LED (light-emitting diode) Technology, Center for Science and Industry Energy Efficiency Improvements, Home Energy Efficiency Baseload Reduction Program, Project Oversight. DOCUMENT(S) AVAILABLE FOR DOWNLOAD

296

Nonlocality improves Deutsch algorithm  

E-Print Network (OSTI)

Recently, [{arXiv:0810.3134}] is accepted and published. We show that the Bell inequalities lead to a new type of linear-optical Deutsch algorithms. We have considered a use of entangled photon pairs to determine simultaneously and probabilistically two unknown functions. The usual Deutsch algorithm determines one unknown function and exhibits a two to one speed up in a certain computation on a quantum computer rather than on a classical computer. We found that the violation of Bell locality in the Hilbert space formalism of quantum theory predicts that the proposed {\\it probabilistic} Deutsch algorithm for computing two unknown functions exhibits at least a $2\\sqrt{2}(\\simeq 2.83)$ to one speed up.

Koji Nagata; Sangkyung Lee; Jaewook Ahn

2007-03-15T23:59:59.000Z

297

Graduate Program Salary Structure  

NLE Websites -- All DOE Office Websites (Extended Search)

Salary Structure Salary Structure Graduate Program Salary Structure Point your career towards LANL: work with the best minds on the planet in an inclusive environment that is rich in intellectual vitality and opportunities for growth. Contact Student Programs (505) 665-8899 Email GRA salary determination process Salaries are determined by evaluating students' current transcripts using the following criteria: Salaries for graduate students are based on completion of 12 credit hours annually for the first two years of a Master's or PhD graduate program (BS+1, BS+2). Salaries are then based on satisfactory progress (minimum of one credit hour) towards degree after the second year of a Master's degree (MS+0 or degree awarded) or PhD program (BS+3, BS+4, BS+5). Professional salary structure

298

RECORD OF CATEGORICAL EXCLUSION DETERMINATION  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Categorical Exclusion for erosion repair and cactus relocation along the existing Tucson-Apache 11S-kV transmission line in Pima County, Arizona RECORD OF CATEGORICAL EXCLUSION DETERMINATION A. Proposed Action: Western proposes to construct a new access road along the existing Tucson-Apache 11S-kV transmission line within the existing right-of-way and to repair erosion damage at transmission line structures. Access road construction will consist of stripping, clearing and removing vegetation and blading and leveling to create a road within the existing right-of-way between structures 24/7-2S/2 & 2S/3- 26/S. We will be installing two gates to limit right-of-way access from Houghton Road. We will be creating reinforced embankments through the placement of

299

RECORD OF CATEGORICAL EXCLUSION DETERMINATION  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

near 10 structure locations along the existing Casa Grande-Empire 115-kV transmission line located in Pinal County, Arizona. RECORD OF CATEGORICAL EXCLUSION DETERMINATION A. Proposed Action: Western proposes to do geologic borings within our right-of-way near structures 18/5, 19/6, 21/2, 2317, 26/4, 28/4, 36/1, 37/5, 39/4 and 41/4 along the existing Casa Grande-ED #5115-kV transmission line. This project involves accessing each bore hole location with a augerldrill rig and light crew trucks, setting up the drill rig, drilling, collecting soil samples and breaking down the drilling setup. Existing access roads and vehicles such as pickup trucks & crew trucks will be used to bring personnel and equipment to the work areas. The attached maps show the project areas situated within Sections 7,20 & 32

300

RECORD OF CATEGORICAL EXCLUSION DETERMINATION  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

upgrading to a upgrading to a double circuit of 3.6 miles of the existing Casa Grande-Empire 11S-kV transmission line located in Pinal County, Arizona RECORD OF CATEGORICAL EXCLUSION DETERMINATION A. Proposed Action: Western proposes to work with Salt River Project on an upgrade to a double circuit on its Casa Grande-Empire 11S-kV transmission line. This project involves the removal of the existing H-frame wooden structures and the installation of new steel monopole structures. This will require auger trucks, bulldozers, bucket trucks and cranes. Existing access roads and the existing right-of-way will be used for vehicles such as pickup trucks, crew trucks, backhoes and bucket trucks to bring personnel and equipment to the work areas. The attached map shows the project area situated within Sections 19, 30 & 31 of

Note: This page contains sample records for the topic "determination improved structure" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


301

RECORD OF CATEGORICAL EXCLUSION DETERMINATION  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

near 9 near 9 structure locations along the existing ED2-ED5 230-kV transmission line located in Pinal County, Arizona RECORD OF CATEGORICAL EXCLUSION DETERMINATION A, Proposed Action: Western proposes to do geologic borings within our right-of-way near structures 21/5,22/5,23/6,25/4,26/5,27/6,28/5,29/5 & 30/4 along the existing ED2-ED5 230-kV transmission line. This project involves accessing each bore hole location with a auger/drill rig and light crew trucks, setting up the drill rig, drilling, collecting soil samples and breaking down the drilling setup. Existing access roads and vehicles such as pickup trucks & crew trucks will be used to bring personnel and equipment to the work areas. The attached maps show the project areas situated within Sections 7, 18, 30 & 31

302

Detecting determinism from point processes  

Science Journals Connector (OSTI)

The detection of a nonrandom structure from experimental data can be crucial for the classification, understanding, and interpretation of the generating process. We here introduce a rank-based nonlinear predictability score to detect determinism from point process data. Thanks to its modular nature, this approach can be adapted to whatever signature in the data one considers indicative of deterministic structure. After validating our approach using point process signals from deterministic and stochastic model dynamics, we show an application to neuronal spike trains recorded in the brain of an epilepsy patient. While we illustrate our approach in the context of temporal point processes, it can be readily applied to spatial point processes as well.

Ralph G. Andrzejak; Florian Mormann; Thomas Kreuz

2014-12-02T23:59:59.000Z

303

CX-005580: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

580: Categorical Exclusion Determination 580: Categorical Exclusion Determination CX-005580: Categorical Exclusion Determination Sidney to Sterling Transmission Line Structure Replacement, Logan County, Colorado CX(s) Applied: B4.6 Date: 12/22/2010 Location(s): Logan County, Colorado Office(s): Western Area Power Administration-Rocky Mountain Region Western proposes to replace approximately 22 existing wood pole H-frame structures along the Sidney to Sterling 115-kilovolt transmission line between the Sterling Substation and Peetz, Colorado. The existing structures would be replaced with structures that are approximately 10 feet taller to ensure proper electrical clearances. The new structures would look nearly identical to the replaced structures. The work includes removing existing structures and hardware, dismantling old structures,

304

Arizona RECORD OF CATEGORICAL EXCLUSION DETERMINATION  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

and structure replacement and structure replacement along the existing Casa Grande-Empire 11~-kV transmission line, Pinal County, Arizona RECORD OF CATEGORICAL EXCLUSION DETERMINATION A. Proposed Action: Western proposes to replace structures and upgrade to a double circuit 230-kV transmission line on its Casa Grande-Empire115-kV transmission line, from Thornton Road to its Empire Substation, within Western's existing right-of-way. This will include the rebuild of 13.2 miles of transmission line, replacing the H-frame structures with steel monopole structures with foundations, hardware and insulator replacement and adding a overhead ground-wire over the entire length of the project. Western will access the structure using crew trucks along the existing access roads. This work is necessary to maintain the safety and reliability of the bulk

305

Categorical Exclusion Determinations: Wisconsin | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Wisconsin Wisconsin Categorical Exclusion Determinations: Wisconsin Location Categorical Exclusion Determinations issued for actions in Wisconsin. DOCUMENTS AVAILABLE FOR DOWNLOAD September 24, 2013 CX-010915: Categorical Exclusion Determination Wisconsin Clean Transportation Program - Conversion of Vehicle to Operate on Compressed Natural Gas CX(s) Applied: B5.1 Date: 09/24/2013 Location(s): Wisconsin Offices(s): National Energy Technology Laboratory August 8, 2013 CX-010807: Categorical Exclusion Determination Biofuels Retail Availability Improvement Network CX(s) Applied: B5.1, B5.22 Date: 08/08/2013 Location(s): Wisconsin Offices(s): National Energy Technology Laboratory July 12, 2013 CX-010623: Categorical Exclusion Determination Wisconsin Clean Transportation Program

306

Categorical Exclusion Determinations: American Recovery and Reinvestment  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

766: Categorical Exclusion Determination 766: Categorical Exclusion Determination Commerce's Capital Asset Energy Efficiency Improvement CX(s) Applied: B2.5, A1, A9, B1.3, B1.4, B5.1 Date: 04/20/2010 Location(s): Commerce, Colorado Office(s): Energy Efficiency and Renewable Energy April 20, 2010 CX-001762: Categorical Exclusion Determination California-City-Petaluma CX(s) Applied: A1, A9, B2.5, B5.1 Date: 04/20/2010 Location(s): Petaluma, California Office(s): Energy Efficiency and Renewable Energy April 20, 2010 CX-001760: Categorical Exclusion Determination California-City-Montebello Energy Efficiency and Conservation Strategy Project CX(s) Applied: A9, A11, B2.5, B5.1 Date: 04/20/2010 Location(s): Montebello City, California Office(s): Energy Efficiency and Renewable Energy April 20, 2010 CX-001754: Categorical Exclusion Determination

307

Categorical Exclusion Determinations: Arizona | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Arizona Arizona Categorical Exclusion Determinations: Arizona Location Categorical Exclusion Determinations issued for actions in Arizona. DOCUMENTS AVAILABLE FOR DOWNLOAD September 13, 2013 CX-010988: Categorical Exclusion Determination High Temperature DC-Bus Capacitors Cost Reduction and Performance Improvements CX(s) Applied: B3.6, B5.15 Date: 09/13/2013 Location(s): Arizona Offices(s): National Energy Technology Laboratory August 22, 2013 CX-010882: Categorical Exclusion Determination Liberty-Parker Dam #2 230-Kilovolt Transmission Line, Optical Power Ground Wire Repair CX(s) Applied: B4.7 Date: 08/22/2013 Location(s): Arizona Offices(s): Western Area Power Administration-Desert Southwest Region August 12, 2013 CX-010883: Categorical Exclusion Determination PHX-LOB and LIB-LOB 230-Kilovolt Double-Circuit- Replace Insulators at

308

Categorical Exclusion Determinations: Indiana | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Indiana Indiana Categorical Exclusion Determinations: Indiana Location Categorical Exclusion Determinations issued for actions in Indiana. DOCUMENTS AVAILABLE FOR DOWNLOAD September 13, 2013 CX-010989: Categorical Exclusion Determination High Temperature DC-Bus Capacitors Cost Reduction and Performance Improvements CX(s) Applied: B3.6, B5.15 Date: 09/13/2013 Location(s): Indiana Offices(s): National Energy Technology Laboratory September 13, 2013 CX-010997: Categorical Exclusion Determination High Performance DC-Bus Capacitors CX(s) Applied: B3.6, B5.15 Date: 09/13/2013 Location(s): New York, Indiana Offices(s): National Energy Technology Laboratory August 7, 2013 CX-010809: Categorical Exclusion Determination New Mechanistic Models of Creep-Fatigue Interactions for Gas Turbine

309

Categorical Exclusion Determinations: Missouri | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Missouri Missouri Categorical Exclusion Determinations: Missouri Location Categorical Exclusion Determinations issued for actions in Missouri. DOCUMENTS AVAILABLE FOR DOWNLOAD August 15, 2013 CX-010751: Categorical Exclusion Determination Solar Ready 2 CX(s) Applied: A9, A11 Date: 08/15/2013 Location(s): Missouri Offices(s): Golden Field Office July 19, 2013 CX-010618: Categorical Exclusion Determination Midwest Region Alternative Fuels Project CX(s) Applied: 0 Date: 07/19/2013 Location(s): Missouri Offices(s): National Energy Technology Laboratory May 22, 2013 CX-010405: Categorical Exclusion Determination Idalia Substation Grounding and Drainage Improvements CX(s) Applied: B4.6 Date: 05/22/2013 Location(s): Missouri Offices(s): Southwestern Power Administration February 14, 2013

310

Composite coatings improve engines  

SciTech Connect

About 40% of the power loss in engine systems is attributed to the adverse effects of friction in reciprocating engine components. Over half of this power loss is caused by friction between pistons, piston rings, and cylinder bores. In addition, engine parts may be attacked by corrosive gasoline substitutes such as liquid propane gas and alcohol/gasoline mixtures. To solve both friction and corrosion problems, Nihon Parkerizing Co. has improved the nickel-phosphorus based ceramic composite (NCC) plating technology that was developed for cylinder bores and pistons by Suzuki Motor Co. in the mid 1970s. Iron and nickel-based composite plating technologies have been investigated since the early 1970s, and a few have been used on small two-stroke motorcycle, outboard marine, snowmobile, and some luxury passenger car engine components. Both nickel- and iron-base plating processes are used on cylinders and pistons because they offer excellent wear and corrosion resistance. Nickel-base films have higher corrosion resistance than those based on iron, and are capable of withstanding the corrosive conditions characteristic of high methanol fuels. Unfortunately, they experience a decrease in hardness as operating temperatures increase. However, NCC coatings with phosphorus additions have high hardness even under severe operating conditions, and hardness increases upon exposure to elevated temperatures. In addition to high hardness and corrosion resistance, NCC coatings provide a low friction coefficient, which contributes to the reduction of friction losses between sliding components. When used in low-quality or alcohol fuels, the corrosion resistance of NCC coatings is far higher than that of Fe-P plating. Additionally, the coatings reduce wall and piston temperature, wear of ring groove and skirt, and carbon deposit formation, and they improve output power and torque. These advantages all contribute to the development of light and efficient engines with better fuel mileage.

Funatani, K.; Kurosawa, K. (Nihon Parkerizing Co. Ltd., Nagoya (Japan))

1994-12-01T23:59:59.000Z

311

Improving the Efficiency of Reasoning Through StructureBased Reformulation #  

E-Print Network (OSTI)

that have overlap in content, and that may even have different reasoning engines. Fur­ thermore, we in this abstract appeared in [2]. 1 In this paper, every set of axioms is a theory (and vice versa). #12; engine pump (4) man f ill # on pump (5) ¬water#¬ok boiler#¬on boiler#steam (6) water # ¬steam (7) ok boiler

Amir, Eyal

312

Improving the Efficiency of Reasoning Through Structure-Based Reformulation  

E-Print Network (OSTI)

that have overlap in content, and that may even have different reasoning engines. Fur- thermore, we in this abstract appeared in [2]. 1 In this paper, every set of axioms is a theory (and vice versa). #12;engine) man fill on pump (5) ¬water¬ok boiler¬on boilersteam (6) water ¬steam (7) ok boiler ¬steam (8

McIlraith, Sheila

313

Lake Improvement District Law and County Lake Improvement Program  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Lake Improvement District Law and County Lake Improvement Program Lake Improvement District Law and County Lake Improvement Program (Minnesota) Lake Improvement District Law and County Lake Improvement Program (Minnesota) < Back Eligibility Utility Fed. Government Commercial Agricultural Investor-Owned Utility State/Provincial Govt Industrial Construction Municipal/Public Utility Local Government Residential Installer/Contractor Rural Electric Cooperative Tribal Government Low-Income Residential Schools Retail Supplier Institutional Multi-Family Residential Systems Integrator Fuel Distributor Nonprofit General Public/Consumer Transportation Savings Category Alternative Fuel Vehicles Hydrogen & Fuel Cells Buying & Making Electricity Water Home Weatherization Solar Wind Program Info State Minnesota Program Type Siting and Permitting Lake Improvement Districts may be established by county boards in order to

314

g-Factor of Heavy Ions: A New Access to the Fine Structure Constant  

SciTech Connect

A possibility for a determination of the fine structure constant in experiments on the bound-electron g-factor is examined. It is found that studying a specific difference of the g-factors of B- and H-like ions of the same spinless isotope in the Pb region to the currently accessible experimental accuracy of 7x10{sup -10} would lead to a determination of the fine structure constant to an accuracy which is better than that of the currently accepted value. Further improvements of the experimental and theoretical accuracy could provide a value of the fine structure constant which is several times more precise than the currently accepted one.

Shabaev, V.M. [Department of Physics, St. Petersburg State University, Oulianovskaya 1, Petrodvorets, St. Petersburg 198504 (Russian Federation); Gesellschaft fuer Schwerionenforschung, Planckstrasse 1, D-64291 Darmstadt (Germany); Glazov, D.A.; Oreshkina, N.S. [Department of Physics, St. Petersburg State University, Oulianovskaya 1, Petrodvorets, St. Petersburg 198504 (Russian Federation); Volotka, A.V. [Department of Physics, St. Petersburg State University, Oulianovskaya 1, Petrodvorets, St. Petersburg 198504 (Russian Federation); Institut fuer Theoretische Physik, TU Dresden, Mommsenstrasse 13, D-01062 Dresden (Germany); Plunien, G. [Institut fuer Theoretische Physik, TU Dresden, Mommsenstrasse 13, D-01062 Dresden (Germany); Kluge, H.-J.; Quint, W. [Gesellschaft fuer Schwerionenforschung, Planckstrasse 1, D-64291 Darmstadt (Germany)

2006-06-30T23:59:59.000Z

315

Requirements for Determining Refrigerant Charge Residential Air Conditioning Measures  

E-Print Network (OSTI)

Requirements for Determining Refrigerant Charge Residential Air Conditioning Measures Improved Refrigerant Charge Purpose Component packages require in some climate zones that split system air refrigerant charge. For the performance method, the proposed design is modeled with less efficiency

316

CX-002529: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

29: Categorical Exclusion Determination 29: Categorical Exclusion Determination CX-002529: Categorical Exclusion Determination Access Road Improvements for Rattlesnake-Garrison Number-1 and Garrison-Anaconda Number-11 Transmission Lines CX(s) Applied: B1.13, B1.3 Date: 05/26/2010 Location(s): Granite County, Montana Office(s): Bonneville Power Administration The proposed project involves improving portions of the existing access road system for the subject transmission lines. Road improvements include blading existing road surfaces, realigning of steep roads to reduce grade, placing and compacting rock surfacing to improve drivability, and installing drainage devices to protect roads from erosion. DOCUMENT(S) AVAILABLE FOR DOWNLOAD CX-002529.pdf More Documents & Publications CX-005675: Categorical Exclusion Determination

317

The high-throughput protein-to-structure pipeline at SECSG  

Science Journals Connector (OSTI)

The high-throughput crystal structure determination pipeline at Southeast Collaboratory for Structural Genomics, a pilot center of the National Institutes of Health Protein Structure Initiative, is described.

Liu, Z.-J.

