Powered by Deep Web Technologies
Note: This page contains sample records for the topic "determination gila-knob structure" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


CX-010545: Categorical Exclusion Determination | Department of...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Exclusion Determination CX-010545: Categorical Exclusion Determination Gila Knob Transmission Line Crossarm Replacement at Structure 183 CX(s) Applied: B4.6 Date: 0603...


CX-007151: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

151: Categorical Exclusion Determination 151: Categorical Exclusion Determination CX-007151: Categorical Exclusion Determination Gila-Knob Structure, Access Road Maintenance & Vegetation Removal CX(s) Applied: B4.6 Date: 02/07/2011 Location(s): Yuma County, AZ; Imperial County, CA, Arizona, California Office(s): Western Area Power Administration-Desert Southwest Region Western proposes to conduct maintenance at structures of the existing Gila-Knob 161-kilovolt transmission line and any other structures east of 16/5, identified by maintenance crews while out in the field . This work will consist of replacing transmission poles, cross arms, cross braces and/or vegetation removal. Western also needs to repair erosion on the Imperial Irrigation District canal road and canal bank near structure 16-5.


CX-007150: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

0: Categorical Exclusion Determination 0: Categorical Exclusion Determination CX-007150: Categorical Exclusion Determination Gila-Knob Structure, Access Road Maintenance & Vegetation Removal CX(s) Applied: B4.6 Date: 08/02/2011 Location(s): Yuma County, AZ; Imperial County, CA, Arizona, California Office(s): Western Area Power Administration-Desert Southwest Region Western proposes to conduct maintenance at structures of the existing Gila-Knob 161-kilovolt transmission line and any other structures east of 16/5, identified by maintenance crews while out in the field. This work will consist of replacing transmission poles, cross arms, cross braces and/or vegetation removal. Western also needs to repair erosion on the Imperial Irrigation District canal road and canal bank near structure 16-5.


CX-007149: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

49: Categorical Exclusion Determination 49: Categorical Exclusion Determination CX-007149: Categorical Exclusion Determination Gila-Knob Structure, Access Road Maintenance & Vegetation Removal Amendment 1 CX(s) Applied: B4.6 Date: 02/18/2011 Location(s): Yuma County, AZ; Imperial County, CA, Arizona, California Office(s): Western Area Power Administration-Desert Southwest Region Western proposes to conduct maintenance at structures of the existing Gila-Knob 161-kilovolt transmission line and any other structures east of 16/5, identified by maintenance crews while out in the field. This work will consist of replacing transmission poles, cross arms, cross braces and/or vegetation removal. Western also needs to repair erosion on the Imperial Irrigation District canal road and canal bank near structure 16-5.



Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

maintenance, maintenance, vegetation removal and structure maintenance at multiple structures along the existing, Gila-Knob 161-kV transmission line in Yuma County, Arizona and Imperial County, California RECORD OF CATEGORICAL EXCLUSION DETERMINATION A. Proposed Action: Western proposes to conduct maintenance at structures 1/4, 2/4,3/2,317,4/1,6/2,6/3,6/5,6/6,8/3,9/2,9/3,9/6, 10/6, 1017, 10/8, 11/1, 11/2, 11/3,11/4,12/3,12/4,12/5,12/6,1317,13/8,14/3, 14/4, 15/2, 15/5, 15/8, 16/1, 16/3, 16/4, 16/5, 19/1 of the existing Gila-Knob 161-kV transmission line and any other structures east of 16/5, identified by maintenance crews while out in the field. This work will consist of replacing transmission poles, cross arms, cross braces andlor vegetation removal. Western also needs to repair erosion on the Imperial Irrigation


Categorical Exclusion Determinations: Arizona | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

February 7, 2011 February 7, 2011 CX-007151: Categorical Exclusion Determination Gila-Knob Structure, Access Road Maintenance & Vegetation Removal CX(s) Applied: B4.6 Date: 02/07/2011 Location(s): Yuma County, AZ; Imperial County, CA, Arizona, California Office(s): Western Area Power Administration-Desert Southwest Region January 25, 2011 CX-005545: Categorical Exclusion Determination Installation of Metering and Circuit Breaker at Powell 69-Kilovolt Substation CX(s) Applied: B4.11 Date: 01/25/2011 Location(s): Page, Arizona Office(s): Western Area Power Administration-Colorado River Storage Project Management Center January 7, 2011 CX-007164: Categorical Exclusion Determination Prescott-Pinnacle Peak & Pinnacle Peak-Rogers Aerial Marker Ball Addition CX(s) Applied: B1.9


In Yuma County, Arizona and Imperial County, California RECORD OF CATEGORICAL EXCLUSION DETERMINATION  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

maintenance, vegetation removal and structure maintenance at multiple structures along the existing GiIa-Knob 161-kV transmission Line In Yuma County, Arizona and Imperial County, California RECORD OF CATEGORICAL EXCLUSION DETERMINATION A. Proposed Action: Western proposes to conduct maintenance at structures 1/4, 2/4,3/2 , 3/7,4/1,6/2, 6/3,6/5 , 6/6,8/3,9/2 , 9/3,9/6, 10/6, 10/7, 10/8, 11/1, 11/2, 11/3,11/4, 12/3,12/4, 12/5,12/6,13/7,13/8, 14/3, 14/4, 15/2 , 15/5, 15/8,16/1 , 16/3, 16/4, 16/5, 19/1 of the existing Gila-Knob 161-kV transmission line and any other structures east of 16/5, identified by maintenance crews while out in the field . This work will consist of replacing transmission poles, cross arms, cross braces andlor vegetation removal. Western also needs to repair erosion on the Imperial Irrigation


CX-011203: Categorical Exclusion Determination | Department of...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Damage Repairs to the Gila North Gila, Gila Knob, and Sonora San Luis Transmission Lines, near Yuma, Yuma County, Arizona CX(s) Applied: B4.6 Date: 08262013 Location(s):...


Page not found | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

01 - 4310 of 28,905 results. 01 - 4310 of 28,905 results. Download CX-003995: Categorical Exclusion Determination Akron City American Recovery and Reinvestment Act - Energy Efficiency and Conservation Block Grant Act 11 - Energy Efficiency Survey of Municipally-Owned Buildings CX(s) Applied: A9, A11 Date: 09/22/2010 Location(s): Akron, Ohio Office(s): Energy Efficiency and Renewable Energy, Golden Field Office http://energy.gov/nepa/downloads/cx-003995-categorical-exclusion-determination Download CX-007150: Categorical Exclusion Determination Gila-Knob Structure, Access Road Maintenance & Vegetation Removal CX(s) Applied: B4.6 Date: 08/02/2011 Location(s): Yuma County, AZ; Imperial County, CA, Arizona, California Office(s): Western Area Power Administration-Desert Southwest Region


Page not found | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

71 - 4380 of 28,905 results. 71 - 4380 of 28,905 results. Download EIS-0269: Record of Decision Long-Term Management and Use of Depleted Uranium Hexafluoride, Paduch, Kentucky; Portsmouth, Ohio; and Oak Ridge, Tennessee http://energy.gov/nepa/downloads/eis-0269-record-decision Download CX-007151: Categorical Exclusion Determination Gila-Knob Structure, Access Road Maintenance & Vegetation Removal CX(s) Applied: B4.6 Date: 02/07/2011 Location(s): Yuma County, AZ; Imperial County, CA, Arizona, California Office(s): Western Area Power Administration-Desert Southwest Region http://energy.gov/nepa/downloads/cx-007151-categorical-exclusion-determination Download EIS-0305: Notice Extending the Public Scoping Period for the Environmental Impact Statement Transuranic Waste Treatment Facility at Oak Ridge, Tennessee


California | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

24, 2011 24, 2011 CX-005321: Categorical Exclusion Determination Boeing Distribution Management System (BDMS) CX(s) Applied: A1, A9, A11, B1.2, B1.7 Date: 02/24/2011 Location(s): San Diego, California Office(s): Electricity Delivery and Energy Reliability, National Energy Technology Laboratory February 18, 2011 CX-007149: Categorical Exclusion Determination Gila-Knob Structure, Access Road Maintenance & Vegetation Removal Amendment 1 CX(s) Applied: B4.6 Date: 02/18/2011 Location(s): Yuma County, AZ; Imperial County, CA, Arizona, California Office(s): Western Area Power Administration-Desert Southwest Region February 16, 2011 At left, highly turbulent behavior as water flows into (clear) oil. At right, all turbulence is suppressed by using cornstarch. | Department of Energy Photo | Courtesy of Lawrence Livermore National Laboratory | Public Domain


Structure Determination of Echovirus 1  

Science Journals Connector (OSTI)

In the structure determination of echovirus 1, subtle interactions between crystallographic and non-crystallographic symmetries caused the space group to be ambiguous, but also allowed significant short cuts in the molecular-replacement calculations.

Filman, D.J.



Structure determination of porcine haemoglobin  

Science Journals Connector (OSTI)

To investigate a potential candidate material for making artificial red blood cells for supplement blood transfusion, the crystal structure of porcine haemoglobin was determined up to 1.8 ? resolution.

Lu, T.-H.



Magnetic Structure Determination from Neutron Diffraction Data  

NLE Websites -- All DOE Office Websites (Extended Search)

logo logo Magnetic Structure Determination from Neutron Diffraction Data September 17 - 20, 2012 logo Oak Ridge National Laboratory - Oak Ridge, Tennessee, USA About the Workshop Program Lecture Notes Useful Links Organizers Travel & Lodging Wireless Networking Photos filler About the Workshop molecule The Magnetic Structure Determination Workshop 2012 concluded on September 20. The aim of this workshop was to enhance the community studying magnetism in materials by learning from experts the essential theoretical foundations to magnetic representation analysis and work through real examples to gain experience in solving and refining magnetic structures from neutron powder and single crystal diffraction data. Invited speakers: Juan Rodríguez-Carvajal (ILL, Grenoble)


Granular Structure Determined by Terahertz Scattering  

E-Print Network (OSTI)

Light-scattering in the terahertz region is demonstrated for granular matter. A quantum-cascade laser is used in a benchtop setup to determine the angle-dependent scattering of spherical grains as well as coffee powder and sugar grains. For the interpretation of the form factors for the scattering from single particles one has to go beyond the usual Rayleigh-Gans-Debye theory and apply calculations within Mie theory. In addition to single scattering also collective correlations can be identified and extracted as a static structure factor.

Philip Born; Nick Rothbart; Matthias Sperl; Heinz-Wilhelm Hübers



Determination of Structural Carbohydrates and Lignin in Biomass...  

NLE Websites -- All DOE Office Websites (Extended Search)

Determination of Structural Carbohydrates and Lignin in Biomass Laboratory Analytical Procedure (LAP) Issue Date: April 2008 Revision Date: August 2012 (Version 08-03-2012) A....


What Determines the Likelihood of Structural Reforms?  

Science Journals Connector (OSTI)

Abstract We use data for a panel of 60 countries over the period 1980-2005 to investigate the main drivers of the likelihood of structural reforms. We find that: (i) external debt crises are the main trigger of financial and banking reforms; (ii) inflation and banking crises are the key drivers of external capital account reforms; (iii) banking crises also hasten financial reforms; and (iv) economic recessions play an important role in promoting the necessary consensus for financial, capital, banking and trade reforms, especially in the group of OECD-countries. Additionally, we also observe that the degree of globalisation is relevant for financial reforms, in particular in the group of non-OECD countries. Moreover, an increase in the income gap accelerates the implementation of structural reforms, but increased political fragmentation does not seem to have a significant impact.

Luca Agnello; Vitor Castro; João Tovar Jalles; Ricardo M. Sousa



Automating the determination of 3D protein structure  

SciTech Connect

The creation of an automated method for determining 3D protein structure would be invaluable to the field of biology and presents an interesting challenge to computer science. Unfortunately, given the current level of protein knowledge, a completely automated solution method is not yet feasible, therefore, our group has decided to integrate existing databases and theories to create a software system that assists X-ray crystallographers in specifying a particular protein structure. By breaking the problem of determining overall protein structure into small subproblems, we hope to come closer to solving a novel structure by solving each component. By generating necessary information for structure determination, this method provides the first step toward designing a program to determine protein conformation automatically.

Rayl, K.D.




E-Print Network (OSTI)

469. RECENT CRYSTAL STRUCTURE DETERMINATIONS BY NEUTRON DIFFRACTION AT OAK RIDGE By GEORGE M. BROWN and HENRI A. LEVY, Chemistry Division Oak Ridge National Laboratory (1), Oak Ridge, Tennessee, U. S. A ont été relevées grace au diffractomètre à neutrons d'Oak Ridge position- nant automatiquement les

Paris-Sud XI, Université de


Phylogeny versus body size as determinants of food web structure  

Science Journals Connector (OSTI)

...versus body size as determinants of food web structure Russell E. Naisbit 1 Rudolf...Changins-Wadenswil, 1260 Nyon, Switzerland. Food webs are the complex networks of trophic interactions...features. However, apparently realistic food webs can be generated by models invoking either...


Note: This page contains sample records for the topic "determination gila-knob structure" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


The Determination of Molecular Structure from Rotational Spectra  

DOE R&D Accomplishments (OSTI)

An analysis is presented concerning the average molecular configuration variations and their effects on molecular structure determinations. It is noted that the isotopic dependence of the zero-point is often primarily governed by the isotopic variation of the average molecular configuration. (J.R.D.)

Laurie, V. W.; Herschbach, D. R.



Method and apparatus for determining material structural integrity  

DOE Patents (OSTI)

Disclosed are a nondestructive method and apparatus for determining the structural integrity of materials by combining laser vibrometry with damping analysis to determine the damping loss factor. The method comprises the steps of vibrating the area being tested over a known frequency range and measuring vibrational force and velocity vs time over the known frequency range. Vibrational velocity is preferably measured by a laser vibrometer. Measurement of the vibrational force depends on the vibration method: if an electromagnetic coil is used to vibrate a magnet secured to the area being tested, then the vibrational force is determined by the coil current. If a reciprocating transducer is used, the vibrational force is determined by a force gauge in the transducer. Using vibrational analysis, a plot of the drive point mobility of the material over the preselected frequency range is generated from the vibrational force and velocity data. Damping loss factor is derived from a plot of the drive point mobility over the preselected frequency range using the resonance dwell method and compared with a reference damping loss factor for structural integrity evaluation.

Pechersky, M.J.



Recent developments in the PHENIX software for automated crystallographic structure determination  

Science Journals Connector (OSTI)

Recent developments in PHENIX, a new software system for automated crystallographic structure determination, are described.

Adams, P.D.



Structural Determination of the Hydrophobic Hydration Shell of Kr  

Science Journals Connector (OSTI)

We report the first direct measurement by extended x-ray absorption fine structure spectroscopy of the hydrophobic hydration shell of the noble gas krypton. Measurements were made in aqueous solution at gas pressures in the range 20 to 100 bars and at a temperature of 320 K. Data of excellent quality were collected taking advantage of the high brilliance of a third generation synchrotron radiation source. An advanced data analysis procedure has been applied to determine the Kr-O partial radial distribution function in the short range.

Adriano Filipponi; Daniel T. Bowron; Colin Lobban; John L. Finney



Structural determinants of tobacco vein mottling virus protease substrate specificity  

SciTech Connect

Tobacco vein mottling virus (TVMV) is a member of the Potyviridae, one of the largest families of plant viruses. The TVMV genome is translated into a single large polyprotein that is subsequently processed by three virally encoded proteases. Seven of the nine cleavage events are carried out by the NIa protease. Its homolog from the tobacco etch virus (TEV) is a widely used reagent for the removal of affinity tags from recombinant proteins. Although TVMV protease is a close relative of TEV protease, they exhibit distinct sequence specificities. We report here the crystal structure of a catalytically inactive mutant TVMV protease (K65A/K67A/C151A) in complex with a canonical peptide substrate (Ac-RETVRFQSD) at 1.7-{angstrom} resolution. As observed in several crystal structures of TEV protease, the C-terminus ({approx}20 residues) of TVMV protease is disordered. Unexpectedly, although deleting the disordered residues from TEV protease reduces its catalytic activity by {approx}10-fold, an analogous truncation mutant of TVMV protease is significantly more active. Comparison of the structures of TEV and TVMV protease in complex with their respective canonical substrate peptides reveals that the S3 and S4 pockets are mainly responsible for the differing substrate specificities. The structure of TVMV protease suggests that it is less tolerant of variation at the P1{prime} position than TEV protease. This conjecture was confirmed experimentally by determining kinetic parameters k{sub cat} and K{sub m} for a series of oligopeptide substrates. Also, as predicted by the cocrystal structure, we confirm that substitutions in the P6 position are more readily tolerated by TVMV than TEV protease.

Sun, Ping; Austin, Brian P.; Tozer, Jozsef; Waugh, David (Debrecen); (NCI)



E-Print Network 3.0 - assignment structure determination Sample...  

NLE Websites -- All DOE Office Websites (Extended Search)

structure determination... complete side- chain resonance ... Source: Donald, Bruce Randall - Departments of Biochemistry & Computer Science, Duke University Collection:...


Determining Factors Influencing Nuclear Envelope and Nuclear Pore Complex Structure.  

E-Print Network (OSTI)

The cell’s nuclear envelope (NE) has pores that are stabilized by nuclear pore complexes (NPC), large proteinaceous structures whose function is to mediate transport between the nucleus and cytoplasm. Although the transport process is well studied...

Gouni, Sushanth



Computer-Supported Protein Structure Determination by NMR  

Science Journals Connector (OSTI)

The relationship between amino acid sequence, three-dimensional structure and biological function of proteins is one of the most intensely pursued areas of molecular biology and biochemistry. In this context, ...

Peter Güntert



Determinants of Role Structure in Family Financial Management  

E-Print Network (OSTI)

Variables determining the role of husband and wife in family financial management are explored based on in-home, personal interviews. Financial tasks reflecting implementation activities and two groupings of decision ...

Rosen, Dennis L.; Granbois, Donald H.



Structural Basis of the Green–Blue Color Switching in Proteorhodopsin as Determined by NMR Spectroscopy  

Science Journals Connector (OSTI)

Structural Basis of the Green–Blue Color Switching in Proteorhodopsin as Determined by NMR Spectroscopy ... Consequently, the S0–S1 energy gap increases, resulting in the observed blue shift. ...

Jiafei Mao; Nhu-Nguyen Do; Frank Scholz; Lenica Reggie; Michaela Mehler; Andrea Lakatos; Yean-Sin Ong; Sandra J. Ullrich; Lynda J. Brown; Richard C. D. Brown; Johanna Becker-Baldus; Josef Wachtveitl; Clemens Glaubitz



Methodology and applications of high resolution solid-state NMR to structure determination of proteins  

E-Print Network (OSTI)

A number of methodological developments and applications of solid-state NMR for assignment and high resolution structure determination of microcrystalline proteins and amyloid fibrils are presented. Magic angle spinning ...

Lewandowski, Józef Romuald



Determination of transient atomic structure of laser-excited materials from time-resolved diffraction data  

SciTech Connect

The time evolution of the Bragg peaks of photo-excited gold nanofilms is measured using transmission ultrafast electron diffraction (UED) with 3.0 MeV electron pulses and the corresponding structure evolution is calculated using two-temperature molecular dynamics (2T-MD). The good agreement obtained between the measured and calculated Bragg peaks, over the full experimental timescale, enables the lattice temperature effects and the structural changes to be disentangled for the first time. The agreement demonstrates that 2T-MD is a reliable method for solving the inverse problem of structure determination of laser irradiated metals in UED measurements.

Giret, Yvelin [The Institute of Scientific and Industrial Research (ISIR), Osaka University, Mihogaoka 8-1, Ibaraki, Osaka 567-0047 (Japan) [The Institute of Scientific and Industrial Research (ISIR), Osaka University, Mihogaoka 8-1, Ibaraki, Osaka 567-0047 (Japan); Department of Physics and Astronomy, University College London, Gower Street, WC1E 6BT London (United Kingdom); Naruse, Nobuyasu; Murooka, Yoshie; Yang, Jinfeng; Tanimura, Katsumi [The Institute of Scientific and Industrial Research (ISIR), Osaka University, Mihogaoka 8-1, Ibaraki, Osaka 567-0047 (Japan)] [The Institute of Scientific and Industrial Research (ISIR), Osaka University, Mihogaoka 8-1, Ibaraki, Osaka 567-0047 (Japan); Daraszewicz, Szymon L.; Duffy, Dorothy M.; Shluger, Alexander L. [Department of Physics and Astronomy, University College London, Gower Street, WC1E 6BT London (United Kingdom)] [Department of Physics and Astronomy, University College London, Gower Street, WC1E 6BT London (United Kingdom)



Stealth carriers for low-resolution structure determination of membrane proteins in solution  

Science Journals Connector (OSTI)

Specifically deuterated phospholipid bilayer nanodiscs have been developed which give a minimal contribution to neutron scattering data when used in 100% D2O. These provide an optimal platform for low-resolution structural determination of membrane proteins and their complexes in solution.

Maric, S.



The determination of the in situ structure by nuclear spin contrast variation  

SciTech Connect

Polarized neutron scattering from polarized nuclear spins in hydrogenous substances opens a new way of contrast variation. The enhanced contrast due to proton spin polarization was used for the in situ structure determination of tRNA of the functional complex of the E.coli ribosome.

Stuhrmann, H.B. [GKSS Forschungszentrum, Geesthacht (Germany); Nierhaus, K.H. [Max-Planch-Institut fuer Molekulare Genetik, Berlin (Germany)




E-Print Network (OSTI)

laboratory-denatured and natively-disordered proteins, the number of restraints measured by the current NMR denatured and disordered proteins, we formulate the structure determination problem as the computation proteins are disordered or partially- disordered in their native state in solution. Such natively

Richardson, David


Lipid Bilayer Structure Determined by the Simultaneous Analysis of Neutron and X-Ray Scattering Data  

E-Print Network (OSTI)

Lipid Bilayer Structure Determined by the Simultaneous Analysis of Neutron and X-Ray Scattering) and dipalmitoylphosphatidylcholine (DPPC) bilayers by simultaneously analyzing x-ray and neutron scattering data. The neutron data electron and neutron scattering density profiles. A key result of the analysis is the molecular surface

Nagle, John F.


Improvement in accuracy of protein local structure determination from NMR data  

Science Journals Connector (OSTI)

A method for determining the most probable conformations of amino acid residues from semiquantitatively estimated nuclear Overhauser effects (NOEs) and coupling constants was developed and coded in the FiSiNOE-2 program. This program is a new version of the FiSiNOE program, utilizing NMR data with complementary knowledge-based information on protein structures. In FiSiNOE-2 this information is conformational clusters of the dihedral angles (?, ?, gc1) derived from the Protein Data Bank. The FiSiNOE-2 method determines mathematical expectations and standard deviations for the angles ?, ?, and ?1, and provides direct determination of the local structure of proteins from NMR data before building and refining their spatial structure. The results of the FiSiNOE-2 program in combination with the results of the habas program may be used to provide stereospecific assignments of a pair of ?-methylene protons and to determine precisely allowed ranges of the ?, ?, and ?1 dihedral angles consistent with a given set of NMR data. To do this, a new procedure, combine, was developed. Computational experiments with the NMR data simulated from X-ray coordinates of the BPTI showed that use of the combine procedure, in comparison with results obtained when habas was used alone, increases by more than 30% the number of correct assignments for ?CH2 groups and reduces the total lengths of the combined angular intervals for ?, ?, and ?1 angles to 1.9, 2.4, and 1.8 times, respectively. In contrast to the redundant dihedral angle constraints (REDAC) strategy, that derives REDAC from preliminary calculations of the complete structure, the combine procedure reduces the length of the angular intervals before using the variable target function algorithm to determine spatial structures of proteins. This feature of the combine strategy may be especially beneficial in the cases when there is lack of long-range NOEs.

Simon Sherman; Stanley Sclove; Leonid Kirnarsky; Igor Tomchin; Oleg Shats



Application of electron microscopy and x-ray structural analysis for the determination of sizes of structural elements in nanocrystalline materials (Review)  

Science Journals Connector (OSTI)

The possibilities of determining the sizes of structural elements in various nanocrystalline materials by electron microscopy and X-ray structural analysis are analyzed. It is shown that these sizes depend on ...

Yu. D. Yagodkin; S. V. Dobatkin



Structural determination of Si(100)2×2-Al by tensor LEED  

Science Journals Connector (OSTI)

The structure of a Si(100)2×2-Al surface at 0.5 monolayers is determined by tensor low-energy electron diffraction. The parallel dimer model is more favorable than the orthogonal dimer model. The R factor for the optimized parallel dimer structure is 0.15. The bond length of the Al dimer is almost equal to the value expected from the Pauling covalent radii. All bond lengths in five surface layers including Si-Al and Si dimer bonds are within the range of 5% from the bulk value. The distortion extends at least through the first five layers into the bulk.

H. Sakama; K. Murakami; K. Nishikata; A. Kawazu



COBRA: Determining Atomic Positions in Thin-Film Structures and Interfaces  

NLE Websites -- All DOE Office Websites (Extended Search)

COBRA: Determining Atomic Positions in Thin-Film Structures and Interfaces COBRA: Determining Atomic Positions in Thin-Film Structures and Interfaces Coherent Bragg rod analyses (COBRA) experiments using synchrotron x-rays at Argonne's Advanced Photon Source (MHATT-CAT and PNC-CAT beamlines) directly revealed the sub-angstrom atomic interaction of epitaxial films with substrates. Information on how atoms in the adjoining layers of the film and substrate rearrange to mimic each other may lead to improvements in semiconductor manufacturing and the development of novel heterostructure materials, such as multilayer ferroelectrics, magnetic nanostructures and thin film superconductors. COBRA electron density map of a Gd2O3 film on a gallium arsenide substrate. The peaks correspond to folded Gd atomic positions parallel to the plane of the substrate.

Note: This page contains sample records for the topic "determination gila-knob structure" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Determination of the structure of oxidised Desulfovibrio africanus ferredoxin I by 1H NMR spectroscopy and comparison of its solution structure with its crystal structure  

Science Journals Connector (OSTI)

The solution structure of the 64 amino acid Fe4S4ferredoxin I fromDesulfovibrio africanus has been determined using two-dimensional 1H NMR spectroscopy. Sequence-specific assignments were obtained for 59 amino acid residues and the structure determined with the program DIANA on the basis of 549 nuclear Overhauser enhancement (NOE) upper distance limits, and four dihedral angle and 52 distance constraints for the Fe4S4cluster. The NMR structure was refined using the simulated annealing and energy minimisation protocols of the program X-PLOR to yield a final family of 19 structures selected on the basis of good covalent geometry and minimal restraint violations. The r.m.s.d. values to the average structure for this family are 0.49(±0.07) Å and 0.94(±0.09) Å for the backbone and heavy-atoms of residues 3 to 62, respectively. The NMR structure has been compared to the previously reported X-ray structures for the two molecules within the asymmetric unit of the crystal, which have a network of seven hydrogen bonds between them. This intermolecular interface, involving residues 38, 40 to 43 and 46, has the same conformation in the solution structures showing that the crystal packing does not perturb the structure. There are three regions in which the NMR and X-ray structures differ: around the cluster, a turn involving residues 8 to 10, and a loop involving residues 29 to 32. In the family of solution structures the backbone of the loop region incorporating residues 29 to 32 is well-defined whilst in both of the X-ray molecules it is ill-defined. The small differences between the X-ray and NMR structures for the cluster environment and the turn between residues 8 to 10 probably reflects a lack of NMR constraints. The observation of relatively rapid amide NH hydrogen exchange of NH groups close to the cluster, together with rapid flipping for Phe25, which is also close to the cluster, indicates that the cluster environment is more dynamic than the corresponding regions of related Fe/S proteins.