2005-05-26T23:59:59.000Z

318

A synchroton single crystal X-ray structure determination of (NH4)3Mo4P3O16: A microporous molybdenum phosphate with Mo4O6+4 cubes  

Science Journals Connector (OSTI)

Reaction of MoO3, Mo, (NH4)2HPO4, H3PO4, and H2O in a mole ratio of 1.4:1:3.6:6:120 at 360°C for 16 hr gives a nearly quantitative yield of black cubes of (NH4)3Mo4P3O16 (1). The structure of (1) was solved from data collected on a 30 × 30 × 30 ?m3 crystal at the National Synchrotron Light Source at Brookhaven National Laboratory. The compound is cubic, space group P43m, with a = 7.736(2) Å, and was refined to residuals of R(Rw) = 0.035(0.049). Phosphate (1) is isotypic with Cs3Mo4P3O16 and is related to the iron arsenate mineral pharmacosiderite. Unlike the Cs+ compound, (1) can be rendered microporous by thermal removal of the NH+4 cations to give ammonia with the charge compensating proton remaining behind in the lattice. Water absorption isotherms show the reversible uptake of 5.6 wt% water, which corresponds to over 15 vol% void space in (1) after the NH3 removal. The framework consists of Mo4O6+4 cubes, with six Mo?Mo contacts of 2.570(4) Å, joined together together by (PO4)62 along ?100? to form a 3-D network composed of tetramers of triply edge-sharing Mo-centered octahedra and phosphate groups alternating along all ?100? directions. The windows and cavities in (1) are large enough that the NH+4 cations occupy several different positions in the unit cell.

H.E. King Jr.; Linda A. Mundi; Karl G. Strohmaier; Robert C. Haushalter

1991-01-01T23:59:59.000Z

319

CONFORMANCE IMPROVEMENT USING GELS  

SciTech Connect

This report describes work performed during the third and final year of the project, ''Conformance Improvement Using Gels.'' Corefloods revealed throughput dependencies of permeability reduction by polymers and gels that were much more prolonged during oil flow than water flow. This behavior was explained using simple mobility ratio arguments. A model was developed that quantitatively fits the results and predicts ''clean up'' times for oil productivity when production wells are returned to service after application of a polymer or gel treatment. X-ray computed microtomography studies of gels in strongly water-wet Berea sandstone and strongly oil-wet porous polyethylene suggested that oil penetration through gel-filled pores occurs by a gel-dehydration mechanism, rather than gel-ripping or gel-displacement mechanisms. In contrast, analysis of data from the University of Kansas suggests that the gel-ripping or displacement mechanisms are more important in more permeable, strongly water-wet sandpacks. These findings help to explain why aqueous gels can reduce permeability to water more than to oil under different conditions. Since cement is the most commonly used material for water shutoff, we considered when gels are preferred over cements. Our analysis and experimental results indicated that cement cannot be expected to completely fill (top to bottom) a vertical fracture of any width, except near the wellbore. For vertical fractures with apertures less than 4 mm, the cement slurry will simply not penetrate very far into the fracture. For vertical fractures with apertures greater than 4 mm, the slurry may penetrate a substantial distance into the bottom part of the fracture. However, except near the wellbore, the upper part of the fracture will remain open due to gravity segregation. We compared various approaches to plugging fractures using gels, including (1) varying polymer content, (2) varying placement (extrusion) rate, (3) using partially formed gels, (4) using combinations of high and low molecular weight (Mw) polymers, (5) using secondary crosslinking reactions, (6) injecting un-hydrated polymer particles, and (7) incorporating particulates. All of these methods showed promise in some aspects, but required performance improvements in other aspects. All materials investigated to date showed significant performance variations with fracture width. High pressure gradients and limited distance of penetration are common problems in tight fractures. Gravity segregation and low resistance to breaching are common problems in wide fractures. These will be key issues to address in future work. Although gels can exhibit disproportionate permeability reduction in fractures, the levels of permeability reduction for oil flow are too high to allow practical exploitation in most circumstances. In contrast, disproportionate permeability reduction provided by gels that form in porous rock (adjacent to the fractures) has considerable potential in fractured systems.

Randall S. Seright

2004-09-30T23:59:59.000Z

320

Draft General Conformity Determination  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

I I Draft General Conformity Determination U.S. Department of the Interior Minerals Management Service MMS Cape Wind Energy Project January 2009 Final EIS Appendix I Draft General Conformity Determination Draft General Conformity Determination Cape Wind Energy Project Prepared by Minerals Management Service Herndon, VA November 2008 i TABLE OF CONTENTS 1.0 INTRODUCTION TO THE PROPOSED ACTION............................................................... 1 2.0 GENERAL CONFORMITY REGULATORY BACKGROUND .......................................... 2 2.1 GENERAL CONFORMITY REQUIREMENTS.................................................................... 2 2.2 GENERAL CONFORMITY APPLICABILITY.....................................................................

Note: This page contains sample records for the topic "determination improved structure" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


321

Tevatron improvement program  

SciTech Connect

A modest Tevatron improvement program is suggested which would provide a storage ring for dedicated use as a p anti p collider at 2 TeV (cm) and as an ep collider at 0.2 TeV (cm). It could also serve as a useful test facility for some of the new developments necessary for an economical SSC. Because use could be made of utilities and facilities that are already installed as part of the tevatron, the cost of the p anti p option might be about 100 million dollars (not including the interaction halls or detectors). The additional cost of a 10 x 1000 GeV' ep option might be about 70 million dollars. The experimental facilities at B and D of the Tevatron might be extended for use with the new collider. As the technology of superconducting magnets develops, the cm energy of the p anti p and the ep colliders might be doubled. The intention is either to double the capability of TeV I and TeV II, or to extend the capability by addition of an ep facility. Alternatively, by adding another proton ring, a high luminosity pp facility might also result.

Wilson, R.R.

1983-07-01T23:59:59.000Z

322

CX-010326: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

6: Categorical Exclusion Determination 6: Categorical Exclusion Determination CX-010326: Categorical Exclusion Determination F-08 Outfall Access Improvement CX(s) Applied: B3.1 Date: 04/11/2013 Location(s): South Carolina Offices(s): Savannah River Operations Office F-Area and EC&ACP personnel are working to improve the sample location for F-08 to accomplish several things: 1) Improve the safety of taking samples during or shortly after a significant rain event. 2) Replace the weir currently used in taking measurements. This weir is improperly installed and does not work well over the broad range of flows experienced at this sample location. A new system is required. CX-010326.pdf More Documents & Publications CX-010020: Categorical Exclusion Determination CX-009083: Categorical Exclusion Determination

323

CONFORMANCE IMPROVEMENT USING GELS  

SciTech Connect

This report describes work performed during the second year of the project, ''Conformance Improvement Using Gels.'' The project has two objectives. The first objective is to identify gel compositions and conditions that substantially reduce flow through fractures that allow direct channeling between wells, while leaving secondary fractures open so that high fluid injection and production rates can be maintained. The second objective is to optimize treatments in fractured production wells, where the gel must reduce permeability to water much more than that to oil. Pore-level images from X-ray computed microtomography were re-examined for Berea sandstone and porous polyethylene. This analysis suggests that oil penetration through gel-filled pores occurs by a gel-dehydration mechanism, rather than a gel-ripping mechanism. This finding helps to explain why aqueous gels can reduce permeability to water more than to oil. We analyzed a Cr(III)-acetate-HPAM gel treatment in a production well in the Arbuckle formation. The availability of accurate pressure data before, during, and after the treatment was critical for the analysis. After the gel treatment, water productivity was fairly constant at about 20% of the pre-treatment value. However, oil productivity was stimulated by a factor of 18 immediately after the treatment. During the six months after the treatment, oil productivity gradually decreased to approach the pre-treatment value. To explain this behavior, we proposed that the fracture area open to oil flow was increased substantially by the gel treatment, followed by a gradual closing of the fractures during subsequent production. For a conventional Cr(III)-acetate-HPAM gel, the delay between gelant preparation and injection into a fracture impacts the placement, leakoff, and permeability reduction behavior. Formulations placed as partially formed gels showed relatively low pressure gradients during placement, and yet substantially reduced the flow capacity of fractures (with widths from 1 to 4 mm) during brine and oil flow after placement. Regardless of gel age before placement, very little gel washed out from the fractures during brine or oil flow. However, increased brine or oil flow rate and cyclic injection of oil and water significantly decreased the level of permeability reduction. A particular need exists for gels that can plug large apertures (e.g., wide fractures and vugs). Improved mechanical strength and stability were demonstrated (in 1- to 4-mm-wide fractures) for a gel that contained a combination of high- and low-molecular weight polymers. This gel reduced the flow capacity of 2- and 4-mm-wide fractures by 260,000. In a 1-mm-wide fracture, it withstood 26 psi/ft without allowing any brine flow through the fracture. Cr(III)-acetate-HPAM gels exhibited disproportionate permeability reduction in fractures. The effect was most pronounced when the gel was placed as gelant or partially formed gels. The effect occurred to a modest extent with concentrated gels and with gels that were ''fully formed'' when placed. The effect was not evident in tubes. We explored swelling polymers for plugging fractures. Polymer suspensions were quickly prepared and injected. In concept, the partially dissolved polymer would lodge and swell to plug the fracture. For three types of swelling polymers, behavior was promising. However, additional development is needed before their performance will be superior to that of conventional gels.

Randall S. Seright

2003-09-01T23:59:59.000Z

324

Improving CS regulations.  

SciTech Connect

President Carter issued Executive Order 12044 (3/28/78) that required all Federal agencies to distinguish between significant and insignificant regulations, and to determine whether a regulation will result in major impacts. This study gathered information on the impact of the order and the guidelines on the Office of Conservation and Solar Energy (CS) regulatory practices, investigated problems encountered by the CS staff when implementing the order and guidelines, and recommended solutions to resolve these problems. Major tasks accomplished and discussed are: (1) legislation, Executive Orders, and DOE Memoranda concerning Federal administrative procedures relevant to the development and analysis of regulations within CS reviewed; (2) relevant DOE Orders and Memoranda analyzed and key DOE and CS staff interviewed in order to accurately describe the current CS regulatory process; (3) DOE staff from the Office of the General Counsel, the Office of Policy and Evaluation, the Office of the Environment, and the Office of the Secretary interviewed to explore issues and problems encountered with current CS regulatory practices; (4) the regulatory processes at five other Federal agencies reviewed in order to see how other agencies have approached the regulatory process, dealt with specific regulatory problems, and responded to the Executive Order; and (5) based on the results of the preceding four tasks, recommendations for potential solutions to the CS regulatory problems developed. (MCW)

Nesse, R.J.; Scheer, R.M.; Marasco, A.L.; Furey, R.

1980-10-01T23:59:59.000Z

325

Structural optimization strategies to design green products  

Science Journals Connector (OSTI)

This paper addresses the need for a structured approach to environmental assessment and improvement. We propose a computer-aided methodology, named Eco-OptiCAD, based on the integration of Structural Optimization and Life Cycle Assessment (LCA) tools. ... Keywords: CAE, Eco-design, LCA, Structural optimization

Davide Russo, Caterina Rizzi

2014-04-01T23:59:59.000Z

326

Structure-Soil-Structure Interaction Effects: Seismic Analysis of Safety-Related Collocated Structures  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

STRUCTURE-SOIL- STRUCTURE-SOIL- STRUCTURE INTERACTION AT SRS Structural Mechanics - SRS October 25, 2011 1 Objective Determination of Structure Soil Structure Interaction (SSSI) effects, if any between large and more massive Process Building (PB) and Exhaust Fan Building (EFB). Results of the SSSI analysis were compared with those from Soil Structure Interaction (SSI) analysis of the individual buildings, for the following parameters: * In-structure floor response spectra (ISRS) * Transfer functions * Relative displacements for EFB and PB * In-plane- shear from SASSI at EFB wall 2 Building Description 3 The Process Building is a massive reinforced concrete structure supported approximately 40 feet below the finished grade. The PB approximate foundation dimensions are approximately

327

Categorical Exclusion Determinations: Maine | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Maine Maine Categorical Exclusion Determinations: Maine Location Categorical Exclusion Determinations issued for actions in Maine. DOCUMENTS AVAILABLE FOR DOWNLOAD February 4, 2013 CX-010231: Categorical Exclusion Determination Hywind Maine CX(s) Applied: A9, B3.1, B3.6 Date: 02/04/2013 Location(s): Maine Offices(s): Golden Field Office January 17, 2013 CX-009915: Categorical Exclusion Determination The University of Maine's "New England Aqua Ventus I" Program CX(s) Applied: A9, B3.6 Date: 01/17/2013 Location(s): Maine Offices(s): Golden Field Office November 5, 2012 CX-009425: Categorical Exclusion Determination Partial Validation of Coupled Models and Optimization of Materials for Offshore Wind Structures CX(s) Applied: B3.3, B3.16, B5.18 Date: 11/05/2012 Location(s): Maine

328

Categorical Exclusion Determinations: Nebraska | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Nebraska Nebraska Categorical Exclusion Determinations: Nebraska Location Categorical Exclusion Determinations issued for actions in Nebraska. DOCUMENTS AVAILABLE FOR DOWNLOAD August 20, 2013 CX-010891: Categorical Exclusion Determination Archer-Stegall 230-Kilovolt Fiber Optic Ground Wire Addition CX(s) Applied: B4.7 Date: 08/20/2013 Location(s): Nebraska, Nebraska Offices(s): Western Area Power Administration-Rocky Mountain Region August 8, 2013 CX-010887: Categorical Exclusion Determination Archer-Sidney 115-Kilovolt Transmission Line Structure Replacement CX(s) Applied: B4.13 Date: 08/08/2013 Location(s): Nebraska Offices(s): Western Area Power Administration-Rocky Mountain Region June 4, 2013 CX-010549: Categorical Exclusion Determination Chappell, Julesburg, and Kersey Tap Line Switch Replacements in Deuel

329

Categorical Exclusion Determinations: Southwestern Power Administration |  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Southwestern Power Southwestern Power Administration Categorical Exclusion Determinations: Southwestern Power Administration Categorical Exclusion Determinations issued by Southwestern Power Administration. DOCUMENTS AVAILABLE FOR DOWNLOAD August 6, 2013 CX-010879: Categorical Exclusion Determination Transmission Line 3005, Structure 290 Replacement CX(s) Applied: B4.6 Date: 08/06/2013 Location(s): Oklahoma Offices(s): Southwestern Power Administration July 25, 2013 CX-010880: Categorical Exclusion Determination Transmission Line 3016, Access Road Acquisition Project CX(s) Applied: B1.24 Date: 07/25/2013 Location(s): Oklahoma Offices(s): Southwestern Power Administration July 22, 2013 CX-010716: Categorical Exclusion Determination Short Mountain Access Road Easement Acquisition CX(s) Applied: B1.24

330

Categorical Exclusion Determinations: Bonneville Power Administration |  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

December 27, 2012 December 27, 2012 CX-009701: Categorical Exclusion Determination Williams Northwest Pipeline Land Use Review Request CX(s) Applied: B4.9 Date: 12/27/2012 Location(s): Washington Offices(s): Bonneville Power Administration December 27, 2012 CX-009700: Categorical Exclusion Determination Finely Creek and North Valley Creek Property Funding CX(s) Applied: B1.25 Date: 12/27/2012 Location(s): Montana, Montana Offices(s): Bonneville Power Administration December 21, 2012 CX-009702: Categorical Exclusion Determination Columbia Rural Electric Association Walla Walla Hydroelectric Project CX(s) Applied: B4.1 Date: 12/21/2012 Location(s): Washington Offices(s): Bonneville Power Administration December 19, 2012 CX-009703: Categorical Exclusion Determination Improve the Access Road System in Miles 4, 5, 16, 17, 18, and 30 of the

331

Categorical Exclusion Determinations: National Energy Technology Laboratory  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

8, 2010 8, 2010 CX-004409: Categorical Exclusion Determination Petroleum Processing Efficiency Improvement CX(s) Applied: B3.6 Date: 11/08/2010 Location(s): Laramie, Wyoming Office(s): Fossil Energy, National Energy Technology Laboratory November 8, 2010 CX-004408: Categorical Exclusion Determination ArmorBelt Single Point Gas Lift System for Stripper Wells CX(s) Applied: B3.7 Date: 11/08/2010 Location(s): Haskell County, Oklahoma Office(s): Fossil Energy, National Energy Technology Laboratory November 8, 2010 CX-004407: Categorical Exclusion Determination ArmorBelt Single Point Gas Lift System for Stripper Wells CX(s) Applied: B3.7 Date: 11/08/2010 Location(s): Pittsburg County, Oklahoma Office(s): Fossil Energy, National Energy Technology Laboratory November 8, 2010 CX-004406: Categorical Exclusion Determination

332

Categorical Exclusion Determinations: Idaho | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

December 19, 2012 December 19, 2012 CX-009703: Categorical Exclusion Determination Improve the Access Road System in Miles 4, 5, 16, 17, 18, and 30 of the Lower Granite-Hatwai Transmission Line CX(s) Applied: B1.3, B1.13 Date: 12/19/2012 Location(s): Washington, Idaho Offices(s): Bonneville Power Administration December 17, 2012 CX-009790: Categorical Exclusion Determination National Oceanic and Atmospheric Administration (NOAA) Birch Creek Canyon Wind Study CX(s) Applied: B3.1 Date: 12/17/2012 Location(s): Idaho Offices(s): Idaho Operations Office December 15, 2012 CX-009635: Categorical Exclusion Determination INTEC - U-233 Waste Stream Disposition CX(s) Applied: NO CX GIVEN Date: 12/15/2012 Location(s): Idaho Offices(s): Idaho Operations Office December 5, 2012 CX-009634: Categorical Exclusion Determination

333

Categorical Exclusion Determinations: Wisconsin | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

December 29, 2011 December 29, 2011 CX-007575: Categorical Exclusion Determination PY2011 State Energy Program Formula - Compressed Natural Gas Infrastructure Challenge: Madison Gas and Electric CX(s) Applied: B5.22 Date: 12/29/2011 Location(s): Wisconsin Offices(s): Golden Field Office December 21, 2011 CX-007436: Categorical Exclusion Determination Whey Waste to Energy - GreenWhey Energy, LLC CX(s) Applied: A9, A11 Date: 12/21/2011 Location(s): Wisconsin Offices(s): Golden Field Office December 20, 2011 CX-007459: Categorical Exclusion Determination Significant Cost Improvement of Lithium-Ion Cells CX(s) Applied: B5.1 Date: 12/20/2011 Location(s): California, Michigan, Wisconsin, Oregon Offices(s): National Energy Technology Laboratory November 30, 2011 CX-007691: Categorical Exclusion Determination

334

Improved Membrane Materials for PEM Fuel Cell Application  

SciTech Connect

The overall goal of this project is to collect and integrate critical structure/property information in order to develop methods that lead to significant improvements in the durability and performance of polymer electrolyte membrane fuel cell (PEMFC) materials. This project is focused on the fundamental improvement of PEMFC membrane materials with respect to chemical, mechanical and morphological durability as well as the development of new inorganically-modified membranes.

Kenneth A. Mauritz; Robert B. Moore

2008-06-30T23:59:59.000Z

335

CONFORMANCE IMPROVEMENT USING GELS  

SciTech Connect

This technical progress report describes work performed from September 1, 2003, through February 29, 2004, for the project, ''Conformance Improvement Using Gels.'' We examined the properties of several ''partially formed'' gels that were formulated with a combination of high and low molecular weight HPAM polymers. After placement in 4-mm-wide fractures, these gels required about 25 psi/ft for brine to breach the gel (the best performance to date in fractures this wide). After this breach, stabilized residual resistance factors decreased significantly with increased flow rate. Also, residual resistance factors were up to 9 times greater for water than for oil. Nevertheless, permeability reduction factors were substantial for both water and oil flow. Gel with 2.5% chopped fiberglass effectively plugged 4-mm-wide fractures if a 0.5-mm-wide constriction was present. The ability to screen-out at a constriction appears crucial for particulate incorporation to be useful in plugging fractures. In addition to fiberglass, we examined incorporation of polypropylene fibers into gels. Once dispersed in brine or gelant, the polypropylene fibers exhibited the least gravity segregation of any particulate that we have tested to date. In fractures with widths of at least 2 mm, 24-hr-old gels (0.5% high molecular weight HPAM) with 0.5% fiber did not exhibit progressive plugging during placement and showed extrusion pressure gradients similar to those of gels without the fiber. The presence of the fiber roughly doubled the gel's resistance to first breach by brine flow. The breaching pressure gradients were not as large as for gels made with high and low molecular weight polymers (mentioned above). However, their material requirements and costs (i.e., polymer and/or particulate concentrations) were substantially lower than for those gels. A partially formed gel made with 0.5% HPAM did not enter a 0.052-mm-wide fracture when applying a pressure gradient of 65 psi/ft. This result suggests a lower limit of fracture width for entry of formed or partially formed gels (when reasonable pressure gradients are applied). In unfractured porous rock, we investigated the time dependence of oil and water permeabilities during various cycles of oil and water injection after placement of a Cr(III)-acetate-HPAM gel. Permeability to water stabilized rapidly (within 1 pore volume, PV), while permeability to oil stabilized gradually over the course of 100 PV. The behavior was surprisingly insensitive to core material (strongly water-wet Berea sandstone and strongly oil-wet porous polyethylene), core permeability (740 to 10,000 md), and applied pressure gradient (10 to 100 psi/ft).

Randall S. Seright

2004-03-01T23:59:59.000Z

336

Nanolubricants to Improve Chiller Performance  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Nanolubricants to Improve Chiller Nanolubricants to Improve Chiller Performance Mark Kedzierski NIST MAK@NIST.GOV 301 975 5282 April 3, 2013 2 | Building Technologies Office eere.energy.gov Purpose & Objectives Problem Statement: Enabling technology for improving the efficiency of chillers that cool large buildings with nanolubricants. (Nanolubricants are not currently used in chillers.) Develop fundamental understanding of how nanolubricants enhance refrigerant/nanolubricant. What nanoparticle size,

337

Improve Your Boiler's Combustion Efficiency  

SciTech Connect

This revised ITP tip sheet on boiler combustion efficiency provides how-to advice for improving industrial steam systems using low-cost, proven practices and technologies.

Not Available

2006-01-01T23:59:59.000Z

338

Improving Design with Agents, Improving Agents by Design  

E-Print Network (OSTI)

DCB 1 WPI Improving Design with Agents, or, Improving Agents by Design David C. Brown AI in Design ASSUMPTION Ã? Assume that the design environment is built using agents. i.e., situated, autonomous, flexible Ã?'s future design and synthesis environment will be built as a real multi-agent system. In what follows, we

Brown, David C.

339

Visible structures  

E-Print Network (OSTI)

All architecture is the interplay between structure, surface and ornament. Traditionally, ornament adorned structure thereby giving it its meaning. A society with its intellectual foundations resting in faith or the abstract ...

Conway, Helene Marie

1991-01-01T23:59:59.000Z

340

Structural biology  

Science Journals Connector (OSTI)

...systematic attempt to 1980 K. C. Holmes Structural biology...structural genomics (Shapiro & Lima 1998). The purpose...Rosenbaum, G., Holmes, K. C. & Witz, J. 1971 Synchrotron...95, 13 585^13590. Shapiro, L. & Lima, C. D. 1998 The Argonne...

1999-01-01T23:59:59.000Z

Note: This page contains sample records for the topic "determination improved structure" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


341

Hydrocarbon saturation determination using acoustic velocities obtained through casing  

DOE Patents (OSTI)

Compressional and shear velocities of earth formations are measured through casing. The determined compressional and shear velocities are used in a two component mixing model to provides improved quantitative values for the solid, the dry frame, and the pore compressibility. These are used in determination of hydrocarbon saturation.

Moos, Daniel (Houston, TX)

2010-03-09T23:59:59.000Z

342

Categorical Exclusion Determinations: Western Area Power  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

March 29, 2012 March 29, 2012 CX-008407: Categorical Exclusion Determination Terry Ranch Road Substation CX(s) Applied: B1.24, B4.11 Date: 03/29/2012 Location(s): Wyoming Offices(s): Western Area Power Administration-Rocky Mountain Region March 29, 2012 CX-008403: Categorical Exclusion Determination Multiple Structure Replacement Flaming Gorge to Vernal No. 1 138 Kilovolt Transmission Line CX(s) Applied: B1.3 Date: 03/29/2012 Location(s): Utah Offices(s): Western Area Power Administration-Rocky Mountain Region March 29, 2012 CX-008399: Categorical Exclusion Determination Erosion Control Measures Structure No. 110-3 Dave Johnston to Stegall 230 Kilovolt Transmission Line CX(s) Applied: B1.3 Date: 03/29/2012 Location(s): Wyoming Offices(s): Western Area Power Administration-Rocky Mountain Region

343

Categorical Exclusion Determinations: Louisiana | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

August 16, 2012 August 16, 2012 CX-008862: Categorical Exclusion Determination Variable Frequency Drivers for Raw Water Intake Structure Pumps Government Furnished Equipment CX(s) Applied: B1.3 Date: 08/16/2012 Location(s): Texas, Texas, Louisiana Offices(s): Strategic Petroleum Reserve Field Office August 14, 2012 CX-008863: Categorical Exclusion Determination Dredging of the West Hackberry Raw Water Intake Structure CX(s) Applied: B1.3 Date: 08/14/2012 Location(s): Louisiana Offices(s): Strategic Petroleum Reserve Field Office July 26, 2012 CX-008866: Categorical Exclusion Determination Install Power Metering for Strategic Petroleum Reserve Site Buildings CX(s) Applied: B1.31 Date: 07/26/2012 Location(s): Louisiana, Texas, Texas, Louisiana Offices(s): Strategic Petroleum Reserve Field Office

344

Categorical Exclusion Determinations: Western Area Power  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

March 11, 2010 March 11, 2010 CX-007156: Categorical Exclusion Determination New Waddell-Raceway-Westwing Structure Replacement CX(s) Applied: B4.6, B4.13 Date: 03/11/2010 Location(s): Maricopa County, Arizona Office(s): Western Area Power Administration-Desert Southwest Region February 18, 2010 CX-007167: Categorical Exclusion Determination Rogers-Coolidge Danger Tree Removal CX(s) Applied: B1.3 Date: 02/18/2010 Location(s): Pinal County, Arizona Office(s): Western Area Power Administration-Desert Southwest Region December 31, 2009 CX-001121: Categorical Exclusion Determination Transmission Line Structure Relocation of Existing Oracle-Tucson 115-kilovolt Transmission Line CX(s) Applied: B4.13 Date: 12/31/2009 Location(s): Pima County, Arizona Office(s): Western Area Power Administration-Desert Southwest Region

345

Interim Action Determination  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Interim Action Determination Interim Action Determination Processing of Plutonium Materials from the DOE Standard 3013 Surveillance Program in H-Canyon at the Savannah River Site The Department of Energy (DOE) is preparing the Surplus Plutonium Disposition Supplemental Environmental Impact Statement (SPD SEIS, DOE/EIS-0283-S2). DOE is evaluating alternatives for disposition of non-pit plutonium that is surplus to the national

346

Determining Electric Motor Load and Efficiency  

Energy.gov (U.S. Department of Energy (DOE))

To compare the operating costs of an existing standard motor with an appropriately-sized energy-efficient replacement, you need to determine operating hours, efficiency improvement values, and load. Part-load is a term used to describe the actual load served by the motor as compared to the rated full-load capability of the motor. Motor part-loads may be estimated through using input power, amperage, or speed measurements. This fact sheet briefly discusses several load estimation techniques.

347

Determination of Asphaltenes in Crude Oil and Petroleum Products by the on Column Precipitation Method  

Science Journals Connector (OSTI)

Determination of Asphaltenes in Crude Oil and Petroleum Products by the on Column Precipitation Method ... An improved analytical method for the determination of asphaltene content in crude oils and petroleum products was developed. ... Composition of heavy petroleums. ...

Estrella Rogel; Cesar Ovalles; Michael E. Moir; John F. Schabron

2009-08-14T23:59:59.000Z

348

CX-010246: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

246: Categorical Exclusion Determination 246: Categorical Exclusion Determination CX-010246: Categorical Exclusion Determination South Table Mountain Denver West Parkway Improvements CX(s) Applied: A9, B1.33 Date: 03/21/2013 Location(s): Colorado Offices(s): Golden Field Office The U.S. Department of Energy (DOE) is proposing improvements to existing transportation infrastructure at the National Renewable Energy Laboratory South Table Mountain campus located in Golden, Colorado. The purpose of the proposed Denver West Parkway Improvements project would be to enhance the safety of vehicles and pedestrians on the site by replacing pavement damaged by construction activities and normal site traffic and would provide enhanced surfacing and signage to improve safety for bicycles and pedestrians. CX-010246.pdf

349

CX-004738: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

38: Categorical Exclusion Determination 38: Categorical Exclusion Determination CX-004738: Categorical Exclusion Determination Improved Photovoltaic Thermal Panel (IPVT) CX(s) Applied: B3.6, B3.11 Date: 11/08/2010 Location(s): New Mexico Office(s): Sandia Site Office Sandia National Laboratories/New Mexico (SNL/NM) proposes to develop a prototype for an improved radiation detection panel. The constructed radiation detection panel would be approximately 6.5 feet (ft) tall, 3 ft wide, and approximately 10 inches (in.) deep. Each Improved Photovoltaic Thermal Panel (IPVT) detector would be about twice as thick (4 inches [in.]) as existing Photovoltaic Thermal (PVT) detectors, to improve the efficiency for gamma-ray detection, which is particularly important for high-energy gamma rays. A single 3-in.-diameter photomultiplier tube (PMT)

350

CX-002103: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

103: Categorical Exclusion Determination 103: Categorical Exclusion Determination CX-002103: Categorical Exclusion Determination Energy Improvements To Wastewater Treatment CX(s) Applied: B2.5, B1.3, B5.1 Date: 04/20/2010 Location(s): Rutland, Vermont Office(s): Energy Efficiency and Renewable Energy As part of an ongoing effort to reduce the amount of energy required to treat wastewater in the City of Rutland, the City proposes to use the funds set aside for Rutland City in the Energy Efficiency and Conservation Block Grant program to make an improvement to the wastewater treatment plant aeration system. The proposed improvement is the replacement of a positive displacement blower with a turbo blower which will in turn improve the aeration system. DOCUMENT(S) AVAILABLE FOR DOWNLOAD CX-002103.pdf

351

Petroleum Reduction Strategies to Improve Vehicle Fuel Efficiency |  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Improve Vehicle Fuel Efficiency Improve Vehicle Fuel Efficiency Petroleum Reduction Strategies to Improve Vehicle Fuel Efficiency October 7, 2013 - 11:53am Addthis YOU ARE HERE: Step 3 For reducing greenhouse gas emissions, the table below describes petroleum reduction strategies to improve vehicle fuel efficiency, as well as guidance and best practices for each strategy. Table 1. Determining When and How to Promote the Use of Strategies to Improve Fuel Efficiency Strategy When Applicable Best Practices Acquiring higher fuel economy vehicles Applicable to all types of vehicles, regardless of ownership or vehicle and fuel type Mission and geographical (e.g., terrain, climate) constraints should be evaluated when acquiring new vehicles Use a VAM to ensure vehicles are right-sized to their intended mission.

352

CX-008738: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

8: Categorical Exclusion Determination 8: Categorical Exclusion Determination CX-008738: Categorical Exclusion Determination Determination of Microstructure and Chemical State Changes in Ion-Irradiated Fuels and Structural Components with a High Kinetic Energy Electron Detector - Illinois Institute of Technology CX(s) Applied: B3.6 Date: 05/22/2012 Location(s): Idaho Offices(s): Idaho Operations Office The Illinois Institute of Technology will purchase a High Kinetic Energy (HiKE) instrument for measuring the structural and chemical changes in ion-irradiated fuels and structural materials for verification of radiation damage models. Microsoft Word - DOE-ID-12-026 Illinois Tech.doc More Documents & Publications CX-009035: Categorical Exclusion Determination CX-007758: Categorical Exclusion Determination

353

CX-008400: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

CX-008400: Categorical Exclusion Determination CX-008400: Categorical Exclusion Determination CX-008400: Categorical Exclusion Determination Estes Park to Mary's Lake West 115 Kilovolt Transmission Line Structure Replacement CX(s) Applied: B1.3 Date: 05/02/2012 Location(s): Colorado Offices(s): Western Area Power Administration-Rocky Mountain Region Western Area Power Administration (Western) proposes to replace two existing wood H-frame structures along the Estes Park to Mary's Lake West 115 kilovolt transmission line. The structures are located on private land near the community of Mary's Lake in Larimer County, Colorado. CX-008400.pdf More Documents & Publications CX-008386: Categorical Exclusion Determination CX-008381: Categorical Exclusion Determination CX-008389: Categorical Exclusion Determination

354

Undergraduate Program Salary Structure  

NLE Websites -- All DOE Office Websites (Extended Search)

Salary Structure Salary Structure Undergraduate Program Salary Structure Point your career towards LANL: work with the best minds on the planet in an inclusive environment that is rich in intellectual vitality and opportunities for growth. Contact Student Programs (505) 665-8899 Email Undergraduate salary determination process Salaries are evaluated from students' current transcripts based on college academic progression and hours completed in a degree program. Administrative/professional structure Years Description Yearly Hourly HS +0 HS grad & acceptance to college $20,900/yr $10.05/hr HS +1 Completion of first year and minimum of 24 semester hours $24,560/yr $11.81/hr HS +2 Completion of second year and minimum of 48 semester hours (salary cap for students pursuing an Associate's Degree) $27,540/yr $13.24/hr

355

CX-001014: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

4: Categorical Exclusion Determination 4: Categorical Exclusion Determination CX-001014: Categorical Exclusion Determination A Measurement - Management Technology for Improving Energy Efficiency in Data Centers and Telecommunication Facilities Date: 03/02/2010 Location(s): New York Office(s): Energy Efficiency and Renewable Energy, Golden Field Office International Business Machines (IBM) Corporation, T. J. Watson Research Center and the Georgia Institute of Technology is proposing to use American Recovery and Reinvestment Act funding through Department of Energy to develop a software tool and the underlying technology components to provide critical decision support and controls for data center and telecommunication facilities operations to improve energy efficiency. DOCUMENT(S) AVAILABLE FOR DOWNLOAD

356

CX-004383: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

83: Categorical Exclusion Determination 83: Categorical Exclusion Determination CX-004383: Categorical Exclusion Determination Pine Hall Brick Company Energy Efficiency Improvements for Lighting, Kiln and Heating, Ventilation, and Air Conditioning Systems CX(s) Applied: B5.1 Date: 11/02/2010 Location(s): North Carolina Office(s): Energy Efficiency and Renewable Energy, National Energy Technology Laboratory Involves installing more efficient lighting, replacing old heating, ventilation, and air conditioning systems, upgrading kiln pressure controls, and changing operational processes, to increase energy efficiency and reduce energy needs. DOCUMENT(S) AVAILABLE FOR DOWNLOAD CX-004383.pdf More Documents & Publications CX-001793: Categorical Exclusion Determination CX-000382: Categorical Exclusion Determination

357

CX-000181: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

1: Categorical Exclusion Determination 1: Categorical Exclusion Determination CX-000181: Categorical Exclusion Determination Florida County Escambia CX(s) Applied: A9, A11, B5.1 Date: 11/11/2009 Location(s): Escambia County, Florida Office(s): Energy Efficiency and Renewable Energy, Golden Field Office Energy Efficiency and Conservation Block Grant for: MC Blanchard Judicial Center and Old Courthouse Block Office Complex Energy Efficiency Improvement Project (EEIP), Road Prison Geothermal Earth Coupled Heating, Ventilating, and Air Conditioning Upgrade, Landfill Gas Extraction and Control System Modernization & Expansion. DOCUMENT(S) AVAILABLE FOR DOWNLOAD CX-000181.pdf More Documents & Publications CX-000180: Categorical Exclusion Determination CX-001843: Categorical Exclusion Determination

358

CX-002921: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

21: Categorical Exclusion Determination 21: Categorical Exclusion Determination CX-002921: Categorical Exclusion Determination Professional Design Services for Oak Park Village Hall Lighting Improvements CX(s) Applied: B2.2, A1, B5.1 Date: 07/07/2010 Location(s): Oak Park, Illinois Office(s): Energy Efficiency and Renewable Energy Energy Efficiency and Conservation Block Grant Program. This funding will be used to fund Professional Design Services for Oak Park Village Hall Lighting Improvements engineering documents for a Village Hall lighting retrofit project. The improvements shall include replacing the existing lighting fixtures with energy efficient fixtures and associated equipment, including motion sensors. DOCUMENT(S) AVAILABLE FOR DOWNLOAD CX-002921.pdf More Documents & Publications CX-002919: Categorical Exclusion Determination

359

Determining age of whales  

NLE Websites -- All DOE Office Websites (Extended Search)

Determining age of whales Determining age of whales Name: Bruce W Walkey Age: N/A Location: N/A Country: N/A Date: N/A Question: While browsing through the Internet, I came upon a question by two fifth grade students. Their question got me thinking and now I pose it to you. How can you determine the age of whales? Since they are mammals, can the methods that are used on humans be used on whales? What are some tests that can be done on bones or tissues to determine age? Looking forward to your reply. Replies: Although it is difficult to determine the age of whales (unless they are born in captivity and we know their birth date), several methods have been commonly used: 1) (if female) the examination of the ovaries 2) Examination of the ridges on baleen, which are not uniform in size and analogous to tree rings. The problem with this is that baleen wears away over time. 3) Studying layers of ossification in an ear bone is probably the most accurate method of aging, since internal bones don't wear away. The biggest problem with aging methods is that they usually require that you are dissecting the animal, and often, we would like a method of aging for live active animals. The best we can do here is to compare the size and markings of whales of known age to those found in the wild. Great question!

360

A VSP transformation technique for the determination of subsurface structure  

E-Print Network (OSTI)

is the dominant wavelength. With the surface reflection profiling technique, resolution typically ranges from tens to hundreds of meters. With this degree of resolution, a detailed understanding of the subsurface is hard to achieve, In a vertical seismic... Chairman of Advisory Committee: Dr. Terry W. Spencer An algorithm was developed which transforms a vertical seismic profile (VSP) from the time-depth domain into the offset-time domain. The procedure operates by calculating the dips of the reflectors...

Malloy, Jeffrey Edward

2012-06-07T23:59:59.000Z

Note: This page contains sample records for the topic "determination improved structure" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


361

THEORETICAL CHALLENGE TO THE EXPERIMENTALLY DETERMINED GEOMETRICAL STRUCTURE OF DIMETHYLSILAETHYLENE  

E-Print Network (OSTI)

J. Mol. Spectry. ]2_, IT c E. Flood and J. E. Boggs, J. Mol.by sulfur d functions, Flood and Boggs predicted r (C =S) e

Yoshioka, Yasunori

2013-01-01T23:59:59.000Z

362

High-Energy Electron Scattering and Nuclear Structure Determinations  

Science Journals Connector (OSTI)

Electrons of energies 125 and 150 Mev are deflected from the Stanford linear accelerator and brought to a focused spot of dimension 3 mm×15 mm at a distance of 9 feet from a double magnet deflecting system. The focus is placed at the center of a brass-scattering chamber of diameter 20 inches. Thin foils are inserted in the chamber and elastically-scattered electrons from these foils pass through thin aluminum windows into the vacuum chamber of a double focusing analyzing magnet of the inhomogeneous field type. The energy resolution of the magnet has been about 1.5 percent in these experiments. This resolution is enough to separate clearly hydrogen or deuterium elastic peaks from carbon peaks in the same scattering target. The energy loss in the foils is readily measurable. In the case of light nuclei, e.g., H, D, Be, C, the shift of the peak of the elastic curve as a function of scattering angle indicates the recoil of the struck nucleus. Relative angular distributions are measured for Be, Ta, Au, and Pb. It is possible to interpret these data in terms of a variable charge density within the nucleus.