Sharon L. Davy; Michael J. Osborne; Geoffrey R. Moore



Ab initio Structure Determination of Mg10Ir19B16  

SciTech Connect

The ab initio structure determination of a novel unconventional noncentro-symmetric superconductor Mg{sub 10}Ir{sub 19}B{sub 16} (T{sub c} = 5 K) has been performed using a method that involves a combination of experimental data and calculations. Electron diffraction, X-ray powder diffraction, phase estimation routines, quantum mechanical calculations, high-resolution electron microscopy, and structural chemistry arguments are used. With the strengths of different methods used to eliminate the ambiguities encountered in others, the complete structure, including a very light B atom, has been determined with a high accuracy from impure polycrystalline powder samples, which suggests that the type of analysis described may be used to successfully address other similar intractable problems. The solved structure of Mg{sub 10}Ir{sub 19}B{sub 16} shows a complex nature that irregular coordination environments preclude a conversional description of compact packing of coordination polyhedra; however, it can be easier understood as ordered in an onion-skin-like series of nested polyhedra.

Xu, Qiang [Delft University of Technology, Delft, Netherlands; Klimczuk, T. [Princeton University; Gortenmulder, T. [Universitate Amsterdam; Jansen, J. [Delft University of Technology, Delft, Netherlands; McGuire, Michael A [ORNL; Cava, R. J. [Princeton University; Zandbergen, H [Delft University of Technology, Delft, Netherlands



Limits of NMR structure determination using variable target function calculations: ribonuclease T1, a case study  

Science Journals Connector (OSTI)

Limits of NMR structure determination using multidimensional NMR spectroscopy, variable target function calculations and relaxation matrix analysis were explored using the model protein ribonuclease T1(RNase T1). The enzyme consists of 104 amino acid residues and has a molecular mass of approximately 11 kDa. Primary experimental data comprise 1856 assigned NOE intensities, 493 3J coupling constants and 62 values of amid proton exchange rates. From these data, 2580 distance bounds, 168 allowed ranges for torsional angles and stereospecific assignments for 75% of ?-methylene protons as well as for 80% of diastereotopic methyl groups were derived. Whenever possible, the distance restraints were refined in a relaxation matrix analysis including amid proton exchange data for improvement of lower distance limits. Description of side-chain conformations were based on various models of motional averaging of 3J coupling constants. The final structure ensemble was selected from the starting ensemble comparing the global precision of structures with order parameters derived from 15N relaxation time measurements. Significant differences between the structure of \\{RNase\\} T1 in solution and in the crystal became apparent from a comparison of the two highly resolved structures.

Stefania Pfeiffer; Yasmin Karimi-Nejad; Heinz Rüterjans



Determination of accidental forklift truck impact forces on drive-in steel rack structures  

Science Journals Connector (OSTI)

The paper addresses the problem of determining the accidental forklift truck impact forces on steel storage racks. Based on first principles of mechanics, simple models of a loaded forklift truck and a drive-in racking structure are presented. Model masses, as well as stiffness and damping coefficients are calibrated against experimental results obtained from tests of a forklift truck and a drive-in racking structure. Comparisons between experimental results and solutions obtained from the simple mechanical models show that the simple models accurately reproduce the static and dynamic behaviours of their associated structures. Based on the drive-in rack impact test results presented in a companion paper (Gilbert and Rasmussen, submitted for publication) [1] and the simple mechanical models for drive-in racks, actual impact forces are calculated and presented. Finally, using the impact test results and the simple mechanical models, the actual motion of the forklift truck body is calculated. This motion, being a common characteristic to all drive-in racking impacts, allows impact forces to be obtained for various pallet loads, impact elevations and rack characteristics. Thus, the paper concludes with a general method for calculating forces generated under forklift truck impact.

Benoit P. Gilbert; Kim J.R. Rasmussen




E-Print Network (OSTI)

Towards Structural Determination of the Water-splitting Enzyme PURIFICATION, CRYSTALLIZATION functions as a water/plastoquinone oxidoreductase in the thylakoid membrane of chloroplasts and cyanobacteria yielding oxygen, protons, and reduced plastoqui- none by the splitting of water. Powered

Roegner, Matthias


Report of the Ad Hoc Committee to Determine the Needs and Structure of UW-Madison's Research Enterprise  

E-Print Network (OSTI)

1 Report of the Ad Hoc Committee to Determine the Needs and Structure of UW-Madison's Research the University of Wisconsin-Madison's preeminence in research and graduate education. The ad hoc committee has

Sheridan, Jennifer


Solid state nuclear magnetic resonance methodology and applications to structure determination of peptides, proteins and amyloid fibrils  

E-Print Network (OSTI)

Several methodological developments and applications of multidimensional solid-state nuclear magnetic resonance to biomolecular structure determination are presented. Studies are performed in uniformly 3C, 15N isotope ...

Jaroniec, Christopher P



Method of Determining the Extent to which a Nickel Structure has been Attached by a Fluorine-Containing Gas  

DOE Patents (OSTI)

The method of determining the extent to which a nickel structure has been attacked by a halogen containing gas to which it has been exposed which comprises preparing a quantity of water substantially free from dissolved oxygen, passing ammonia gas through a cuprammonium solution to produce ammonia substantially free from oxygen, dissolving said oxygen-free ammonia in said water to produce a saturated aqueous ammonia solution free from uncombined oxygen, treating at least a portion of said nickel structure of predetermined weight with said solution to dissolve nickel compounds from the surface of said structure without dissolving an appreciable amount of said nickel and analyzing the resulting solution to determine the quantity of said nickel compounds that was associated with said said portion of said structure to determine the proportion of combined nickel in said nickel structure.

Brusie, James P.



A Laves phase-body-centered cubic structural relationship determined using high voltage electron microscopy  

SciTech Connect

High energy electron and ion irradiation of a TiCr{sub 2} Laves compound were found previously to result in a transformation to a body-centered cubic (bcc) solid solution. In the case of electron irradiation, the precipitating bcc phase exhibits preferential crystallographic orientation with respect to the initial compound crystal for irradiation temperatures above 200 K. This article presents an analysis of the electron diffraction data gathered in the course of the electron irradiation-induced Laves phase to bcc transformation in TiCr{sub 2}. A structural relationship between the bcc and Laves compound crystal lattices is determined which can account for all observations of preferentially oriented bcc precipitates. The significance of this mechanism for transformations between bcc and the Laves phases is discussed. In addition, the possible significance for deformation mechanisms of the Laves compounds is explored.

Sinkler, W. [GKSS Forschungszentrum, Geesthacht (Germany). Inst. fuer Werkstofforschung] [GKSS Forschungszentrum, Geesthacht (Germany). Inst. fuer Werkstofforschung



Myosin head orientation: a structural determinant for the Frank-Starling relationship  

SciTech Connect

The cellular mechanism underlying the Frank-Starling law of the heart is myofilament length-dependent activation. The mechanism(s) whereby sarcomeres detect changes in length and translate this into increased sensitivity to activating calcium has been elusive. Small-angle X-ray diffraction studies have revealed that the intact myofilament lattice undergoes numerous structural changes upon an increase in sarcomere length (SL): lattice spacing and the I{sub 1,1}/I{sub 1,0} intensity ratio decreases, whereas the M3 meridional reflection intensity (I{sub M3}) increases, concomitant with increases in diastolic and systolic force. Using a short ({approx}10 ms) X-ray exposure just before electrical stimulation, we were able to obtain detailed structural information regarding the effects of external osmotic compression (with mannitol) and obtain SL on thin intact electrically stimulated isolated rat right ventricular trabeculae. We show that over the same incremental increases in SL, the relative changes in systolic force track more closely to the relative changes in myosin head orientation (as reported by IM3) than to the relative changes in lattice spacing. We conclude that myosin head orientation before activation determines myocardial sarcomere activation levels and that this may be the dominant mechanism for length-dependent activation.

Farman, Gerrie P.; Gore, David; Allen, Edward; Schoenfelt, Kelly; Irving, Thomas C.; de Tombe, Pieter P. (IIT); (UIC)



Experimental determination of the effective structure-function parameter for atmospheric turbulence  

Science Journals Connector (OSTI)

The effective structure-function parameter for scattering by atmospheric turbulentvelocityfluctuations has normally been assumed to be C eff 2 =4C V 2 /c 0 2 where C V 2 is the velocitystructure-function parameter and c 0 the sound speed. However a new derivation by Ostashev [WavesRandom Media4 403–428 (1994)] which takes into account the vectorial nature of the wind velocity field suggests that C eff 2 =22C V 2 /3c 0 2 . An experiment was designed to determine the correct value of the coefficient. Sound-pressure amplitude variances were monitored for several discrete frequencies between 380 and 3800 Hz at distances up to 250 m. Cup and hot-wire anemometers were used to determine C V 2 . A theory for scattering by inertial-subrange turbulence was then used to calculate the C eff 2 coefficient from the amplitude variance and C V 2 . Datasets recorded under different atmospheric conditions yielded different relationships between the coefficients and failed to verify either the 4 or 22/3 value. Some possible explanations for this behavior are discussed including the need for more realistic meteorological modeling.

D. K. Wilson; D. I. Havelock; M. Heyd; M. J. Smith; J. M. Noble; H. J. Auvermann



Surface structure determination from scattering and recoiling: W(211) and W(211)-p(1×2)-O  

Science Journals Connector (OSTI)

Time-of-flight scattering and recoiling spectrometry with detection of both neutrals and ions for structure determinations is presented and applied to the clean W(211)-p(1×1) and W(211)-p(1×2)-O structures. Experimental data are presented in the form of scattering and recoiling intensities versus beam incident angle and scattering and recoiling structural contour maps. The clean surface is relaxed both laterally and vertically from the bulk truncated structure. Oxygen atoms occupy threefold trough sites where they are bound to two first-layer and one second-layer W atoms.

J. W. Rabalais; O. Grizzi; M. Shi; H. Bu



Ethylene adsorbed on Ni(110): An experimental and theoretical determination of the two-dimensional band structure  

Science Journals Connector (OSTI)

We have investigated the saturated ethylene layer on Ni(110) by low-energy electron diffraction (LEED), angle-resolved ultraviolet photoemission spectroscopy (ARUPS), and near-edge x-ray-absorption fine structure (NEXAFS). This layer exhibits a c(2×4) LEED pattern that corresponds to a structure containing two adsorbates per primitive unit cell. The ethylene molecules are adsorbed with the molecular plane parallel to the surface and the C-C axis preferentially aligned along the [11¯0] direction of the substrate, as is independently determined from the ARUPS and NEXAFS experiments. The two-dimensional (2D) adsorbate band structure is determined from the ARUPS spectra at various photon energies. Except for the ? orbital, all ethylene-derived bands show significant dispersion (up to 2 eV), but no splitting as would be expected for a structure with two molecules per unit cell. The experimentally determined band structure is reproduced in all details by extended-Hückel-theory calculations for an unsupported ethylene layer. The structural model derived from LEED, ARUPS, and NEXAFS is confirmed both by force field and by the 2D band-structure calculations. This indicates that the adsorbate-adsorbate interactions are essentially decoupled from the adsorbate-substrate interaction, that is responsible for the chemisorption bond.

M. Weinelt; W. Huber; P. Zebisch; H.-P. Steinrück; B. Reichert; U. Birkenheuer; N. Rösch



Methods used in the structure determination of bovine mitochondrial F1 ATPase  

Science Journals Connector (OSTI)

The structure of bovine mitochondrial F1 ATPase (372 kDa) was solved to 2.8 Å resolution using only one derivative compound. The structure solution depended on careful data collection and processing in conjunction with `solvent flipping'.

Abrahams, J.P.



Primary Structure and Solution Conditions Determine Conformational Ensemble Properties of Intrinsically Disordered Proteins.  

E-Print Network (OSTI)

??Intrinsically disordered proteins (IDPs) are a class of proteins that do not exhibit well-defined three-dimensional structures. The absence of structure is intrinsic to their amino… (more)

Mao, Albert Hsuan-Han



Geometry of the Ag{001}-c (2×2)Cl structure as determined by He diffraction  

Science Journals Connector (OSTI)

The structure of the Ag{001}-c (2×2)Cl surface has been studied with He-atom diffraction. Two proposed Cl binding geometries have been considered as structural alternatives: the fourfold-hollow simple overlayer model and a mixed layer of coplanar Ag and Cl. We have calculated the repulsive He potential, based on self-consistent charge densities of the target, for both configurations. The two geometries are easily distinguished. The charge densities for the overlayer structure yield a corrugation which is in good agreement with the scattering data and lead to an unambiguous selection between the two structural models. We have further examined the possibility that the Cl overlayer undergoes a structural phase transition or irreversibly disorders at elevated temperatures. We find no change in the structure for temperatures up to 650 K, at which point Cl leaves the surface.

M. J. Cardillo, G. E. Becker, D. R. Hamann, J. A. Serri, L. Whitman, and L. F. Mattheiss



Facilitation of protein 3-D structure determination using enhanced peptide amide deuterium exchange mass spectrometry (DXMS)  

E-Print Network (OSTI)

hydrophobic interaction in protein folding. Proc Natl Acad1999;28:1-27. 15. Protein Folding, Dynamics, and StructuralHydrogen exchange and protein folding. Curr. Opin. Struct.

Pantazatos, Dennis Peter



Determining the size-dependent structure of ligand-free gold-cluster ions  

Science Journals Connector (OSTI)

...size-dependence of the methanol C-O stretching frequency, as well as Car-Parrinello calculations of vibrational frequencies and structures...decahedral (5) can be clearly ruled out. Even the singly defective tetrahedral isomer (2) or the distorted fcc structure (4...



Structure determination of thin CoFe films by anomalous x-ray diffraction  

SciTech Connect

This work reports on the investigation of structure-property relationships in thin CoFe films grown on MgO. Because of the very similar scattering factors of Fe and Co, it is not possible to distinguish the random A2 (W-type) structure from the ordered B2 (CsCl-type) structure with commonly used x-ray sources. Synchrotron radiation based anomalous x-ray diffraction overcomes this problem. It is shown that as grown thin films and 300 K post annealed films exhibit the A2 structure with a random distribution of Co and Fe. In contrast, films annealed at 400 K adopt the ordered B2 structure.

Gloskovskii, Andrei; Stryganyuk, Gregory; Ouardi, Siham [Institut fuer Anorganische und Analytische Chemie, Johannes Gutenberg-Universitaet, 55099 Mainz (Germany); Fecher, Gerhard H.; Felser, Claudia [Institut fuer Anorganische und Analytische Chemie, Johannes Gutenberg-Universitaet, 55099 Mainz (Germany); Max Planck Institute for Chemical Physics of Solids, D-01187 Dresden (Germany); Hamrle, Jaroslav; Pistora, Jaromir [Department of Physics and Nanotechnology Centre, VSB-Technical University of Ostrava, 70833 Ostrava (Czech Republic); Bosu, Subrojati; Saito, Kesami; Sakuraba, Yuya; Takanashi, Koki [Institute for Materials Research (IMR), Tohoku University, Sendai 980-8577 (Japan)



Structure determination of human Fas apoptosis inhibitory molecule and identification of the critical residues linking the interdomain interaction to the anti-apoptotic activity  

Science Journals Connector (OSTI)

The structures of N-terminal and C-terminal domains of the human Fas apoptosis inhibitory molecule were determined. Structural and biochemical analyses of the two domains linked the interdomain interaction to the anti-apoptotic activity.

Li, G.


Note: This page contains sample records for the topic "determination gila-knob structure" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Determining soft segment structure-property effects in the enhancement of segmented polyurethane performance  

E-Print Network (OSTI)

Liquid Crystalline Elastomer (LCE)-inspired segmented polyurethane elastomers possessing widely different extents of ordering were created to mimic the hierarchical structure of the continuous matrix and superior mechanical ...

Waletzko, Ryan Scott



Identification of the first small-molecule ligand of the neuronal receptor sortilin and structure determination of the receptor-ligand complex  

Science Journals Connector (OSTI)

The identification of the first small-molecule ligand of the neuronal receptor sortilin and structure determination of the receptor-ligand complex are reported.

Andersen, J.L.



NMR characterization and solution structure determination of the oxidized cytochrome c7 from Desulfuromonas?acetoxidans  

Science Journals Connector (OSTI)

...of heme proteins deposited in the Protein Data Bank. diana calculations, including the redundant angle strategy routine ( redac ) (30), were performed following the procedure and with the parameters already used by us for the determination of other...

Lucia Banci; Ivano Bertini; Mireille Bruschi; Pornthep Sompornpisut; Paola Turano



Nuclear magnetic resonance solution structure of hirudin(1–51) and comparison with corresponding three-dimensional structures determined using the complete 65-residue hirudin polypeptide chain  

Science Journals Connector (OSTI)

The three-dimensional structure of the N-terminal 51-residue domain of recombinant hirudin in aqueous solution was determined by 1H nuclear magnetic resonance (NMR) spectroscopy, and the resulting high-quality solution structure was compared with corresponding structures obtained from studies with the intact, 65-residue polypeptide chain of hirudin. On the basis of 580 distance constraints derived from nuclear Overhauser effects and 109 dihedral angle constraints, a group of 20 conformers representing the solution structure of hirudin(1–51) was computed with the program DIANA and energyminimized with a modified version of the program AMBER. Residues 3 to 30 and 37 to 48 form a well-defined molecular core with two antiparallel ?-sheets composed of residues 14 to 16 and 20 to 22, and 27 to 31 and 36 to 40, and three reverse turns at residues 8 to 11 (type II), 17 to 20 (type II?) and 23 to 26 (type II). The average root-mean-square deviation of the individual NMR conformers relative to their mean co-ordinates is 0.38 Å for the backbone atoms and 0.77 Å for all heavy atoms of these residues. Increased structural disorder was found for the N-terminal dipeptide segment, the loop at residues 31 to 36, and the C-terminal tripeptide segment. The solution structure of hirudin(1–51) has the same molecular architecture as the corresponding polypeptide segment in natural hirudin and recombinant desulfatohirudin. It is also closely similar to the crystal structure of the N-terminal 51-residue segment of hirudin in a hirudin-thrombin complex, with root-mean-square deviations of the crystal structure relative to the mean solution structure of 0.61 Å for the backbone atoms and 0.91 Å for all heavy atoms of residues 3 to 30 and 37 to 48. Further coincidence is found for the loop formed by residues 31 to 36, which shows increased structural disorder in all available solution structures of hirudin, and of which residues 32 to 35 are not observable in the electron density map of the thrombin complex. Significant local structural differences between hirudin(1–51) in solution and hirudin in the crystalline thrombin complex were identified mainly for the N-terminal tripeptide segment and residues 17 to 21. These are further analyzed in an accompanying paper.

T. Szyperski; P. Güntert; S.R. Stone; K. Wüthrich



Local structure of amorphous \\{MO50Ni50\\} determined by anomalous x-ray scattering using synchroton radiation  

Science Journals Connector (OSTI)

Anomalous (resonance) x-ray scattering technique using synchrotron radiation was applied to determine the compositionally resolved local structure of sputter deposited amorphous Mo50Ni50. The local environments of Mo atoms and Ni atoms were found to be significantly different from each other, but similar to the corresponding local environments in crystalline MoNi. The results compare favorably with those of the EXAFS measurement.

S. Aur; D. Kofalt; Y. Waseda; T. Egami; R. Wang; H.S. Chen; Boon-Keng Teo



NMR Structure Determination for Larger Proteins Using Backbone-Only Data  

Science Journals Connector (OSTI)

...Zimmerman D. E. ., Automated analysis of protein...Montelione G. T. , Automated analysis of protein...interface for evaluating automated probabilistic peak...A web server for rapid NMR-based protein...protein structure modeling methodology...Proteins | Computer Simulation Models, Molecular...

Srivatsan Raman; Oliver F. Lange; Paolo Rossi; Michael Tyka; Xu Wang; James Aramini; Gaohua Liu; Theresa A. Ramelot; Alexander Eletsky; Thomas Szyperski; Michael A. Kennedy; James Prestegard; Gaetano T. Montelione; David Baker



SUPPLEMENTARY MATERIAL Lipid bilayer structure determined by the simultaneous analysis of neutron  

E-Print Network (OSTI)

scattering intensities I(q) for both neutrons and x-rays using )()()()( qPqPqIqF TSLC= , (1.) where PLC in structure between oriented and spherical bilayers experimentally using both neutron and x-ray scattering in (2). Our study concluded no difference between the two for x-ray and neutron scattering data

Nagle, John F.


Device and nondestructive method to determine subsurface micro-structure in dense materials  

DOE Patents (OSTI)

A method and a device to detect subsurface three-dimensional micro-structure in a sample by illuminating the sample with light of a given polarization and detecting light emanating from the sample that has a different direction of polarization by means of a confocal optical system.

Sun, Jiangang (Westmont, IL)



A combined fit of total scattering and extended x-ray absorption fine structure data for local-structure determination in crystalline materials  

SciTech Connect

Reverse Monte Carlo (RMC) refinements of local structure using a simultaneous fit of X-ray/neutron total scattering and extended X-ray absorption fine structure (EXAFS) data were developed to incorporate an explicit treatment of both single- and multiple-scattering contributions to EXAFS. The refinement algorithm, implemented as an extension to the public domain computer software RMCProfile, enables accurate modeling of EXAFS over distances encompassing several coordination shells around the absorbing species. The approach was first tested on Ni, which exhibits extensive multiple scattering in EXAFS, and then applied to perovskite-like SrAl{sub 1/2}Nb{sub 1/2}O{sub 3}. This compound crystal1izes with a cubic double-perovskite structure but presents a challenge for local-structure determination using a total pair-distribution function (PDF) alone because of overlapping peaks of the constituent partial PDFs (e.g. Al-O and Nb-O or Sr-O and O-O). The results obtained here suggest that the combined use of the total scattering and EXAFS data provides sufficient constraints for RMC refinements to recover fine details of local structure in complex perovskites. Among other results, it was found that the probability density distribution for Sr in SrAl{sub 1/2}Nb{sub 1/2}O{sub 3} adopts T{sub d} point-group symmetry for the Sr sites, determined by the ordered arrangement of Al and Nb, as opposed to a spherical distribution commonly assumed in traditional Rietveld refinements.

Proffen, Thomas E [Los Alamos National Laboratory; Krayzman, Victor [NIST; Levin, Igor [NIST; Tucker, Matt [ISIS, UK



Structure determination of Ag-Ge-S glasses using neutron diffraction  

Science Journals Connector (OSTI)

The structure of the superionic glass system (Ag2S)x(GeS2)1-x, for three compositions x=0.3, 0.4, 0.5, has been studied using neutron diffraction, and isotopic-substitution neutron-diffraction experiments have been performed on three silver isotope-substituted (107Ag,natAg,109Ag) samples of the composition (Ag2S)0.5(GeS2)0.5. The average short-range orderings of Ge-S, Ag-S, and Ge-Ag correlations were identified in the radial distribution functions for the isotopically substituted system of (Ag2S)0.5(GeS2)0.5. From the first and second differences in the three sets of isotopic-substitution neutron-diffraction data, the other three partial correlations (Ag-Ag, Ge-Ge, and S-S), were also identified. By examining unusually broad peaks in the Ag-Ag correlation function, it was concluded that the Ag-Ag distribution was rather homogeneous. We were also able to obtain further information by combining the first and second difference analyses, resulting in a structural model of a slightly elongated GeS4 tetrahedron with the local environment of Ag+ ions being threefold coordination by nonbridging sulphur ions. The medium-range order of the host framework was found to be a chainlike structure of linked corner-sharing GeS4 tetrahedra. Substantial changes in the first and second peaks in the distinct scattering functions i(Q) were found with composition and also with isotopic substitution. It was possible to explain the trends in the changes of the heights of these peaks in the structure factor by applying the void model for the first sharp diffraction peak. © 1996 The American Physical Society.

J. H. Lee; A. P. Owens; A. Pradel; A. C. Hannon; M. Ribes; S. R. Elliott



Progress in the Determination of the Partonic Structure of the Proton  

E-Print Network (OSTI)

We review the current state of the art in the determination of the parton substructure of the nucleon, as expressed in terms of parton distribution functions (PDFs), and probed in high-energy lepton-hadron and hadron-hadron collisions, and we assess their implications for current precision collider phenomenology, in particular at the Large Hadron Collider (LHC). We review the theoretical foundations of PDF determination: the way cross sections are expressed in terms of PDFs using perturbative QCD factorization and evolution, the methodology used to extract PDFs from experimental data, and the way in which different physical processes can be used to constrain different PDFs. We summarize current knowledge of PDFs and the limitations in accuracy currently entailed for the computation of hadron collider processes, in particular at the LHC. We discuss the current main sources of theoretical and phenomenological uncertainties, and the direction of progress towards their reduction in the future.

Stefano Forte; Graeme Watt



Atmospheric structure and variability in areas of convective storms determined from 3-h rawinsonde data  

E-Print Network (OSTI)

changes in TTI determined from charts in Fig. 58. . 101 60 61 62 Cumulative frequency distributions of changes in TTI in AVE II . . ~ . . . . . ~ Surface analysis at 2100 GMT, 11 May 1974 Satellite and radar composite at 2200 GMT, 11 May 1974 102... change in the probability of convective activity by a factor of 8 or more in 3 h. Between 30% and 60% of the total changes in parameters associated with convective activity over a 12-h period is shown to take place during a 3-h period. These large...

Wilson, Gregory Sims



Crystal structure determination of the oxynitride Sr{sub 2}TaO{sub 3}N  

SciTech Connect

The crystal structure of the strontium tantalum oxynitride Sr{sub 2}TaO{sub 3}N has been resolved by Rietveld refinement using time-of-flight neutron powder diffraction data. The structure is of the K{sub 2}NiF{sub 4} type with a partially ordered anion sublattice (tetragonal, I4/mmm, a = 4.04127(3) {angstrom}, c = 12.6073(2) {angstrom}, c/a = 3.120, Z = 2). The tantalum atoms are at the center of TaO{sub 2}(O, N){sub 4} octahedra built up from two oxygen atoms at the apexes and four (N + O) atoms statistically forming the median plane. The strontium atoms have a coordination number of nine: SrO{sub 5}(O, N){sub 4}. The profile agreement factors are R{sub p} = 0.022, R{sub wp} = 0.016, R{sub exp} = 0.012, and R{sub 1} = 0.063.

Diot, N.; Marchand, R. [Univ. de Rennes 1 (France). Lab. Verres et Ceramiques] [Univ. de Rennes 1 (France). Lab. Verres et Ceramiques; Haines, J.; Leger, J.M. [CNRS, Meudon (France). Lab. de Physicochimie des Materiaux] [CNRS, Meudon (France). Lab. de Physicochimie des Materiaux; Macaudiere, P. [Centre de Recherches d`Aubervilliers (France)] [Centre de Recherches d`Aubervilliers (France); Hull, S. [Rutherford Appleton Lab., Didcot (United Kingdom). ISIS Science Div.] [Rutherford Appleton Lab., Didcot (United Kingdom). ISIS Science Div.



Crystal structure determination of the oxynitride Sr[sub 2]TaO[sub 3]N  

SciTech Connect

The crystal structure of the strontium tantalum oxynitride Sr[sub 2]TaO[sub 3]N has been resolved by Rietveld refinement using time-of-flight neutron powder diffraction data. The structure is of the K[sub 2]NiF[sub 4] type with a partially ordered anion sublattice (tetragonal, I4/mmm, a = 4.04127(3) [angstrom], c = 12.6073(2) [angstrom], c/a = 3.120, Z = 2). The tantalum atoms are at the center of TaO[sub 2](O, N)[sub 4] octahedra built up from two oxygen atoms at the apexes and four (N + O) atoms statistically forming the median plane. The strontium atoms have a coordination number of nine: SrO[sub 5](O, N)[sub 4]. The profile agreement factors are R[sub p] = 0.022, R[sub wp] = 0.016, R[sub exp] = 0.012, and R[sub 1] = 0.063.

Diot, N.; Marchand, R. (Univ. de Rennes 1 (France). Lab. Verres et Ceramiques); Haines, J.; Leger, J.M. (CNRS, Meudon (France). Lab. de Physicochimie des Materiaux); Macaudiere, P. (Centre de Recherches d'Aubervilliers (France)); Hull, S. (Rutherford Appleton Lab., Didcot (United Kingdom). ISIS Science Div.)