R. Hofstadter; H. R. Fechter; J. A. McIntyre

1953-11-15T23:59:59.000Z

363

Improving Soliton Compression Quality with Cascaded Nonlinearities by Engineered Multi-section Quasi-phase-matching Design  

Science Journals Connector (OSTI)

In few-cycle soliton generation with large compression factors using cascaded nonlinearities the pulse quality can be improved by engineering quasi-phase-matching structures. The...

Zeng, Xianglong; Guo, Hairun; Zhou, Binbin; Bache, Morten

364

Wavelets in electronic structure calculations  

Science Journals Connector (OSTI)

A three-dimensional wavelet analysis is employed to develop a new formalism for electronic structure calculations. The wavelet formalism provides a systematically improvable and tractable description of electronic wave functions and overcomes limitations of conventional basis expansions. The potential power of the wavelet formalism for ab initio electronic structure calculations is demonstrated by a calculation of 1s states for all the naturally occurring nuclei on the periodic table and the interaction energies of the hydrogen molecule ion.

K. Cho, T. A. Arias, J. D. Joannopoulos, and Pui K. Lam

1993-09-20T23:59:59.000Z

365

Categorical Exclusion Determinations: American Recovery and Reinvestment  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

9, 2010 9, 2010 CX-003770: Categorical Exclusion Determination Maine-County-York CX(s) Applied: A1, A9, A11, B2.5, B5.1 Date: 09/09/2010 Location(s): York County, Maine Office(s): Energy Efficiency and Renewable Energy September 9, 2010 CX-003765: Categorical Exclusion Determination Idaho-Tribe-Nez Perce Tribe CX(s) Applied: A9, A11, B2.5, B5.1 Date: 09/09/2010 Location(s): Idaho Office(s): Energy Efficiency and Renewable Energy September 9, 2010 CX-003713: Categorical Exclusion Determination Validation of Coupled Models and Optimization of Materials for Offshore Wind Structures CX(s) Applied: A9, B3.1, B3.3, B3.6 Date: 09/09/2010 Location(s): Maine Office(s): Energy Efficiency and Renewable Energy, Golden Field Office September 9, 2010 CX-003694: Categorical Exclusion Determination

366

Categorical Exclusion Determinations: Science | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

March 30, 2010 March 30, 2010 CX-002583: Categorical Exclusion Determination Digital Hadron Calorimeter CX(s) Applied: B3.6 Date: 03/30/2010 Location(s): Illinois Office(s): Fermi Site Office, Science March 13, 2010 CX-001226: Categorical Exclusion Determination End Station Test Beam CX(s) Applied: B3.10 Date: 03/13/2010 Location(s): California Office(s): Science, Stanford Linear Accelerator Site Office March 2, 2010 CX-001509: Categorical Exclusion Determination East Campus Parking Structure at the Oak Ridge National Laboratory (ORNL) CX(s) Applied: B1.15 Date: 03/02/2010 Location(s): Oak Ridge, Tennessee Office(s): Oak Ridge Office, Science February 23, 2010 CX-003141: Categorical Exclusion Determination Advanced Biofuels Process Development Unit for Lawrence Berkeley National

367

Categorical Exclusion Determinations: Savannah River Operations Office |  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

July 31, 2013 July 31, 2013 CX-010844: Categorical Exclusion Determination Subcontractor Repair of Leak Over Entry Door #1 at 703-B CX(s) Applied: B1.3 Date: 07/31/2013 Location(s): South Carolina Offices(s): Savannah River Operations Office July 30, 2013 CX-010846: Categorical Exclusion Determination Install Stud, Shims, and Nut in the L-Basin 70-Ton Cask Lid Support Structure CX(s) Applied: B2.5 Date: 07/30/2013 Location(s): South Carolina Offices(s): Savannah River Operations Office July 23, 2013 CX-010850: Categorical Exclusion Determination Install Well Pump into the F-Tank Farm Catch Tank FL-241901-WTS-TK-1 CX(s) Applied: B1.3 Date: 07/23/2013 Location(s): South Carolina Offices(s): Savannah River Operations Office July 23, 2013 CX-010849: Categorical Exclusion Determination

368

Categorical Exclusion Determinations: Texas | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

October 2, 2012 October 2, 2012 CX-009237: Categorical Exclusion Determination The Dow Chemical Company CX(s) Applied: B5.7 Date: 10/02/2012 Location(s): Texas Offices(s): Fossil Energy September 27, 2012 CX-009327: Categorical Exclusion Determination Gas Hydrate Dynamics on the Alaskan Beaufort Continental Slope: Modeling and Field Characterization CX(s) Applied: A9 Date: 09/27/2012 Location(s): Texas Offices(s): National Energy Technology Laboratory September 20, 2012 CX-009218: Categorical Exclusion Determination Replace Sparge Piping at Bryan Mound Raw Water Intake Structure CX(s) Applied: B1.3 Date: 09/20/2012 Location(s): Texas Offices(s): Strategic Petroleum Reserve Field Office September 19, 2012 CX-009359: Categorical Exclusion Determination Houston Zero Emission Delivery Vehicle Deployment

369

Categorical Exclusion Determinations: Washington | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

June 22, 2012 June 22, 2012 CX-008692: Categorical Exclusion Determination Amendment Number 2 to the Alcoa Power Sales Agreement CX(s) Applied: A2 Date: 06/22/2012 Location(s): Oregon, Washington Offices(s): Bonneville Power Administration June 21, 2012 CX-008695: Categorical Exclusion Determination Munro Control Center Expansion CX(s) Applied: B1.15 Date: 06/21/2012 Location(s): Washington Offices(s): Bonneville Power Administration June 20, 2012 CX-008694: Categorical Exclusion Determination Acquisition and Disposition of Property CX(s) Applied: B1.24 Date: 06/20/2012 Location(s): Washington, Oregon Offices(s): Bonneville Power Administration June 20, 2012 CX-008693: Categorical Exclusion Determination Wood Pole Structure Replacements on the Chehalis-Centralia No. 2 115 Kilovolt Transmission Line

370

Categorical Exclusion Determinations: Colorado | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

May 18, 2012 May 18, 2012 CX-008766: Categorical Exclusion Determination Asphalt Repair and Concrete Work Activities at the Grand Junction, Colorado, Disposal Site CX(s) Applied: B1.3 Date: 05/18/2012 Location(s): Colorado Offices(s): Legacy Management May 15, 2012 CX-008238: Categorical Exclusion Determination Recovery Act: Colorado State Capitol Building Geothermal Program CX(s) Applied: A9, B2.1, B5.19 Date: 05/15/2012 Location(s): Colorado Offices(s): Golden Field Office May 9, 2012 CX-008401: Categorical Exclusion Determination Giant Track Communications Tower Removal CX(s) Applied: B1.19 Date: 05/09/2012 Location(s): Colorado Offices(s): Western Area Power Administration-Rocky Mountain Region May 9, 2012 CX-008381: Categorical Exclusion Determination Big Thompson to Flatiron 13.8 Kilovolt Transmission Line Structure

371

Categorical Exclusion Determinations: New Brunswick Laboratory | Department  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

New Brunswick Laboratory New Brunswick Laboratory Categorical Exclusion Determinations: New Brunswick Laboratory Categorical Exclusion Determinations issued by New Brunswick Laboratory. DOCUMENTS AVAILABLE FOR DOWNLOAD June 8, 2012 CX-008816: Categorical Exclusion Determination Renovations and Maintenance Activities for Buildings, Structures, Infrastructures and Equipment CX(s) Applied: B1.3, 61.4, 61.5, B1.11, B1.15, B1.16, B1.17, 81.22, B1.27, 62.1, B2.2, B2.3, 62.5 Date: 06/08/2012 Location(s): Illinois Offices(s): New Brunswick Laboratory June 8, 2012 CX-008817: Categorical Exclusion Determination Indoor Bench Scale Research Projects and Conventional Laboratory Operations CX(s) Applied: B3.6 Date: 06/08/2012 Location(s): Illinois Offices(s): New Brunswick Laboratory December 10, 2009

372

Categorical Exclusion Determinations: Missouri | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

22, 2010 22, 2010 CX-004797: Categorical Exclusion Determination 3M Columbia Solar Film Date: 12/22/2010 Location(s): Columbia, Missouri Office(s): Energy Efficiency and Renewable Energy, Golden Field Office December 16, 2010 CX-004688: Categorical Exclusion Determination Single-Molecule Imaging System Combined with Nano-Fluidic Chip to Understand Fluid Flow in Shale Gas CX(s) Applied: B3.6 Date: 12/16/2010 Location(s): Rolla, Missouri Office(s): Fossil Energy, National Energy Technology Laboratory December 8, 2010 CX-007798: Categorical Exclusion Determination Springfield Maintenance Garage CX(s) Applied: B1.15 Date: 12/08/2010 Location(s): Missouri Offices(s): Southwestern Power Administration November 24, 2010 CX-004540: Categorical Exclusion Determination Remote Monitoring of the Structural Health of Hydrokinetic Composite

373

Categorical Exclusion Determinations: Idaho Operations Office | Department  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

May 22, 2012 May 22, 2012 CX-008744: Categorical Exclusion Determination Implementation of a Low-Level Gamma-Ray Counting Facility - University of Texas at Austin CX(s) Applied: B3.6 Date: 05/22/2012 Location(s): Idaho Offices(s): Idaho Operations Office May 22, 2012 CX-008738: Categorical Exclusion Determination Determination of Microstructure and Chemical State Changes in Ion-Irradiated Fuels and Structural Components with a High Kinetic Energy Electron Detector - Illinois Institute of Technology CX(s) Applied: B3.6 Date: 05/22/2012 Location(s): Idaho Offices(s): Idaho Operations Office May 22, 2012 CX-008737: Categorical Exclusion Determination Building Calorimetric and Thermogravimetric Analytical Instrumentation Capability at Oregon State University CX(s) Applied: B3.6 Date: 05/22/2012

374

Categorical Exclusion Determinations: Western Area Power  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Desert Southwest Region Desert Southwest Region Categorical Exclusion Determinations: Western Area Power Administration-Desert Southwest Region Categorical Exclusion Determinations issued by Western Area Power Administration-Desert Southwest Region. DOCUMENTS AVAILABLE FOR DOWNLOAD August 22, 2013 CX-010882: Categorical Exclusion Determination Liberty-Parker Dam #2 230-Kilovolt Transmission Line, Optical Power Ground Wire Repair CX(s) Applied: B4.7 Date: 08/22/2013 Location(s): Arizona Offices(s): Western Area Power Administration-Desert Southwest Region August 12, 2013 CX-010883: Categorical Exclusion Determination PHX-LOB and LIB-LOB 230-Kilovolt Double-Circuit- Replace Insulators at Structure No. 28-2 With NCI Type Polymers CX(s) Applied: B1.3 Date: 08/12/2013 Location(s): Arizona Offices(s): Western Area Power Administration-Desert Southwest Region

375

Supertruck - Improving Transportation Efficiency through Integrated...  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

Improving Transportation Efficiency through Integrated Vehicle, Engine and Powertrain Research Supertruck - Improving Transportation Efficiency through Integrated Vehicle, Engine...

376

Water Efficiency Improvements at Various Environmental Protection...  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

Water Efficiency Improvements at Various Environmental Protection Agency Sites Water Efficiency Improvements at Various Environmental Protection Agency Sites Water Efficiency...

377

Utilization of Refractory Metals and Alloys in Fusion Reactor Structures  

Science Journals Connector (OSTI)

In design of fusion reactors, structural material selection is very crucial to improve reactor’s performance. Different types of materials have been proposed for use in fusion reactor structures. Among these mate...

Mustafa Übeyli; ?enay Yalç?n

2006-12-01T23:59:59.000Z

378

Categorical Exclusion Determinations: Ohio | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

September 13, 2011 September 13, 2011 CX-006752: Categorical Exclusion Determination Energy Efficiency Vehicles for Sustainable Mobility - Department of Energy Graduate Automotive Technology Education Center of Excellence CX(s) Applied: A9, A11, B3.6 Date: 09/13/2011 Location(s): Columbus, Ohio Office(s): Energy Efficiency and Renewable Energy, National Energy Technology Laboratory September 7, 2011 CX-006806: Categorical Exclusion Determination Stationary Fuel Cell System Cost Analysis CX(s) Applied: A9 Date: 09/07/2011 Location(s): Ohio Office(s): Energy Efficiency and Renewable Energy, Golden Field Office August 29, 2011 CX-006499: Categorical Exclusion Determination Improving Fuel Efficiency through Innovative Tire Design and Materials CX(s) Applied: B3.6 Date: 08/29/2011 Location(s): Findlay, Ohio

379

Categorical Exclusion Determinations: Tennessee | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

September 22, 2011 September 22, 2011 CX-006988: Categorical Exclusion Determination Use of Ultraviolet or Electron Beam Curing Technology to Significantly Reduce Cost to Manufacture Lithium-Ion Batteries CX(s) Applied: B3.6 Date: 09/22/2011 Location(s): Illinois, Maryland, Massachusetts, New Jersey, Tennessee Office(s): Energy Efficiency and Renewable Energy September 21, 2011 CX-006844: Categorical Exclusion Determination Tennessee Energy Efficient Schools Initiative Ground Source Heat Pump CX(s) Applied: A9, B5.1 Date: 09/21/2011 Location(s): Tennessee Office(s): Energy Efficiency and Renewable Energy, Golden Field Office September 19, 2011 CX-007056: Categorical Exclusion Determination Interstate Electrification Improvement CX(s) Applied: B5.1 Date: 09/19/2011 Location(s): California, Iowa, Maine, Missouri, Montana, Nevada, New

380

Categorical Exclusion Determinations: Bonneville Power Administration |  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

July 30, 2012 July 30, 2012 CX-008891: Categorical Exclusion Determination Pilot Butte-La Pine No. 1 Wood Pole Replacement Project CX(s) Applied: B4.6 Date: 07/30/2012 Location(s): Oregon Offices(s): Bonneville Power Administration July 30, 2012 CX-008890: Categorical Exclusion Determination Bonneville Power Administration/Washington Department of Natural Resources Access Road Improvements CX(s) Applied: B1.3 Date: 07/30/2012 Location(s): Washington, Washington, Washington, Washington Offices(s): Bonneville Power Administration July 27, 2012 CX-008676: Categorical Exclusion Determination Four AT&T Wireless Communication Site Upgrades CX(s) Applied: B1.7, B1.19 Date: 07/27/2012 Location(s): Washington, Washington, Washington, Washington Offices(s): Bonneville Power Administration

Note: This page contains sample records for the topic "determination improved structure" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


381

Categorical Exclusion Determinations: Missouri | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

2, 2011 2, 2011 CX-007714: Categorical Exclusion Determination Donald Danforth Plant Science Center - Center for Enhanced Camelina Oil CX(s) Applied: B3.6, B3.8 Date: 12/02/2011 Location(s): Michigan, Missouri, Montana, Nebraska, New Mexico Offices(s): Advanced Research Projects Agency-Energy November 28, 2011 CX-007767: Categorical Exclusion Determination Upgrade of Missouri Science and Technology Reactor for Distance Learning - Missouri University of Science and Technology CX(s) Applied: B1.7 Date: 11/28/2011 Location(s): Missouri Offices(s): Nuclear Energy, Idaho Operations Office October 18, 2011 CX-007066: Categorical Exclusion Determination Interstate Electrification Improvement CX(s) Applied: B5.1 Date: 10/18/2011 Location(s): Alabama, Arizona, California, Florida, Iowa, Kansas,

382

Categorical Exclusion Determinations: California | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

September 20, 2011 September 20, 2011 CX-010375: Categorical Exclusion Determination Replace Existing Firehouse CX(s) Applied: B1.15 Date: 09/20/2011 Location(s): California Offices(s): Berkeley Site Office September 19, 2011 CX-007052: Categorical Exclusion Determination Silicon-Nanowire-Based Lithium-Ion Batteries with Doubling Energy Density CX(s) Applied: B3.6 Date: 09/19/2011 Location(s): Menlo Park, California Office(s): Energy Efficiency and Renewable Energy, National Energy Technology Laboratory September 19, 2011 CX-007056: Categorical Exclusion Determination Interstate Electrification Improvement CX(s) Applied: B5.1 Date: 09/19/2011 Location(s): California, Iowa, Maine, Missouri, Montana, Nevada, New Mexico, Tennessee, Utah, Virginia, Washington Office(s): Energy Efficiency and Renewable Energy, Savannah River

383

Categorical Exclusion Determinations: American Recovery and Reinvestment  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

0, 2010 0, 2010 CX-002214: Categorical Exclusion Determination Susanville Indian Rancheria Portfolio Manager Tool CX(s) Applied: B2.5, B5.1 Date: 05/10/2010 Location(s): California Office(s): Energy Efficiency and Renewable Energy May 10, 2010 CX-002355: Categorical Exclusion Determination Kansas City Power and Light (KCP&L) Green Impact Zone Smart Grid Demonstration CX(s) Applied: B4.6, A1, A9, A11, B1.7, B4.11, B5.1 Date: 05/10/2010 Location(s): Kansas City, Missouri Office(s): Electricity Delivery and Energy Reliability, National Energy Technology Laboratory May 10, 2010 CX-002351: Categorical Exclusion Determination Interstate Electrification Improvement CX(s) Applied: A1, B5.1 Date: 05/10/2010 Location(s): Portland, Oregon Office(s): Energy Efficiency and Renewable Energy, National Energy

384

Categorical Exclusion Determinations: Wyoming | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

July 30, 2012 July 30, 2012 CX-009090: Categorical Exclusion Determination Line Switch Replacements at Guernsey Rural, Worland, Refinery, Box Butte, and Morrill Taps CX(s) Applied: B4.6, B4.11 Date: 07/30/2012 Location(s): Wyoming, Nebraska Offices(s): Western Area Power Administration-Rocky Mountain Region July 23, 2012 CX-008784: Categorical Exclusion Determination License Outgrant to Owl Creek Water District Town of Thermopolis, Hot Springs County, Wyoming CX(s) Applied: B4.9 Date: 07/23/2012 Location(s): Wyoming Offices(s): Western Area Power Administration-Rocky Mountain Region July 23, 2012 CX-008496: Categorical Exclusion Determination Interstate Electrification Improvement CX(s) Applied: B5.1 Date: 07/23/2012 Location(s): Wyoming Offices(s): National Energy Technology Laboratory

385

Categorical Exclusion Determinations: Connecticut | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

January 27, 2010 January 27, 2010 CX-000644: Categorical Exclusion Determination Recovery Act: State of Connecticut Energy Efficiency and Conservation Block Grant CX(s) Applied: A9, A11, B5.1 Date: 01/27/2010 Location(s): Connecticut Office(s): Energy Efficiency and Renewable Energy, Golden Field Office January 5, 2010 CX-000698: Categorical Exclusion Determination Connecticut - State Building Energy Improvements: 79 Elm Street CX(s) Applied: B1.3, B1.4, B1.24, B1.31, B2.5, B5.1 Date: 01/05/2010 Location(s): Hartford, Connecticut Office(s): Energy Efficiency and Renewable Energy, National Energy Technology Laboratory December 28, 2009 CX-000272: Categorical Exclusion Determination Tailored Working Fluids for Enhanced Binary Geothermal Power Plants CX(s) Applied: A9, B3.6, B5.1

386

Categorical Exclusion Determinations: American Recovery and Reinvestment  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

6, 2010 6, 2010 CX-003804: Categorical Exclusion Determination Recovery Act: San Bernardino Associated Government Natural Gas Truck Project (Orange, California Infrastructure Modification) CX(s) Applied: B5.1 Date: 09/16/2010 Location(s): Orange, California Office(s): Energy Efficiency and Renewable Energy, National Energy Technology Laboratory September 16, 2010 CX-003799: Categorical Exclusion Determination Electrochromic Glazing Technology: Improved Performance, Lower Price CX(s) Applied: A9, B2.2, B5.1 Date: 09/16/2010 Location(s): Faribault, Minnesota Office(s): Energy Efficiency and Renewable Energy, National Energy Technology Laboratory September 16, 2010 CX-003798: Categorical Exclusion Determination Master Curriculum Development for Energy Auditors, Commissioning Agents and

387

Categorical Exclusion Determinations: National Energy Technology Laboratory  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

January 21, 2011 January 21, 2011 CX-005058: Categorical Exclusion Determination Improving Reservoir Contact for Increased Production and Recovery of Gas Shale Reservoirs CX(s) Applied: B3.6 Date: 01/21/2011 Location(s): Salt Lake City, Utah Office(s): Fossil Energy, National Energy Technology Laboratory January 20, 2011 CX-005057: Categorical Exclusion Determination Area of Interest 1, Carbon Dioxide at the Interface: Nature and Dynamics of the Reservoir/Caprock Contact and Implications for Carbon Storage Performance CX(s) Applied: A9, B3.1 Date: 01/20/2011 Location(s): Eau Claire, Wisconsin Office(s): Fossil Energy, National Energy Technology Laboratory January 20, 2011 CX-005056: Categorical Exclusion Determination Area of Interest 1, Carbon Dioxide at the Interface: Nature and Dynamics of

388

Categorical Exclusion Determinations: Texas | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

December 11, 2009 December 11, 2009 CX-002608: Categorical Exclusion Determination Improving the Monitoring, Verification, and Accounting of Carbon Dioxide Sequestered in Geologic Systems with Multicomponent Seismic Technology and Rock Physics Modeling CX(s) Applied: A9 Date: 12/11/2009 Location(s): Austin, Texas Office(s): Fossil Energy, National Energy Technology Laboratory December 10, 2009 CX-000341: Categorical Exclusion Determination Development of a National Liquid Propane (Autogas) Refueling Network, Clean School Bus/Vehicle Incentive & Green Jobs Outreach Program CX(s) Applied: A1, A9 Date: 12/10/2009 Location(s): Texas Office(s): Energy Efficiency and Renewable Energy, National Energy Technology Laboratory December 10, 2009 CX-000351: Categorical Exclusion Determination

389

Categorical Exclusion Determinations: Massachusetts | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

August 8, 2012 August 8, 2012 CX-008958: Categorical Exclusion Determination Enhanced Simulation Tools to Improve Predictions and Performance of Geologic Storage: Coupled Modeling CX(s) Applied: A1, A9 Date: 08/08/2012 Location(s): Massachusetts Offices(s): National Energy Technology Laboratory August 6, 2012 CX-008990: Categorical Exclusion Determination "Prototype Development and Evaluation of Self-Cleaning Concentrated Solar Power Collectors and Receivers CX(s) Applied: B3.6, B5.17 Date: 08/06/2012 Location(s): Massachusetts Offices(s): Golden Field Office" August 6, 2012 CX-008829: Categorical Exclusion Determination Proliferation Detection Research for Discovery and Development of Process for Deposition of Pure, Stoichiometric and Conformal Films of Magnesium Diboride at Harvard University

390

Categorical Exclusion Determinations: Alabama | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

October 18, 2011 October 18, 2011 CX-007065: Categorical Exclusion Determination Slipstream Pilot-Scale Demonstration of a Novel Amine-Based Post-Combustion Technology for Carbon Dioxide Capture CX(s) Applied: B3.6 Date: 10/18/2011 Location(s): Wilsonville, Alabama Office(s): Fossil Energy, National Energy Technology Laboratory October 18, 2011 CX-007066: Categorical Exclusion Determination Interstate Electrification Improvement CX(s) Applied: B5.1 Date: 10/18/2011 Location(s): Alabama, Arizona, California, Florida, Iowa, Kansas, Massachusetts, Michigan, Missouri, Montana, New Mexico, New York, North Carolina, Texas, Utah, Virginia, Washington, Wyoming Office(s): Energy Efficiency and Renewable Energy, National Energy Technology Laboratory October 14, 2011 CX-007067: Categorical Exclusion Determination

391

Categorical Exclusion Determinations: Environmental Management | Department  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

February 10, 2011 February 10, 2011 CX-005510: Categorical Exclusion Determination 785-A Cooling Tower Replacement CX(s) Applied: B1.3 Date: 02/10/2011 Location(s): Aiken, South Carolina Office(s): Environmental Management, Savannah River Operations Office February 10, 2011 CX-005508: Categorical Exclusion Determination 43RD Weapons of Mass Destruction Civil Support Team Training Exercise in D-Area Date: 02/10/2011 Location(s): Aiken, South Carolina Office(s): Environmental Management, Savannah River Operations Office February 4, 2011 CX-005513: Categorical Exclusion Determination Enhanced Chemical Cleaning of Waste Tanks to Improve Actinide Solubility CX(s) Applied: B3.6 Date: 02/04/2011 Location(s): Aiken, South Carolina Office(s): Environmental Management, Savannah River Operations Office

392

The balancing test: Is fairtrade cotton a sustainable policy for improving the livelihoods of Indian cotton producers?.  

E-Print Network (OSTI)

?? This thesis determines if Fairtrade cotton can improve the livelihoods of cotton farmers in India. Interviews with Fairtrade cotton farmers and local staff members… (more)

Mooter, Sheyanne

2012-01-01T23:59:59.000Z

393

Gender determination in populus  

SciTech Connect

Gender, the expression of maleness or femaleness, in dioecious plants has been associated with changes in morphology, physiology, ecological position, and commercial importance of several species, including members of the Salicaceae family. Various mechanisms have been proposed to explain the expression of gender in Salicaceae, including sex chromosomes, simple Mendelian genes, quantitative genes, environment, and genotype-by-environment interactions. Published reports would favor a genetic basis for gender. The objective of this study was to identify molecular markers associated with gender in a segregating family of hybrid poplars. Bulked segregant analysis and chi-squared analysis were used to test for the occurrence of sex chromosomes, individual loci, and chromosome ratios (i.e., ploidy levels) as the mechanisms for gender determination. Examination of 2488 PCR based RAPD markers from 1219 primers revealed nine polymorphic bands between male and female bulked samples. However, linkage analysis indicated that none of these markers were significantly associated with gender. Chisquared results for difference in male-to-female ratios between diploid and triploid genotypes also revealed no significant differences. These findings suggest gender is not controlled via sex chromosomes, simple Mendelian loci or ratios of autosome to gender-determining loci. It is possible that gender is determined genetically by regions of the genome not sampled by the tested markers or by a complex of loci operating in an additive threshold manner or in an epistatic manner. It is also possible that gender is determined environmentally at an early zygote stage, canalizing gender expression.

McLetchie, D.N. [Univ. of Kentucky, Lexington, KY (United States). Dept. of Biological Sciences; Tuskan, G.A. [Oak Ridge National Lab., TN (United States)

1994-12-31T23:59:59.000Z

394

Improving Platinum Catalyst Durability with a Doped Graphene Support  

Science Journals Connector (OSTI)

Improving the durability of a platinum catalyst is an important step in increasing its utility when incorporated as the anode or cathode of a proton-exchange membrane fuel cell. ... Carboxyl Group Enhanced CO Tolerant GO Supported Pt Catalysts: DFT and Electrochemical Analysis ... Chemical Structure of Nitrogen-Doped Graphene with Single Platinum Atoms and Atomic Clusters as a Platform for the PEMFC Electrode ...

Michael N. Groves; Cecile Malardier-Jugroot; Manish Jugroot

2012-04-13T23:59:59.000Z

395

Structure of the BPA-Fructose Complex  

Science Journals Connector (OSTI)

The fructose complex of Boronophenylalanine (BPA) is commonly used for in vivo administration, due to its improved water solubility.1...Until now, however, the detailed molecular structure of the BPA-fructose com...

P. Bendel; C. Anderson; G. W. Kabalka

2001-01-01T23:59:59.000Z

396

LANL researchers improve path to producing uranium compounds, candidates  

NLE Websites -- All DOE Office Websites (Extended Search)

Researchers improve path to producing uranium compounds Researchers improve path to producing uranium compounds LANL researchers improve path to producing uranium compounds, candidates for advanced nuclear fuels Enhance the ability to develop advanced nuclear fuels in a safer, simpler manner. April 7, 2011 This illustration shows the structures of UI4(1,4-dioxane)2 (left) and the UI3(1,4-dioxane)1.5 complexes. This illustration shows the structures of UI4(1,4-dioxane)2 (left) and the UI3(1,4-dioxane)1.5 complexes. Contact Kevin Roark Communicatons Office (505) 665-9202 Email LOS ALAMOS, New Mexico, April 7, 2010- Advances made by researchers at Los Alamos National Laboratory could enhance the ability of scientists to develop advanced nuclear fuels in a safer, simpler manner. Uranium chemistry research relies heavily on a variety of uranium "starting

397

CX-007359: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

359: Categorical Exclusion Determination 359: Categorical Exclusion Determination CX-007359: Categorical Exclusion Determination McNary-Horse Heaven 230-kilovolt Transmission Line Raise (Structures 15/2 to 16/3) CX(s) Applied: B1.3 Date: 12/01/2011 Location(s): Washington Offices(s): Bonneville Power Administration Bonneville Power Administration (BPA) is proposing to add six wooden prop structures to the McNary-Horse Heaven No. 1 230-kilovolt transmission line between structures 15/2-16/3. The prop structures are needed to raise the existing line so that the conductor meets the necessary Minimum Approach Distance from the orchard below. An augur truck would use existing BPA roads to access the site and install wooden poles. More Documents & Publications CX-006582: Categorical Exclusion Determination

398

CX-005546: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

6: Categorical Exclusion Determination 6: Categorical Exclusion Determination CX-005546: Categorical Exclusion Determination McNary-Ross Number 1 Structure 162/4 Relocation and Insulator Replacement Project CX(s) Applied: B1.3 Date: 03/25/2011 Location(s): Clark County, Washington Office(s): Bonneville Power Administration In order to increase the ground-to-conductor clearance of the 345-kilovolt McNary-Ross Number 1 transmission line, Bonneville Power Administration proposes to relocate structure 162/4 to a new location that is 75 feet ahead-on-line (west) of the center of the existing structure, and replace the insulator hardware that suspends the conductor on 15 structures. DOCUMENT(S) AVAILABLE FOR DOWNLOAD CX-005546.pdf More Documents & Publications CX-006817: Categorical Exclusion Determination

399

CX-006302: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

302: Categorical Exclusion Determination 302: Categorical Exclusion Determination CX-006302: Categorical Exclusion Determination Colville-Republic Rebuild Project CX(s) Applied: B1.3, B4.6 Date: 07/21/2011 Location(s): Stevens County, Washington Office(s): Bonneville Power Administration Bonneville Power Administration (BPA) is proposing to replace deteriorating wood pole structures along approximately 13.5 miles of the Colville-Republic No. 1 115 kilovolt (kV) transmission line (structures 1/1-14/5). BPA would replace wood pole structures in kind and at their currently existing locations. In addition to pole replacement, BPA would replace structure crossarms, insulators, dampers and conductor. DOCUMENT(S) AVAILABLE FOR DOWNLOAD CX-006302.pdf More Documents & Publications CX-010439: Categorical Exclusion Determination

400

improve | OpenEI Community  

Open Energy Info (EERE)

improve improve Home Dc's picture Submitted by Dc(15) Member 17 September, 2013 - 12:39 Are you willing to reply to a text message once a day with information about your comfort level at your indoor location? building comfort design improve incentive indoor message sms text Yes 60% (3 votes) No 0% (0 votes) Maybe if I had an incentive 20% (1 vote) Maybe if my reply is confidential and anonymous 0% (0 votes) Maybe if the data will be used to improve building design 20% (1 vote) Total votes: 5 Buildings account for roughly 40% of all U.S. energy use (70% of all electricity): residential buildings account for 22% of all U.S. energy use and commercial buildings account for 18% of all U.S. energy use[i]. There is an unanswered need for information about buildings in use and how building design affects building occupant comfort, productivity, and, by

Note: This page contains sample records for the topic "determination improved structure" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


401

Detecting Discrepancies and Improving Intelligibility  

E-Print Network (OSTI)

Detecting Discrepancies and Improving Intelligibility: Two Preliminary Evaluations of RIPTIDES evaluations of RIPTIDES, a sys- tem that combines information extraction (IE), extraction-based sum unduly sacrificing content relevance. 1 Introduction We report on two preliminary evaluations of RIPTIDES

Wagstaff, Kiri L.

402

Prescription to Improve Thermoelectric Efficiency  

E-Print Network (OSTI)

PRESCRIPTION TO IMPROVE THERMOELECTRIC EFFICIENCY A Thesis by SHIV AKARSH MEKA Submitted to the Office of Graduate Studies of Texas A&M University in partial fulfillment of the requirements for the degree of MASTER OF SCIENCE... May 2010 Major Subject: Materials Science and Engineering PRESCRIPTION TO IMPROVE THERMOELECTRIC EFFICIENCY A Thesis by SHIV AKARSH MEKA Submitted to the Office of Graduate Studies of Texas A&M University in partial fulfillment...

Meka, Shiv Akarsh

2012-07-16T23:59:59.000Z

403

CX-003620: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

620: Categorical Exclusion Determination 620: Categorical Exclusion Determination CX-003620: Categorical Exclusion Determination Structure 57/2 Relocation on the Lovell-Thermopolis 115 Kilovolt Transmission Line CX(s) Applied: B1.3, B4.6 Date: 08/23/2010 Location(s): Wyoming Office(s): Western Area Power Administration-Rocky Mountain Region Western Power Administration proposes to relocate structure 57/2 on the Lovell-Thermopolis transmission line. The structure is presently located on the bank of the Greybull River, which is quickly eroding. The structure will be moved approximately 30 feet north of its present location, within the existing transmission line right-of-way. The structure is located on Wyoming State lands. DOCUMENT(S) AVAILABLE FOR DOWNLOAD CX-003620.pdf More Documents & Publications

404

CX-006780: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

780: Categorical Exclusion Determination 780: Categorical Exclusion Determination CX-006780: Categorical Exclusion Determination Snohomish-Murray Relocation of Wood Pole at Structure 9/4 CX(s) Applied: B4.6 Date: 08/26/2011 Location(s): Snohomish County, Washington Office(s): Bonneville Power Administration Bonneville Power Administration (BPA) proposes to relocate a single wood pole on a three pole transmission tower (structure 9/4) on the Snohomish-Murray # 1 transmission line. The existing pole on the east side of the structure will be permanently removed and a new pole and guy anchors will be installed 23 feet to the west of the existing pole. This will effectively move structure 9/4 23 feet to the west. The relocated pole will be in-kind with the rest of the line structures, and all of the work will

405

CX-005130: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

0: Categorical Exclusion Determination 0: Categorical Exclusion Determination CX-005130: Categorical Exclusion Determination Ringold Substation Structure Replacement Project CX(s) Applied: B4.6 Date: 01/21/2011 Location(s): Basin City, Washington Office(s): Bonneville Power Administration Bonneville Power Administration is proposing to replace the single pole structure 8/9 of the Benton-Scooteney No. 1 115-kilovolt (kV) transmission line, the attached vertically mounted disconnect switch, and current guy wiring with a new, 30-foot wide, three-pole transposition structure, a new horizontally mounted disconnect switch, and new guy wiring. In addition, a new 14-foot wide two-pole structure and a new 25?5-foot switch support structure would be installed roughly 30-feet ahead of the substation dead-end and approximately 15-feet ahead of the KD, respectively. There

406

CX-003194: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

194: Categorical Exclusion Determination 194: Categorical Exclusion Determination CX-003194: Categorical Exclusion Determination Installation of a Mid-Span Interset Structure between Structures 141/1 and 141/2 on the Existing Davis Dam-Prescott 230-Kilovolt Transmission Line in Yavapai County, Arizona CX(s) Applied: B4.13 Date: 06/10/2010 Location(s): Yavapai County, Arizona Office(s): Western Area Power Administration-Desert Southwest Region Western Area Power Administration plans to install a mid-span (interset) structure between structures 141/1 and 141/2 of the existing Davis Dam-Prescott 230-kilovolt transmission line. The proposed undertaking entails constructing a 100-foot tall steel H-frame near the midpoint of the 1900-foot-long span between two lattice tower structures. The H-frame will

407

CX-010734: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

4: Categorical Exclusion Determination 4: Categorical Exclusion Determination CX-010734: Categorical Exclusion Determination Covington District Culvert Replacements CX(s) Applied: B1.3 Date: 07/22/2013 Location(s): Washington Offices(s): Bonneville Power Administration Bonneville Power Administration (BPA) is proposing to replace existing culverts at 12 access road stream crossings that present barriers to fish passage. These improvements will be made on BPA easement access roads within Department of Natural Resources (DNR) owned and managed lands. BPA will make these improvements by installing new fish friendly culverts and/or bridges at each stream crossing. CX-010734.pdf More Documents & Publications CX-008890: Categorical Exclusion Determination CX-010432: Categorical Exclusion Determination

408

CX-000070: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

70: Categorical Exclusion Determination 70: Categorical Exclusion Determination CX-000070: Categorical Exclusion Determination Meridian Township's Revolving Energy Fund CX(s) Applied: B5.1, B2.5, B2.2 Date: 11/12/2009 Location(s): Meridian Township, Michigan Office(s): Energy Efficiency and Renewable Energy Initially, the Energy Efficiency and Conservation Block Grant funds will be used to retrofit Township-owned buildings and facilities. As energy savings and utility rebates replenish the fund, additional improvements will be made. Ten buildings have been assessed and over two dozen improvements have been identified with reasonable payback periods. DOCUMENT(S) AVAILABLE FOR DOWNLOAD CX-000070.pdf More Documents & Publications CX-002413: Categorical Exclusion Determination CX-000062: Categorical Exclusion Determination