Determining the DUF55-domain structure of human thymocyte nuclear protein 1 from crystals partially twinned by tetartohedry  

SciTech Connect

Human thymocyte nuclear protein 1 (hTHYN1) contains a unique DUF55 domain of 167 residues (55-221), but its cellular function is unclear. Crystals of DUF55 belong to the trigonal space group P3{sub 1}, but twinning causes the data to approach an apparent 622 symmetry. Two datasets to 2.3 {angstrom} resolution were collected. Statistical analysis confirmed that both datasets were partially twinned by tetartohedry. Tetartohedral twin fractions were estimated. After the structure was determined, only one twofold axis of rotational pseudosymmetry was found in the crystal structure. Using the DALI program, a YTH domain, which is a potential RNA binding domain from human YTH domain-containing protein 2, was identified to have the most similar three-dimensional fold to DUF55. It is implied that DUF55 might be a potential RNA-related domain.

Yu, Feng; Song, Aixin; Xu, Chunyan; Sun, Lihua; Li, Jian; Tang, Lin; Yu, Minmin; Yeates, Todd O.; Hu, Hongyu; He, Jianhua



Gas-Expanded Liquids: Synergism of Experimental and Computational Determinations of Local Structure  

SciTech Connect

This project focuses on the characterization of a new class of solvent systems called gas-expanded liquids (GXLs), targeted for green-chemistry processing. The collaboration has adopted a synergistic approach combining elements of molecular dynamics (MD) simulation and spectroscopic experiments to explore the local solvent behavior that could not be studied by simulation or experiment alone. The major accomplishments from this project are: • Applied MD simulations to explore the non-uniform structure of CO2/methanol and CO2/acetone GXLs and studied their dynamic behavior with self-diffusion coefficients and correlation functions • Studied local solvent structure and solvation behavior with a combination of spectroscopy and MD simulations • Measured transport properties of heterocyclic solutes in GXLs through Taylor-Aris diffusion techniques and compared these findings to those of MD simulations • Probed local polarity and specific solute-solvent interactions with Diels-Alder and SN2 reaction studies The broader scientific impact resulting from the research activities of this contract have been recognized by two recent awards: the Presidential Green Chemistry Award (Eckert & Liotta) and a fellowship in the American Association for the Advancement of Science (Hernandez). In addition to the technical aspects of this contract, the investigators have been engaged in a number of programs extending the broader impacts of this project. The project has directly supported the development of two postdoctoral researcher, four graduate students, and five undergraduate students. Several of the undergraduate students were co-funded by a Georgia Tech program, the Presidential Undergraduate Research Award. The other student, an African-American female graduated from Georgia Tech in December 2005, and was co-funded through an NSF Research and Education for Undergraduates (REU) award.

Charles A. Eckert; Charles L. Liotta; Rigoberto Hernandez



Surface structure determinations of crystalline ionic thin films grown on transition metal single crystal surfaces by low energy electron diffraction  

SciTech Connect

The surface structures of NaCl(100), LiF(100) and alpha-MgCl2(0001) adsorbed on various metal single crystals have been determined by low energy electron diffraction (LEED). Thin films of these salts were grown on metal substrates by exposing the heated metal surface to a molecular flux of salt emitted from a Knudsen cell. This method of investigating thin films of insulators (ionic salts) on a conducting substrate (metal) circumvents surface charging problems that plagued bulk studies, thereby allowing the use of electron-based techniques to characterize the surface.

Roberts, J.G.



Biochemical Characterization and Structure Determination of a Prolyl 4-Hydroxylase-like Protein from Bacillus anthracis  

E-Print Network (OSTI)

Assay 64 UV-Vis Spectroscopy Coupled Assay 65 O 2 Electrode Assay 66 3.2.6 Anaerobic UV-vis Spectroscopy Monitoring Anthrax-P4H Cofactor Binding 67 3.2.7 UV-vis Spectroscopic Titration of Anthrax-P4H with !KG 68 3.2.8 Determination.../Fe(II)-Oxygenases 83 3.3.7 O 2 Electrode Assay for Anthrax-P4H Activity 85 3.3.8 pH-Dependency of Uncoupled Reaction Catalyzed by Anthrax-P4H 88 3.3.9 Anaerobic UV-Vis Spectroscopy Monitoring Anthrax-P4H Binding 89 3.3.10 Recombinant Bacillus (Collagen...

Culpepper, Megen



The Molecular Structure of a Phosphatidylserine Bilayer Determined by Scattering and Molecular Dynamics Simulations  

SciTech Connect

Phosphatidylserine (PS) lipids play essential roles in biological processes, including enzyme activation and apoptosis. We report on the molecular structure and atomic scale interactions of a fluid bilayer composed of 1-palmitoyl-2-oleoyl-sn-glycero-3-phosphatidylserine (POPS). A scattering density profile model, aided by molecular dynamics (MD) simulations, was developed to jointly refine different contrast small-angle neutron and X-ray scattering data, which yielded a lipid area of 62.7 A2 at 25 C. MD simulations with POPS lipid area constrained at different values were also performed using all-atom and aliphatic united-atom models. The optimal simulated bilayer was obtained using a model-free comparison approach. Examination of the simulated bilayer, which agrees best with the experimental scattering data, reveals a preferential interaction between Na+ ions and the terminal serine and phosphate moieties. Long-range inter-lipid interactions were identified, primarily between the positively charged ammonium, and the negatively charged carboxylic and phosphate oxygens. The area compressibility modulus KA of the POPS bilayer was derived by quantifying lipid area as a function of surface tension from area-constrained MD simulations. It was found that POPS bilayers possess a much larger KA than that of neutral phosphatidylcholine lipid bilayers. We propose that the unique molecular features of POPS bilayers may play an important role in certain physiological functions.

Pan, Jianjun [University of South Florida, Tampa (USF)] [University of South Florida, Tampa (USF); Cheng, Xiaolin [ORNL] [ORNL; Monticelli, Luca [Institut National de la Santé et de la Recherche Médicale (INSERM) and INTS, France] [Institut National de la Santé et de la Recherche Médicale (INSERM) and INTS, France; Heberle, Frederick A [ORNL] [ORNL; Kucerka, Norbert [Atomic Energy of Canada Limited (AECL), Canadian Neutron Beam Centre (CNBC) and Comenius University,] [Atomic Energy of Canada Limited (AECL), Canadian Neutron Beam Centre (CNBC) and Comenius University,; Tieleman, D. Peter [University of Calgary, ALberta, Canada] [University of Calgary, ALberta, Canada; Katsaras, John [ORNL] [ORNL



Crystal structure of a triacylglycerol lipase from Penicillium expansum at 1.3 A determined by sulfur SAD  

SciTech Connect

Triacylglycerol lipases (EC are present in many different organisms including animals, plants, and microbes. Lipases catalyze the hydrolysis of long-chain triglycerides into fatty acids and glycerol at the interface between the water insoluble substrate and the aqueous phase. Lipases can also catalyze the reverse esterification reaction to form glycerides under certain conditions. Lipases of microbial origin are of considerable commercial interest for wide variety of biotechnological applications in industries, including detergent, food, cosmetic, pharmaceutical, fine chemicals, and biodiesel. Nowadays, microbial lipases have become one of the most important industrial enzymes. PEL (Penicillium expansum lipase) is a fungal lipase from Penicillium expansum strain PF898 isolated from Chinese soil that has been subjected to several generations of mutagenesis to increase its enzymatic activity. PEL belongs to the triacylglycerol lipases family, and its catalytic characteristics have been studied. The enzyme has been used in Chinese laundry detergent industry for several years (http://www.leveking.com). However, the poor thermal stability of the enzyme limits its application. To further study and improve this enzyme, PEL was cloned and sequenced. Furthermore, it was overexpressed in Pichia pastoris. PEL contains GHSLG sequence, which is the lipase consensus sequence Gly-X1-Ser-X2-Gly, but has a low amino acid sequence identities to other lipases. The most similar lipases are Rhizomucor miehei (PML) and Rhizopus niveus (PNL) with a 21% and 20% sequence identities to PEL, respectively. Interestingly, the similarity of PEL with the known esterases is somewhat higher with 24% sequence identity to feruloyl esterase A. Here, we report the 1.3 {angstrom} resolution crystal structure of PEL determined by sulfur SAD phasing. This structure not only presents a new lipase structure at high resolution, but also provides a structural platform to analyze the published mutagenesis results. The structure may also open up new avenues for future protein engineering study on PEL.

Bian, Chuanbing; Yuan, Cai; Chen, Liqing; Meehan, Edward J.; Jiang, Longguang; Huang, Zixiang; Lin, Lin; Huang, Mingdong; (UAH); (Fujian); (Chinese Aca. Sci.)


Note: This page contains sample records for the topic "determination gila-knob structure" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Determination of the three-dimensional solution structure of Raphanus sativus Antifungal Protein 1 by 1H NMR  

Science Journals Connector (OSTI)

Raphanus sativus Antifungal Protein 1 (Rs-AFP1) is a 51 amino acid residue plant defensin isolated from radish (Raphanus sativusL.) seeds. The three-dimensional structure in aqueous solution has been determined from two-dimensional 1H NMR data recorded at 500 \\{MHz\\} using the DIANA/REDAC calculation protocols. Experimental constraints consisted of 787 interproton distances extracted from NOE cross-peaks, 89 torsional constraints from 106 vicinal interproton coupling constants and 32 stereospecific assignments of prochiral protons. Further refinement by simulated annealing resulted in a set of 20 structures having pairwise root-mean-square differences of 1.35(±0.35) Å over the backbone heavy atoms and 2.11(±0.46) Å over all heavy atoms. The molecule adopts a compact globular fold comprising an ?-helix from Asn18 till Leu28 and a triple-stranded ?-sheet (?1=Lys2-Arg6, ?2=His33-Tyr38 and ?3=His43-Pro50). The central strand of this ?-sheet is connected by two disulfide bridges (Cys21–Cys45 and Cys25–Cys47) to the ?-helix. The connection between ?-strand 2 and 3 is formed by a type \\{VIa\\} ?-turn. Even the loop (Pro7 to Asn17) between ?-strand 1 and the ?-helix is relatively well defined. The structure of Raphanus sativus Antifungal Protein 1 features all the characteristics of the “cysteine stabilized ?? motif”. A comparison of the complete structure and of the regions important for interaction with the fungal receptor according to a mutational study, is made with the structure of ?-thionin, a plant defensin that has no antifungal activity. It is concluded that this interaction is both electrostatic and specific, and some possible scenarios for the mode of action are given.

Franky Fant; Wim Vranken; Willem Broekaert; Frans Borremans




SciTech Connect

A key parameter to the description of all star formation processes is the density structure of the gas. In this Letter, we make use of probability distribution functions (PDFs) of Herschel column density maps of Orion B, Aquila, and Polaris, obtained with the Herschel Gould Belt survey (HGBS). We aim to understand which physical processes influence the PDF shape, and with which signatures. The PDFs of Orion B (Aquila) show a lognormal distribution for low column densities until A{sub V} {approx} 3 (6), and a power-law tail for high column densities, consistent with a {rho}{proportional_to}r {sup -2} profile for the equivalent spherical density distribution. The PDF of Orion B is broadened by external compression due to the nearby OB stellar aggregates. The PDF of a quiescent subregion of the non-star-forming Polaris cloud is nearly lognormal, indicating that supersonic turbulence governs the density distribution. But we also observe a deviation from the lognormal shape at A{sub V} > 1 for a subregion in Polaris that includes a prominent filament. We conclude that (1) the point where the PDF deviates from the lognormal form does not trace a universal A{sub V} -threshold for star formation, (2) statistical density fluctuations, intermittency, and magnetic fields can cause excess from the lognormal PDF at an early cloud formation stage, (3) core formation and/or global collapse of filaments and a non-isothermal gas distribution lead to a power-law tail, and (4) external compression broadens the column density PDF, consistent with numerical simulations.

Schneider, N.; Andre, Ph.; Koenyves, V.; Motte, F.; Arzoumanian, D.; Didelon, P.; Hennemann, M.; Hill, T.; Palmeirim, P.; Peretto, N.; Roy, A. [IRFU/SAp CEA/DSM, Laboratoire AIM CNRS, Universite Paris Diderot, F-91191 Gif-sur-Yvette (France); Bontemps, S. [OASU/LAB-UMR5804, CNRS, Universite Bordeaux 1, F-33270 Floirac (France); Federrath, C. [MoCA, School of Mathematical Sciences, Monash University, VIC 3800 (Australia); Ward-Thompson, D. [Jeremiah Horrocks Institute, UCLAN, Preston, Lancashire PR1 2HE (United Kingdom); Benedettini, M.; Pezzuto, S.; Rygl, K. L. J. [IAPS-INAF, Fosso del Cavaliere 100, I-00133 Roma (Italy); Bressert, E. [CSIRO Astronomy and Space Science, Epping (Australia); Di Francesco, J. [NRCC, Herzberg Institute of Astrophysics, University of Victoria (Canada); Griffin, M. [University School of Physics and Astronomy, Cardiff (United Kingdom); and others



The Crystal Structure of the Ivy delta4-16:0-ACP Desaturase Reveals Structural Details of the Oxidized Active Site and Potential Determinants of Regioselectivity  

SciTech Connect

The multifunctional acyl-acyl carrier protein (ACP) desaturase from Hedera helix (English ivy) catalyzes the {Delta}{sup 4} desaturation of 16:0-ACP and the{Delta}{sup 9} desaturation of 18:0-ACP and further desaturates{Delta}{sup 9}-16:1 or {Delta}{sup 9}-18:1 to the corresponding {Delta}{sup 4,9} dienes. The crystal structure of the enzyme has been solved to 1.95{angstrom} resolution, and both the iron-iron distance of 3.2{angstrom} and the presence of a {mu}-oxo bridge reveal this to be the only reported structure of a desaturase in the oxidized FeIII-FeIII form. Significant differences are seen between the oxidized active site and the reduced active site of the Ricinus communis (castor) desaturase; His{sup 227} coordination to Fe2 is lost, and the side chain of Glu{sup 224}, which bridges the two iron ions in the reduced structure, does not interact with either iron. Although carboxylate shifts have been observed on oxidation of other diiron proteins, this is the first example of the residue moving beyond the coordination range of both iron ions. Comparison of the ivy and castor structures reveal surface amino acids close to the annulus of the substrate-binding cavity and others lining the lower portion of the cavity that are potential determinants of their distinct substrate specificities. We propose a hypothesis that differences in side chain packing explains the apparent paradox that several residues lining the lower portion of the cavity in the ivy desaturase are bulkier than their equivalents in the castor enzyme despite the necessity for the ivy enzyme to accommodate three more carbons beyond the diiron site.

Guy,J.; Whittle, E.; Kumaran, D.; Lindqvist, Y.; Shanklin, J.



Microwave Determination of the Structure of Borine Carbonyl and of the Nuclear Moments of the Stable Boron Isotopes  

Science Journals Connector (OSTI)

From measurements on the J=1?2 and the J=2?3 rotational transitions of borine carbonyl its molecular structure has been determined as follows: dBH=1.194A, dBC=1.540A, dCO=1.131A, and ?HBH = 113°52?. The moments of inertia (which assume h=6.6242×10-27 erg. sec.) in g cm2×10-40 are: 93.4266 for B10H3C12O, 96.9092 for B11H3C12O, 111.4113 for B10D3C12O, and 114.3540 for B11D3C12O. Nuclear quadrupole couplings determined are 3.36±0.10 mc/sec. for B10 and 1.55±0.08 mc/sec. for B11. Approximate values of the nuclear quadrupole moments are 0.06×10-24 cm2 for B10 and 0.03×10-24 cm2 for B11. The nuclear spin of B10 is determined as 3 and that of B11 as 3/2.

Walter Gordy; Harold Ring; Anton B. Burg



Application of polarized neutron reflectometry and X-ray resonant magnetic reflectometry for determining the inhomogeneous magnetic structure in Fe/Gd multilayers  

Science Journals Connector (OSTI)

The evolution of the magnetic structure of multilayer [Fe (35 Å)/Gd (50 Å)5...] with variation in temperature and an applied magnetic field was determined using a complementary approach combining polarized neutron

E. A. Kravtsov; D. Haskel…



The determination of the void structure of microporous coals by small?angle neutron scattering: Void geometry and structure in Illinois No. 6 bituminous coal  

Science Journals Connector (OSTI)

The access of solvents and reactants to the microvoid volume in porous materials such as coal plays an important role in determining the overall chemistry which takes place during a variety of chemical transformations including oxidation combustion and pyrolysis. The structure and surface composition of these voids were studied using small?angle neutron scattering techniques to examine selectively the subset of the overall void volume distribution which comprises the microvoid volume. Powdered Illinois No. 6 coal containing approximately 20% void volume was slurried in several different aqueous and cyclohexane solutions. The solutions used had various hydrogen?to?deuterium ratios in order to contrast match most of the open pore volume thereby making the microvoid volume visible. The microvoid volume observed is characterized as elongated voids having a fairly well?defined diameter and surface composition. The scattering intensity from the microvoid volume shows a well?defined Porod region indicating that the smallest void dimension is resolved by the instrumental configuration employed. A Guinier region exhibiting Q ? 1 behavior which is characteristic of elongated structures is also observed. The average radius of a circular cross section of these voids is found to be 25.4 Å. The microvoids are found to be completely filled by aqueous solutions so that the residual neutron scattering which is not eliminated by the contrast?matching aqueous solution is due to the organic matrix structure. Nonaqueous mixtures of cyclohexane cannot fill the entire microvoid volume as effectively as the aqueous mixtures. The scattering differences observed between the aqueous and nonaqueous filled coal indicates that the surface of the microvoids is predominantly aliphatic in character with the principal compositional variation being the presence or absence of acidic functionality on the surface.

Jon S. Gethner



N-terminal determinants of human cytomegalovirus IE1 protein in nuclear targeting and disrupting PML-associated subnuclear structures  

SciTech Connect

The 72-kDa IE1 protein of human cytomegalovirus disrupts PML-associated subnuclear structures (PODs) by inducing PML desumoylation. This process correlates with the functions of IE1 in transcriptional regulation and efficient viral replication. Here, we defined the N-terminal regions of IE1 required for nuclear targeting and POD-disrupting activity. Although the 24 N-terminal amino acids encoded by exon 2, which were previously shown to be essential for nuclear targeting, did not appear to contain typical basic nuclear localization signals, these residues were able to efficiently convey the GFP protein into the nucleus, suggesting a role in promoting nuclear translocation. In assays using a series of N-terminal truncation IE1 mutants, which were forced to enter the nucleus, exon 2 was completely dispensable for POD disruption. However, the predicted two {alpha}-helix regions in exon 3 were identified as important structural determinants for protein stability and for the correlating activities in POD disruption and PML desumoylation.

Lee, Hye-Ra [Department of Molecular Cell Biology, Samsung Biomedical Research Institute, Sungkyunkwan University School of Medicine, 300 Cheoncheondong, Jangangu, Suwon, Gyeonggido 440-746 (Korea, Republic of); Huh, Yong Ho [Department of Molecular Cell Biology, Samsung Biomedical Research Institute, Sungkyunkwan University School of Medicine, 300 Cheoncheondong, Jangangu, Suwon, Gyeonggido 440-746 (Korea, Republic of); Kim, Young-Eui [Department of Molecular Cell Biology, Samsung Biomedical Research Institute, Sungkyunkwan University School of Medicine, 300 Cheoncheondong, Jangangu, Suwon, Gyeonggido 440-746 (Korea, Republic of); Lee, Karim [Institute of Molecular Biology and Genetics, School of Biological Sciences, Seoul National University, Seoul (Korea, Republic of); Kim, Sunyoung [Institute of Molecular Biology and Genetics, School of Biological Sciences, Seoul National University, Seoul (Korea, Republic of); Ahn, Jin-Hyun [Department of Molecular Cell Biology, Samsung Biomedical Research Institute, Sungkyunkwan University School of Medicine, 300 Cheoncheondong, Jangangu, Suwon, Gyeonggido 440-746 (Korea, Republic of)]. E-mail: jahn@med.skku.ac.kr



Application of polarized neutron reflectometry and x-ray resonant magnetic reflectometry for determining the inhomogeneous magnetic structure in Fe/Gd multilayers.  

SciTech Connect

The evolution of the magnetic structure of multilayer [Fe (35 {angstrom})/Gd (50 {angstrom}){sub 5}] with variation in temperature and an applied magnetic field was determined using a complementary approach combining polarized neutron and X-ray resonant magnetic reflectometry. Self-consistent simultaneous analysis of X-ray and neutron spectra allowed us to determine the elemental and depth profiles in the multilayer structure with unprecedented accuracy, including the identification of an inhomogeneous intralayer magnetic structure with near-atomic resolution.

Kravtsov, E. A.; Haskel, D.; te Velthuis, S. G. E.; Jiang, J. S.; Kirby, B. J. (Materials Science Division); ( XSD); (Russian Academy of Sciences and Ural Federal Univ.); (Ural State Technical Univ.); (NIST Center for Neutron Research)



Communication: Determining the structure of the N{sub 2}Ar van der Waals complex with laser-based channel-selected Coulomb explosion  

SciTech Connect

We experimentally reconstructed the structure of the N{sub 2}Ar van der Waals complex with the technique of laser-based channel-selected Coulomb explosion imaging. The internuclear distance between the N{sub 2} center of mass and the Ar atom, i.e., the length of the van der Waals bond, was determined to be 3.88 Å from the two-body explosion channels. The angle between the van der Waals bond and the N{sub 2} principal axis was determined to be 90° from the three-body explosion channels. The reconstructed structure was contrasted with our high level ab initio calculations. The agreement demonstrated the potential application of laser-based Coulomb explosion in imaging transient molecular structure, particularly for floppy van der Waals complexes, whose structures remain difficult to be determined by conventional spectroscopic methods.

Wu, Chengyin, E-mail: cywu@pku.edu.cn; Liu, Yunquan; Gong, Qihuang [State Key Laboratory for Mesoscopic Physics, Department of Physics, Peking University, Beijing 100871 (China) [State Key Laboratory for Mesoscopic Physics, Department of Physics, Peking University, Beijing 100871 (China); Collaborative Innovation Center of Quantum Matter, Beijing (China); Wu, Cong; Xie, Xiguo; Li, Min; Deng, Yongkai [State Key Laboratory for Mesoscopic Physics, Department of Physics, Peking University, Beijing 100871 (China)] [State Key Laboratory for Mesoscopic Physics, Department of Physics, Peking University, Beijing 100871 (China); Song, Di; Su, Hongmei, E-mail: hongmei@iccas.ac.cn [State Key Laboratory of Molecular Reaction Dynamics, Beijing National Laboratory for Molecular Sciences, Institute of Chemistry, Chinese Academy of Sciences, Beijing 100190 (China)] [State Key Laboratory of Molecular Reaction Dynamics, Beijing National Laboratory for Molecular Sciences, Institute of Chemistry, Chinese Academy of Sciences, Beijing 100190 (China)



Recent Progress in the Structure Determination of GPCRs, a Membrane Protein Family with High Potential as Pharmaceutical Targets  

SciTech Connect

G protein-coupled receptors (GPCRs) constitute a highly diverse and ubiquitous family of integral membrane proteins, transmitting signals inside the cells in response to an assortment of disparate extra-cellular stimuli. Their strategic location on the cell surface and their involvement in crucial cellular and physiological processes turn these receptors into highly important pharmaceutical targets. Recent technological developments aimed at stabilization and crystallization of these receptors have led to significant breakthroughs in GPCR structure determination efforts. One of the successful approaches involved receptor stabilization with the help of a fusion partner combined with crystallization in lipidic cubic phase (LCP). The success of using an LCP matrix for crystallization is generally attributed to the creation of a more native, membrane-like stabilizing environment for GPCRs just prior to nucleation and to the formation of type I crystal lattices, thus generating highly ordered and strongly diffracting crystals. Here they describe protocols for reconstituting purified GPCRs in LCP, performing pre-crystallization assays, setting up crystallization trials in manual mode, detecting crystallization hits, optimizing crystallization conditions, harvesting, and collecting crystallographic data. The protocols provide a sensible framework for approaching crystallization of stabilized GPCRs in LCP, however, as in any crystallization experiment, extensive screening and optimization of crystallization conditions as well as optimization of protein construct and purification steps are required. The process remains risky and these protocols do not necessarily guarantee success.

Cherezov, Vadim; Abola, Enrique; Stevens, Raymond C.



The Structure of Sindbis Virus Produced from Vertebrate and Invertebrate Hosts as Determined by Small-Angle Neutron Scattering  

Science Journals Connector (OSTI)

...Determined by Small-Angle Neutron Scattering Published ahead of print on...Raleigh, North Carolina 27695 3 Neutron Scattering Sciences Division, Oak Ridge...determined by small-angle neutron scattering (SANS), a nondestructive...

Lilin He; Amanda Piper; Flora Meilleur; Dean A. A. Myles; Raquel Hernandez; Dennis T. Brown; William T. Heller



Structure Determination of Polyunsaturated Fatty Acids by Gas Chromatography-Mass Spectrometry—A Comparison of Fragmentation Patterns of Various Derivatives  

Science Journals Connector (OSTI)

......C - C I I 0 0 B Since boron does not participate...tributing system and alkyl-boron cleavage does not take...the corres- ponding isotope peaks observed at m...fragment ions containing two boron atoms. On the basis...diagnostic value for structure determination of polyenoate derivatives......

Veronika Dommes; Ferdinand Wirtz-Peitz; Wolf-H. Kunau



Determining the crystal structure of SseB, a product of the Salmonella Pathogenicity Island II Type III Secretion System of Salmonella typhimurium  

E-Print Network (OSTI)

-epithelial cells. The aim of the research project is to clone, purify the SseB protein from Salmonella typhimurium and obtain a diffracting-quality crystal that will give high resolution data so that the structure of the protein can be determined using x...

Patel, Bhavini Narendrakumar



Moisture determination and structure investigation of native and dried Argonne premium coals. A hydrogen-1 solid-state NMR relaxation study  

Science Journals Connector (OSTI)

Moisture determination and structure investigation of native and dried Argonne premium coals. ... This work has been undertaken aiming to estimate the size of pores in moist coals on the basis of the nuclear magnetic resonance relaxation characteristics of water sorbed in the pores as the molecular probe. ...

X. Yang; A. R. Garcia; J. W. Larsen; B. G. Silbernagel



Structure determination and analysis of helix parameters in the DNA decamer d(CATGGCCATG)2 comparison of results from NMR and crystallography  

Science Journals Connector (OSTI)

The solution structure of the DNA decamer (CATGGCCATG)2 has been determined by NMR spectroscopy and restrained molecular dynamic and distance geometry calculations. The restrainted data set includes interproton distances and torsion angles for the deoxyribose sugar ring which were obtained by nuclear Overhauser enhancement intensities and quantitative simulation of cross-peaks from double quantum filtered correlation spectroscopy. The backbone torsion angles were constrained using experimental data from NOE cross-peaks, 1H-1H and 1H-31P-coupling constants. The NMR structure and the crystal structure of the DNA decamer deviates from the structure of the canonical form of B-DNA in a number of observable characteristics. Particularly, both structures display a specific pattern of stacking interaction in the central GGC base triplet. Furthermore, a specific local conformation of the TG/CA base-pair step is present in NMR and crystal structure, highlighting the unusually high flexibility of this DNA duplex part. The solution structure of the TG/CA base-pair step obtained by our high resolution NMR study is characterized by a positive roll angle, whereas in crystal this base-pair step tends to adopt remarkably high twist angles.

Utz Dornberger; Joachim Flemming; Hartmut Fritzsche



Single-particle structure determination by correlations of snapshot X-ray diffraction patterns (CXIDB ID 20)  

DOE Data Explorer (OSTI)

This deposition includes the diffraction images generated by the paired polystyrene spheres in random orientations. These images were used to determine and phase the single particle diffraction volume from their autocorrelation functions.

Starodub, D.


Determination of energy release rate and mode mix in three-dimensional layered structures using plate theory  

Science Journals Connector (OSTI)

A plate theory-based method for determining energy release rates is presented for general loadings ... which certain other restrictions apply. Predictions for energy release rate and mode mix for typical problems...

Barry D. Davidson; LiJie Yu; Hurang Hu



ATP requirement for Prp5p function is determined by Cus2p and the structure of U2 small nuclear RNA  

E-Print Network (OSTI)

ATP requirement for Prp5p function is determined by Cus2p and the structure of U2 small nuclear RNA is the first ATP-dependent step in splicing, and it requires the DEXD H box ATPase Prp5p. However, prespli- ceosome formation occurs without ATP in extracts lacking the U2 snRNP protein Cus2p. Here we show that Prp

Ares Jr., Manny


Structural Determinant of Human La Protein Critical for Internal Initiation of Translation of Hepatitis C Virus RNA  

Science Journals Connector (OSTI)

...peptide. This not only reduces the entropic cost of binding to the receptor (disorder-to-order...activities were measured and plotted in the graph. The relative FLuc activities were represented...recognition motif coupled to a helical nuclear retention element. Structure 11: 833-843...

Tanmoy Mondal; Upasana Ray; Asit Kumar Manna; Romi Gupta; Siddhartha Roy; Saumitra Das



Structure determination of three furan-substituted benzimidazoles and calculation of - and C-H inter­action energies  

Science Journals Connector (OSTI)

The structures of 2-(furan-2-yl)-1-(furan-2-ylmeth­yl)-1H-benzimidazole, its hydro­chloride monohydrate, and the hydro­bromide salt of 5,6-dimethyl-2-(furan-2-yl)-1-(furan-2-ylmeth­yl)-1H-benzimidazole exhibit a combination of - and C-H inter­molecular inter­actions. DFT calculations were used to estimate the strength of these inter­actions.

Geiger, D.K.


Note: This page contains sample records for the topic "determination gila-knob structure" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Metalloproteins: Structure Determination (HADH), Inhibition (P4H), and Biomimetic Systems (P-1[Ru(NO)(Cl)])  

E-Print Network (OSTI)

A) Phen-2-GKDEL B)Phen-2 157 -E(EDANS)VKDEL Figure 3.5. Dipsi spectrum of phen-2-GKDEL on Bruker 50 MHz 158 NMR Figure 3.6. Dipsi spectrum of phen-2-E(EDANS)VKDEL on Bruker 159 50 MHz NMR Figure 3.7. Fluorescence imaging of HF...-P4H. Figure 3.10. Colagen production by HF cels with no inhibitor (red 166 boxes) and phen-GKDEL (gren diamonds). x Figure 3.1. The chemical structure of the dye that covalently links 167 to colagen types I through V in the Sircol...

Reed, Timothy Michael




NLE Websites -- All DOE Office Websites (Extended Search)

Structure Structure functions 1 NOTE: THE FIGURES IN THIS SECTION ARE INTENDED TO SHOW THE REPRESENTATIVE DATA. THEY ARE NOT MEANT TO BE COMPLETE COMPILATIONS OF ALL THE WORLD'S RELIABLE DATA. Q 2 (GeV 2 ) F 2 (x,Q 2 ) * 2 i x H1 ZEUS BCDMS E665 NMC SLAC 10 -3 10 -2 10 -1 1 10 10 2 10 3 10 4 10 5 10 6 10 7 10 8 10 9 10 -1 1 10 10 2 10 3 10 4 10 5 10 6 Figure 16.6: The proton structure function F p 2 measured in electromagnetic scattering of positrons on protons (collider experiments ZEUS and H1), in the kinematic domain of the HERA data, for x > 0.00006 (cf. Fig. 16.9 for data at smaller x and Q 2 ), and for electrons (SLAC) and muons (BCDMS, E665, NMC) on a fixed target. Statistical and systematic errors added in quadrature are shown. The data are plotted as a function of Q 2 in bins of fixed x. Some points have been slightly offset in Q 2 for clarity. The ZEUS binning in x is used in this plot; all other data are rebinned to the x values of


High-Pressure Synthesis and Structure Determination of K6(SeO4)(SeO5), The First Potassium Orthoselenate(VI)  

SciTech Connect

The authors report on the first synthesis of a potassium orthoselenate(VI), K{sub 6}(SeO{sub 4})(SeO{sub 5}), and the structure determination from synchrotron powder diffraction data. The title compound crystallizes in the tetragonal space group P4{sub 1}2{sub 1}2 with a = 8.1259(1) {angstrom}, c = 17.4953(2) {angstrom}, V = 1155.21(2) {angstrom}{sup 3}, and Z = 4. Selenium displays two different complex anions, tetrahedral SeO{sub 4}{sup 2-} and trigonal-bipyramidal SeO{sub 5}{sup 4-}. When the formula is reduced to A{sub 3}B, the spatial arrangement of the constituting building units can be derived from the Li{sub 3}Bi type of structure.

Orosel,D.; Dinnebeier, R.; Jansen, M.



X-ray absorption fine structure spectroscopic determination of plutonium speciation at the Rocky Flats environmental technology  

SciTech Connect

X-ray Absorption Fine Structure spectroscopy was used to probe the speciation of the ppm level Pu in thirteen soil and concrete samples from the Rocky Flats Environmental Technology Site in support of the site remediation effort that has been successfully completed since these measurements. In addition to X-ray Absorption Near Edge Spectra, two of the samples yielded Extended X-ray Absorption Fine Structure spectra that could be analyzed by curve-fits. Most of these spectra exhibited features consistent with PU(IV), and more specificaJly, PuO{sub 2+x}-type speciation. Two were ambiguous, possibly indicating that Pu that was originally present in a different form was transforming into PuO{sub 2+x}, and one was interpreted as demonstrating the presence of an unusual Pu(VI) compound, consistent with its source being spills from a PUREX purification line onto a concrete floor and the resultant extreme conditions. These experimental results therefore validated models that predicted that insoluble PuO{sub 2+x} would be the most stable form of Pu in equilibrium with air and water even when the source terms were most likely Pu metal with organic compounds or a Pu fire. A corollary of these models' predictions and other in situ observations is therefore that the minimal transport of Pu that occurred on the site was via the resuspension and mobilization of colloidal particles. Under these conditions, the small amounts of diffusely distributed Pu that were left on the site after its remediation pose only a negligible hazard.

Lezama-pacheco, Juan S [Los Alamos National Laboratory; Conradson, Steven D [Los Alamos National Laboratory; Clark, David L [Los Alamos National Laboratory



Modeling the determinants of Medicaid home care payments for children with special health care needs: A structural equation model approach  

Science Journals Connector (OSTI)

AbstractBackground The management of children with special needs can be very challenging and expensive. Objective To examine direct and indirect cost drivers of home care expenditures for this vulnerable and expensive population. Methods We retrospectively assessed secondary data on children, ages 4–20, receiving Medicaid Personal Care Services (PCS) (n = 2760). A structural equation model assessed direct and indirect effects of several child characteristics, clinical conditions and functional measures on Medicaid home care payments. Results The mean age of children was 12.1 years and approximately 60% were female. Almost half of all subjects reported mild, moderate or severe ID diagnosis. The mean ADL score was 5.27 and about 60% of subjects received some type of rehabilitation services. Caseworkers authorized an average of 25.5 h of PCS support per week. The SEM revealed three groups of costs drivers: indirect, direct and direct + indirect. Cognitive problems, health impairments, and age affect expenditures, but they operate completely through other variables. Other elements accumulate effects (externalizing behaviors, PCS hours, and rehabilitation) and send them on a single path to the dependent variable. A few elements exhibit a relatively complex position in the model by having both significant direct and indirect effects on home care expenditures – medical conditions, intellectual disability, region, and ADL function. Conclusions The most important drivers of home care expenditures are variables that have both meaningful direct and indirect effects. The only one of these factors that may be within the sphere of policy change is the difference among costs in different regions.

Omolola E. Adepoju; Yichen Zhang; Charles D. Phillips



DOE ER63951-3 Final Report: An Integrated Assessment of Geochemical and Community Structure Determinants of Metal Reduction Rates in Subsurface Sediments  

SciTech Connect

The objective of this research was to examine the importance of microbial community structure in influencing uranium reduction rates in subsurface sediments. If the redox state alone is the key to metal reduction, then any organisms that can utilize the oxygen and nitrate in the subsurface can change the geochemical conditions so metal reduction becomes an energetically favored reaction. Thus, community structure would not be critical in determining rates or extent of metal reduction unless community structure influenced the rate of change in redox. Alternatively, some microbes may directly catalyze metal reduction (e.g., specifically reduce U). In this case the composition of the community may be more important and specific types of electron donors may promote the production of communities that are more adept at U reduction. Our results helped determine if the type of electron donor or the preexisting community is important in the bioremediation of metal-contaminated environments subjected to biostimulation. In a series of experiments at the DOE FRC site in Oak Ridge we have consistently shown that all substrates promoted nitrate reduction, while glucose, ethanol, and acetate always promoted U reduction. Methanol only occasionally promoted extensive U reduction which is possibly due to community heterogeneity. There appeared to be limitations imposed on the community related to some substrates (e.g. methanol and pyruvate). Membrane lipid analyses (phospholipids and respiratory quinones) indicated different communities depending on electron donor used. Terminal restriction fragment length polymorphism and clone libraries indicated distinct differences among communities even in treatments that promoted U reduction. Thus, there was enough metabolic diversity to accommodate many different electron donors resulting in the U bioimmobilization.

Susan Pfiffner



Solution structure of a fragment of the dimerization domain of DP-1 determined by 1H-nuclear magnetic resonance and distance geometry  

Science Journals Connector (OSTI)

The structure of a synthesized peptide with the sequence of NHILPNESAYDQKNIRRRVYDALNVLMAMNIISK that corresponds to residues 151–184 of transcription factor DP-1 (Girling et al., Nature 362 (1993) 83–87) was determined by 1H-nuclear magnetic resonance in water and 40% d3-trifluoroethanol/water, respectively. Nuclear Overhauser effect cross peaks, ?H chemical shifts and J-coupling constants of ?H–NH show that the peptide consists a helix from Ser-8 to Ser-33 in solution. Fifty structures were constructed with 288 upper distance limits and 21 angle constraints by DIANA (Guntert et al., J. Mol. Biol. 217 (1991) 517–530). Although the N-terminal of the peptide exhibits a random conformation, the 20 best structures show a root mean square deviation of 0.89±0.36 Å for backbone atoms and 1.80±0.34 Å for heavy atoms from residue Ser-8 to Ser-33. This result supports the proposal that DP-1 and E2F-1 may dimerize with a coiled-coil type interaction.

Shouhong Guang; Jihui Wu; Tianning Yu; Youlin Xia; Yunyu Shi



Solution structure of a fragment of the dimerization domain of E2F-1 determined by circular dichroism, 1H nuclear magnetic resonance and distance geometry  

Science Journals Connector (OSTI)

The structure of a synthesized peptide with the sequence GVVDLNWAAEVLKVQKRRIYDITNVLEGIQ which corresponds to residues 149–178 of transcription factor E2F-1 was determined by 1H nuclear magnetic resonance in 40% d3-TFE/water. NOE cross peaks and ?H chemical shifts indicate that the peptide consists of a helix from Ala-8 to Leu-26 in this solution. Circular dichroism measurements confirm the presence of nearly 45% helix in TFE/water solution but show no evidence of helicity in water solution of this peptide. Fifty structures were constructed with 329 upper distance limits by DIANA. The 20 best conformers show a RMSD of 0.78 Å for backbone atoms and 1.78 Å for heavy atoms from residue Ala-8 to Leu-26. This result, together with our previous work on the solution structure of a fragment of DP-1, supports the proposal that E2F-1 and DP-1 may dimerize with a coiled-coil type interaction.

Shouhong Guang; Jihui Wu; Limei Tao; Youlin Xia; Yunyu Shi



Proline 107 Is a Major Determinant in Maintaining the Structure of the Distal Pocket and Reactivity of the High-Spin Heme of MauG  

SciTech Connect

The diheme enzyme MauG catalyzes a six-electron oxidation required for posttranslational modification of a precursor of methylamine dehydrogenase (preMADH) to complete the biosynthesis of its protein-derived tryptophan tryptophylquinone (TTQ) cofactor. Crystallographic studies had shown that Pro107, which resides in the distal pocket of the high-spin heme of MauG, changes conformation upon binding of CO or NO to the heme iron. In this study, Pro107 was converted to Cys, Val, and Ser by site-directed mutagenesis. The structures of each of these MauG mutant proteins in complex with preMADH were determined, as were their physical and catalytic properties. P107C MauG was inactive, and the crystal structure revealed that Cys107 had been oxidatively modified to a sulfinic acid. Mass spectrometry revealed that this modification was present prior to crystallization. P107V MauG exhibited spectroscopic and catalytic properties that were similar to those of wild-type MauG, but P107V MauG was more susceptible to oxidative damage. The P107S mutation caused a structural change that resulted in the five-coordinate high-spin heme being converted to a six-coordinate heme with a distal axial ligand provided by Glu113. EPR and resonance Raman spectroscopy revealed this heme remained high-spin but with greatly increased rhombicity as compared to that of the axial signal of wild-type MauG. P107S MauG was resistant to reduction by dithionite and reaction with H{sub 2}O{sub 2} and unable to catalyze TTQ biosynthesis. These results show that the presence of Pro107 is critical in maintaining the proper structure of the distal heme pocket of the high-spin heme of MauG, allowing exogenous ligands to bind and directing the reactivity of the heme-activated oxygen during catalysis, thus minimizing the oxidation of other residues of MauG.

Feng, Manliang; Jensen, Lyndal M.R.; Yukl, Erik T.; Wei, Xiaoxi; Liu, Aimin; Wilmot, Carrie M.; Davidson, Victor L. (Central Florida); (GSU); (Tougaloo); (UMM)



Polypeptide backbone resonance assignments and secondary structure of Bacillus subtilis enzyme III sup glc determined by two-dimensional and three-dimensional heteronuclear NMR spectroscopy  

SciTech Connect

The enzyme III{sup glc}-like domain of Bacillus subtilis II{sup glc} (III{sup glc}; 162 residues, 17.4 kDa) has been cloned and overexpressed in Escherichia coli. Sequence-specific assignment of the backbone {sup 1}H and {sup 15}N resonances has been carried out with a combination of mohonuclear and heteronuclear two-dimensional and heteronuclear three-dimensional (3D) NMR spectroscopy. Amide proton solvent exchange rate constants have been determined from a series of {sup 1}H-{sup 15}N heteronuclear single-quantum coherence (HSQC) spectra acquired following dissolution of the protein in D{sub 2}O. Major structural features of III{sup glc} have been inferred from the pattern of short-, medium- and long-range NOEs in 3D heteronuclear {sup 1}H nuclear Overhauser effect {sup 1}H-{sup 15}N multiple-quantum coherence (3D NOESY-HMQC) spectra, together with the exchange rate constants. III{sup glc} contains three antiparallel {beta}-sheets comprised of eight, three, and two {beta}-strands. In addition, five {beta}-bulges were identified. no evidence of regular helical structure was found. The N-terminal 15 residues of the protein appear disordered, which is consistent with their being part of the Q-linker that connects the C-terminal enzyme III{sup glc}-like domain to the membrane-bound II{sup glc} domain. Significantly, two histidine residues, His 68 and His 83, which are important for phosphotransferase function, are found from NOE measurements to be in close proximity at the ends of adjacent strands in the major {beta}-sheet.

Fairbrother, W.J.; Cavanagh, J.; Dyson, H.J.; Palmer, A.G. III; Wright, P.E. (Research Inst. of Scripps Clinic, La Jolla, CA (United States)); Sutrina, S.L.; Reizer, J.; Saier, M.H. Jr. (Univ. of California, San Diego (United States))



Structural Genomics  

Science Journals Connector (OSTI)

Structural Genomics ... Structural genomics is the field of science focused on the systematic determination of the three-dimensional structure of the proteins encoded into genomes. ... Structural genomics is spreading the philosophy of high throughput in all fields of science and making available new tools to speed up research procedures. ...

Ivano Bertini



Determination of the structure of 2(benzene-1,3,5-tricarboxylic acid)·1.5(pyrene)·2(methanol) and comparison with that of 2(benzene-1,3,5-tricarboxylic acid)·pyrene·2(ethanol)  

Science Journals Connector (OSTI)

A detailed comparison is made of the structures of 2(benzene-1,3,5-tricarboxylic acid)·1.5(pyrene)·2(methanol) (new determination) and of 2(benzene-1,3,5-tricarboxylic acid)·pyrene·2(ethanol) (data from the literature).

Herbstein, F.H.



Groundwater and surface water supplies in the Williston and Powder River structural basins are necessary for future development in these regions. To help determine  

E-Print Network (OSTI)

#12;i Abstract Groundwater and surface water supplies in the Williston and Powder River structural of streams, and quantify reservoir interaction in the Williston and Powder River structural basins the loss to underlying aquifers was 7790 ft3 /s. Both the Powder River and Williston basins contain gaining

Torgersen, Christian


Using SSR markers to determine the population genetic structure of wild apricot (Prunus armeniaca L.) in the Ily Valley of West China  

Science Journals Connector (OSTI)

Genetic structure of three wild populations (Xinyuan, Gongliu and Daxigou) of apricot in the Ily Valley, Xinjiang Uygur Autonomous Region of China, was investigated with microsatellite (simple sequence repeat,...

He Tian-Ming; Chen Xue-Sen; Xu Zheng…



The impact of market structure on price determination : a simulation approach using multi-agent reinforcement learning in continuous state and action space  

E-Print Network (OSTI)

This thesis proposes a simulation tool to study the question of how market structure and market players' behavior affect price movements. The adaptive market simulation system consists of multiple agents and a centralized ...

Shu, Buliao



Determination of the structural changes by Raman and {sup 13}C CP/MAS NMR spectroscopy on native corn starch with plasticizers  

SciTech Connect

The plasticizing - antiplasticizing effect of water and glycerol contents on native corn starch samples is investigated by FT-Raman and {sup 13}C CP/MAS NMR spectroscopy. The presence of both amorphous and crystalline structural phases was evidenced in pure native corn starch and also in the samples containing plasticizers. Among the crystalline starch structures, the A- and V- types were suggested by CP/MAS NMR spectra.

Cozar, O. [Academy of Romanian Scientists, Splaiul Independentei 54, 050094, Bucharest, Romania and National Institute of Research-Development for Machines and Installations Designed to Agriculture and Food Industry - INMA Bucure?ti - Cluj-Napoca Branch (Romania)] [Academy of Romanian Scientists, Splaiul Independentei 54, 050094, Bucharest, Romania and National Institute of Research-Development for Machines and Installations Designed to Agriculture and Food Industry - INMA Bucure?ti - Cluj-Napoca Branch (Romania); Filip, C.; Tripon, C. [National Institute for Research and Development of Isotopic and Molecular Technologies, 65-103 Donath, 400293 Cluj-Napoca (Romania)] [National Institute for Research and Development of Isotopic and Molecular Technologies, 65-103 Donath, 400293 Cluj-Napoca (Romania); Cioica, N.; Co?a, C.; Nagy, E. M. [National Institute of Research-Development for Machines and Installations Designed to Agriculture and Food Industry - INMA Bucure?ti - Cluj-Napoca Branch, RO-400458 Cluj-Napoca (Romania)] [National Institute of Research-Development for Machines and Installations Designed to Agriculture and Food Industry - INMA Bucure?ti - Cluj-Napoca Branch, RO-400458 Cluj-Napoca (Romania)



CX-011653: Categorical Exclusion Determination | Department of...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Determination CX-011653: Categorical Exclusion Determination Saguaro-Tucson 115 Kilovolt Transmission Line Structure Replacement CX(s) Applied: B1.3 Date: 12032013 Location(s):...


CX-012092: Categorical Exclusion Determination | Department of...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Determination CX-012092: Categorical Exclusion Determination Tucson-Apache 115-Kilovolt Transmission Line Structure Stabilization Project CX(s) Applied: B1.3 Date: 09062013...


CX-010547: Categorical Exclusion Determination | Department of...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Determination CX-010547: Categorical Exclusion Determination Parker-Gila 161 Kilovolt Transmission Line Maintenance Project, Structure 921 to 949 CX(s) Applied: B1.3 Date:...


CX-008693: Categorical Exclusion Determination | Department of...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

693: Categorical Exclusion Determination CX-008693: Categorical Exclusion Determination Wood Pole Structure Replacements on the Chehalis-Centralia No. 2 115 Kilovolt Transmission...

Note: This page contains sample records for the topic "determination gila-knob structure" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Structure determination of a 20 amino acid peptide by NMR The twenty amino acid peptide contains over 100 unique protons that are potentially observable by  

E-Print Network (OSTI)

, depending on its local chemical environment within the peptide structure. The frequency of the RF energy of the peptide will be needed. NOE is an abbreviation for "nuclear Overhauser effect". The 2-D NOE spectrum proton within the peptide can absorb or emit radiofrequency (RF) energy at a specific frequency


Determination of nanoparticle structure type, size and strain distribution from X-ray data for monatomic f.c.c.-derived non-crystallographic nanoclusters  

Science Journals Connector (OSTI)

Whole-profile-fitting least-squares techniques are successfully applied to simulated and experimental diffraction patterns of monatomic f.c.c.-derived non-crystallographic nanoclusters, with the aim of extracting information about structure-type concentration, size and strain distribution.

Cervellino, A.



Global Structure of a Three-Way Junction in a Phi29 Packaging RNA Dimer Determined Using Site-Directed Spin Labeling  

SciTech Connect

The condensation of bacteriophage phi29 genomic DNA into its preformed procapsid requires the DNA packaging motor, which is the strongest known biological motor. The packaging motor is an intricate ring-shaped protein/RNA complex, and its function requires an RNA component called packaging RNA (pRNA). Current structural information on pRNA is limited, which hinders studies of motor function. Here, we used site-directed spin labeling to map the conformation of a pRNA three-way junction that bridges binding sites for the motor ATPase and the procapsid. The studies were carried out on a pRNA dimer, which is the simplest ring-shaped pRNA complex and serves as a functional intermediate during motor assembly. Using a nucleotide-independent labeling scheme, stable nitroxide radicals were attached to eight specific pRNA sites without perturbing RNA folding and dimer formation, and a total of 17 internitroxide distances spanning the three-way junction were measured using Double Electron-Electron Resonance spectroscopy. The measured distances, together with steric chemical constraints, were used to select 3662 viable three-way junction models from a pool of 65 billion. The results reveal a similar conformation among the viable models, with two of the helices (HT and HL) adopting an acute bend. This is in contrast to a recently reported pRNA tetramer crystal structure, in which HT and HL stack onto each other linearly. The studies establish a new method for mapping global structures of complex RNA molecules, and provide information on pRNA conformation that aids investigations of phi29 packaging motor and developments of pRNA-based nanomedicine and nanomaterial.

Zhang, Xiaojun; Tung, Chang-Shung; Sowa, Glenna; Hatmal, Ma'mon M.; Haworth, Ian S.; Qin, Peter Z.



Structural Determination of Marine Bacteriogenic Manganese Oxides  

NLE Websites -- All DOE Office Websites (Extended Search)

fig 2 Figure 2. (A) X-ray diffraction intensity data for bacteriogenic manganese oxides produced in sea water. The bottom pattern is for clean cells. (B) X-ray diffraction...


CX-011438: Categorical Exclusion Determination | Department of...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Energy Technology Laboratory Samples are scanned with X-rays and the diffracted beams are analyzed to determine the crystalline structure and other properties of the...


CX-008862: Categorical Exclusion Determination | Department of...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Exclusion Determination Variable Frequency Drivers for Raw Water Intake Structure Pumps Government Furnished Equipment CX(s) Applied: B1.3 Date: 08162012 Location(s):...


CX-010410: Categorical Exclusion Determination | Department of...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

CX-010410: Categorical Exclusion Determination Oracle to Tucson 115 Kilovolt Transmission Line, Cross Arm Replacements at Structure 25 and 73 CX(s) Applied: B1.3...


CX-002644: Categorical Exclusion Determination | Department of...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

CX-002644: Categorical Exclusion Determination Photoactive, Organic-Inorganic Hybrid Porous Structures for Photocatalytic Carbon Dioxide Reduction CX(s) Applied: B3.6...


Combining NMR, PRE, and EPR Methods For Homodimer Protein Structure...  

NLE Websites -- All DOE Office Websites (Extended Search)

NMR, PRE, and EPR Methods For Homodimer Protein Structure Determination. Combining NMR, PRE, and EPR Methods For Homodimer Protein Structure Determination. Abstract: Homo-oligomer...



Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

vegetation removal betweeen vegetation removal betweeen structures 0/3 and 0/4, liS and 1/6, 3/1 and 3/2, 412 and 4/3, a round structure 418, between structures S/l and S/2 and around structure S/4 along the existing Saguaro -Oracle 11S-kV transmission line, Pinal County, Arizona RECORD OF CATEGORICAL EXCLUSION DETERMINATION A. Proposed Action: Western proposes to conduct vegetation removal between structures 0/3 and 0/4, 1/5 and 1/6, 3/1 and 3/2, 4/2 and 4/3, around structure 4/8, between structures 5/1 and 5/2 and around structure 5/4 of its Saguaro-Oracle 115- kV transmission line, within Western's existing right-of-way. Western will access the vegetation removal areas using crew trucks along the existing access roads. Western will use a front end loader with a cut shredder attachment to knock down


JGI - Structural Genomics Program  

NLE Websites -- All DOE Office Websites (Extended Search)

Structural Genomics Program Structural Genomics Program The structural characterization of proteins of unknown function can be described as structural genomics, an approach in which structure determination by X-ray crystallography supplies key functional information. This is exemplified by studies of the carboxysome. The structures of the first carboxysome shell proteins (Kerfeld et al., Science 2005) confirmed earlier hypotheses that they are indeed the basic building blocks of the carboxysome shell; the quaternary structure and the higher order assemblies of the proteins in the crystals provided insight into how they assemble into shell facets. Likewise, our structure of the carboxysome component CsoS3 revealed that it was a member of the beta-carbonic family, despite having no detectable sequence homology at the level of primary structure



Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

addition of addition of aerial marker balls along the existing Prescott -Pinnacle Peak & Pinnacle Peak-Rogers 230-kV Transmission Line right-of-ways located in Maricopa County, Arizona. RECORD OF CATEGORICAL EXCLUSION DETERMINATION A. Proposed Action: Western proposes removing 2 existing marker balls at structures 0/4 & 0/5 of the Pinnacle Peak-Rogers #1 & #2 230-kV double circuit transmission line & installing aerial marker ball equipment on all static wires (overhead ground wires) of the Prescott-Pinnacle Peak 230-kV transmission line on the north side of structures 216/1-216/3 & the southeast side of structures 0/3-0/5 on the Pinnacle Peak-Rogers #1 & #2 230-kV double circuit transmission line. The diverters will be installed using a hot stick by accessing the structure using existing access roads and


Identification of a novel polyfluorinated compound as a lead to inhibit the human enzymes aldose reductase and AKR1B10: structure determination of both ternary complexes and implications for drug design  

Science Journals Connector (OSTI)

The polyfluorinated compound 2,2',3,3',5,5',6,6'-octafluoro-4,4'-biphenyldiol (JF0064) is a potent inhibitor (IC50 1 ?M) of both aldose reductase and AKR1B10. X-ray structures of ternary complexes of both enzymes with JF0064 allow it to be inferred that this lead compound binds to the enzyme active site through an acidic phenol group and allow the extraction of important hints for structure-based drug design.

Cousido-Siah, A.



CX-011200: Categorical Exclusion Determination | Department of...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

CX-011200: Categorical Exclusion Determination Blast and Paint West Hackberry Meter Skid, Prover Piping and Structure CX(s) Applied: B1.3 Date: 09092013 Location(s):...


CX-011228: Categorical Exclusion Determination | Department of...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

CX-011228: Categorical Exclusion Determination Structure 112-4 LIBPAD1 230-kilovolt Transmission Line "Live Line" Maintenance Training CX(s) Applied: B1.2 Date: 10252013...


Determining solar abundances using helioseismology  

E-Print Network (OSTI)

The recent downward revision of solar photospheric abundances of Oxygen and other heavy elements has resulted in serious discrepancies between solar models and solar structure as determined through helioseismology. In this work we investigate the possibility of determining the solar heavy-element abundance without reference to spectroscopy by using helioseismic data. Using the dimensionless sound-speed derivative in the solar convection zone, we find that the heavy element abundance, Z, of 0.0172 +/- 0.002, which is closer to the older, higher value of the abundances.