409

CX-010734: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

734: Categorical Exclusion Determination 734: Categorical Exclusion Determination CX-010734: Categorical Exclusion Determination Covington District Culvert Replacements CX(s) Applied: B1.3 Date: 07/22/2013 Location(s): Washington Offices(s): Bonneville Power Administration Bonneville Power Administration (BPA) is proposing to replace existing culverts at 12 access road stream crossings that present barriers to fish passage. These improvements will be made on BPA easement access roads within Department of Natural Resources (DNR) owned and managed lands. BPA will make these improvements by installing new fish friendly culverts and/or bridges at each stream crossing. CX-010734.pdf More Documents & Publications CX-008890: Categorical Exclusion Determination CX-010432: Categorical Exclusion Determination

410

CX-006616: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

16: Categorical Exclusion Determination 16: Categorical Exclusion Determination CX-006616: Categorical Exclusion Determination Y646 (Y189), Renovation of E-Wing Ventilation, Building 773-A CX(s) Applied: B2.1 Date: 07/13/2011 Location(s): Aiken, South Carolina Office(s): Savannah River Operations Office Y646 is the current project underway to address Modification 2 of the original Commercial Modification Scope Document (CMSD). CMSD was originated to modify the E-Wing heating, ventilation and air conditioning Ventilation System to improve the air flow balance; and to improve radiological confinement and contamination control. DOCUMENT(S) AVAILABLE FOR DOWNLOAD CX-006616.pdf More Documents & Publications CX-006951: Categorical Exclusion Determination CX-005104: Categorical Exclusion Determination

411

CX-005999: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

999: Categorical Exclusion Determination 999: Categorical Exclusion Determination CX-005999: Categorical Exclusion Determination Missouri Independent Energy Efficiency Program: Continental Casting, LLC - Compressed Air Improvements CX(s) Applied: B5.1 Date: 05/31/2011 Location(s): Monroe City, Missouri Office(s): Energy Efficiency and Renewable Energy, Golden Field Office The Missouri Department of Natural Resources proposes to provide $69,066 of State Energy Program funds to Continental Casting, LLC, at the Monroe City Plant and the Palmyra Plant. Continental Castings is proposing lighting replacement and compressed air system improvement projects. DOCUMENT(S) AVAILABLE FOR DOWNLOAD CX-005999.pdf More Documents & Publications CX-005998: Categorical Exclusion Determination CX-006024: Categorical Exclusion Determination

412

CX-005581: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

5581: Categorical Exclusion Determination 5581: Categorical Exclusion Determination CX-005581: Categorical Exclusion Determination Quark Gluon Structure of Hadrons in Quantum Chromodynamics CX(s) Applied: A9 Date: 04/07/2011 Location(s): Illinois Office(s): Science, Chicago Office The purpose of this project is to perform fundamental research in the field of theoretical hadronic physics, using paper and pencil as well as computer simulations. In particular, we plan to investigate the structure of hadrons and the vacuum, as well as the interplay between vacuum and hadron structure, both through theoretical modeling as well as first-principles numerical calculations. DOCUMENT(S) AVAILABLE FOR DOWNLOAD CX-005581.pdf More Documents & Publications CX-005687: Categorical Exclusion Determination CX-002583: Categorical Exclusion Determination

413

CX-004457: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

457: Categorical Exclusion Determination 457: Categorical Exclusion Determination CX-004457: Categorical Exclusion Determination Trinity Line Cat Building Installation CX(s) Applied: B1.15 Date: 11/03/2010 Location(s): Trinity County, California Office(s): Western Area Power Administration-Sierra Nevada Region Western Area Power Administration proposes to install a 33 foot by 70 foot pre-fabricated metal structure and 1,000 linear feet of fencing. The structure will be anchored on top of an existing concrete slab which is part of an old building foundation. The structure will be used to store line maintenance equipment and materials. DOCUMENT(S) AVAILABLE FOR DOWNLOAD CX-004457.pdf More Documents & Publications CX-004883: Categorical Exclusion Determination CX-006627: Categorical Exclusion Determination

414

CX-007127: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

27: Categorical Exclusion Determination 27: Categorical Exclusion Determination CX-007127: Categorical Exclusion Determination Blythe-Knob CX(s) Applied: B1.3 Date: 03/21/2011 Location(s): Imperial County, California, Maricopa County, Arizona Office(s): Western Area Power Administration-Desert Southwest Region Western proposes to replace broken crossarms at structures 32/3,6312 and cross brace repair at structure 31/2 along the existing Blythe - Knob 161-kilovolt transmission line. Western will access structures using crew trucks and pickup trucks along existing access roads. This work is necessary to maintain the safety and reliability of the bulk electrical system. CX-007127.pdf More Documents & Publications CX-007800: Categorical Exclusion Determination CX-007159: Categorical Exclusion Determination

415

CX-004883: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

CX-004883: Categorical Exclusion Determination CX-004883: Categorical Exclusion Determination CX-004883: Categorical Exclusion Determination Trinity Line Cat Building Installation CX(s) Applied: B1.15 Date: 11/03/2010 Location(s): Trinity County, California Office(s): Western Area Power Administration-Sierra Nevada Region Western Area Power Administration proposes to install a 33 foot by 70 foot pre-fabricated metal structure and 1,000 linear feet of fencing. The structure will be anchored on top of an existing concrete slab which is part of an old building foundation. The structure will be used to store line maintenance equipment and materials. DOCUMENT(S) AVAILABLE FOR DOWNLOAD CX-004883.pdf More Documents & Publications CX-004457: Categorical Exclusion Determination CX-006627: Categorical Exclusion Determination

416

Protein Structure  

NLE Websites -- All DOE Office Websites (Extended Search)

Protein Structure Protein Structure Name: Chris Location: N/A Country: N/A Date: N/A Question: what are the four levels or structure of protien Replies: Hi Chris... as you must know proteins are made of amino acids arranged in polypeptide chains, and the order of them in these chains is called primary structure. The regular way in which the polypeptide chains are arranged in space to form a protein molecule is called secondary structure. The arrangement of the three-dimensional structure of the polypeptide chain in space is the tertiary structure. The arrangement of the combination of two or more polypeptide chains constitutes the quartenary structure. Quite simple, isn't? If you just remember that the molecular weights of proteins range usually from 10,000 to 100,000 daltons (one dalton is the weight of one hydrogen atom) and that 20 different amino-acids in a chain 100 amino acids long can be arranged in far more than 10 to its 100 potency ( number 1 followed by 100 zeroes) ways!

417

Categorical Exclusion (CX) Determination  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

North Oakes tap of the Edgeley to Forman 69 kV line North Oakes tap of the Edgeley to Forman 69 kV line Description of Proposed Action: Central Power Electric Cooperative is proposing to tap into the Western Area Power Administration (Western) Edgeley to Forman 69 kV transmission line with a new substation to meet load growth in the Southeastern North Dakota area. Number and Title of Categorical Exclusions Being Applied: 10 CFR 1021.410 Subpart D, Appendix B, B4.11: Construction of electric power substations ... or modification of existing substations and support facilities. Regulatory Requirements for CX Determination: The DOE Guidelines for Compliance with the Regulatory Requirements for the National Environmental Policy Act at 10 CFR 1021.410(b), require the following determinations be made in order for a proposed action to be categorically

418

NEWTON: Determining Material Degradation  

NLE Websites -- All DOE Office Websites (Extended Search)

Determining Material Degradation Determining Material Degradation Name: Hamish Status: student Grade: 6-8 Location: CA Country: USA Date: Summer 2013 Question: I am working on a science project about photo-degradation of plastic film. My question is how much degraded a plastic film should be to say that it was 100% photo-degraded? The plastic film I am photo-degrading is turning into dust when I touch it, what level of degradation is that? Replies: Hi Hamish, Thanks for the question. You will need to define what you mean by photo-degraded. 100% photo-degraded could be that the film becomes translucent and lets through only blurry images. Or it could mean that the film turns to dust when you touch it. As long as you clearly state in your science project what you mean by 100% photo-degraded, you will be doing a good job.

419

Categorical Exclusion (CX) Determination  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Circle substation expansion Circle substation expansion Description of Proposed Action: Expansion of the Circle substation approximately 4 acres to the south for the purpose of adding additional bays for the Keystone XL pipeline project. Number and Title of Categorical Exclusions Being Applied: 10 CFR 1021.410 Subpart D, Appendix B, B4.11: Construction of electric power substations ... or modification of existing substations and support facilities. Regulatory Requirements for CX Determination: The DOE Guidelines for Compliance with the Regulatory Requirements for the National Environmental Policy Act at 10 CFR 1021.410(b), require the following determinations be made in order for a proposed action to be categorically excluded from National Environmentally Policy Act (NEPA) review:

420

Categorical Exclusion (CX) Determination  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Addition of a new substation near Lake Bowdoin, MT. Addition of a new substation near Lake Bowdoin, MT. Description of Proposed Action: Addition of a new substation near Lake Bowdoin on Western's Fort Peck to Havre 161 k V transmission line for the purpose of providing power for a Keystone XL pipeline project pump station. Number and Title of Categorical Exclusions Being Applied: 10 CFR 1021.410 Subpart D, Appendix B, B4.11: Construction of electric power substations ... or modification of existing substations and support facilities. Regulatory Requirements for CX Determination: The DOE Guidelines for Compliance with the Regulatory Requirements for the National Environmental Policy Act at 10 CFR 1021.41 O(b), require the following determinations be made in order for a proposed action to be categorically

Note: This page contains sample records for the topic "determination improved structure" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


421

Mental Health, Determinants of  

Science Journals Connector (OSTI)

Abstract In this article, the authors first review differences between mental health and physical health conditions and explicitly consider how the health production function can be applied to mental health. They then review the research on the determinants of mental health, focusing on the contributions of economists to this literature. They focus on three important inputs to mental health production: income, macroeconomic conditions, and employment.

E. Golberstein; S.H. Busch

2014-01-01T23:59:59.000Z

422

Solar system having improved heliostat and sensor mountings  

SciTech Connect

This specification discloses an improvement in a solar system having one or more collectors for receiving and using radiant energy from the sun and at least one and preferably a plurality of respective reflector means for reflecting the radiant energy onto the collectors. The improvement is characterized by having each reflector in the form of a heliostat that can be moved to maximize the radiant energy reflected onto its collector, driving motor for so moving each heliostat; firmly anchored support structure carrying each heliostat; and sensor connected by suitable controls with each drive motor for so moving each heliostat; the respective sensor being mounted on the same support structure as the heliostat and aligned in a straight line from the heliostat to its collector. With this construction, the sensor does not require an expensive and firmly anchored separate support structure to prevent receiving small surface movements different from those received by the heliostat.

Blake, F.A.; Northrup, L.L.

1980-10-14T23:59:59.000Z

423

Nucleon spin structure studies at COMPASS  

SciTech Connect

One of the main goal of the COMPASS experiment at CERN is the study of the spin structure of the nucleon in DIS, by scattering 160 GeV polarized muon beam on a longitudinally (or transversely) polarized 6LiD target. Besides the scattered muon, the particles produced in the deep inelastic scattering are detected by a two stage magnetic spectrometer equipped with state of the art tracking and particle ID detectors.The emphasis of COMPASS muon program is the direct determination of the gluon polarization {delta}G/G, accessed via asymmetries involving photon-gluon fusion mechanism (PGF). Both open charm production (detecting D0's), as well as production of height pT hadron pairs are used to tag PGF. Preliminary results for {delta}G/G based on the analysis of 2002 and 2003 data are shown. In addition, improved measurement of the deuteron structure function g{sub 1}{sup d} at small x, as well as studies of transverse distribution functions in the deuteron by measuring Collins and Sivers azimuthal asymmetries, are reported.

Marchand, Claude [CEA/DAPNIA/SPhN, CE Saclay, F-91191 Gif-sur-Yvette CEDEX (France)

2006-02-11T23:59:59.000Z

424

Sphericity determination using resonant ultrasound spectroscopy  

DOE Patents (OSTI)

A method is provided for grading production quantities of spherical objects, such as roller balls for bearings. A resonant ultrasound spectrum (RUS) is generated for each spherical object and a set of degenerate sphere-resonance frequencies is identified. From the degenerate sphere-resonance frequencies and known relationships between degenerate sphere-resonance frequencies and Poisson's ratio, a Poisson's ratio can be determined, along with a 'best' spherical diameter, to form spherical parameters for the sphere. From the RUS, fine-structure resonant frequency spectra are identified for each degenerate sphere-resonance frequency previously selected. From each fine-structure spectrum and associated sphere parameter values an asphericity value is determined. The asphericity value can then be compared with predetermined values to provide a measure for accepting or rejecting the sphere. 14 figs.

Dixon, R.D.; Migliori, A.; Visscher, W.M.

1994-10-18T23:59:59.000Z

425

CX-009665: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

5: Categorical Exclusion Determination 5: Categorical Exclusion Determination CX-009665: Categorical Exclusion Determination Mission Support Alliance Annual Categorical Exclusion for Air Conditioning Systems for Existing Equipment under 10 CFR 1021, Subpart o, Appendix B CX(s) Applied: B1.4 Date: 12/05/2012 Location(s): Washington Offices(s): River Protection-Richland Operations Office Mission Support Alliance (MSA) and its subcontractors perform installation or modification of air conditioning systems required for temperature control for operations of existing buildings, structures, infrastructures, and equipment in previously disturbed or developed areas. CX-009665.pdf More Documents & Publications CX-009099: Categorical Exclusion Determination CX-006627: Categorical Exclusion Determination

426

CX-005016: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

16: Categorical Exclusion Determination 16: Categorical Exclusion Determination CX-005016: Categorical Exclusion Determination A Public/Private Partnership for Improving Short Term Wind Energy Forecasts and Quantifying the Benefits to Utility CX(s) Applied: A9, B3.1 Date: 01/13/2011 Location(s): Saint Paul, Minnesota Office(s): Energy Efficiency and Renewable Energy, Golden Field Office WindLogics, in Saint Paul, Minnesota, is proposing to use federal funding to identify and quantify the benefits of improved National Oceanic and Atmospheric Administration (NOAA) foundational weather forecasts when applied to wind energy forecasting. Improved weather forecasts from NOAA would result in more efficient integration of wind energy forecasts on power grid system operations. DOCUMENT(S) AVAILABLE FOR DOWNLOAD

427

CX-000625: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

25: Categorical Exclusion Determination 25: Categorical Exclusion Determination CX-000625: Categorical Exclusion Determination New Membrane Electrode Assemblies Materials for Improved Direct Methanol Fuel Cell Performance, Durability and Cost CX(s) Applied: B3.6 Date: 01/21/2010 Location(s): Florida Office(s): Energy Efficiency and Renewable Energy, Golden Field Office The University of North Florida proposes to use Department of Energy and cost share funding to examine and implement improvements in performance, durability, manufacturability, and cost to the PolyFuel membrane electrode assemblies. The propsoed work includes optimizing membranes through post-processing, examining alternate membrane chemistries and composite membrane strategies, and improving membrane electrode stability and performance.

428

Categorical Exclusion Determinations: Office of Energy Efficiency and  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

2, 2010 2, 2010 CX-004383: Categorical Exclusion Determination Pine Hall Brick Company Energy Efficiency Improvements for Lighting, Kiln and Heating, Ventilation, and Air Conditioning Systems CX(s) Applied: B5.1 Date: 11/02/2010 Location(s): North Carolina Office(s): Energy Efficiency and Renewable Energy, National Energy Technology Laboratory November 2, 2010 CX-004382: Categorical Exclusion Determination Van Wingerden International Energy Efficiency Improvements for Climate Control System CX(s) Applied: B5.1 Date: 11/02/2010 Location(s): North Carolina Office(s): Energy Efficiency and Renewable Energy, National Energy Technology Laboratory November 2, 2010 CX-004378: Categorical Exclusion Determination Genetic Improvement of Switchgrass CX(s) Applied: B3.6 Date: 11/02/2010

429

CX-003516: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

6: Categorical Exclusion Determination 6: Categorical Exclusion Determination CX-003516: Categorical Exclusion Determination BioEnergy Initiative for Connecticut CX(s) Applied: A9, B3.6, B5.1 Date: 08/24/2010 Location(s): Connecticut Office(s): Energy Efficiency and Renewable Energy, Golden Field Office The University of Connecticut is requesting the Department of Energy funding to further evaluate the viability of poplar trees as a bioenergy crop. The initiative would also include field evaluation and genetic improvement of poplar trees to improve their bioenergy capabilities. The expected outcome of this project would be improved poplar trees as bioenergy feedstocks; new catalysts and lab reactors for biomass conversion; newly designed biofuel processing systems; outreach activities for educating the public about biofuels, inventories of bio-feedstocks; and

430

CX-001629: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

629: Categorical Exclusion Determination 629: Categorical Exclusion Determination CX-001629: Categorical Exclusion Determination Fort Worden State Park Energy Efficiency Improvements CX(s) Applied: B5.1 Date: 04/14/2010 Location(s): Washington Office(s): Energy Efficiency and Renewable Energy, Golden Field Office The Project is energy efficiency retrofits at the historic Fort Worden. These improvements are part of a long term project which has a goal of improving energy efficiencies in all of the 90+ buildings that are at Fort Worden State Park. The funding will be for the equipment installation for five (5) condensing unit boilers; window rehabilitation in two or more buildings which will include repair to historic sashes, weights, ropes, sills, caulking and sealing and then the installation of storm sashes over

431

CX-000792: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

0792: Categorical Exclusion Determination 0792: Categorical Exclusion Determination CX-000792: Categorical Exclusion Determination Infrastructure Improvements for General Plasma Science User CX(s) Applied: B3.6 Date: 02/08/2010 Location(s): New Jersey Office(s): Princeton Site Office, Science The proposed action would consist of the following General Plasma Science infrastructure improvement projects: (1) An upgrade of the existing laboratory free-surface liquid-metal flow experiment to study thermal convection under the influence of an applied magnet field; (2) Expansion of diagnostic capabilities for K[alpha]-line radiation of medium-Z ions utilizing the horizontal x-ray spectrometer on the existing National Spherical Torus Experiment; and (3) Fabrication of a laser induced fluorescence apparatus based on a tunable diode to improve diagnostic

432

Categorical Exclusion Determination Form  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

® ® ; ~. ; Program of field Office: Sandia Sile Office Project Title- From Sensing to Enhancing OraiD Processes (l3!dgs. 899, 980, AOQ MRN, and Univ of JIlinois) I oCiltjon- Sandia National Laboratories - New Mexico Proposed Action or project pescription- American Recovery and Reinyestment Acr r Sandia National LaboratoriesINew Mexico (SNLlNM) proposes a project (or basi~ research in human memory and investigating techniques Ihal could be used to improve memory. The project would also establish an eleclroencephalography (EEG) laboratory al Sandia Facility Operations DB 1.1 - Rate increases < innation (not p

433

SRS FTF Section 3116 Basis for Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

FTF Section 3116 Basis for Determination FTF Section 3116 Basis for Determination SRS FTF Section 3116 Basis for Determination Basis for Section 3116 Determination for Closure of F-Tank Farm at the Savannah River Site. In accordance with NDAA Section 3116, certain waste from reprocessing of spent nuclear fuel is not high-level waste if the Secretary of Energy, in consultation with the NRC, determines that the criteria in NDAA Section 3116(a) are met. This FTF 3116 Basis Document shows that those criteria are satisfied, to support a determination that the Secretary may make pursuant to NDAA Section 3116. This FTF 3116 Basis Document concerns the stabilized residuals in waste tanks and ancillary structures, those waste tanks, and the ancillary structures (including integral equipment) at the SRS FTF at the time of closure.

434

ENVIRONMENTAL REVIEW FOR CATEGORICAL EXCLUSION DETERMINATION  

NLE Websites -- All DOE Office Websites (Extended Search)

Blue Ridge Microwave Site Upgrade Project Blue Ridge Microwave Site Upgrade Project Grand and Summit Counties, Colorado A. Bl'ief Description of Proposal: Western Area Power Administration (Western) proposes three maintenance actions within previously disturbed or developed areas to upgrade electric service and improve system reliability for the Blue Ridge Microwave Site (Site) in Grand County, Colorado. Western's proposed actions are: installation of a new electric service distribution arrangement at the Site, replacement of three defective single pole wooden structures on the Green Mountain-Blue Ridge (GM-BLR) 2.4-kilovolt (kV) distribution line, and removal of trees to improve Western's microwave line-of-sight path. * Western's GM-BLR 2.4-kV distribution line provides electric service to several communication.

435

SNF project engineering process improvement plan  

SciTech Connect

This Engineering Process Improvement Plan documents the activities and plans to be taken by the SNF Project (the Project) to support its engineering process and to produce a consolidated set of engineering procedures that are fully compliant with the requirements of HNF-PRO-1819 (1819). These requirements are imposed on all engineering activities performed for the Project and apply to all life-cycle stages of the Project's systems, structures and components (SSCs). This Plan describes the steps that will be taken by the Project during the transition period to ensure that new procedures are effectively integrated into the Project's work process as these procedures are issued. The consolidated procedures will be issued and implemented by September 30, 1999.

KELMENSON, R.L.

1999-05-24T23:59:59.000Z

436

An improved integrally formed radio frequency quadrupole  

DOE Patents (OSTI)

An improved radio frequency quadrupole is provided having an elongate housing with an elongate central axis and top, bottom and two side walls symmetrically disposed about the axis, and vanes formed integrally with the walls, the vanes each having a cross-section at right angles to the central axis which tapers inwardly toward the axis to form electrode tips spaced from each other by predetermined distances. Each of the four walls, and the vanes integral therewith, is a separate structural element having a central lengthwise plane passing through the tip of the vane, the walls having flat mounting surfaces at right angles to and parallel to the control plane, respectively, which are butted together to position the walls and vane tips relative to each other. 4 figs.

Abbott, S.R.

1987-10-05T23:59:59.000Z

437

Characterization of improved InSb interfaces  

Science Journals Connector (OSTI)

Improved quality surfaces on n?type InSb have been produced using a low?temperature chemical vapor deposition (LTCVD) of SiO2 by pyrolytic decomposition of silane in the presence of oxygen. Preservation of the thin natural oxide on the InSbsurface through a suitable LTCVD process results in a surface state density ?1010 eV?1?cm?2 and without C–V hysteresis. Confirmation of these results is made by both quasistatic C–V and conductance measurements on MIS structures. Complications introduced by the presence of lateral nonuniformity of the LTCVD oxide and thus in the surface potential have been accounted for in the observed low density measurements. The presence chemical identification and thickness of the natural oxide both before and after the LTCVD process has been idependently confirmed by XPS. The apparent oxidation state and resultant electrical properties are identified with changes in LTCVD reactor conditions.

J. D. Langan; C. R. Viswanathan

1979-01-01T23:59:59.000Z

438

An Improved Tissue Culture System  

NLE Websites -- All DOE Office Websites (Extended Search)

Improved Improved Tissue Culture System for Embryogenic Callus Production and Plant Regeneration in Switchgrass (Panicum virgatum L.) Jason N. Burris & David G. J. Mann & Blake L. Joyce & C. Neal Stewart Jr. Published online: 10 October 2009 # Springer Science + Business Media, LLC. 2009 Abstract The increased emphasis on research of dedicated biomass and biofuel crops begs for biotechnology method improvements. For switchgrass (Panicum virgatum L.), one limitation is inefficient tissue culture and transformation systems. The objectives of this study were to investigate the utility of a new medium described here, LP9, for the production and maintenance of switchgrass callus and its regeneration, which also enables genetic transformation. LP9 medium is not based on Murashige and Skoog (MS) medium, the basal medium that all published switchgrass transformation has been

439

HVAC Improvements for Existing Houses  

NLE Websites -- All DOE Office Websites (Extended Search)

HVAC Improvements for Existing Houses HVAC Improvements for Existing Houses Speaker(s): Chryséis Bovagnet Date: September 5, 2002 - 12:00pm Location: Bldg. 90 Many older houses in the US are either not well designed from a thermal point of view or have HVAC (Heating Ventilation and Air Conditioning) systems in need of repairs or improvements. The building envelopes tend to have poor insulation and lots of leakage, and the HVAC systems are inefficient. The cooling/heating equipment is often located outside of the conditioned space (e.g. in attics or crawlspaces) with ducts that leak and have poor insulation, which cause energy loss and bad occupant comfort on peak days or in extreme climates. We developed a series of retrofits that will allow us to reduce the energy consumption of residential HVAC

440

A 3D electrical resistivity tomography survey to characterise the structure of a albeluvic tonguing horizon composed of distinct elementary pedological volumes  

Science Journals Connector (OSTI)

Abstract Water and gas transfer in porous media like soils are determined by their porous network, described by their structure. In soil, the horizon is usually considered to be elementary and homogeneous functioning system in the description of gas and water functioning. However, in some cases, a horizon is heterogeneous, and its structure is defined by the 3D arrangement of Elementary Pedological Volumes (EPVs). The horizon needs to be described in three dimensions to improve the characterisation of the structure and, consequently, the prediction of its hydraulic functioning. The aim of this study was to determine the feasibility of describing the 3D structure of a heterogeneous albeluvic tonguing soil horizon composed of a juxtaposition of silty white and clayey ochre EPVs, using 3D electrical resistivity tomography (ERT). Electrical measurements were compared with geostatistical analyses from soil photographs. We demonstrated that the resistivity of the white \\{EPVs\\} was greater than that of the ochre EPVs. In addition, the general soil structure and organisation of the soil horizon could be derived from the electrical resistivity data. We proposed a method to discretise the soil electrical resistivity into a binary system that corresponded to white and ochre volumes. Finally, a 3D representation of the soil structure was created that could be used to improve soil hydraulic models.

M. Séger; R. Guérin; A. Frison; H. Bourennane; G. Richard; I. Cousin

2014-01-01T23:59:59.000Z

Note: This page contains sample records for the topic "determination improved structure" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


441

Structured Descriptions  

E-Print Network (OSTI)

A descriptive formalism along with a philosophy for its use and expansion are presented wherein descriptions are of a highly structured nature. This descriptive system and the method of recognition are extended to the ...

Gabriel, Richard P.

442

Improving Process Cooling Tower Eddiciency  

E-Print Network (OSTI)

of the Thrity-Fifth Industrial Energy Technology Conference New Orleans, LA. May 21-24, 2013 7 Improving Cooling Tower Efficiency ? Two Improvements in Capacity/Performance 1. Filtration for water quality control Side stream filtration Make up water quality...-Fifth Industrial Energy Technology Conference New Orleans, LA. May 21-24, 2013 2 Types of Cooling Towers Forced Draft Towers ESL-IE-13-05-08 Proceedings of the Thrity-Fifth Industrial Energy Technology Conference New Orleans, LA. May 21-24, 2013 3 Types...

Turpish, W.

2013-01-01T23:59:59.000Z

443

Categorical Exclusion Determinations: American Recovery and Reinvestment  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

7, 2010 7, 2010 CX-001827: Categorical Exclusion Determination Recovery Act: Finding Large Aperture Fractures in Geothermal Resource Areas Using a 3-Component Long-Offset Surface Seismic Survey, PSlnSAR and Kinematic Structural Analysis CX(s) Applied: B3.1, A9 Date: 04/27/2010 Location(s): Washoe County, Nevada Office(s): Energy Efficiency and Renewable Energy, Golden Field Office April 26, 2010 CX-001951: Categorical Exclusion Determination Preparation of Energy Efficiency and Conservation Strategy CX(s) Applied: A8, A11, B5.1 Date: 04/26/2010 Location(s): Perth Amboy, New Jersey Office(s): Energy Efficiency and Renewable Energy April 26, 2010 CX-001950: Categorical Exclusion Determination Preparation of Energy Efficiency and Conservation Block Grant Application CX(s) Applied: A1, B5.1

444

Categorical Exclusion Determinations: Louisiana | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

January 12, 2010 January 12, 2010 CX-000486: Categorical Exclusion Determination Project Number WH-09-119 - Replace Fiberglass Covers/Troughs on Traveling Screens at West Hackberry Raw Water Intake Structure CX(s) Applied: B1.3 Date: 01/12/2010 Location(s): West Hackberry, Louisiana Office(s): Fossil Energy, Strategic Petroleum Reserve Field Office December 20, 2009 CX-000256: Categorical Exclusion Determination Louisiana City Baton Rouge CX(s) Applied: A9, A11, B2.2, B3.6, B5.1 Date: 12/20/2009 Location(s): Baton Rouge, Louisiana Office(s): Energy Efficiency and Renewable Energy, Golden Field Office December 17, 2009 CX-001263: Categorical Exclusion Determination Hire a Consultant CX(s) Applied: A9, A11, B2.5, B5.1 Date: 12/17/2009 Location(s): Livingston, Louisiana Office(s): Energy Efficiency and Renewable Energy

445

Categorical Exclusion Determinations: Colorado | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

September 5, 2012 September 5, 2012 CX-009189: Categorical Exclusion Determination (0675-1594) Eaton Corporation - Predictive Battery Management for Commercial Hybrid Vehicles CX(s) Applied: B3.6 Date: 09/05/2012 Location(s): Michigan, Minnesota, Colorado Offices(s): Advanced Research Projects Agency-Energy August 31, 2012 CX-009227: Categorical Exclusion Determination Beaver Creek- Big Sandy 115 Kilovolt Transmission Line Structure Replacements - Last Chance Fire CX(s) Applied: B4.13 Date: 08/31/2012 Location(s): Colorado Offices(s): Western Area Power Administration-Rocky Mountain Region August 29, 2012 CX-008913: Categorical Exclusion Determination High Resolution 3D Laser Imaging for Inspection, Maintenance, Repair and Operations - Phase II CX(s) Applied: A9, B3.6 Date: 08/29/2012

446

Categorical Exclusion Determinations: Michigan | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

February 16, 2012 February 16, 2012 CX-007936: Categorical Exclusion Determination Smart Grid Capable Electric Vehicle Supply Equipment CX(s) Applied: A1, A11 Date: 02/16/2012 Location(s): New Jersey, North Carolina, Michigan Offices(s): National Energy Technology Laboratory February 10, 2012 CX-007896: Categorical Exclusion Determination Bottom Fixed Platform Dynamics Models Assessing Surface Ice Interactions for Transitional Depth Structures in the Great Lakes CX(s) Applied: A9 Date: 02/10/2012 Location(s): Michigan Offices(s): Golden Field Office January 18, 2012 CX-007606: Categorical Exclusion Determination General Motors Battery Pack Assembly Plant - Electric Substation Upgrade CX(s) Applied: A9, A11 Date: 01/18/2012 Location(s): Michigan Offices(s): National Energy Technology Laboratory

447

Categorical Exclusion Determinations: Western Area Power  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

November 23, 2010 November 23, 2010 CX-004887: Categorical Exclusion Determination Cable and Conduit Addition Within the Fenced Area of the Buck Boulevard Substation CX(s) Applied: B4.6 Date: 11/23/2010 Location(s): Riverside County, California Office(s): Western Area Power Administration-Desert Southwest Region November 23, 2010 CX-007129: Categorical Exclusion Determination Buck Boulevard Substation CX(s) Applied: B4.6 Date: 11/23/2010 Location(s): Ripley, California Office(s): Western Area Power Administration-Desert Southwest Region November 5, 2010 CX-004898: Categorical Exclusion Determination Gila-Wellton-Mohawk (Structure Maintenance) CX(s) Applied: B1.3 Date: 11/05/2010 Location(s): Yuma County, Arizona Office(s): Western Area Power Administration-Desert Southwest Region

448

Categorical Exclusion Determinations: National Energy Technology Laboratory  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

May 10, 2013 May 10, 2013 CX-010285: Categorical Exclusion Determination Advancing Low Temperature Combustion and Lean Burning Engines for Light-and Heavy-Duty Vehicles CX(s) Applied: A9, B3.6 Date: 05/10/2013 Location(s): CX: none Offices(s): National Energy Technology Laboratory May 10, 2013 CX-010284: Categorical Exclusion Determination Construction of an Autogas Refueling Network CX(s) Applied: B5.22 Date: 05/10/2013 Location(s): West Virginia Offices(s): National Energy Technology Laboratory May 8, 2013 CX-010287: Categorical Exclusion Determination Understanding Nitrous Oxide Selective Catalytic Reduction Mechanism and Activity on Copper/Chabazite Structures throughout the Catalyst Life CX(s) Applied: A9, B3.6 Date: 05/08/2013 Location(s): CX: none Offices(s): National Energy Technology Laboratory

449

Categorical Exclusion Determinations: Arizona | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

November 23, 2009 November 23, 2009 CX-000202: Categorical Exclusion Determination Energy Efficiency and Renewable Energy in Schools CX(s) Applied: B5.1 Date: 11/23/2009 Location(s): Arizona Office(s): Energy Efficiency and Renewable Energy, Golden Field Office November 13, 2009 CX-007136: Categorical Exclusion Determination Coolidge-Oracle Pole Replacement CX(s) Applied: B4.6 Date: 11/13/2009 Location(s): Pinal County, Arizona Office(s): Western Area Power Administration-Desert Southwest Region November 13, 2009 CX-001118: Categorical Exclusion Determination Emergency Wood Pole Replacement at 59 Structures Located Along the Coolidge-Oracle 115-Kilovolt Transmission Line CX(s) Applied: B4.6 Date: 11/13/2009 Location(s): Pinal County, Arizona Office(s): Western Area Power Administration-Desert Southwest Region

450

Categorical Exclusion Determinations: Arizona | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

February 7, 2011 February 7, 2011 CX-007151: Categorical Exclusion Determination Gila-Knob Structure, Access Road Maintenance & Vegetation Removal CX(s) Applied: B4.6 Date: 02/07/2011 Location(s): Yuma County, AZ; Imperial County, CA, Arizona, California Office(s): Western Area Power Administration-Desert Southwest Region January 25, 2011 CX-005545: Categorical Exclusion Determination Installation of Metering and Circuit Breaker at Powell 69-Kilovolt Substation CX(s) Applied: B4.11 Date: 01/25/2011 Location(s): Page, Arizona Office(s): Western Area Power Administration-Colorado River Storage Project Management Center January 7, 2011 CX-007164: Categorical Exclusion Determination Prescott-Pinnacle Peak & Pinnacle Peak-Rogers Aerial Marker Ball Addition CX(s) Applied: B1.9

451

Categorical Exclusion Determinations: Arizona | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

July 8, 2010 July 8, 2010 CX-003196: Categorical Exclusion Determination Emergency Crossarm Replacement at Structure 39/7 and Access Road Maintenance along the Existing Tucson-Apache 115-Kilovolt Transmission Line in Pima County, Arizona CX(s) Applied: B1.3 Date: 07/08/2010 Location(s): Pima County, Arizona Office(s): Western Area Power Administration-Desert Southwest Region July 6, 2010 CX-003004: Categorical Exclusion Determination Arizona-Tribal Energy Program-Hualapai Tribe CX(s) Applied: A9, B3.1 Date: 07/06/2010 Location(s): Hualapai Tribe, Arizona Office(s): Energy Efficiency and Renewable Energy July 2, 2010 CX-002842: Categorical Exclusion Determination Overcoming Critical Barriers to United States Wind Power; A University-Industry Consortium CX(s) Applied: A9 Date: 07/02/2010

452

Categorical Exclusion Determinations: Maine | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

March 2, 2010 March 2, 2010 CX-001043: Categorical Exclusion Determination Verso Paper Corporation Waste Energy Recovery (Jay) CX(s) Applied: B1.24, B5.1 Date: 03/02/2010 Location(s): Jay, Maine Office(s): Energy Efficiency and Renewable Energy, National Energy Technology Laboratory March 2, 2010 CX-001042: Categorical Exclusion Determination Verso Paper Corporation Waste Energy Recovery (Bucksport) CX(s) Applied: B1.24, B5.1 Date: 03/02/2010 Location(s): Bucksport, Maine Office(s): Energy Efficiency and Renewable Energy, National Energy Technology Laboratory January 21, 2010 CX-002154: Categorical Exclusion Determination Recovery Act: DeepCwind Consortium National Research Program: Validation of Coupled Models and Optimization of Materials for Offshore Wind Structures CX(s) Applied: B3.1, B3.3, B3.6, A9

453

IGNITION IMPROVEMENT OF LEAN NATURAL GAS MIXTURES  

SciTech Connect

This report describes work performed during a thirty month project which involves the production of dimethyl ether (DME) on-site for use as an ignition-improving additive in a compression-ignition natural gas engine. A single cylinder spark ignition engine was converted to compression ignition operation. The engine was then fully instrumented with a cylinder pressure transducer, crank shaft position sensor, airflow meter, natural gas mass flow sensor, and an exhaust temperature sensor. Finally, the engine was interfaced with a control system for pilot injection of DME. The engine testing is currently in progress. In addition, a one-pass process to form DME from natural gas was simulated with chemical processing software. Natural gas is reformed to synthesis gas (a mixture of hydrogen and carbon monoxide), converted into methanol, and finally to DME in three steps. Of additional benefit to the internal combustion engine, the offgas from the pilot process can be mixed with the main natural gas charge and is expected to improve engine performance. Furthermore, a one-pass pilot facility was constructed to produce 3.7 liters/hour (0.98 gallons/hour) DME from methanol in order to characterize the effluent DME solution and determine suitability for engine use. Successful production of DME led to an economic estimate of completing a full natural gas-to-DME pilot process. Additional experimental work in constructing a synthesis gas to methanol reactor is in progress. The overall recommendation from this work is that natural gas to DME is not a suitable pathway to improved natural gas engine performance. The major reasons are difficulties in handling DME for pilot injection and the large capital costs associated with DME production from natural gas.

Jason M. Keith

2005-02-01T23:59:59.000Z

454

Restoration of Riparian and Aquatic Systems for Improved Aquatic Habitats in the Upper Columbia River Basin  

Science Journals Connector (OSTI)

In this paper, I explore linkages among soils, channel morphology, riparian hydrology, and stream-side vegetation to illustrate why, from an ecological perspective, instream structural manipulations to improve fi...

Robert L. Beschta

1997-01-01T23:59:59.000Z

455

Structural graphitic carbon foams  

SciTech Connect

Graphitic carbon foams are a unique material form with very high structural and thermal properties at a light weight. A process has been developed to produce microcellular, open-celled graphitic foams. The process includes heating a mesophase pitch preform above the pitch melting temperature in a pressurized reactor. At the appropriate time, the pressure is released, the gas nucleates bubbles, and these bubbles grow forming the pitch into the foam structure. The resultant foamed pitch is then stabilized in an oxygen environment. At this point a rigid structure exists with some mechanical integrity. The foam is then carbonized to 800 C followed by a graphitization to 2700 C. The shear action from the growing bubbles aligns the graphitic planes along the foam struts to provide the ideal structure for good mechanical properties. Some of these properties have been characterized for some of the foam materials. It is known that variations of the blowing temperature, blowing pressure and saturation time result in foams of variously sized with mostly open pores; however, the mechanism of bubble nucleation is not known. Therefore foams were blown with various gases to begin to determine the nucleation method. These gases are comprised of a variety of molecular weights as well as a range of various solubility levels. By examining the resultant structures of the foam, differences were noted to develop an explanation of the foaming mechanism.