H. M. Antia; Sarbani Basu



Detection of structural degradation  

SciTech Connect

A time domain method developed for determining dynamic system characteristics is applied to structural monitoring and/or flaw detection. The potential usefulness for monitoring is evaluated based on several criteria, which include sensitivity to structural changes, location of flaws, and dependence upon excitation signals. The strengths and weaknesses of the methods are discussed. Also, structural monitoring using a signal's singular values is presented and evaluated. 2 refs., 4 figs., 2 tabs.

Endebrock, E.G.



What determines cell size?  

E-Print Network (OSTI)

as: Marshall WF, et al. : What determines cell size? BMC7007/10/101 FORUM Open Access What determines cell size?biologists have been wondering what determines the size of



The crystal structure of the interrupted framework silicate K{sub 9.6}Ca{sub 1.2}Si{sub 12}O{sub 30} determined from laboratory X-ray diffraction data  

SciTech Connect

The crystal structure of a potassium calcium silicate with composition K{sub 9.6}Ca{sub 1.2}Si{sub 12}O{sub 30} (or K{sub 8}CaSi{sub 10}O{sub 25}) has been solved by direct methods aided by distance least squares optimization from laboratory X-ray powder diffraction data. The trigonal compound adopts the non-centrosymmetric space group R3c with the following basic crystallographic data: a=11.13623(5)A, c=21.9890(2)A, V=2361.63(2)A{sup 3}, Z=3, D{sub calc}=2.617gcm{sup -3}. The crystal structure can be classified as an interrupted framework with exclusively Q{sup 3}-units. It can be thought of as being built from layers parallel to (001) containing isolated six-membered tetrahedral rings in UDUDUD conformation. Corner sharing of tetrahedra belonging to adjacent sheets results in a tetrahedral framework. The framework density of the structure is 15.2 T-atoms/1000A{sup 3}. The coordination sequences are identical for both silicon atoms in the asymmetric unit: 3-6-11-20-32-46-60-80-102-122. The vertex symbols for the two tetrahedral centers are 10{sub 2}.10{sub 2}.6{sub 1}. Topologically, the structure can be described as an Archimedean three-dimensional 3-connected net. It can be derived from the diamond or cristobalite net by removing 20% of the knots. Charge compensation in the structure is achieved by the incorporation of mono- and divalent M-cations (M: K, Ca). These extra-framework ions are coordinated by six to nine oxygen ligands. Ca/K distributions for the five symmetrically independent M-sites were obtained from a combination of bond distance considerations, site occupancy refinements and the bulk chemical composition. The structural characterization is completed by a detailed Raman spectroscopic study. Furthermore, possible implications of the structural chemistry of interrupted framework silicates for the field of silicate glass research are addressed.

Kahlenberg, V. [Institute of Mineralogy and Petrography, University of Innsbruck, Innrain 52, A-6020 Innsbruck (Austria)]. E-mail: volker.kahlenberg@uibk.ac.at; Kaindl, R. [Institute of Mineralogy and Petrography, University of Innsbruck, Innrain 52, A-6020 Innsbruck (Austria); Christian-Doppler-Laboratory for Advanced Hard Coatings at the Institute of Mineralogy and Petrography, University of Innsbruck, Innrain 52, A-6020 Innsbruck (Austria); Toebbens, D.M. [Institute of Mineralogy and Petrography, University of Innsbruck, Innrain 52, A-6020 Innsbruck (Austria)




Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

maintenance and avian nesting removal maintenance and avian nesting removal between structures 180/1 & 188/2 of the existing Mead-Perkins 500-kV transmission line in Maricopa County, Arizona. RECORD OF CATEGORICAL EXCLUSION DETERMINATION A. Proposed Action: Western proposes to conduct access road maintenance between structures 180/1 & 188/2 of the existing Mead-Perkins 500-kV transmission line. This will consist of blading and leveling out areas of the existing access road using dozers, bucket trucks, crew trucks and pickup trucks. This work is needed to facilitate avian nest removal at structures 180/1, 182/2, 186/2 & 188/2. This work is necessary to maintain the safety and reliability of the bulk electrical system. The attached A1ap shows the project areas are situated within Sections 13 & 24

Note: This page contains sample records for the topic "determination gila-knob structure" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.



Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

maintenance maintenance along the exis!ing Blythe-Knob 161-kV transmission Ime in Maricopa County. Arizona RECORD OF CATEGORICAL EXCLUSION DETERMINATION A. Proposed Action: Western proposes to replace broken crossarms at structures 32/3,6312 and cross brace repair at structure 31/2 along the existing Blythe - Knob 161-kV transmission line. Western will access structures using crew trucks and pickup trucks along existing access roads. This work is necessary to maintain the safety and reliability of the bulk electrical system. The attached maps show the project area is situated within Sections 15 & 21 Township 11 South Range 20 East & Section 10 Township 16 South Range 21 East on the San Bernardino Meridian, Imperial County, California. The corresponding


Graduate Program Salary Structure  

NLE Websites -- All DOE Office Websites (Extended Search)

Salary Structure Salary Structure Graduate Program Salary Structure Point your career towards LANL: work with the best minds on the planet in an inclusive environment that is rich in intellectual vitality and opportunities for growth. Contact Student Programs (505) 665-8899 Email GRA salary determination process Salaries are determined by evaluating students' current transcripts using the following criteria: Salaries for graduate students are based on completion of 12 credit hours annually for the first two years of a Master's or PhD graduate program (BS+1, BS+2). Salaries are then based on satisfactory progress (minimum of one credit hour) towards degree after the second year of a Master's degree (MS+0 or degree awarded) or PhD program (BS+3, BS+4, BS+5). Professional salary structure



Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Categorical Exclusion for erosion repair and cactus relocation along the existing Tucson-Apache 11S-kV transmission line in Pima County, Arizona RECORD OF CATEGORICAL EXCLUSION DETERMINATION A. Proposed Action: Western proposes to construct a new access road along the existing Tucson-Apache 11S-kV transmission line within the existing right-of-way and to repair erosion damage at transmission line structures. Access road construction will consist of stripping, clearing and removing vegetation and blading and leveling to create a road within the existing right-of-way between structures 24/7-2S/2 & 2S/3- 26/S. We will be installing two gates to limit right-of-way access from Houghton Road. We will be creating reinforced embankments through the placement of



Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

near 10 structure locations along the existing Casa Grande-Empire 115-kV transmission line located in Pinal County, Arizona. RECORD OF CATEGORICAL EXCLUSION DETERMINATION A. Proposed Action: Western proposes to do geologic borings within our right-of-way near structures 18/5, 19/6, 21/2, 2317, 26/4, 28/4, 36/1, 37/5, 39/4 and 41/4 along the existing Casa Grande-ED #5115-kV transmission line. This project involves accessing each bore hole location with a augerldrill rig and light crew trucks, setting up the drill rig, drilling, collecting soil samples and breaking down the drilling setup. Existing access roads and vehicles such as pickup trucks & crew trucks will be used to bring personnel and equipment to the work areas. The attached maps show the project areas situated within Sections 7,20 & 32



Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

upgrading to a upgrading to a double circuit of 3.6 miles of the existing Casa Grande-Empire 11S-kV transmission line located in Pinal County, Arizona RECORD OF CATEGORICAL EXCLUSION DETERMINATION A. Proposed Action: Western proposes to work with Salt River Project on an upgrade to a double circuit on its Casa Grande-Empire 11S-kV transmission line. This project involves the removal of the existing H-frame wooden structures and the installation of new steel monopole structures. This will require auger trucks, bulldozers, bucket trucks and cranes. Existing access roads and the existing right-of-way will be used for vehicles such as pickup trucks, crew trucks, backhoes and bucket trucks to bring personnel and equipment to the work areas. The attached map shows the project area situated within Sections 19, 30 & 31 of



Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

near 9 near 9 structure locations along the existing ED2-ED5 230-kV transmission line located in Pinal County, Arizona RECORD OF CATEGORICAL EXCLUSION DETERMINATION A, Proposed Action: Western proposes to do geologic borings within our right-of-way near structures 21/5,22/5,23/6,25/4,26/5,27/6,28/5,29/5 & 30/4 along the existing ED2-ED5 230-kV transmission line. This project involves accessing each bore hole location with a auger/drill rig and light crew trucks, setting up the drill rig, drilling, collecting soil samples and breaking down the drilling setup. Existing access roads and vehicles such as pickup trucks & crew trucks will be used to bring personnel and equipment to the work areas. The attached maps show the project areas situated within Sections 7, 18, 30 & 31


Detecting determinism from point processes  

Science Journals Connector (OSTI)

The detection of a nonrandom structure from experimental data can be crucial for the classification, understanding, and interpretation of the generating process. We here introduce a rank-based nonlinear predictability score to detect determinism from point process data. Thanks to its modular nature, this approach can be adapted to whatever signature in the data one considers indicative of deterministic structure. After validating our approach using point process signals from deterministic and stochastic model dynamics, we show an application to neuronal spike trains recorded in the brain of an epilepsy patient. While we illustrate our approach in the context of temporal point processes, it can be readily applied to spatial point processes as well.

Ralph G. Andrzejak; Florian Mormann; Thomas Kreuz



CX-005580: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

580: Categorical Exclusion Determination 580: Categorical Exclusion Determination CX-005580: Categorical Exclusion Determination Sidney to Sterling Transmission Line Structure Replacement, Logan County, Colorado CX(s) Applied: B4.6 Date: 12/22/2010 Location(s): Logan County, Colorado Office(s): Western Area Power Administration-Rocky Mountain Region Western proposes to replace approximately 22 existing wood pole H-frame structures along the Sidney to Sterling 115-kilovolt transmission line between the Sterling Substation and Peetz, Colorado. The existing structures would be replaced with structures that are approximately 10 feet taller to ensure proper electrical clearances. The new structures would look nearly identical to the replaced structures. The work includes removing existing structures and hardware, dismantling old structures,



Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

and structure replacement and structure replacement along the existing Casa Grande-Empire 11~-kV transmission line, Pinal County, Arizona RECORD OF CATEGORICAL EXCLUSION DETERMINATION A. Proposed Action: Western proposes to replace structures and upgrade to a double circuit 230-kV transmission line on its Casa Grande-Empire115-kV transmission line, from Thornton Road to its Empire Substation, within Western's existing right-of-way. This will include the rebuild of 13.2 miles of transmission line, replacing the H-frame structures with steel monopole structures with foundations, hardware and insulator replacement and adding a overhead ground-wire over the entire length of the project. Western will access the structure using crew trucks along the existing access roads. This work is necessary to maintain the safety and reliability of the bulk


The high-throughput protein-to-structure pipeline at SECSG  

Science Journals Connector (OSTI)

The high-throughput crystal structure determination pipeline at Southeast Collaboratory for Structural Genomics, a pilot center of the National Institutes of Health Protein Structure Initiative, is described.

Liu, Z.-J.



A synchroton single crystal X-ray structure determination of (NH4)3Mo4P3O16: A microporous molybdenum phosphate with Mo4O6+4 cubes  

Science Journals Connector (OSTI)

Reaction of MoO3, Mo, (NH4)2HPO4, H3PO4, and H2O in a mole ratio of 1.4:1:3.6:6:120 at 360°C for 16 hr gives a nearly quantitative yield of black cubes of (NH4)3Mo4P3O16 (1). The structure of (1) was solved from data collected on a 30 × 30 × 30 ?m3 crystal at the National Synchrotron Light Source at Brookhaven National Laboratory. The compound is cubic, space group P43m, with a = 7.736(2) Å, and was refined to residuals of R(Rw) = 0.035(0.049). Phosphate (1) is isotypic with Cs3Mo4P3O16 and is related to the iron arsenate mineral pharmacosiderite. Unlike the Cs+ compound, (1) can be rendered microporous by thermal removal of the NH+4 cations to give ammonia with the charge compensating proton remaining behind in the lattice. Water absorption isotherms show the reversible uptake of 5.6 wt% water, which corresponds to over 15 vol% void space in (1) after the NH3 removal. The framework consists of Mo4O6+4 cubes, with six Mo?Mo contacts of 2.570(4) Å, joined together together by (PO4)62 along ?100? to form a 3-D network composed of tetramers of triply edge-sharing Mo-centered octahedra and phosphate groups alternating along all ?100? directions. The windows and cavities in (1) are large enough that the NH+4 cations occupy several different positions in the unit cell.

H.E. King Jr.; Linda A. Mundi; Karl G. Strohmaier; Robert C. Haushalter



Draft General Conformity Determination  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

I I Draft General Conformity Determination U.S. Department of the Interior Minerals Management Service MMS Cape Wind Energy Project January 2009 Final EIS Appendix I Draft General Conformity Determination Draft General Conformity Determination Cape Wind Energy Project Prepared by Minerals Management Service Herndon, VA November 2008 i TABLE OF CONTENTS 1.0 INTRODUCTION TO THE PROPOSED ACTION............................................................... 1 2.0 GENERAL CONFORMITY REGULATORY BACKGROUND .......................................... 2 2.1 GENERAL CONFORMITY REQUIREMENTS.................................................................... 2 2.2 GENERAL CONFORMITY APPLICABILITY.....................................................................


Structure-Soil-Structure Interaction Effects: Seismic Analysis of Safety-Related Collocated Structures  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

STRUCTURE-SOIL- STRUCTURE-SOIL- STRUCTURE INTERACTION AT SRS Structural Mechanics - SRS October 25, 2011 1 Objective Determination of Structure Soil Structure Interaction (SSSI) effects, if any between large and more massive Process Building (PB) and Exhaust Fan Building (EFB). Results of the SSSI analysis were compared with those from Soil Structure Interaction (SSI) analysis of the individual buildings, for the following parameters: * In-structure floor response spectra (ISRS) * Transfer functions * Relative displacements for EFB and PB * In-plane- shear from SASSI at EFB wall 2 Building Description 3 The Process Building is a massive reinforced concrete structure supported approximately 40 feet below the finished grade. The PB approximate foundation dimensions are approximately


Categorical Exclusion Determinations: Maine | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Maine Maine Categorical Exclusion Determinations: Maine Location Categorical Exclusion Determinations issued for actions in Maine. DOCUMENTS AVAILABLE FOR DOWNLOAD February 4, 2013 CX-010231: Categorical Exclusion Determination Hywind Maine CX(s) Applied: A9, B3.1, B3.6 Date: 02/04/2013 Location(s): Maine Offices(s): Golden Field Office January 17, 2013 CX-009915: Categorical Exclusion Determination The University of Maine's "New England Aqua Ventus I" Program CX(s) Applied: A9, B3.6 Date: 01/17/2013 Location(s): Maine Offices(s): Golden Field Office November 5, 2012 CX-009425: Categorical Exclusion Determination Partial Validation of Coupled Models and Optimization of Materials for Offshore Wind Structures CX(s) Applied: B3.3, B3.16, B5.18 Date: 11/05/2012 Location(s): Maine


Categorical Exclusion Determinations: Nebraska | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Nebraska Nebraska Categorical Exclusion Determinations: Nebraska Location Categorical Exclusion Determinations issued for actions in Nebraska. DOCUMENTS AVAILABLE FOR DOWNLOAD August 20, 2013 CX-010891: Categorical Exclusion Determination Archer-Stegall 230-Kilovolt Fiber Optic Ground Wire Addition CX(s) Applied: B4.7 Date: 08/20/2013 Location(s): Nebraska, Nebraska Offices(s): Western Area Power Administration-Rocky Mountain Region August 8, 2013 CX-010887: Categorical Exclusion Determination Archer-Sidney 115-Kilovolt Transmission Line Structure Replacement CX(s) Applied: B4.13 Date: 08/08/2013 Location(s): Nebraska Offices(s): Western Area Power Administration-Rocky Mountain Region June 4, 2013 CX-010549: Categorical Exclusion Determination Chappell, Julesburg, and Kersey Tap Line Switch Replacements in Deuel


Categorical Exclusion Determinations: Southwestern Power Administration |  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Southwestern Power Southwestern Power Administration Categorical Exclusion Determinations: Southwestern Power Administration Categorical Exclusion Determinations issued by Southwestern Power Administration. DOCUMENTS AVAILABLE FOR DOWNLOAD August 6, 2013 CX-010879: Categorical Exclusion Determination Transmission Line 3005, Structure 290 Replacement CX(s) Applied: B4.6 Date: 08/06/2013 Location(s): Oklahoma Offices(s): Southwestern Power Administration July 25, 2013 CX-010880: Categorical Exclusion Determination Transmission Line 3016, Access Road Acquisition Project CX(s) Applied: B1.24 Date: 07/25/2013 Location(s): Oklahoma Offices(s): Southwestern Power Administration July 22, 2013 CX-010716: Categorical Exclusion Determination Short Mountain Access Road Easement Acquisition CX(s) Applied: B1.24


Visible structures  

E-Print Network (OSTI)

All architecture is the interplay between structure, surface and ornament. Traditionally, ornament adorned structure thereby giving it its meaning. A society with its intellectual foundations resting in faith or the abstract ...

Conway, Helene Marie



Structural biology  

Science Journals Connector (OSTI)

...systematic attempt to 1980 K. C. Holmes Structural biology...structural genomics (Shapiro & Lima 1998). The purpose...Rosenbaum, G., Holmes, K. C. & Witz, J. 1971 Synchrotron...95, 13 585^13590. Shapiro, L. & Lima, C. D. 1998 The Argonne...



Categorical Exclusion Determinations: Western Area Power  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

March 29, 2012 March 29, 2012 CX-008407: Categorical Exclusion Determination Terry Ranch Road Substation CX(s) Applied: B1.24, B4.11 Date: 03/29/2012 Location(s): Wyoming Offices(s): Western Area Power Administration-Rocky Mountain Region March 29, 2012 CX-008403: Categorical Exclusion Determination Multiple Structure Replacement Flaming Gorge to Vernal No. 1 138 Kilovolt Transmission Line CX(s) Applied: B1.3 Date: 03/29/2012 Location(s): Utah Offices(s): Western Area Power Administration-Rocky Mountain Region March 29, 2012 CX-008399: Categorical Exclusion Determination Erosion Control Measures Structure No. 110-3 Dave Johnston to Stegall 230 Kilovolt Transmission Line CX(s) Applied: B1.3 Date: 03/29/2012 Location(s): Wyoming Offices(s): Western Area Power Administration-Rocky Mountain Region


Categorical Exclusion Determinations: Louisiana | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

August 16, 2012 August 16, 2012 CX-008862: Categorical Exclusion Determination Variable Frequency Drivers for Raw Water Intake Structure Pumps Government Furnished Equipment CX(s) Applied: B1.3 Date: 08/16/2012 Location(s): Texas, Texas, Louisiana Offices(s): Strategic Petroleum Reserve Field Office August 14, 2012 CX-008863: Categorical Exclusion Determination Dredging of the West Hackberry Raw Water Intake Structure CX(s) Applied: B1.3 Date: 08/14/2012 Location(s): Louisiana Offices(s): Strategic Petroleum Reserve Field Office July 26, 2012 CX-008866: Categorical Exclusion Determination Install Power Metering for Strategic Petroleum Reserve Site Buildings CX(s) Applied: B1.31 Date: 07/26/2012 Location(s): Louisiana, Texas, Texas, Louisiana Offices(s): Strategic Petroleum Reserve Field Office

Note: This page contains sample records for the topic "determination gila-knob structure" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Categorical Exclusion Determinations: Western Area Power  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

March 11, 2010 March 11, 2010 CX-007156: Categorical Exclusion Determination New Waddell-Raceway-Westwing Structure Replacement CX(s) Applied: B4.6, B4.13 Date: 03/11/2010 Location(s): Maricopa County, Arizona Office(s): Western Area Power Administration-Desert Southwest Region February 18, 2010 CX-007167: Categorical Exclusion Determination Rogers-Coolidge Danger Tree Removal CX(s) Applied: B1.3 Date: 02/18/2010 Location(s): Pinal County, Arizona Office(s): Western Area Power Administration-Desert Southwest Region December 31, 2009 CX-001121: Categorical Exclusion Determination Transmission Line Structure Relocation of Existing Oracle-Tucson 115-kilovolt Transmission Line CX(s) Applied: B4.13 Date: 12/31/2009 Location(s): Pima County, Arizona Office(s): Western Area Power Administration-Desert Southwest Region


Interim Action Determination  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Interim Action Determination Interim Action Determination Processing of Plutonium Materials from the DOE Standard 3013 Surveillance Program in H-Canyon at the Savannah River Site The Department of Energy (DOE) is preparing the Surplus Plutonium Disposition Supplemental Environmental Impact Statement (SPD SEIS, DOE/EIS-0283-S2). DOE is evaluating alternatives for disposition of non-pit plutonium that is surplus to the national


CX-008738: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

8: Categorical Exclusion Determination 8: Categorical Exclusion Determination CX-008738: Categorical Exclusion Determination Determination of Microstructure and Chemical State Changes in Ion-Irradiated Fuels and Structural Components with a High Kinetic Energy Electron Detector - Illinois Institute of Technology CX(s) Applied: B3.6 Date: 05/22/2012 Location(s): Idaho Offices(s): Idaho Operations Office The Illinois Institute of Technology will purchase a High Kinetic Energy (HiKE) instrument for measuring the structural and chemical changes in ion-irradiated fuels and structural materials for verification of radiation damage models. Microsoft Word - DOE-ID-12-026 Illinois Tech.doc More Documents & Publications CX-009035: Categorical Exclusion Determination CX-007758: Categorical Exclusion Determination


CX-008400: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

CX-008400: Categorical Exclusion Determination CX-008400: Categorical Exclusion Determination CX-008400: Categorical Exclusion Determination Estes Park to Mary's Lake West 115 Kilovolt Transmission Line Structure Replacement CX(s) Applied: B1.3 Date: 05/02/2012 Location(s): Colorado Offices(s): Western Area Power Administration-Rocky Mountain Region Western Area Power Administration (Western) proposes to replace two existing wood H-frame structures along the Estes Park to Mary's Lake West 115 kilovolt transmission line. The structures are located on private land near the community of Mary's Lake in Larimer County, Colorado. CX-008400.pdf More Documents & Publications CX-008386: Categorical Exclusion Determination CX-008381: Categorical Exclusion Determination CX-008389: Categorical Exclusion Determination


Undergraduate Program Salary Structure  

NLE Websites -- All DOE Office Websites (Extended Search)

Salary Structure Salary Structure Undergraduate Program Salary Structure Point your career towards LANL: work with the best minds on the planet in an inclusive environment that is rich in intellectual vitality and opportunities for growth. Contact Student Programs (505) 665-8899 Email Undergraduate salary determination process Salaries are evaluated from students' current transcripts based on college academic progression and hours completed in a degree program. Administrative/professional structure Years Description Yearly Hourly HS +0 HS grad & acceptance to college $20,900/yr $10.05/hr HS +1 Completion of first year and minimum of 24 semester hours $24,560/yr $11.81/hr HS +2 Completion of second year and minimum of 48 semester hours (salary cap for students pursuing an Associate's Degree) $27,540/yr $13.24/hr


Determining age of whales  

NLE Websites -- All DOE Office Websites (Extended Search)

Determining age of whales Determining age of whales Name: Bruce W Walkey Age: N/A Location: N/A Country: N/A Date: N/A Question: While browsing through the Internet, I came upon a question by two fifth grade students. Their question got me thinking and now I pose it to you. How can you determine the age of whales? Since they are mammals, can the methods that are used on humans be used on whales? What are some tests that can be done on bones or tissues to determine age? Looking forward to your reply. Replies: Although it is difficult to determine the age of whales (unless they are born in captivity and we know their birth date), several methods have been commonly used: 1) (if female) the examination of the ovaries 2) Examination of the ridges on baleen, which are not uniform in size and analogous to tree rings. The problem with this is that baleen wears away over time. 3) Studying layers of ossification in an ear bone is probably the most accurate method of aging, since internal bones don't wear away. The biggest problem with aging methods is that they usually require that you are dissecting the animal, and often, we would like a method of aging for live active animals. The best we can do here is to compare the size and markings of whales of known age to those found in the wild. Great question!


A VSP transformation technique for the determination of subsurface structure  

E-Print Network (OSTI)

is the dominant wavelength. With the surface reflection profiling technique, resolution typically ranges from tens to hundreds of meters. With this degree of resolution, a detailed understanding of the subsurface is hard to achieve, In a vertical seismic... Chairman of Advisory Committee: Dr. Terry W. Spencer An algorithm was developed which transforms a vertical seismic profile (VSP) from the time-depth domain into the offset-time domain. The procedure operates by calculating the dips of the reflectors...

Malloy, Jeffrey Edward




E-Print Network (OSTI)

J. Mol. Spectry. ]2_, IT c E. Flood and J. E. Boggs, J. Mol.by sulfur d functions, Flood and Boggs predicted r (C =S) e

Yoshioka, Yasunori



High-Energy Electron Scattering and Nuclear Structure Determinations  

Science Journals Connector (OSTI)

Electrons of energies 125 and 150 Mev are deflected from the Stanford linear accelerator and brought to a focused spot of dimension 3 mm×15 mm at a distance of 9 feet from a double magnet deflecting system. The focus is placed at the center of a brass-scattering chamber of diameter 20 inches. Thin foils are inserted in the chamber and elastically-scattered electrons from these foils pass through thin aluminum windows into the vacuum chamber of a double focusing analyzing magnet of the inhomogeneous field type. The energy resolution of the magnet has been about 1.5 percent in these experiments. This resolution is enough to separate clearly hydrogen or deuterium elastic peaks from carbon peaks in the same scattering target. The energy loss in the foils is readily measurable. In the case of light nuclei, e.g., H, D, Be, C, the shift of the peak of the elastic curve as a function of scattering angle indicates the recoil of the struck nucleus. Relative angular distributions are measured for Be, Ta, Au, and Pb. It is possible to interpret these data in terms of a variable charge density within the nucleus.