Kearns, K.M.; Anderson, H.J. [Air Force Lab., Wright-Patterson AFB, OH (United States). Materials and Mfg. Directorate

1998-12-31T23:59:59.000Z

456

Measuring and Improving Cell Capability  

E-Print Network (OSTI)

Measuring and Improving Cell Capability by Tom Bering Rate Parts / Hour Parts / Car Good Parts 1000 ppm defects/part 1 ppm defects/part 0.1 ppm defects/part 0.001 ppm defects/part 3600 Good Parts / Hour Defect Every 20 Min. Defect Every 2 Weeks Defect Every 20 Weeks Defect Every 40 Years 5000 Good Parts = 1

Bone, Gary

457

Managing Critical Management Improvement Initiatives  

Directives, Delegations, and Requirements

Provides requirements and responsibilities for planning, executing and assessing critical management improvement initiatives within DOE. DOE N 251.59, dated 9/27/2004, extends this Notice until 10/01/2005. Archived 11-8-10. Does not cancel other directives.

2003-10-01T23:59:59.000Z

458

Determinants of Meme Popularity  

E-Print Network (OSTI)

Online social media have greatly affected the way in which we communicate with each other. However, little is known about what are the fundamental mechanisms driving dynamical information flow in online social systems. Here, we introduce a generative model for online sharing behavior and analytically show, using techniques from mathematical population genetics, that competition between memes for the limited resource of user attention leads to a type of self-organized criticality, with heavy-tailed distributions of meme popularity: a few memes "go viral" but the majority become only moderately popular. The time-dependent solutions of the model are shown to fit empirical micro-blogging data on hashtag usage, and to predict novel scaling features of the data. The presented framework, in contrast to purely empirical studies or simulation-based models, clearly distinguishes the roles of two distinct factors affecting meme popularity: the memory time of users and the connectivity structure of the social network.

Gleeson, James P; Baños, Raquel A; Moreno, Yamir

2015-01-01T23:59:59.000Z

459

Determination of Event Magnitudes with Correlated Data and Censoring: A Maximum Likelihood Approach  

Science Journals Connector (OSTI)

......explosions in granite at the Nevada Test Site and Algeria: joint determination...structure beneath Pahute Mesa, Nevada Test Site, Bull seism. Soc. Am., 77...explosions in granite at the Nevada Test Site and Algeria: joint determination......

K. L. McLaughlin; R. H. Shumway; T. W. McElfresh

1988-10-01T23:59:59.000Z

460

Sustaining Performance Improvements in Energy Intensive Industries  

E-Print Network (OSTI)

Experience has shown that significant opportunity for performance improvements exists in energy intensive operations. Often, efforts to improve efficiency focus on vendor-led initiatives to improve operations of particular equipment. This approach...

Moore, D. A.

2005-01-01T23:59:59.000Z

Note: This page contains sample records for the topic "determination improved structure" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


461

CX-007506: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

06: Categorical Exclusion Determination 06: Categorical Exclusion Determination CX-007506: Categorical Exclusion Determination Record of Categorical Exclusion for Bryan Mound Building BE-2 Drainage Improvements and Foundation Repair CX(s) Applied: B1.3 Date: 11/16/2011 Location(s): Texas Offices(s): Strategic Petroleum Reserve Field Office Subcontractor shall furnish all labor, materials, equipment, tools, transportation, supervision, mobile lifting equipment, and rigging required to repair timber piles which support Bryan Mound Building BE-2. Subcontractor shall modify the ground surface around the building with crushed stone to prevent soil washout and improve drainage conditions which led to disrepair of the building foundation. CX-007506.pdf More Documents & Publications CX-009716: Categorical Exclusion Determination

462

Categorical Exclusion (CX) Determinations By Date | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

3, 2013 3, 2013 CX-010294: Categorical Exclusion Determination Building For Re-Roofing Project CX(s) Applied: B1.23, B2.1, B2.5 Date: 05/03/2013 Location(s): Oregon Offices(s): National Energy Technology Laboratory May 3, 2013 CX-010292: Categorical Exclusion Determination Modification to the Petrography Laboratory CX(s) Applied: B2.3, B3.6 Date: 05/03/2013 Location(s): West Virginia Offices(s): National Energy Technology Laboratory May 3, 2013 CX-010291: Categorical Exclusion Determination Interstate Electrification Improvement CX(s) Applied: B5.1 Date: 05/03/2013 Location(s): Texas Offices(s): National Energy Technology Laboratory May 3, 2013 CX-010289: Categorical Exclusion Determination Interstate Electrification Improvement CX(s) Applied: B5.1 Date: 05/03/2013 Location(s): Texas

463

Categorical Exclusion Determinations: B3.6 | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

November 8, 2010 November 8, 2010 CX-004738: Categorical Exclusion Determination Improved Photovoltaic Thermal Panel (IPVT) CX(s) Applied: B3.6, B3.11 Date: 11/08/2010 Location(s): New Mexico Office(s): Sandia Site Office November 8, 2010 CX-004409: Categorical Exclusion Determination Petroleum Processing Efficiency Improvement CX(s) Applied: B3.6 Date: 11/08/2010 Location(s): Laramie, Wyoming Office(s): Fossil Energy, National Energy Technology Laboratory November 8, 2010 CX-004406: Categorical Exclusion Determination ArmorBelt Single Point Gas Lift System for Stripper Wells CX(s) Applied: B3.6 Date: 11/08/2010 Location(s): Chickasha, Oklahoma Office(s): Fossil Energy, National Energy Technology Laboratory November 8, 2010 CX-004404: Categorical Exclusion Determination ArmorBelt Single Point Gas Lift System for Stripper Wells

464

CX-007384: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

4: Categorical Exclusion Determination 4: Categorical Exclusion Determination CX-007384: Categorical Exclusion Determination Improving Recycling Capacity and Solid Waste Education in American Samoa CX(s) Applied: B1.31, B1.35, A9 Date: 12/21/2011 Location(s): American Samoa Offices(s): Golden Field Office The U.S. Department of Energy (DOE) provided funding to the American Samoa Government Territorial Energy Office under DOE's American Recovery and Reinvestment Act of 2009 Energy Efficiency and Conservation Block Grant (EECBG) Program. The American Samoa Government Territorial Energy Office is proposing to use $500,000 of that funding for the "Improving Recycling Capacity and Solid Waste Education in American Samoa" project. CX-007384.pdf More Documents & Publications CX-009566: Categorical Exclusion Determination

465

CX-004080: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

080: Categorical Exclusion Determination 080: Categorical Exclusion Determination CX-004080: Categorical Exclusion Determination Fisk University Nonproliferation Grant CX(s) Applied: B3.6 Date: 09/17/2010 Location(s): Tennessee Office(s): NNSA-Proliferation Detection The Department of Energy National Nuclear Security Administration proposes to provide financial assistance to Fisk University for scientific research. The financial assistance would be used to undertake laboratory studies on Strontium Iodide Crystals and study the relationship between the preparation and treatments of the starting materials and establish the relationship with the improved crystalline quality of the improved doped material. DOCUMENT(S) AVAILABLE FOR DOWNLOAD CX-004080.pdf More Documents & Publications CX-003993: Categorical Exclusion Determination

466

CX-004456: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

456: Categorical Exclusion Determination 456: Categorical Exclusion Determination CX-004456: Categorical Exclusion Determination Boysen-Copper Mountain Structure 98/1 Replacement Project, Fremont County, Wyoming CX(s) Applied: B1.3, B4.6 Date: 11/10/2010 Location(s): Fremont County, Wyoming Office(s): Western Area Power Administration-Rocky Mountain Region Western proposes to replace Structure 98/1 and conduct access road maintenance on Western's existing Boysen-Copper Mountain 115 kilovolt transmission line in Fremont County, Wyoming. Structure 98/1 is located on United States (US) Bureau of Reclamation land in the southeast 1/4 of Section 16, T. 5 north, R. 6 east, of the Wind River meridian, Wyoming near the Boysen State Park Headquarters. A cleared, level area (landing) will be constructed around the base of structure 98/1 for better equipment

467

CX-007154: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

7154: Categorical Exclusion Determination 7154: Categorical Exclusion Determination CX-007154: Categorical Exclusion Determination Liberty-Coolidge Structure Maintenance CX(s) Applied: B1.3 Date: 12/16/2010 Location(s): Maricopa County, Arizona Office(s): Western Area Power Administration-Desert Southwest Region Western proposes to conduct vegetation removal and maintenance at structures 2/1, 3/3, 3/5, 10/2, 13/5, 17/5, 18/5, 20/2, 20/3, 22/4, 22/8, 23/2,23/3,24/1,24/3,33/6,51/2,5413 & 56/3 of the existing Liberty-Coolidge 230- kilovolt transmission line. This work will consist of replacing bad structure poles, ground wires and anchors, crossarms & cross braces, insulators, conductors and hardware. Western will access structures using crew trucks and pickup trucks along existing access roads. This work is

468

CX-007169: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

169: Categorical Exclusion Determination 169: Categorical Exclusion Determination CX-007169: Categorical Exclusion Determination Saguaro-Oracle Vegetation Removal CX(s) Applied: B1.3 Date: 04/07/2011 Location(s): Pinal County, Arizona Office(s): Western Area Power Administration-Desert Southwest Region Western proposes to conduct vegetation removal between structures 0/3 and 0/4, 1/5 and 1/6, 3/1 and 3/2, 4/2 and 4/3, around structure 4/8, between structures 5/1 and 5/2 and around structure 5/4 of its Saguaro-Oracle 115- kilovolt transmission line, within Western's existing right-of-way. Western will access the vegetation removal areas using crew trucks along the existing access roads. Western will use a front end loader with a cut shredder attachment to knock down and chip wood vegetation. The debris will

469

CX-005936: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

936: Categorical Exclusion Determination 936: Categorical Exclusion Determination CX-005936: Categorical Exclusion Determination Erie to Terry Street and Lyons to Longmont Northwest 115 Kilovolt Transmission Line Structure Replacements, Boulder and Broomfield Counties, Colorado CX(s) Applied: B4.6 Date: 05/16/2011 Location(s): Boulder County, Colorado Office(s): Western Area Power Administration-Rocky Mountain Region Western proposes to replace nine existing wood pole H-frame structures along the Erie-Terry Street and Lyons-Longmont Northwest transmission lines between Longmont and Erie, Colorado. These transmission lines occur on private lands in Boulder and Broomfield counties, Colorado. Structure sites are located in and around the city of Longmont, in rural residential areas and in agricultural fields. The structures will be replaced with similar

470

CX-007143: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

7143: Categorical Exclusion Determination 7143: Categorical Exclusion Determination CX-007143: Categorical Exclusion Determination Empire-Electrical District 5 Double Circuit Upgrade CX(s) Applied: B1.3 Date: 03/08/2011 Location(s): Pinal County, Arizona Office(s): Western Area Power Administration-Desert Southwest Region Western proposes to replace structures and upgrade to a double circuit 230-kilovolt (kV) transmission line on its Empire-Electrical District #5 115-kV transmission line, within Western's existing right-of-way. This will include the rebuild of 9.2 miles of transmission line, replacing the H-frame structures with steel monopole structures with foundations, hardware and insulator replacement and adding a overhead ground-wire over the entire length of the project. Western will access the structure using

471

CX-007131: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

7131: Categorical Exclusion Determination 7131: Categorical Exclusion Determination CX-007131: Categorical Exclusion Determination Casa Grande-Empire Double Circuit Upgrade and Structure Replacement CX(s) Applied: B1.3 Date: 03/08/2011 Location(s): Pinal County, Arizona Office(s): Western Area Power Administration-Desert Southwest Region Western proposes to replace structures and upgrade to a double circuit 230- kilovolt (kV) transmission line on its Casa Grande-Empire 115-kV transmission line, from Thornton Road to its Empire Substation, within Western's existing right-of-way. This will include the rebuild of 13.2 miles of transmission line, replacing the H-frame structures with steel monopole structures with foundations, hardware and insulator replacement and adding a overhead ground-wire over the entire length of the project.

472

CX-008380: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

80: Categorical Exclusion Determination 80: Categorical Exclusion Determination CX-008380: Categorical Exclusion Determination Archer to Ault 230 Kilovolt Transmission Line Structure Replacement, Weld County, Colorado CX(s) Applied: B1.3 Date: 05/09/2012 Location(s): Colorado Offices(s): Western Area Power Administration-Rocky Mountain Region Western Area Power Administration (Western) proposes to replace an existing three pole wood structure along the Archer to Ault 230 kilovolt (kV) transmission line. The structure is located on private land adjacent to County Road 27 northwest of the town of Nunn in Weld County, Colorado. The structure will be replaced in-kind with wood poles of the same height, hardware, configuration, and at the same location. All work will be confined to Western's right-of way easement.

473

CX-007151: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

151: Categorical Exclusion Determination 151: Categorical Exclusion Determination CX-007151: Categorical Exclusion Determination Gila-Knob Structure, Access Road Maintenance & Vegetation Removal CX(s) Applied: B4.6 Date: 02/07/2011 Location(s): Yuma County, AZ; Imperial County, CA, Arizona, California Office(s): Western Area Power Administration-Desert Southwest Region Western proposes to conduct maintenance at structures of the existing Gila-Knob 161-kilovolt transmission line and any other structures east of 16/5, identified by maintenance crews while out in the field . This work will consist of replacing transmission poles, cross arms, cross braces and/or vegetation removal. Western also needs to repair erosion on the Imperial Irrigation District canal road and canal bank near structure 16-5.

474

CX-007143: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

43: Categorical Exclusion Determination 43: Categorical Exclusion Determination CX-007143: Categorical Exclusion Determination Empire-Electrical District 5 Double Circuit Upgrade CX(s) Applied: B1.3 Date: 03/08/2011 Location(s): Pinal County, Arizona Office(s): Western Area Power Administration-Desert Southwest Region Western proposes to replace structures and upgrade to a double circuit 230-kilovolt (kV) transmission line on its Empire-Electrical District #5 115-kV transmission line, within Western's existing right-of-way. This will include the rebuild of 9.2 miles of transmission line, replacing the H-frame structures with steel monopole structures with foundations, hardware and insulator replacement and adding a overhead ground-wire over the entire length of the project. Western will access the structure using

475

CX-003083: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

3083: Categorical Exclusion Determination 3083: Categorical Exclusion Determination CX-003083: Categorical Exclusion Determination Wood Pole Replacement of Ross-Vancouver Shipyard Number 1, Structure 2/3 in Fog Chamber Dump Area Number 2 CX(s) Applied: B1.3 Date: 07/07/2010 Location(s): Vancouver, Washington Office(s): Bonneville Power Administration Bonneville Power Administration (BPA) proposes to replace deteriorating wood poles and associated structural/electrical components (such as cross arms, insulators, guy anchors) on structure 2/3 of the Ross-Vancouver Shipyard Number 1 transmission line. Pole replacement will be in the same location as the existing structure. All work will be in accordance with the National Electrical Safety Code and BPA standards. DOCUMENT(S) AVAILABLE FOR DOWNLOAD CX-003083.pdf

476

CX-007168: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

168: Categorical Exclusion Determination 168: Categorical Exclusion Determination CX-007168: Categorical Exclusion Determination Rodgers-Cooolidge Structure Maintenance CX(s) Applied: B1.3 Date: 08/26/2011 Location(s): Pinal County, Arizona Office(s): Western Area Power Administration-Desert Southwest Region Western proposes to replace damaged structure foundation and leg extension at structure 25/3 along the existing Rogers-Coolidge 230-kilovolt transmission line. This will include providing temporary bracing to the structure, placing it on a steel plate laying across the surface of the ground during removal and replacement of the damaged leg and replacing the foundation, reinforced steel and associated hardware. The foundation replacement will occur within a 20- foot-wide x 20-foot-long x 10-foot-deep

477

CX-009530: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

30: Categorical Exclusion Determination 30: Categorical Exclusion Determination CX-009530: Categorical Exclusion Determination Artesia-Rangely Tap of the Hayden-Vernal 138 Kilovolt Transmission Line Bank Stabilization on Structure 20/2 CX(s) Applied: B1.3 Date: 10/29/2012 Location(s): Colorado Offices(s): Western Area Power Administration-Rocky Mountain Region Flooding in 2011 caused the White River to erode its riverbank near structure 20/2 on Western Area Power Administration's Artesia-Rangely section of the Hayden-Vernal transmission line. This structure is located approximately 1 mile west of the town of Rangely, Rio Blanco County, Colorado. The structure base is in jeopardy of undermining by the river and this may result in a failure of the transmission line. CX-009530.pdf More Documents & Publications

478

CX-000869: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

869: Categorical Exclusion Determination 869: Categorical Exclusion Determination CX-000869: Categorical Exclusion Determination Construction of Grade Control Structures in Pueblo and DP Canyons CX(s) Applied: B6.1 Date: 10/28/2009 Location(s): Pueblo Canyon, New Mexico Office(s): Los Alamos Site Office, NNSA-Headquarters Installation of grade-control structures to reduce the potential for transport of low-level polychlorinated biphenyl contamination in the sediment deposits of the Pueblo and DP Canyon watersheds. The grade-control structures would result in reduced-flow velocities and peak discharge during flood events and should reduce erosion of contaminated deposits downstream of the structures. DOCUMENT(S) AVAILABLE FOR DOWNLOAD CX-000869.pdf More Documents & Publications EA-1736: Final Environmental Assessment

479

CX-007150: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

0: Categorical Exclusion Determination 0: Categorical Exclusion Determination CX-007150: Categorical Exclusion Determination Gila-Knob Structure, Access Road Maintenance & Vegetation Removal CX(s) Applied: B4.6 Date: 08/02/2011 Location(s): Yuma County, AZ; Imperial County, CA, Arizona, California Office(s): Western Area Power Administration-Desert Southwest Region Western proposes to conduct maintenance at structures of the existing Gila-Knob 161-kilovolt transmission line and any other structures east of 16/5, identified by maintenance crews while out in the field. This work will consist of replacing transmission poles, cross arms, cross braces and/or vegetation removal. Western also needs to repair erosion on the Imperial Irrigation District canal road and canal bank near structure 16-5.

480

CX-007131: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

7131: Categorical Exclusion Determination 7131: Categorical Exclusion Determination CX-007131: Categorical Exclusion Determination Casa Grande-Empire Double Circuit Upgrade and Structure Replacement CX(s) Applied: B1.3 Date: 03/08/2011 Location(s): Pinal County, Arizona Office(s): Western Area Power Administration-Desert Southwest Region Western proposes to replace structures and upgrade to a double circuit 230- kilovolt (kV) transmission line on its Casa Grande-Empire 115-kV transmission line, from Thornton Road to its Empire Substation, within Western's existing right-of-way. This will include the rebuild of 13.2 miles of transmission line, replacing the H-frame structures with steel monopole structures with foundations, hardware and insulator replacement and adding a overhead ground-wire over the entire length of the project.