R. Hofstadter; H. R. Fechter; J. A. McIntyre



Categorical Exclusion Determinations: American Recovery and Reinvestment  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

9, 2010 9, 2010 CX-003770: Categorical Exclusion Determination Maine-County-York CX(s) Applied: A1, A9, A11, B2.5, B5.1 Date: 09/09/2010 Location(s): York County, Maine Office(s): Energy Efficiency and Renewable Energy September 9, 2010 CX-003765: Categorical Exclusion Determination Idaho-Tribe-Nez Perce Tribe CX(s) Applied: A9, A11, B2.5, B5.1 Date: 09/09/2010 Location(s): Idaho Office(s): Energy Efficiency and Renewable Energy September 9, 2010 CX-003713: Categorical Exclusion Determination Validation of Coupled Models and Optimization of Materials for Offshore Wind Structures CX(s) Applied: A9, B3.1, B3.3, B3.6 Date: 09/09/2010 Location(s): Maine Office(s): Energy Efficiency and Renewable Energy, Golden Field Office September 9, 2010 CX-003694: Categorical Exclusion Determination


Categorical Exclusion Determinations: Science | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

March 30, 2010 March 30, 2010 CX-002583: Categorical Exclusion Determination Digital Hadron Calorimeter CX(s) Applied: B3.6 Date: 03/30/2010 Location(s): Illinois Office(s): Fermi Site Office, Science March 13, 2010 CX-001226: Categorical Exclusion Determination End Station Test Beam CX(s) Applied: B3.10 Date: 03/13/2010 Location(s): California Office(s): Science, Stanford Linear Accelerator Site Office March 2, 2010 CX-001509: Categorical Exclusion Determination East Campus Parking Structure at the Oak Ridge National Laboratory (ORNL) CX(s) Applied: B1.15 Date: 03/02/2010 Location(s): Oak Ridge, Tennessee Office(s): Oak Ridge Office, Science February 23, 2010 CX-003141: Categorical Exclusion Determination Advanced Biofuels Process Development Unit for Lawrence Berkeley National


Categorical Exclusion Determinations: Savannah River Operations Office |  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

July 31, 2013 July 31, 2013 CX-010844: Categorical Exclusion Determination Subcontractor Repair of Leak Over Entry Door #1 at 703-B CX(s) Applied: B1.3 Date: 07/31/2013 Location(s): South Carolina Offices(s): Savannah River Operations Office July 30, 2013 CX-010846: Categorical Exclusion Determination Install Stud, Shims, and Nut in the L-Basin 70-Ton Cask Lid Support Structure CX(s) Applied: B2.5 Date: 07/30/2013 Location(s): South Carolina Offices(s): Savannah River Operations Office July 23, 2013 CX-010850: Categorical Exclusion Determination Install Well Pump into the F-Tank Farm Catch Tank FL-241901-WTS-TK-1 CX(s) Applied: B1.3 Date: 07/23/2013 Location(s): South Carolina Offices(s): Savannah River Operations Office July 23, 2013 CX-010849: Categorical Exclusion Determination


Categorical Exclusion Determinations: Texas | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

October 2, 2012 October 2, 2012 CX-009237: Categorical Exclusion Determination The Dow Chemical Company CX(s) Applied: B5.7 Date: 10/02/2012 Location(s): Texas Offices(s): Fossil Energy September 27, 2012 CX-009327: Categorical Exclusion Determination Gas Hydrate Dynamics on the Alaskan Beaufort Continental Slope: Modeling and Field Characterization CX(s) Applied: A9 Date: 09/27/2012 Location(s): Texas Offices(s): National Energy Technology Laboratory September 20, 2012 CX-009218: Categorical Exclusion Determination Replace Sparge Piping at Bryan Mound Raw Water Intake Structure CX(s) Applied: B1.3 Date: 09/20/2012 Location(s): Texas Offices(s): Strategic Petroleum Reserve Field Office September 19, 2012 CX-009359: Categorical Exclusion Determination Houston Zero Emission Delivery Vehicle Deployment


Categorical Exclusion Determinations: Washington | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

June 22, 2012 June 22, 2012 CX-008692: Categorical Exclusion Determination Amendment Number 2 to the Alcoa Power Sales Agreement CX(s) Applied: A2 Date: 06/22/2012 Location(s): Oregon, Washington Offices(s): Bonneville Power Administration June 21, 2012 CX-008695: Categorical Exclusion Determination Munro Control Center Expansion CX(s) Applied: B1.15 Date: 06/21/2012 Location(s): Washington Offices(s): Bonneville Power Administration June 20, 2012 CX-008694: Categorical Exclusion Determination Acquisition and Disposition of Property CX(s) Applied: B1.24 Date: 06/20/2012 Location(s): Washington, Oregon Offices(s): Bonneville Power Administration June 20, 2012 CX-008693: Categorical Exclusion Determination Wood Pole Structure Replacements on the Chehalis-Centralia No. 2 115 Kilovolt Transmission Line


Categorical Exclusion Determinations: Colorado | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

May 18, 2012 May 18, 2012 CX-008766: Categorical Exclusion Determination Asphalt Repair and Concrete Work Activities at the Grand Junction, Colorado, Disposal Site CX(s) Applied: B1.3 Date: 05/18/2012 Location(s): Colorado Offices(s): Legacy Management May 15, 2012 CX-008238: Categorical Exclusion Determination Recovery Act: Colorado State Capitol Building Geothermal Program CX(s) Applied: A9, B2.1, B5.19 Date: 05/15/2012 Location(s): Colorado Offices(s): Golden Field Office May 9, 2012 CX-008401: Categorical Exclusion Determination Giant Track Communications Tower Removal CX(s) Applied: B1.19 Date: 05/09/2012 Location(s): Colorado Offices(s): Western Area Power Administration-Rocky Mountain Region May 9, 2012 CX-008381: Categorical Exclusion Determination Big Thompson to Flatiron 13.8 Kilovolt Transmission Line Structure


Categorical Exclusion Determinations: New Brunswick Laboratory | Department  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

New Brunswick Laboratory New Brunswick Laboratory Categorical Exclusion Determinations: New Brunswick Laboratory Categorical Exclusion Determinations issued by New Brunswick Laboratory. DOCUMENTS AVAILABLE FOR DOWNLOAD June 8, 2012 CX-008816: Categorical Exclusion Determination Renovations and Maintenance Activities for Buildings, Structures, Infrastructures and Equipment CX(s) Applied: B1.3, 61.4, 61.5, B1.11, B1.15, B1.16, B1.17, 81.22, B1.27, 62.1, B2.2, B2.3, 62.5 Date: 06/08/2012 Location(s): Illinois Offices(s): New Brunswick Laboratory June 8, 2012 CX-008817: Categorical Exclusion Determination Indoor Bench Scale Research Projects and Conventional Laboratory Operations CX(s) Applied: B3.6 Date: 06/08/2012 Location(s): Illinois Offices(s): New Brunswick Laboratory December 10, 2009


Categorical Exclusion Determinations: Savannah River Operations Office |  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

July 20, 2012 July 20, 2012 CX-009070: Categorical Exclusion Determination A-Area Alternate Fire Water Supply CX(s) Applied: B1.3 Date: 07/20/2012 Location(s): South Carolina Offices(s): Savannah River Operations Office July 20, 2012 CX-009069: Categorical Exclusion Determination Remove and Dispose of 107 A & B Tanks and Support Structure CX(s) Applied: B6.1 Date: 07/20/2012 Location(s): South Carolina Offices(s): Savannah River Operations Office July 20, 2012 CX-009068: Categorical Exclusion Determination Hydrogen Charging Tritium Contaminated Metals CX(s) Applied: B3.6 Date: 07/20/2012 Location(s): South Carolina Offices(s): Savannah River Operations Office July 16, 2012 CX-009077: Categorical Exclusion Determination F-Area Infrasturcture Improvement CX(s) Applied: B1.23 Date: 07/16/2012


Categorical Exclusion Determinations: Missouri | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

22, 2010 22, 2010 CX-004797: Categorical Exclusion Determination 3M Columbia Solar Film Date: 12/22/2010 Location(s): Columbia, Missouri Office(s): Energy Efficiency and Renewable Energy, Golden Field Office December 16, 2010 CX-004688: Categorical Exclusion Determination Single-Molecule Imaging System Combined with Nano-Fluidic Chip to Understand Fluid Flow in Shale Gas CX(s) Applied: B3.6 Date: 12/16/2010 Location(s): Rolla, Missouri Office(s): Fossil Energy, National Energy Technology Laboratory December 8, 2010 CX-007798: Categorical Exclusion Determination Springfield Maintenance Garage CX(s) Applied: B1.15 Date: 12/08/2010 Location(s): Missouri Offices(s): Southwestern Power Administration November 24, 2010 CX-004540: Categorical Exclusion Determination Remote Monitoring of the Structural Health of Hydrokinetic Composite


Categorical Exclusion Determinations: Idaho Operations Office | Department  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

May 22, 2012 May 22, 2012 CX-008744: Categorical Exclusion Determination Implementation of a Low-Level Gamma-Ray Counting Facility - University of Texas at Austin CX(s) Applied: B3.6 Date: 05/22/2012 Location(s): Idaho Offices(s): Idaho Operations Office May 22, 2012 CX-008738: Categorical Exclusion Determination Determination of Microstructure and Chemical State Changes in Ion-Irradiated Fuels and Structural Components with a High Kinetic Energy Electron Detector - Illinois Institute of Technology CX(s) Applied: B3.6 Date: 05/22/2012 Location(s): Idaho Offices(s): Idaho Operations Office May 22, 2012 CX-008737: Categorical Exclusion Determination Building Calorimetric and Thermogravimetric Analytical Instrumentation Capability at Oregon State University CX(s) Applied: B3.6 Date: 05/22/2012


Categorical Exclusion Determinations: Western Area Power  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Desert Southwest Region Desert Southwest Region Categorical Exclusion Determinations: Western Area Power Administration-Desert Southwest Region Categorical Exclusion Determinations issued by Western Area Power Administration-Desert Southwest Region. DOCUMENTS AVAILABLE FOR DOWNLOAD August 22, 2013 CX-010882: Categorical Exclusion Determination Liberty-Parker Dam #2 230-Kilovolt Transmission Line, Optical Power Ground Wire Repair CX(s) Applied: B4.7 Date: 08/22/2013 Location(s): Arizona Offices(s): Western Area Power Administration-Desert Southwest Region August 12, 2013 CX-010883: Categorical Exclusion Determination PHX-LOB and LIB-LOB 230-Kilovolt Double-Circuit- Replace Insulators at Structure No. 28-2 With NCI Type Polymers CX(s) Applied: B1.3 Date: 08/12/2013 Location(s): Arizona Offices(s): Western Area Power Administration-Desert Southwest Region

Note: This page contains sample records for the topic "determination gila-knob structure" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Gender determination in populus  

SciTech Connect

Gender, the expression of maleness or femaleness, in dioecious plants has been associated with changes in morphology, physiology, ecological position, and commercial importance of several species, including members of the Salicaceae family. Various mechanisms have been proposed to explain the expression of gender in Salicaceae, including sex chromosomes, simple Mendelian genes, quantitative genes, environment, and genotype-by-environment interactions. Published reports would favor a genetic basis for gender. The objective of this study was to identify molecular markers associated with gender in a segregating family of hybrid poplars. Bulked segregant analysis and chi-squared analysis were used to test for the occurrence of sex chromosomes, individual loci, and chromosome ratios (i.e., ploidy levels) as the mechanisms for gender determination. Examination of 2488 PCR based RAPD markers from 1219 primers revealed nine polymorphic bands between male and female bulked samples. However, linkage analysis indicated that none of these markers were significantly associated with gender. Chisquared results for difference in male-to-female ratios between diploid and triploid genotypes also revealed no significant differences. These findings suggest gender is not controlled via sex chromosomes, simple Mendelian loci or ratios of autosome to gender-determining loci. It is possible that gender is determined genetically by regions of the genome not sampled by the tested markers or by a complex of loci operating in an additive threshold manner or in an epistatic manner. It is also possible that gender is determined environmentally at an early zygote stage, canalizing gender expression.

McLetchie, D.N. [Univ. of Kentucky, Lexington, KY (United States). Dept. of Biological Sciences; Tuskan, G.A. [Oak Ridge National Lab., TN (United States)



CX-007359: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

359: Categorical Exclusion Determination 359: Categorical Exclusion Determination CX-007359: Categorical Exclusion Determination McNary-Horse Heaven 230-kilovolt Transmission Line Raise (Structures 15/2 to 16/3) CX(s) Applied: B1.3 Date: 12/01/2011 Location(s): Washington Offices(s): Bonneville Power Administration Bonneville Power Administration (BPA) is proposing to add six wooden prop structures to the McNary-Horse Heaven No. 1 230-kilovolt transmission line between structures 15/2-16/3. The prop structures are needed to raise the existing line so that the conductor meets the necessary Minimum Approach Distance from the orchard below. An augur truck would use existing BPA roads to access the site and install wooden poles. More Documents & Publications CX-006582: Categorical Exclusion Determination


CX-005546: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

6: Categorical Exclusion Determination 6: Categorical Exclusion Determination CX-005546: Categorical Exclusion Determination McNary-Ross Number 1 Structure 162/4 Relocation and Insulator Replacement Project CX(s) Applied: B1.3 Date: 03/25/2011 Location(s): Clark County, Washington Office(s): Bonneville Power Administration In order to increase the ground-to-conductor clearance of the 345-kilovolt McNary-Ross Number 1 transmission line, Bonneville Power Administration proposes to relocate structure 162/4 to a new location that is 75 feet ahead-on-line (west) of the center of the existing structure, and replace the insulator hardware that suspends the conductor on 15 structures. DOCUMENT(S) AVAILABLE FOR DOWNLOAD CX-005546.pdf More Documents & Publications CX-006817: Categorical Exclusion Determination


CX-006302: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

302: Categorical Exclusion Determination 302: Categorical Exclusion Determination CX-006302: Categorical Exclusion Determination Colville-Republic Rebuild Project CX(s) Applied: B1.3, B4.6 Date: 07/21/2011 Location(s): Stevens County, Washington Office(s): Bonneville Power Administration Bonneville Power Administration (BPA) is proposing to replace deteriorating wood pole structures along approximately 13.5 miles of the Colville-Republic No. 1 115 kilovolt (kV) transmission line (structures 1/1-14/5). BPA would replace wood pole structures in kind and at their currently existing locations. In addition to pole replacement, BPA would replace structure crossarms, insulators, dampers and conductor. DOCUMENT(S) AVAILABLE FOR DOWNLOAD CX-006302.pdf More Documents & Publications CX-010439: Categorical Exclusion Determination


CX-003620: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

620: Categorical Exclusion Determination 620: Categorical Exclusion Determination CX-003620: Categorical Exclusion Determination Structure 57/2 Relocation on the Lovell-Thermopolis 115 Kilovolt Transmission Line CX(s) Applied: B1.3, B4.6 Date: 08/23/2010 Location(s): Wyoming Office(s): Western Area Power Administration-Rocky Mountain Region Western Power Administration proposes to relocate structure 57/2 on the Lovell-Thermopolis transmission line. The structure is presently located on the bank of the Greybull River, which is quickly eroding. The structure will be moved approximately 30 feet north of its present location, within the existing transmission line right-of-way. The structure is located on Wyoming State lands. DOCUMENT(S) AVAILABLE FOR DOWNLOAD CX-003620.pdf More Documents & Publications


CX-006780: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

780: Categorical Exclusion Determination 780: Categorical Exclusion Determination CX-006780: Categorical Exclusion Determination Snohomish-Murray Relocation of Wood Pole at Structure 9/4 CX(s) Applied: B4.6 Date: 08/26/2011 Location(s): Snohomish County, Washington Office(s): Bonneville Power Administration Bonneville Power Administration (BPA) proposes to relocate a single wood pole on a three pole transmission tower (structure 9/4) on the Snohomish-Murray # 1 transmission line. The existing pole on the east side of the structure will be permanently removed and a new pole and guy anchors will be installed 23 feet to the west of the existing pole. This will effectively move structure 9/4 23 feet to the west. The relocated pole will be in-kind with the rest of the line structures, and all of the work will


CX-005130: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

0: Categorical Exclusion Determination 0: Categorical Exclusion Determination CX-005130: Categorical Exclusion Determination Ringold Substation Structure Replacement Project CX(s) Applied: B4.6 Date: 01/21/2011 Location(s): Basin City, Washington Office(s): Bonneville Power Administration Bonneville Power Administration is proposing to replace the single pole structure 8/9 of the Benton-Scooteney No. 1 115-kilovolt (kV) transmission line, the attached vertically mounted disconnect switch, and current guy wiring with a new, 30-foot wide, three-pole transposition structure, a new horizontally mounted disconnect switch, and new guy wiring. In addition, a new 14-foot wide two-pole structure and a new 25?5-foot switch support structure would be installed roughly 30-feet ahead of the substation dead-end and approximately 15-feet ahead of the KD, respectively. There


CX-003194: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

194: Categorical Exclusion Determination 194: Categorical Exclusion Determination CX-003194: Categorical Exclusion Determination Installation of a Mid-Span Interset Structure between Structures 141/1 and 141/2 on the Existing Davis Dam-Prescott 230-Kilovolt Transmission Line in Yavapai County, Arizona CX(s) Applied: B4.13 Date: 06/10/2010 Location(s): Yavapai County, Arizona Office(s): Western Area Power Administration-Desert Southwest Region Western Area Power Administration plans to install a mid-span (interset) structure between structures 141/1 and 141/2 of the existing Davis Dam-Prescott 230-kilovolt transmission line. The proposed undertaking entails constructing a 100-foot tall steel H-frame near the midpoint of the 1900-foot-long span between two lattice tower structures. The H-frame will


CX-005581: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

5581: Categorical Exclusion Determination 5581: Categorical Exclusion Determination CX-005581: Categorical Exclusion Determination Quark Gluon Structure of Hadrons in Quantum Chromodynamics CX(s) Applied: A9 Date: 04/07/2011 Location(s): Illinois Office(s): Science, Chicago Office The purpose of this project is to perform fundamental research in the field of theoretical hadronic physics, using paper and pencil as well as computer simulations. In particular, we plan to investigate the structure of hadrons and the vacuum, as well as the interplay between vacuum and hadron structure, both through theoretical modeling as well as first-principles numerical calculations. DOCUMENT(S) AVAILABLE FOR DOWNLOAD CX-005581.pdf More Documents & Publications CX-005687: Categorical Exclusion Determination CX-002583: Categorical Exclusion Determination


CX-004457: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

457: Categorical Exclusion Determination 457: Categorical Exclusion Determination CX-004457: Categorical Exclusion Determination Trinity Line Cat Building Installation CX(s) Applied: B1.15 Date: 11/03/2010 Location(s): Trinity County, California Office(s): Western Area Power Administration-Sierra Nevada Region Western Area Power Administration proposes to install a 33 foot by 70 foot pre-fabricated metal structure and 1,000 linear feet of fencing. The structure will be anchored on top of an existing concrete slab which is part of an old building foundation. The structure will be used to store line maintenance equipment and materials. DOCUMENT(S) AVAILABLE FOR DOWNLOAD CX-004457.pdf More Documents & Publications CX-004883: Categorical Exclusion Determination CX-006627: Categorical Exclusion Determination


CX-007127: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

27: Categorical Exclusion Determination 27: Categorical Exclusion Determination CX-007127: Categorical Exclusion Determination Blythe-Knob CX(s) Applied: B1.3 Date: 03/21/2011 Location(s): Imperial County, California, Maricopa County, Arizona Office(s): Western Area Power Administration-Desert Southwest Region Western proposes to replace broken crossarms at structures 32/3,6312 and cross brace repair at structure 31/2 along the existing Blythe - Knob 161-kilovolt transmission line. Western will access structures using crew trucks and pickup trucks along existing access roads. This work is necessary to maintain the safety and reliability of the bulk electrical system. CX-007127.pdf More Documents & Publications CX-007800: Categorical Exclusion Determination CX-007159: Categorical Exclusion Determination


CX-004883: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

CX-004883: Categorical Exclusion Determination CX-004883: Categorical Exclusion Determination CX-004883: Categorical Exclusion Determination Trinity Line Cat Building Installation CX(s) Applied: B1.15 Date: 11/03/2010 Location(s): Trinity County, California Office(s): Western Area Power Administration-Sierra Nevada Region Western Area Power Administration proposes to install a 33 foot by 70 foot pre-fabricated metal structure and 1,000 linear feet of fencing. The structure will be anchored on top of an existing concrete slab which is part of an old building foundation. The structure will be used to store line maintenance equipment and materials. DOCUMENT(S) AVAILABLE FOR DOWNLOAD CX-004883.pdf More Documents & Publications CX-004457: Categorical Exclusion Determination CX-006627: Categorical Exclusion Determination


Protein Structure  

NLE Websites -- All DOE Office Websites (Extended Search)

Protein Structure Protein Structure Name: Chris Location: N/A Country: N/A Date: N/A Question: what are the four levels or structure of protien Replies: Hi Chris... as you must know proteins are made of amino acids arranged in polypeptide chains, and the order of them in these chains is called primary structure. The regular way in which the polypeptide chains are arranged in space to form a protein molecule is called secondary structure. The arrangement of the three-dimensional structure of the polypeptide chain in space is the tertiary structure. The arrangement of the combination of two or more polypeptide chains constitutes the quartenary structure. Quite simple, isn't? If you just remember that the molecular weights of proteins range usually from 10,000 to 100,000 daltons (one dalton is the weight of one hydrogen atom) and that 20 different amino-acids in a chain 100 amino acids long can be arranged in far more than 10 to its 100 potency ( number 1 followed by 100 zeroes) ways!


Categorical Exclusion (CX) Determination  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

North Oakes tap of the Edgeley to Forman 69 kV line North Oakes tap of the Edgeley to Forman 69 kV line Description of Proposed Action: Central Power Electric Cooperative is proposing to tap into the Western Area Power Administration (Western) Edgeley to Forman 69 kV transmission line with a new substation to meet load growth in the Southeastern North Dakota area. Number and Title of Categorical Exclusions Being Applied: 10 CFR 1021.410 Subpart D, Appendix B, B4.11: Construction of electric power substations ... or modification of existing substations and support facilities. Regulatory Requirements for CX Determination: The DOE Guidelines for Compliance with the Regulatory Requirements for the National Environmental Policy Act at 10 CFR 1021.410(b), require the following determinations be made in order for a proposed action to be categorically


NEWTON: Determining Material Degradation  

NLE Websites -- All DOE Office Websites (Extended Search)

Determining Material Degradation Determining Material Degradation Name: Hamish Status: student Grade: 6-8 Location: CA Country: USA Date: Summer 2013 Question: I am working on a science project about photo-degradation of plastic film. My question is how much degraded a plastic film should be to say that it was 100% photo-degraded? The plastic film I am photo-degrading is turning into dust when I touch it, what level of degradation is that? Replies: Hi Hamish, Thanks for the question. You will need to define what you mean by photo-degraded. 100% photo-degraded could be that the film becomes translucent and lets through only blurry images. Or it could mean that the film turns to dust when you touch it. As long as you clearly state in your science project what you mean by 100% photo-degraded, you will be doing a good job.


Categorical Exclusion (CX) Determination  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Circle substation expansion Circle substation expansion Description of Proposed Action: Expansion of the Circle substation approximately 4 acres to the south for the purpose of adding additional bays for the Keystone XL pipeline project. Number and Title of Categorical Exclusions Being Applied: 10 CFR 1021.410 Subpart D, Appendix B, B4.11: Construction of electric power substations ... or modification of existing substations and support facilities. Regulatory Requirements for CX Determination: The DOE Guidelines for Compliance with the Regulatory Requirements for the National Environmental Policy Act at 10 CFR 1021.410(b), require the following determinations be made in order for a proposed action to be categorically excluded from National Environmentally Policy Act (NEPA) review:


Categorical Exclusion (CX) Determination  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Addition of a new substation near Lake Bowdoin, MT. Addition of a new substation near Lake Bowdoin, MT. Description of Proposed Action: Addition of a new substation near Lake Bowdoin on Western's Fort Peck to Havre 161 k V transmission line for the purpose of providing power for a Keystone XL pipeline project pump station. Number and Title of Categorical Exclusions Being Applied: 10 CFR 1021.410 Subpart D, Appendix B, B4.11: Construction of electric power substations ... or modification of existing substations and support facilities. Regulatory Requirements for CX Determination: The DOE Guidelines for Compliance with the Regulatory Requirements for the National Environmental Policy Act at 10 CFR 1021.41 O(b), require the following determinations be made in order for a proposed action to be categorically


Mental Health, Determinants of  

Science Journals Connector (OSTI)

Abstract In this article, the authors first review differences between mental health and physical health conditions and explicitly consider how the health production function can be applied to mental health. They then review the research on the determinants of mental health, focusing on the contributions of economists to this literature. They focus on three important inputs to mental health production: income, macroeconomic conditions, and employment.

E. Golberstein; S.H. Busch



Sphericity determination using resonant ultrasound spectroscopy  

DOE Patents (OSTI)

A method is provided for grading production quantities of spherical objects, such as roller balls for bearings. A resonant ultrasound spectrum (RUS) is generated for each spherical object and a set of degenerate sphere-resonance frequencies is identified. From the degenerate sphere-resonance frequencies and known relationships between degenerate sphere-resonance frequencies and Poisson's ratio, a Poisson's ratio can be determined, along with a 'best' spherical diameter, to form spherical parameters for the sphere. From the RUS, fine-structure resonant frequency spectra are identified for each degenerate sphere-resonance frequency previously selected. From each fine-structure spectrum and associated sphere parameter values an asphericity value is determined. The asphericity value can then be compared with predetermined values to provide a measure for accepting or rejecting the sphere. 14 figs.

Dixon, R.D.; Migliori, A.; Visscher, W.M.



CX-009665: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

5: Categorical Exclusion Determination 5: Categorical Exclusion Determination CX-009665: Categorical Exclusion Determination Mission Support Alliance Annual Categorical Exclusion for Air Conditioning Systems for Existing Equipment under 10 CFR 1021, Subpart o, Appendix B CX(s) Applied: B1.4 Date: 12/05/2012 Location(s): Washington Offices(s): River Protection-Richland Operations Office Mission Support Alliance (MSA) and its subcontractors perform installation or modification of air conditioning systems required for temperature control for operations of existing buildings, structures, infrastructures, and equipment in previously disturbed or developed areas. CX-009665.pdf More Documents & Publications CX-009099: Categorical Exclusion Determination CX-006627: Categorical Exclusion Determination

Note: This page contains sample records for the topic "determination gila-knob structure" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


SRS FTF Section 3116 Basis for Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

FTF Section 3116 Basis for Determination FTF Section 3116 Basis for Determination SRS FTF Section 3116 Basis for Determination Basis for Section 3116 Determination for Closure of F-Tank Farm at the Savannah River Site. In accordance with NDAA Section 3116, certain waste from reprocessing of spent nuclear fuel is not high-level waste if the Secretary of Energy, in consultation with the NRC, determines that the criteria in NDAA Section 3116(a) are met. This FTF 3116 Basis Document shows that those criteria are satisfied, to support a determination that the Secretary may make pursuant to NDAA Section 3116. This FTF 3116 Basis Document concerns the stabilized residuals in waste tanks and ancillary structures, those waste tanks, and the ancillary structures (including integral equipment) at the SRS FTF at the time of closure.


Structured Descriptions  

E-Print Network (OSTI)

A descriptive formalism along with a philosophy for its use and expansion are presented wherein descriptions are of a highly structured nature. This descriptive system and the method of recognition are extended to the ...

Gabriel, Richard P.


Categorical Exclusion Determinations: American Recovery and Reinvestment  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

7, 2010 7, 2010 CX-001827: Categorical Exclusion Determination Recovery Act: Finding Large Aperture Fractures in Geothermal Resource Areas Using a 3-Component Long-Offset Surface Seismic Survey, PSlnSAR and Kinematic Structural Analysis CX(s) Applied: B3.1, A9 Date: 04/27/2010 Location(s): Washoe County, Nevada Office(s): Energy Efficiency and Renewable Energy, Golden Field Office April 26, 2010 CX-001951: Categorical Exclusion Determination Preparation of Energy Efficiency and Conservation Strategy CX(s) Applied: A8, A11, B5.1 Date: 04/26/2010 Location(s): Perth Amboy, New Jersey Office(s): Energy Efficiency and Renewable Energy April 26, 2010 CX-001950: Categorical Exclusion Determination Preparation of Energy Efficiency and Conservation Block Grant Application CX(s) Applied: A1, B5.1


Categorical Exclusion Determinations: Louisiana | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

January 12, 2010 January 12, 2010 CX-000486: Categorical Exclusion Determination Project Number WH-09-119 - Replace Fiberglass Covers/Troughs on Traveling Screens at West Hackberry Raw Water Intake Structure CX(s) Applied: B1.3 Date: 01/12/2010 Location(s): West Hackberry, Louisiana Office(s): Fossil Energy, Strategic Petroleum Reserve Field Office December 20, 2009 CX-000256: Categorical Exclusion Determination Louisiana City Baton Rouge CX(s) Applied: A9, A11, B2.2, B3.6, B5.1 Date: 12/20/2009 Location(s): Baton Rouge, Louisiana Office(s): Energy Efficiency and Renewable Energy, Golden Field Office December 17, 2009 CX-001263: Categorical Exclusion Determination Hire a Consultant CX(s) Applied: A9, A11, B2.5, B5.1 Date: 12/17/2009 Location(s): Livingston, Louisiana Office(s): Energy Efficiency and Renewable Energy


Categorical Exclusion Determinations: Colorado | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

September 5, 2012 September 5, 2012 CX-009189: Categorical Exclusion Determination (0675-1594) Eaton Corporation - Predictive Battery Management for Commercial Hybrid Vehicles CX(s) Applied: B3.6 Date: 09/05/2012 Location(s): Michigan, Minnesota, Colorado Offices(s): Advanced Research Projects Agency-Energy August 31, 2012 CX-009227: Categorical Exclusion Determination Beaver Creek- Big Sandy 115 Kilovolt Transmission Line Structure Replacements - Last Chance Fire CX(s) Applied: B4.13 Date: 08/31/2012 Location(s): Colorado Offices(s): Western Area Power Administration-Rocky Mountain Region August 29, 2012 CX-008913: Categorical Exclusion Determination High Resolution 3D Laser Imaging for Inspection, Maintenance, Repair and Operations - Phase II CX(s) Applied: A9, B3.6 Date: 08/29/2012


Categorical Exclusion Determinations: Michigan | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

February 16, 2012 February 16, 2012 CX-007936: Categorical Exclusion Determination Smart Grid Capable Electric Vehicle Supply Equipment CX(s) Applied: A1, A11 Date: 02/16/2012 Location(s): New Jersey, North Carolina, Michigan Offices(s): National Energy Technology Laboratory February 10, 2012 CX-007896: Categorical Exclusion Determination Bottom Fixed Platform Dynamics Models Assessing Surface Ice Interactions for Transitional Depth Structures in the Great Lakes CX(s) Applied: A9 Date: 02/10/2012 Location(s): Michigan Offices(s): Golden Field Office January 18, 2012 CX-007606: Categorical Exclusion Determination General Motors Battery Pack Assembly Plant - Electric Substation Upgrade CX(s) Applied: A9, A11 Date: 01/18/2012 Location(s): Michigan Offices(s): National Energy Technology Laboratory


Categorical Exclusion Determinations: Western Area Power  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

November 23, 2010 November 23, 2010 CX-004887: Categorical Exclusion Determination Cable and Conduit Addition Within the Fenced Area of the Buck Boulevard Substation CX(s) Applied: B4.6 Date: 11/23/2010 Location(s): Riverside County, California Office(s): Western Area Power Administration-Desert Southwest Region November 23, 2010 CX-007129: Categorical Exclusion Determination Buck Boulevard Substation CX(s) Applied: B4.6 Date: 11/23/2010 Location(s): Ripley, California Office(s): Western Area Power Administration-Desert Southwest Region November 5, 2010 CX-004898: Categorical Exclusion Determination Gila-Wellton-Mohawk (Structure Maintenance) CX(s) Applied: B1.3 Date: 11/05/2010 Location(s): Yuma County, Arizona Office(s): Western Area Power Administration-Desert Southwest Region


Categorical Exclusion Determinations: National Energy Technology Laboratory  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

May 10, 2013 May 10, 2013 CX-010285: Categorical Exclusion Determination Advancing Low Temperature Combustion and Lean Burning Engines for Light-and Heavy-Duty Vehicles CX(s) Applied: A9, B3.6 Date: 05/10/2013 Location(s): CX: none Offices(s): National Energy Technology Laboratory May 10, 2013 CX-010284: Categorical Exclusion Determination Construction of an Autogas Refueling Network CX(s) Applied: B5.22 Date: 05/10/2013 Location(s): West Virginia Offices(s): National Energy Technology Laboratory May 8, 2013 CX-010287: Categorical Exclusion Determination Understanding Nitrous Oxide Selective Catalytic Reduction Mechanism and Activity on Copper/Chabazite Structures throughout the Catalyst Life CX(s) Applied: A9, B3.6 Date: 05/08/2013 Location(s): CX: none Offices(s): National Energy Technology Laboratory


Categorical Exclusion Determinations: Arizona | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

November 23, 2009 November 23, 2009 CX-000202: Categorical Exclusion Determination Energy Efficiency and Renewable Energy in Schools CX(s) Applied: B5.1 Date: 11/23/2009 Location(s): Arizona Office(s): Energy Efficiency and Renewable Energy, Golden Field Office November 13, 2009 CX-007136: Categorical Exclusion Determination Coolidge-Oracle Pole Replacement CX(s) Applied: B4.6 Date: 11/13/2009 Location(s): Pinal County, Arizona Office(s): Western Area Power Administration-Desert Southwest Region November 13, 2009 CX-001118: Categorical Exclusion Determination Emergency Wood Pole Replacement at 59 Structures Located Along the Coolidge-Oracle 115-Kilovolt Transmission Line CX(s) Applied: B4.6 Date: 11/13/2009 Location(s): Pinal County, Arizona Office(s): Western Area Power Administration-Desert Southwest Region


Categorical Exclusion Determinations: Bonneville Power Administration |  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

November 2, 2009 November 2, 2009 CX-000008: Categorical Exclusion Determination Raver-Paul #1 Access Road Improvement and Bridge Replacement CX(s) Applied: B1.3 Date: 11/02/2009 Location(s): Pierce County, Washington Office(s): Bonneville Power Administration October 27, 2009 CX-000007: Categorical Exclusion Determination Spirit Tap to Colville-Boundary #1 Landings and Access Roads Construction CX(s) Applied: B1.3, B1.13 Date: 10/27/2009 Location(s): Stevens County, Washington Office(s): Bonneville Power Administration October 8, 2009 CX-000004: Categorical Exclusion Determination Lane-Wendson #1 Structure 10/5 Access Road Improvement and Pole Replacement Project CX(s) Applied: B1.3 Date: 10/08/2009 Location(s): Lane County, Oregon Office(s): Bonneville Power Administration October 8, 2009


Categorical Exclusion Determinations: Arizona | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

July 8, 2010 July 8, 2010 CX-003196: Categorical Exclusion Determination Emergency Crossarm Replacement at Structure 39/7 and Access Road Maintenance along the Existing Tucson-Apache 115-Kilovolt Transmission Line in Pima County, Arizona CX(s) Applied: B1.3 Date: 07/08/2010 Location(s): Pima County, Arizona Office(s): Western Area Power Administration-Desert Southwest Region July 6, 2010 CX-003004: Categorical Exclusion Determination Arizona-Tribal Energy Program-Hualapai Tribe CX(s) Applied: A9, B3.1 Date: 07/06/2010 Location(s): Hualapai Tribe, Arizona Office(s): Energy Efficiency and Renewable Energy July 2, 2010 CX-002842: Categorical Exclusion Determination Overcoming Critical Barriers to United States Wind Power; A University-Industry Consortium CX(s) Applied: A9 Date: 07/02/2010


Categorical Exclusion Determinations: Maine | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

March 2, 2010 March 2, 2010 CX-001043: Categorical Exclusion Determination Verso Paper Corporation Waste Energy Recovery (Jay) CX(s) Applied: B1.24, B5.1 Date: 03/02/2010 Location(s): Jay, Maine Office(s): Energy Efficiency and Renewable Energy, National Energy Technology Laboratory March 2, 2010 CX-001042: Categorical Exclusion Determination Verso Paper Corporation Waste Energy Recovery (Bucksport) CX(s) Applied: B1.24, B5.1 Date: 03/02/2010 Location(s): Bucksport, Maine Office(s): Energy Efficiency and Renewable Energy, National Energy Technology Laboratory January 21, 2010 CX-002154: Categorical Exclusion Determination Recovery Act: DeepCwind Consortium National Research Program: Validation of Coupled Models and Optimization of Materials for Offshore Wind Structures CX(s) Applied: B3.1, B3.3, B3.6, A9


Categorical Exclusion Determinations: Bonneville Power Administration |  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

March 16, 2010 March 16, 2010 CX-001179: Categorical Exclusion Determination Lancaster-Noxon Number 1 Mile 46-50 Access Road Improvement and Bridge Replacement Project CX(s) Applied: B1.3 Date: 03/16/2010 Location(s): Bonner County, Idaho Office(s): Bonneville Power Administration March 15, 2010 CX-001180: Categorical Exclusion Determination Monroe-Custer Number 1 and 2 500-Kilovolt Transmission Line Structure 16/2 Access Road Improvement and Bridge Replacement Project CX(s) Applied: B1.3 Date: 03/15/2010 Location(s): Snohomish County, Washington Office(s): Bonneville Power Administration March 12, 2010 CX-001181: Categorical Exclusion Determination Santiam Substation Renovation CX(s) Applied: B1.16 Date: 03/12/2010 Location(s): Linn County, Oregon Office(s): Bonneville Power Administration


Structural graphitic carbon foams  

SciTech Connect

Graphitic carbon foams are a unique material form with very high structural and thermal properties at a light weight. A process has been developed to produce microcellular, open-celled graphitic foams. The process includes heating a mesophase pitch preform above the pitch melting temperature in a pressurized reactor. At the appropriate time, the pressure is released, the gas nucleates bubbles, and these bubbles grow forming the pitch into the foam structure. The resultant foamed pitch is then stabilized in an oxygen environment. At this point a rigid structure exists with some mechanical integrity. The foam is then carbonized to 800 C followed by a graphitization to 2700 C. The shear action from the growing bubbles aligns the graphitic planes along the foam struts to provide the ideal structure for good mechanical properties. Some of these properties have been characterized for some of the foam materials. It is known that variations of the blowing temperature, blowing pressure and saturation time result in foams of variously sized with mostly open pores; however, the mechanism of bubble nucleation is not known. Therefore foams were blown with various gases to begin to determine the nucleation method. These gases are comprised of a variety of molecular weights as well as a range of various solubility levels. By examining the resultant structures of the foam, differences were noted to develop an explanation of the foaming mechanism.

Kearns, K.M.; Anderson, H.J. [Air Force Lab., Wright-Patterson AFB, OH (United States). Materials and Mfg. Directorate



Determinants of Meme Popularity  

E-Print Network (OSTI)

Online social media have greatly affected the way in which we communicate with each other. However, little is known about what are the fundamental mechanisms driving dynamical information flow in online social systems. Here, we introduce a generative model for online sharing behavior and analytically show, using techniques from mathematical population genetics, that competition between memes for the limited resource of user attention leads to a type of self-organized criticality, with heavy-tailed distributions of meme popularity: a few memes "go viral" but the majority become only moderately popular. The time-dependent solutions of the model are shown to fit empirical micro-blogging data on hashtag usage, and to predict novel scaling features of the data. The presented framework, in contrast to purely empirical studies or simulation-based models, clearly distinguishes the roles of two distinct factors affecting meme popularity: the memory time of users and the connectivity structure of the social network.

Gleeson, James P; Baños, Raquel A; Moreno, Yamir



Determination of Event Magnitudes with Correlated Data and Censoring: A Maximum Likelihood Approach  

Science Journals Connector (OSTI)

......explosions in granite at the Nevada Test Site and Algeria: joint determination...structure beneath Pahute Mesa, Nevada Test Site, Bull seism. Soc. Am., 77...explosions in granite at the Nevada Test Site and Algeria: joint determination......

K. L. McLaughlin; R. H. Shumway; T. W. McElfresh



CX-004456: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

456: Categorical Exclusion Determination 456: Categorical Exclusion Determination CX-004456: Categorical Exclusion Determination Boysen-Copper Mountain Structure 98/1 Replacement Project, Fremont County, Wyoming CX(s) Applied: B1.3, B4.6 Date: 11/10/2010 Location(s): Fremont County, Wyoming Office(s): Western Area Power Administration-Rocky Mountain Region Western proposes to replace Structure 98/1 and conduct access road maintenance on Western's existing Boysen-Copper Mountain 115 kilovolt transmission line in Fremont County, Wyoming. Structure 98/1 is located on United States (US) Bureau of Reclamation land in the southeast 1/4 of Section 16, T. 5 north, R. 6 east, of the Wind River meridian, Wyoming near the Boysen State Park Headquarters. A cleared, level area (landing) will be constructed around the base of structure 98/1 for better equipment


CX-007154: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

7154: Categorical Exclusion Determination 7154: Categorical Exclusion Determination CX-007154: Categorical Exclusion Determination Liberty-Coolidge Structure Maintenance CX(s) Applied: B1.3 Date: 12/16/2010 Location(s): Maricopa County, Arizona Office(s): Western Area Power Administration-Desert Southwest Region Western proposes to conduct vegetation removal and maintenance at structures 2/1, 3/3, 3/5, 10/2, 13/5, 17/5, 18/5, 20/2, 20/3, 22/4, 22/8, 23/2,23/3,24/1,24/3,33/6,51/2,5413 & 56/3 of the existing Liberty-Coolidge 230- kilovolt transmission line. This work will consist of replacing bad structure poles, ground wires and anchors, crossarms & cross braces, insulators, conductors and hardware. Western will access structures using crew trucks and pickup trucks along existing access roads. This work is


CX-007169: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

169: Categorical Exclusion Determination 169: Categorical Exclusion Determination CX-007169: Categorical Exclusion Determination Saguaro-Oracle Vegetation Removal CX(s) Applied: B1.3 Date: 04/07/2011 Location(s): Pinal County, Arizona Office(s): Western Area Power Administration-Desert Southwest Region Western proposes to conduct vegetation removal between structures 0/3 and 0/4, 1/5 and 1/6, 3/1 and 3/2, 4/2 and 4/3, around structure 4/8, between structures 5/1 and 5/2 and around structure 5/4 of its Saguaro-Oracle 115- kilovolt transmission line, within Western's existing right-of-way. Western will access the vegetation removal areas using crew trucks along the existing access roads. Western will use a front end loader with a cut shredder attachment to knock down and chip wood vegetation. The debris will


CX-005936: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

936: Categorical Exclusion Determination 936: Categorical Exclusion Determination CX-005936: Categorical Exclusion Determination Erie to Terry Street and Lyons to Longmont Northwest 115 Kilovolt Transmission Line Structure Replacements, Boulder and Broomfield Counties, Colorado CX(s) Applied: B4.6 Date: 05/16/2011 Location(s): Boulder County, Colorado Office(s): Western Area Power Administration-Rocky Mountain Region Western proposes to replace nine existing wood pole H-frame structures along the Erie-Terry Street and Lyons-Longmont Northwest transmission lines between Longmont and Erie, Colorado. These transmission lines occur on private lands in Boulder and Broomfield counties, Colorado. Structure sites are located in and around the city of Longmont, in rural residential areas and in agricultural fields. The structures will be replaced with similar

Note: This page contains sample records for the topic "determination gila-knob structure" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


CX-007143: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

7143: Categorical Exclusion Determination 7143: Categorical Exclusion Determination CX-007143: Categorical Exclusion Determination Empire-Electrical District 5 Double Circuit Upgrade CX(s) Applied: B1.3 Date: 03/08/2011 Location(s): Pinal County, Arizona Office(s): Western Area Power Administration-Desert Southwest Region Western proposes to replace structures and upgrade to a double circuit 230-kilovolt (kV) transmission line on its Empire-Electrical District #5 115-kV transmission line, within Western's existing right-of-way. This will include the rebuild of 9.2 miles of transmission line, replacing the H-frame structures with steel monopole structures with foundations, hardware and insulator replacement and adding a overhead ground-wire over the entire length of the project. Western will access the structure using


CX-007131: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

7131: Categorical Exclusion Determination 7131: Categorical Exclusion Determination CX-007131: Categorical Exclusion Determination Casa Grande-Empire Double Circuit Upgrade and Structure Replacement CX(s) Applied: B1.3 Date: 03/08/2011 Location(s): Pinal County, Arizona Office(s): Western Area Power Administration-Desert Southwest Region Western proposes to replace structures and upgrade to a double circuit 230- kilovolt (kV) transmission line on its Casa Grande-Empire 115-kV transmission line, from Thornton Road to its Empire Substation, within Western's existing right-of-way. This will include the rebuild of 13.2 miles of transmission line, replacing the H-frame structures with steel monopole structures with foundations, hardware and insulator replacement and adding a overhead ground-wire over the entire length of the project.


CX-008380: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

80: Categorical Exclusion Determination 80: Categorical Exclusion Determination CX-008380: Categorical Exclusion Determination Archer to Ault 230 Kilovolt Transmission Line Structure Replacement, Weld County, Colorado CX(s) Applied: B1.3 Date: 05/09/2012 Location(s): Colorado Offices(s): Western Area Power Administration-Rocky Mountain Region Western Area Power Administration (Western) proposes to replace an existing three pole wood structure along the Archer to Ault 230 kilovolt (kV) transmission line. The structure is located on private land adjacent to County Road 27 northwest of the town of Nunn in Weld County, Colorado. The structure will be replaced in-kind with wood poles of the same height, hardware, configuration, and at the same location. All work will be confined to Western's right-of way easement.


CX-007143: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

43: Categorical Exclusion Determination 43: Categorical Exclusion Determination CX-007143: Categorical Exclusion Determination Empire-Electrical District 5 Double Circuit Upgrade CX(s) Applied: B1.3 Date: 03/08/2011 Location(s): Pinal County, Arizona Office(s): Western Area Power Administration-Desert Southwest Region Western proposes to replace structures and upgrade to a double circuit 230-kilovolt (kV) transmission line on its Empire-Electrical District #5 115-kV transmission line, within Western's existing right-of-way. This will include the rebuild of 9.2 miles of transmission line, replacing the H-frame structures with steel monopole structures with foundations, hardware and insulator replacement and adding a overhead ground-wire over the entire length of the project. Western will access the structure using


CX-003083: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

3083: Categorical Exclusion Determination 3083: Categorical Exclusion Determination CX-003083: Categorical Exclusion Determination Wood Pole Replacement of Ross-Vancouver Shipyard Number 1, Structure 2/3 in Fog Chamber Dump Area Number 2 CX(s) Applied: B1.3 Date: 07/07/2010 Location(s): Vancouver, Washington Office(s): Bonneville Power Administration Bonneville Power Administration (BPA) proposes to replace deteriorating wood poles and associated structural/electrical components (such as cross arms, insulators, guy anchors) on structure 2/3 of the Ross-Vancouver Shipyard Number 1 transmission line. Pole replacement will be in the same location as the existing structure. All work will be in accordance with the National Electrical Safety Code and BPA standards. DOCUMENT(S) AVAILABLE FOR DOWNLOAD CX-003083.pdf


CX-007168: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

168: Categorical Exclusion Determination 168: Categorical Exclusion Determination CX-007168: Categorical Exclusion Determination Rodgers-Cooolidge Structure Maintenance CX(s) Applied: B1.3 Date: 08/26/2011 Location(s): Pinal County, Arizona Office(s): Western Area Power Administration-Desert Southwest Region Western proposes to replace damaged structure foundation and leg extension at structure 25/3 along the existing Rogers-Coolidge 230-kilovolt transmission line. This will include providing temporary bracing to the structure, placing it on a steel plate laying across the surface of the ground during removal and replacement of the damaged leg and replacing the foundation, reinforced steel and associated hardware. The foundation replacement will occur within a 20- foot-wide x 20-foot-long x 10-foot-deep


CX-009530: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

30: Categorical Exclusion Determination 30: Categorical Exclusion Determination CX-009530: Categorical Exclusion Determination Artesia-Rangely Tap of the Hayden-Vernal 138 Kilovolt Transmission Line Bank Stabilization on Structure 20/2 CX(s) Applied: B1.3 Date: 10/29/2012 Location(s): Colorado Offices(s): Western Area Power Administration-Rocky Mountain Region Flooding in 2011 caused the White River to erode its riverbank near structure 20/2 on Western Area Power Administration's Artesia-Rangely section of the Hayden-Vernal transmission line. This structure is located approximately 1 mile west of the town of Rangely, Rio Blanco County, Colorado. The structure base is in jeopardy of undermining by the river and this may result in a failure of the transmission line. CX-009530.pdf More Documents & Publications


CX-000869: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

869: Categorical Exclusion Determination 869: Categorical Exclusion Determination CX-000869: Categorical Exclusion Determination Construction of Grade Control Structures in Pueblo and DP Canyons CX(s) Applied: B6.1 Date: 10/28/2009 Location(s): Pueblo Canyon, New Mexico Office(s): Los Alamos Site Office, NNSA-Headquarters Installation of grade-control structures to reduce the potential for transport of low-level polychlorinated biphenyl contamination in the sediment deposits of the Pueblo and DP Canyon watersheds. The grade-control structures would result in reduced-flow velocities and peak discharge during flood events and should reduce erosion of contaminated deposits downstream of the structures. DOCUMENT(S) AVAILABLE FOR DOWNLOAD CX-000869.pdf More Documents & Publications EA-1736: Final Environmental Assessment


CX-007131: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

7131: Categorical Exclusion Determination 7131: Categorical Exclusion Determination CX-007131: Categorical Exclusion Determination Casa Grande-Empire Double Circuit Upgrade and Structure Replacement CX(s) Applied: B1.3 Date: 03/08/2011 Location(s): Pinal County, Arizona Office(s): Western Area Power Administration-Desert Southwest Region Western proposes to replace structures and upgrade to a double circuit 230- kilovolt (kV) transmission line on its Casa Grande-Empire 115-kV transmission line, from Thornton Road to its Empire Substation, within Western's existing right-of-way. This will include the rebuild of 13.2 miles of transmission line, replacing the H-frame structures with steel monopole structures with foundations, hardware and insulator replacement and adding a overhead ground-wire over the entire length of the project.


CX-008399: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

99: Categorical Exclusion Determination 99: Categorical Exclusion Determination CX-008399: Categorical Exclusion Determination Erosion Control Measures Structure No. 110-3 Dave Johnston to Stegall 230 Kilovolt Transmission Line CX(s) Applied: B1.3 Date: 03/29/2012 Location(s): Wyoming Offices(s): Western Area Power Administration-Rocky Mountain Region Western Area Power Administration (Western) will repair erosion damage at Structure No. 110-3 of the Dave Johnston to Stegall 230 kilovolt (kV) transmission line located near southeast Torrington. Wyoming. Flood flows along the North Platte River in 2011 migrated the active channel bank towards Structure No. 110-3. The potential exists for future channel meandering to underline the foundation supports of the 80 foot steel lattice structure. To mitigate this potential, Western proposes to


CX-008382: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

82: Categorical Exclusion Determination 82: Categorical Exclusion Determination CX-008382: Categorical Exclusion Determination Bridgeport-Sidney 115 Kilovolt Line Rejected Pole Replacement CX(s) Applied: B1.3 Date: 03/16/2012 Location(s): Nebraska Offices(s): Western Area Power Administration-Rocky Mountain Region Western Area Power Administration (Western) regularly inspects the structures that support our transmission lines and occasionally needs to replace structures that have failed these inspections. To avoid an outage caused by the failure of shell rotted poles, Western will conduct pole replacements on three structures in the Bridgeport-Sidney 115 kilovolt line. The structure numbers are 134, 24, and 14. The work will be done in mid- summer 2012 to avoid disrupting the landowner's wheat harvest.


CX-008381: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

381: Categorical Exclusion Determination 381: Categorical Exclusion Determination CX-008381: Categorical Exclusion Determination Big Thompson to Flatiron 13.8 Kilovolt Transmission Line Structure Replacement CX(s) Applied: B1.3 Date: 05/09/2012 Location(s): Colorado Offices(s): Western Area Power Administration-Rocky Mountain Region Western Area Power Administration (Western) proposes to replace four existing single wood pole structures along the Big Thompson to Flatiron 13.8 kilovolt (kV) transmission line. The structures are located along a previously disturbed area adjacent to the Horsetooth Supply Canal in Larimer County, Colorado. The structures will be replaced in-kind with single wood poles of the same height, hardware, configuration, and in the same location. CX-008381.pdf More Documents & Publications


Categorical Exclusion (CX) Determination  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Letcher to Mitchell 115 kV transmission line to Western's Letcher to Mitchell 115 kV transmission line to Western's Letcher substation. Description of Proposed Action: Interconnection of Northwestern Energy's 115 kV Letcher to Mitchell transmission line at Western's Letcher substation. Northwestern Energy is proposing to build a 14.5 mile transmission line between their Mitchell substation and Western's Letcher substation to shore up reliability of their electrical system in the area. Number and Title of Categorical Exclusions Being Applied: 10 CFR 1021.410 Subpart D, Appendix B, B4.11: Construction of electric power substations ... or modification of existing substations and support facilities. Regulatory Requirements for CX Determination: The DOE Guidelines for Compliance with the Regulatory Requirements for the National Environmental Policy Act at 10 CFR 1021.41 O(b), require the


Categorical Exclusion (CX) Determination  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Movement of the Shirley Pump substation to a new site away from Movement of the Shirley Pump substation to a new site away from Yellowstone River and replacement of the Shirley Pump substation transformer. Description of Proposed Action: Move the existing Shirley Pump substation approximately 200 meters to the southeast away from its current location and the Yellowstone River as well as replace the aging transformer with a new one. Number and Title of Categorical Exclusions Being Applied: 10 CPR 1021.410 Subpart D, Appendix B, B4.11: Construction of electric power substations ... or modification of existing substations and support facilities. Regulatory Requirements for CX Determination: The DOE Guidelines for Compliance with the Regulatory Requirements for the National Environmental Policy Act at 10 CPR 1021.41 O(b),


Categorical Exclusion Determination Form  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

t t Categorical Exclusion Determination Form Proposed Action Title: (0471-1563) University of South Florida - Development of a Low Cost Thermal Energy Storage System Using Phase Change Materials with Enhanced Radiation Heat Transfer Program or Field Office: Advanced Research Projects Agency - Energy Location(s) (City/County/State): Tampa, FL Proposed Action Description: Funding will support development of low cost, industrially scalable capsules containing high-temperature phase change materials (PCMs) for use in thermal energy storage (TES) systems to enable continuous power supply from concentrated solar thermal and nuclear power plants. No nuclear research and development activities will take place under this project. ARPA-E has undertaken a review of the work to be performed


Categorical Exclusion Determination Form  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

n rgy n rgy Categorical Exclusion Determination Form Proposed Action Title: (0474-1555) University of Colorado - Boulder - Wafer-Level Sub-Module Integrated DCfDC Converter Program or Field Office: Advanced Research Projects Agency - Energy LocationCs) CCity/County/State): Colorado, Maine, Virginia Proposed Action Description: Funding will support development of a planar, wafer-level sub-module integrated converter (SubMIC) device that can be integrated into various types of photovoltaic (PV) modules to enable low-cost maximum power point tracking at high power processing efficiencies. Proposed work consists of indoor laboratory-based research and development (R&D), microfabrication activities, and analytical research, including: (1) simulated modeling and design of SubMIC components and integrated units, (2) development, fabrication, testing, and optimization


Categorical Exclusion Determination Form  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

1537) Utah State University - 1537) Utah State University - Robust Cell-Level Modeling and Control of Large Battery Packs Program or Field Office: Advanced Research Projects Agency - Energy LocationCs) CCity/County/State): Logan, UT; Colorado Springs, CO; Boulder, CO; Golden, CO; Dearborn, MI Proposed Action Description: Funding will support efforts to develop a novel battery pack architecture supported by algorithms to drive analysis, feedback, and operability. Proposed work will consist of: (1) performing a requirements analysis to determine optimal theoretical design for the battery pack; (2) design and theoretical optimization of the necessary algorithms to control and monitor the cells in the pack; (3) creation , testing, and analysis of a proof-of- concept unit; and (4) application of the algorithmic controls to a commercial battery pack to analyze performance.


Categorical Exclusion Determination Form  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

ergy ergy Categorical Exclusion Determination Form Proposed Action Title: (0472-1569) G~tomics - Double Sator Switched Reluctance Motor (DSSRM) Technology Progi'am or Field Office: Advanced Research Projects Agency - Energy Location(s) (City/County/State): San Diego, CA Proposed Action Description: General Atomics, in conjunction with the University of Texas-Dallas (UT Dallas), proposes to develop double-stator switched reluctance motor (DSSRM) for electric vehicles (EVs) that will eliminate the use of permanent magnet-based motors that rely on rare earth metals in EVs. General Atomics' application was selected for an initial 18-month period (Phase 1) of funding. The ARPA-E Program Director may decide to negotiate and fund project activities for an additional 18-month period (Phase II) after evaluating the work performed in Phase I. ARPA-E has not obligated


Ultratrace determination of curium  

SciTech Connect

Development of a method for detection of curium at near single atom levels is being undertaken as a part of the Advanced Concepts Project at Argonne National Laboratory with funding from the US Department of Energy, Office of Arms Control and Nonproliferation. Ultratrace determination of curium, with the ability to quantify the fraction that is curium-242, provides a signature method of detecting clandestine reprocessing of recently irradiated uranium targets. Curium initially present in any of a variety of materials such as air filters, solid or liquid process waste, soil, flora, or fauna can be recovered via current chemical separations processing techniques. Using the ultratrace method being developed, such recovered curium will be quantified with thousand-fold higher sensitivity than the best currently available method which is alpha counting. This high sensitivity arises because, on average, a given trivalent curium (Cm{sup 3+}) ion can emit a very large number of fluorescence photons before alpha decay occurs.

Beitz, J.V.



Categorical Exclusion Determination Form  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

y y Categorical Exclusion Determination Form Proposed Action Title: (0471-1595) Regents of the University of Minnesota - Thermal Fuel: Solar Fuels via Partial Redox Cycles with Heat Recovery Program or Field Office: Advanced Research Projects Agency - Energy LocationCs) CCity/County/State): Minnesota, California, and Colorado. Proposed Action Description: Funding will support development of a dual zone solar thermochemical reactor to produce fuel using ceria-based reactive materials in partial redox cycles and high heat recovery levels through counter-circulation of solid state components. Proposed work consists of indoor laboratory-based research and development, including: (1) designing, fabricating, and characterizing an optimized ceria-based reactive element for use in the reactor to enable maximum fuel productivity and durability; (2) designing and fabricating a

Note: This page contains sample records for the topic "determination gila-knob structure" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Categorical Exclusion Determination Form  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

of n y of n y Categorical Exclusion Determination Form Proposed Action Title: (0471-1607) University of Florida - Solar Thermochemical Fuel Production via a Novel Low Pressure, Magnetically Stabilized, Non-Volatile Iron Oxide Looping Process Program or Field Office: Advanced Research Projects Agency - Energy LocationCs) CCity/County/State): Gainesville, FL Proposed Action Description: University of Florida proposes to develop a novel solar thermochemical reactor with inputs of water, recycled carbon dioxide (C02), and concentrated solar energy to cost-effectively produce Syngas, a renewable, carbon-neutral fuel. Project activities will include: (1) modeling, design, and fabrication of a high efficiency 1 OkW reactor prototype; (2) test analysis of bench-scale


Cat Dish Bacteria Determination  

NLE Websites -- All DOE Office Websites (Extended Search)

Dish Bacteria Determination Dish Bacteria Determination Name: Ashlyn Status: student Grade: 6-8 Location: FL Country: USA Date: Summer 2011 Question: Is there a simple way to measure bacteria in cat's water dishes without doing something with Agar? To measure bacteria in a water bowl, do I need to use a microscope? I am thinking of using different materials (metal, plastic, and glass) to see which of those has the grows the most bacteria. Replies: Hello Ashlyn, That is a very good idea for a science project. Usually the best way to do a quantitative analysis of bacteria content is to take a measured amount of a liquid, plate it out on some type of agar and do a colony count. This will give a basic indication of bacterial load, but not differentiate the types of bacteria. The most common type of bacteria that causes a pink film to form on water bowls and showers, etc. is Serratia marcescens. It is a fairly harmless organism that reacts with standing water. It may only adhere to the walls of the container and not be 'free floating' in the water. A microscope would not likely help unless you were able to do special stains to help see the bacteria. You might also want to add stoneware or ceramic to your list. Just so you know stoneware or ceramic make the best containers for cats to drink out of. It keeps the water fresher: Maybe less bacteria? You might just have to rely on a visual inspection of the containers to see which has more pink per surface area.


Nano-porous Silicon Microcavity Sensors for Determination of Organic Fuel Mixtures  

Science Journals Connector (OSTI)

We present the preparation and characteristics of liquid-phase sensors based on nano-porous silicon multilayer structures for determination of organic content in gasoline. The...

Pham, Van Hoi; Bui, Huy; Hoang, Le Ha; Nguyen, Thuy Van; Nguyen, The Anh; Pham, Thanh Son; Ngo, Quang Minh




Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

for access for access road maintenance. vegetation removal and structure maintenance at multiple structures along the eXisting G,'a-Knob 161-kV transmission line in Yuma County. Arozona and Imperial County. California RECORD OF CATEGORICAL EXCLUSION DETERMINATION: Amendment No. 1 A. Proposed Action: No changes B. Categorical Exclusion Applied: No changes C. Regulatory Requirements in 10 CFR 1021.410 fbI: No changes D. Determination: No changes E. Special Conditions: The following Special Conditions are added to those listed in the Categorical Exclusion dated 2nt11 . Updated maps are attached. 33. Avoid ground-disturbing activities between Structure 4/5 and 6thStreet. 34. Avoid ground-disturbing activities between Structures 417 and 4/8 . 35. Avoid ground disturbing activities between Structure 4/9 and a point 200 feet to


Determinations | Building Energy Codes Program  

NLE Websites -- All DOE Office Websites (Extended Search)

Regulations Regulations Site Map Printable Version Development Adoption Compliance Regulations Determinations Federal Buildings Manufactured Housing Resource Center Determinations Commercial Determinations Residential Determinations Final Determination on ASHRAE Standard 90.1-2010 On October 19, 2011, DOE issued a final determination that ASHRAE Standard 90.1-2010 would achieve greater energy efficiency in buildings subject to the standard than if they were built to ASHRAE Standard 90.1-2007. View the complete final determination notice that appeared in the Federal Register on October 19, 2011. View the complete preliminary determination notice that appeared in the Federal Register on July 20, 2011. State Certification This final determination is being published before the two year deadline


CX-003624: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

624: Categorical Exclusion Determination 624: Categorical Exclusion Determination CX-003624: Categorical Exclusion Determination Replacement of Twenty 22-L Structures on the Satsop-Aberdeen Number 2 230-kilovolt Transmission Line CX(s) Applied: B1.3 Date: 08/12/2010 Location(s): Gray's Harbor County, Washington Office(s): Bonneville Power Administration Replacement of twenty 22-L structures on the Satsop-Aberdeen Number 2 230-kilovolt (kV) transmission line. The project work would involve removal of the existing towers and building replacement towers, replacing insulators, and attaching the existing conductor to the new towers. DOCUMENT(S) AVAILABLE FOR DOWNLOAD CX-003624.pdf More Documents & Publications CX-003025: Categorical Exclusion Determination CX-001179: Categorical Exclusion Determination


CX-001413: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

1413: Categorical Exclusion Determination 1413: Categorical Exclusion Determination CX-001413: Categorical Exclusion Determination Control House Seismic Upgrades - Allston, Keeler, Ostrander, and Marion Substations CX(s) Applied: B1.16, B1.3 Date: 04/12/2010 Location(s): Columbia, Oregon Office(s): Bonneville Power Administration Bonneville Power Administration (BPA) proposes to first remove and dispose of any asbestos and lead-based paint within seismic strengthening project area at each of its substations listed in the project title. BPA will then construct both structural and non-structural seismic upgrades, and perform minor architectural work at each substation. DOCUMENT(S) AVAILABLE FOR DOWNLOAD CX-001413.pdf More Documents & Publications CX-005411: Categorical Exclusion Determination CX-002433: Categorical Exclusion Determination


CX-009230: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

30: Categorical Exclusion Determination 30: Categorical Exclusion Determination CX-009230: Categorical Exclusion Determination Curecanti-Rifle 230 Kilovolt Transmission Line Sullivan Ranch Irrigation Water Pipeline Project Between Structures 25/5 to 26/1 CX(s) Applied: B4.9 Date: 09/28/2012 Location(s): Colorado Offices(s): Western Area Power Administration-Rocky Mountain Region Western Area Power Administration (Western) proposes to grant permission to Mr. Dan Sullivan for the Sullivan Ranch Pipeline Project on Western's right-of-way (ROW) between structures 25/5 to 2611 on the Curecanti-Rifle (CCI-RFL) 230 kilovolt Transmission Line. CX-009230.pdf More Documents & Publications CX-010110: Categorical Exclusion Determination CX-010413: Categorical Exclusion Determination EIS-0442: Draft Environmental Impact Statement


CX-008816: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

16: Categorical Exclusion Determination 16: Categorical Exclusion Determination CX-008816: Categorical Exclusion Determination Renovations and Maintenance Activities for Buildings, Structures, Infrastructures and Equipment CX(s) Applied: B1.3, 61.4, 61.5, B1.11, B1.15, B1.16, B1.17, 81.22, B1.27, 62.1, B2.2, B2.3, 62.5 Date: 06/08/2012 Location(s): Illinois Offices(s): New Brunswick Laboratory This evaluation covers general renovation and maintenance activities at the New Brunswick Laboratory (NBL) which include: installation, modification, removal, replacement and preparation, for a wide variety of activities that occur for the existing NBL building and structures. CX-008816.pdf More Documents & Publications CX-008817: Categorical Exclusion Determination CX-000787: Categorical Exclusion Determination


CX-003402: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

3402: Categorical Exclusion Determination 3402: Categorical Exclusion Determination CX-003402: Categorical Exclusion Determination Corrugated Membrane and Fuel Cell Structures CX(s) Applied: B3.6 Date: 08/16/2010 Location(s): New Castle, Delaware Office(s): Energy Efficiency and Renewable Energy, Golden Field Office Ion Power, Incorporated (Ion) would demonstrate the feasibility in developing a hydrogen fuel cell structure. Laboratory work would take place at existing laboratories: Ion laboratory at 720 Governor Lea Drive, New Castle, Delaware; GrafTech facilities in Parma, Ohio; and General Motors facility in Honeoye Falls, New York. DOCUMENT(S) AVAILABLE FOR DOWNLOAD CX-003402_0.pdf More Documents & Publications CX-003458: Categorical Exclusion Determination CX-003408: Categorical Exclusion Determination


CX-006583: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

3: Categorical Exclusion Determination 3: Categorical Exclusion Determination CX-006583: Categorical Exclusion Determination Wood Pole Replacement Along Portions of the Grand Coulee-Chief Joseph #1 and #2 230-Kilovolt Transmission Line CX(s) Applied: B1.3, B1.13 Date: 08/22/2011 Location(s): Douglas County, Washington Office(s): Bonneville Power Administration Maintenance activities will take place within the existing transmission line right-of-way easement and include upgrading existing access roads, relocating or constructing short spur roads to structures, constructing equipment landings and performing maintenance on structures. DOCUMENT(S) AVAILABLE FOR DOWNLOAD CX-006583.pdf More Documents & Publications CX-006580: Categorical Exclusion Determination CX-010424: Categorical Exclusion Determination


CX-010549: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

9: Categorical Exclusion Determination 9: Categorical Exclusion Determination CX-010549: Categorical Exclusion Determination Chappell, Julesburg, and Kersey Tap Line Switch Replacements in Deuel County, Nebraska and Weld County, Colorado CX(s) Applied: B4.6, B4.11 Date: 06/04/2013 Location(s): Nebraska, Colorado Offices(s): Western Area Power Administration-Rocky Mountain Region Western Area Power Administration (WAPA) proposes to replace the wood-switch structures and 115-kilovolt (kV) line disconnect switches with new switches and steel-box structures at the Chappell and Julesburg Taps in Deuel County, Nebraska and the Kersey Tap in Weld County, Colorado. CX-010549.pdf More Documents & Publications CX-008785: Categorical Exclusion Determination CX-009804: Categorical Exclusion Determination


CX-003021: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

21: Categorical Exclusion Determination 21: Categorical Exclusion Determination CX-003021: Categorical Exclusion Determination Structure Replacements and Reconductor Black Hollow to Ault Transmission Line, Weld County, Colorado CX(s) Applied: B4.6 Date: 06/01/2010 Location(s): Weld County, Colorado Office(s): Western Area Power Administration-Rocky Mountain Region The Western Area Power Administration, Loveland, Colorado, proposes to replace wood pole H-frame structures and reconductor approximately 3 miles of the existing transmission line between the Black Hollow Substation and the Ault Substation in Weld, County, Colorado. DOCUMENT(S) AVAILABLE FOR DOWNLOAD CX-003021.pdf More Documents & Publications CX-008785: Categorical Exclusion Determination CX-008773: Categorical Exclusion Determination


CX-008785: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

785: Categorical Exclusion Determination 785: Categorical Exclusion Determination CX-008785: Categorical Exclusion Determination Line Switch Replacements at Chappell and Julesburg Taps in Deuel County, Nebraska and Kersey Tap in Weld, Colorado CX(s) Applied: B4.6, B4.11 Date: 07/25/2012 Location(s): Nebraska, Colorado Offices(s): Western Area Power Administration-Rocky Mountain Region Western Area Power Administration (Western) proposes to replace the wood switch structures and 115-kilovolt line disconnect switches with new switches and steel box structures at the Chappell and Julesburg Taps in Deuel County, Nebraska, and the Kersey Tap in Weld County, Colorado. CX-008785.pdf More Documents & Publications CX-010549: Categorical Exclusion Determination CX-007682: Categorical Exclusion Determination


CX-008709: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

09: Categorical Exclusion Determination 09: Categorical Exclusion Determination CX-008709: Categorical Exclusion Determination Wood Pole Replacements As Needed on the Shelton-Fairmount No. 1, 115 Kilovolt Transmission Line CX(s) Applied: B1.3 Date: 05/24/2012 Location(s): Washington, Washington Offices(s): Bonneville Power Administration Bonneville Power Administration proposes to replace deteriorating wood poles and associated structural/electrical components (e.g. crossarms, insulators, and guy anchors) at existing H-frame structures along the subject transmission line in Mason and Jefferson counties, Washington. Microsoft Word - CX-Shelton-Fairmount-WoodPolesFY12_WEB.doc More Documents & Publications CX-008693: Categorical Exclusion Determination CX-008708: Categorical Exclusion Determination


CX-009641: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

1: Categorical Exclusion Determination 1: Categorical Exclusion Determination CX-009641: Categorical Exclusion Determination Dike Construction and Modifications CX(s) Applied: B1.6 Date: 11/19/2012 Location(s): Tennessee, California, California, Virginia Offices(s): Oak Ridge Office The proposed actions would involve construction or modification of new or existing secondary containment structures such as dikes, berms, curbing, diversion structures, weirs, booms, and other barriers which would meet the requirements for secondary containment, as specified in 40 CFR Part 112.7(c), to prevent accidental discharges from reaching navigable water courses. CX-009641.pdf More Documents & Publications CX-010362: Categorical Exclusion Determination CX-009646: Categorical Exclusion Determination CX-009692


CX-005409: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

5409: Categorical Exclusion Determination 5409: Categorical Exclusion Determination CX-005409: Categorical Exclusion Determination Olympia-Grand Coulee Number 1 Transmission Line CX(s) Applied: B1.3 Date: 03/03/2011 Location(s): Washington Office(s): Bonneville Power Administration Access road maintenance project near structure 38/2 of the Olympia-Grand Coulee Number 1 Transmission Line. Bonneville Power Administration proposes to maintain one double-culvert creek crossing on an unnamed stream. Work would include removing woody debris that is the result of beaver activity, and installing a beaver deterrent structure to exclude the beaver(s) from the culverts. DOCUMENT(S) AVAILABLE FOR DOWNLOAD CX-005409.pdf More Documents & Publications CX-008679: Categorical Exclusion Determination CX-008687: Categorical Exclusion Determination


Offshore structures  

Science Journals Connector (OSTI)

... SIR,-We have had some experience with modelling offshore structures in the laboratory, and wish to call attention to the need for better ... have already occurred have been serious enough, but the failure of one of the giant rigs or platforms now being planned would be a catastrophe of unprecedented proportions.




Membrane Structure  

Science Journals Connector (OSTI)

...structure. The gen-cral picturc (given bs both of' these workeirs \\aas very similar...Circle No. 82 on Readers Service Card Low cost student recording from Harvard Apparatus...Steim, thermal analysis; D. Chapman, nuclear magnet-ic resonance; H. M. McConnell...

D. E. Green



Glass Structure  

Science Journals Connector (OSTI)

... Structure and Crystallization of Glasses. By WernerVogel. Pp. 246. (Pergamon: Oxford and New York, October 1971. ... account of the experimental work on liquid-liquid separation and nucleation and crystal growth in glasses carried out by the author and his colleagues in the laboratories of VEB Jena ...



Note: This page contains sample records for the topic "determination gila-knob structure" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


CX-010417: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

417: Categorical Exclusion Determination 417: Categorical Exclusion Determination CX-010417: Categorical Exclusion Determination Above-Ground Routine Transmission Line Maintenance CX(s) Applied: B1.3 Date: 05/17/2013 Location(s): Colorado, Wyoming, Nebraska, Montana, Utah Offices(s): Western Area Power Administration-Rocky Mountain Region Western Area Power Administration (Western) has identified certain routine transmission line maintenance projects which require little or no environmental review and resource agency coordination. Western includes in this determination all routine maintenance activities on transmission lines which typically occur above-ground within existing structure footprints and will cause little or no ground surface disturbance. CX-010417.pdf More Documents & Publications


Amorphous Binary Alloy Structures  

NLE Websites -- All DOE Office Websites (Extended Search)

Hope Ishii, Sean Brennan and Arthur Bienenstock SSRL/SLAC Hope Ishii, Sean Brennan and Arthur Bienenstock SSRL/SLAC Figure 1: Partial Pair Distribution Functions extracted from the scattering patterns obtained at four different photon energies near the Ge and Mo K-absorption edges. Attempting to determine and describe the atomic arrangements in an amorphous material is a daunting prospect. A considerable advance has been made in the anomalous X-ray scattering approach to determining these arrangements in materials containing two atomic species. Up until the advent of X-ray synchrotron radiation, the X-ray radial distribution function (RDF) method was the most widely used approach for structure analysis of amorphous materials. The RDF is the probability of finding two electrons in a sample separated by a distance r, but with all


Structural characterization of a novel autonomous cohesin from Ruminococcus flavefaciens  

Science Journals Connector (OSTI)

The crystal structure of a standalone cohesin protein from the rumen bacterium R. flavefaciens has been determined at 2.44 ? resolution, revealing an elaborate set of secondary-structural elements.

Voronov-Goldman, M.



5.841 Crystal Structure Refinement, Fall 2006  

E-Print Network (OSTI)

This course in crystal structure refinement examines the practical aspects of crystal structure determination from data collection strategies to data reduction and basic and advanced refinement problems of organic and ...

Mueller, Peter


5.067 Crystal Structure Refinement, Fall 2007  

E-Print Network (OSTI)

This course in crystal structure refinement examines the practical aspects of crystal structure determination from data collection strategies to data reduction and basic and advanced refinement problems of organic and ...

Mueller, Peter


Protein structures by spallation neutron crystallography  

Science Journals Connector (OSTI)

The capabilities of the Protein Crystallography Station at Los Alamos Neutron Science Center for determining protein structures by spallation neutron crystallography are illustrated, and the methodological and technological advances that are emerging from the Macromolecular Neutron Crystallography consortium are described.

Langan, P.



Terminal structure  

DOE Patents (OSTI)

A terminal structure (2) for a superconducting cable (1) is described. It consists of a conductor (2a) and an insulator (2b) that surrounds the conductor (2a), wherein the superconducting cable (1) has a core with a superconducting conductor (5) and a layer of insulation that surrounds the conductor (5), and wherein the core is arranged in such a way that it can move longitudinally in a cryostat. The conductor (2a) of the terminal structure (2) is electrically connected with the superconducting conductor (5) or with a normal conductor (6) that is connected with the superconducting conductor (5) by means of a tubular part (7) made of an electrically conductive material, wherein the superconducting conductor (5) or the normal conductor (6) can slide in the part (7) in the direction of the superconductor.

Schmidt, Frank (Langenhagen, DE); Allais, Arnaud (Hannover, DE); Mirebeau, Pierre (Villebon sur Yvette, FR); Ganhungu, Francois (Vieux-Reng, FR); Lallouet, Nicolas (Saint Martin Boulogne, FR)



Structures of the rat complement regulator CrrY  

Science Journals Connector (OSTI)

The structure of rat CrrY1-4 determined in two distinct crystal forms shows a pronounced bend at the interface between domains 3 and 4.

Roversi, P.



Evaluation of the Effects of Porous Media Structure on Mixing...  

NLE Websites -- All DOE Office Websites (Extended Search)

Media Structure on Mixing-Controlled Reactions Using Pore-Scale Modeling and Micromodel Abstract: The objectives of this work were to determine if a porescale model could...



Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

access road maintenance access road maintenance and replacement of down guy wlfes and guy anchors on structure16/5 on the existing (Army Tap) Gila-Senator Wash 69-kV T.L. in Imperial County, CA. RECORD OF CATEGORICAL EXCLUSION DETERMINATION A. Proposed Action: Western proposes to conduct maintenance on access roads leading to structure 16/5 of the Gila-Senator Wash 69kV Transmission Line. All work will be done along existing access roads. This will consist of blading and leveling out areas of the existing access road using dozers, bucket trucks, crew trucks and pickup trucks. A backhoe will be used during replacement of the anchor guy and down guys, This work is necessary to maintain the safety and reliability of the bulk electrical system. The attached map shows the project area situated within Section 5 Township 15


Determining Ductile Fracture Toughness in Metals  

SciTech Connect

Ductile fracture toughness determination, such as the J-integral versus crack growth resistance (J-R) curve, is a useful tool for evaluating material structural integrity in the presence of pre-existing defects. The J-R curve represents a way to calculate the work (energy) per unit fracture surface area needed to drive the crack growth. A typical J-R curve is shown in Fig. 1 from which the material fracture toughness near the initiation of stable crack growth (Jq) can be derived. In addition, tearing modulus (TR), representing the material resistance to stable crack growth, can be calculated based on the slope of the J-R curve between two exclusion lines (red dashed lines in Fig. 1). Since the introduction of the J-R curve, extensive efforts have been continuously devoted to develop simplified and reliable methods for determining the material J-R curve. This article briefly reviews three widely-used J-R curve test methods in metals, i.e. elastic unloading compliance (EUC), normalization, and direct current potential drop (DCPD). The main difference in these methods relates to the determination of the crack size. More details of performing the J-R curve determination can be found in ASTM standard E1820-11.

Chen, Xiang [ORNL] [ORNL; Nanstad, Randy K [ORNL] [ORNL; Sokolov, Mikhail A [ORNL] [ORNL; Manneschmidt, Eric T [ORNL] [ORNL



CX-002035: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

35: Categorical Exclusion Determination 35: Categorical Exclusion Determination CX-002035: Categorical Exclusion Determination Energy Efficiency and Conservation Block Grant - Activity #8: Bio-Diesel CX(s) Applied: B5.1 Date: 04/20/2010 Location(s): Lee County, Florida Office(s): Energy Efficiency and Renewable Energy, Golden Field Office Energy Efficiency and Conservation Block Grant funds in the amount of $500,000 will be used to fund a portion of biodiesel plant in Lee County. The remaining $5.5 million necessary for the plant will come from FL Biofuels, LLC. The location of the proposed facility is within the existing structural footprint of a commercial building. A pre-fabricated biodiesel plant kit will be used for the facility. Conversion of the existing commercial structure to the biodiesel plant does not require any structural


CX-009227: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

27: Categorical Exclusion Determination 27: Categorical Exclusion Determination CX-009227: Categorical Exclusion Determination Beaver Creek- Big Sandy 115 Kilovolt Transmission Line Structure Replacements - Last Chance Fire CX(s) Applied: B4.13 Date: 08/31/2012 Location(s): Colorado Offices(s): Western Area Power Administration-Rocky Mountain Region Western Area Power Administration (Western) replaced approximately 55 structures on an existing l 0 mile section of the 115-k V transmission line between Beaver Creek and Big Sandy Substations in Washington County, Colorado. The Last Chance fire which began on June 25, 2012, destroyed the existing structures beyond repair. Western crews responded to this emergency and rebuilt the downed power lines to restore electrical service. The maintenance crews used existing access roads and no grading or


CX-007156: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

7156: Categorical Exclusion Determination 7156: Categorical Exclusion Determination CX-007156: Categorical Exclusion Determination New Waddell-Raceway-Westwing Structure Replacement CX(s) Applied: B4.6, B4.13 Date: 03/11/2010 Location(s): Maricopa County, Arizona Office(s): Western Area Power Administration-Desert Southwest Region Western plans to remove an existing three-pole turning structure (3/1 B) on the existing Raceway-Westwing 230-kilovolt (kV) Transmission Line, add a new replacement three-pole turning structure (also 3/1 B), and move equipment to a bay constructed by Arizona Public Service (APS) within the existing Raceway Substation in order to accommodate APS's new transmission line and substation equipment. APS intends to use the bay currently occupied by the Raceway-Westwing 230-kV Transmission Line for their new


CX-006290: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

0: Categorical Exclusion Determination 0: Categorical Exclusion Determination CX-006290: Categorical Exclusion Determination Cardwell-Cowlitz 2011 Wood Pole Replacements CX(s) Applied: B1.3 Date: 07/25/2011 Location(s): Cowlitz County, Washington Office(s): Bonneville Power Administration Bonneville Power Administration (BPA) is proposing to replace all of the aging wood pole transmission line support structures along the Cardwell-Cowlitz No. 1, 115 kilovolt (kV) transmission line. Due to the age of the wood poles, the work is necessary to improve the safety, operation, and reliability of the transmission line. All wooden pole structures, hardware, and support structures will be replaced in the original location. DOCUMENT(S) AVAILABLE FOR DOWNLOAD CX-006290.pdf More Documents & Publications


CX-003084: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

3084: Categorical Exclusion Determination 3084: Categorical Exclusion Determination CX-003084: Categorical Exclusion Determination Maintenance of and Improvements to the Access Roads from Structure 53/3 through 66/3 of the Fairview-Rogue Number 1 Transmission Line Corridor CX(s) Applied: B1.3 Date: 06/21/2010 Location(s): Curry County, Oregon Office(s): Bonneville Power Administration Bonneville Power Administration (BPA) proposes to perform road maintenance activities along the access roads of the southern 13 miles of the Fairview-Rogue transmission line from Structure 53/3 to Structure 66/3. There are roughly 32 miles of access roads in this section of transmission line. The proposed access road project is part of ongoing operations and maintenance along this line and this work is proposed for 2010 and 2011.


CX-006777: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

777: Categorical Exclusion Determination 777: Categorical Exclusion Determination CX-006777: Categorical Exclusion Determination Swan Valley-Goshen Concrete Box Culvert at Granite Creek CX(s) Applied: B1.3 Date: 08/24/2011 Location(s): Bonneville County, Idaho Office(s): Bonneville Power Administration This project will include the removal of an existing structurally deficient wood bridge and replacing it with a precast concrete box culvert. The new structure will be a 12-foot (span) by 6-foot (rise) by 30-foot (long) box culvert with associated wing walls. The base footprint dimensions of the road crossing will be 42-foot wide by 14-foot long. The driving surface of the roadway will consist of a single 14-foot wide lane. Backfill will be compacted around the structure to lines and grade of the road prism


CX-001509: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

CX-001509: Categorical Exclusion Determination CX-001509: Categorical Exclusion Determination CX-001509: Categorical Exclusion Determination East Campus Parking Structure at the Oak Ridge National Laboratory (ORNL) CX(s) Applied: B1.15 Date: 03/02/2010 Location(s): Oak Ridge, Tennessee Office(s): Oak Ridge Office, Science The Department of Energy (DOE) at the Oak Ridge Office (ORO) proposes to construct a parking structure at the East Campus region of Oak Ridge National Laboratory (ORNL). This will provide staff parking in the most heavily populated area of ORNL. Construction activities will include clearing the area of trees and vegetation, grading the site, and constructing an approximately 200 feet long by 120 feet wide and 3-story high concrete and steel-supported structure. In addition, the surface areas


CX-009647: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

7: Categorical Exclusion Determination 7: Categorical Exclusion Determination CX-009647: Categorical Exclusion Determination Alterations to Existing Buildings, Construction of Small-Scale Support Structures, and Relocation of Machinery and Equipment CX(s) Applied: B1.11, B1.15, B1.31 Date: 11/19/2012 Location(s): Tennessee, California, California, Virginia Offices(s): Oak Ridge Office The proposed actions would involve minor alterations to structures and the operation of these structures including, but not limited to, (1) modifying, installing, extending, and enclosing docks and platforms; (2) refurbishing buildings, offices, and rooms; (3) modifying and renovating laboratories; (4) converting rooms/laboratories into office space; (5) installing and replacing canopies; (6) installing and modifying stairways; (7) installing


CX-001049: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

1049: Categorical Exclusion Determination 1049: Categorical Exclusion Determination CX-001049: Categorical Exclusion Determination Replacing 11 Wood Pole Structures on the Midway ? Grandview Transmission Line and 12 Wood Pole Structures on the Grandview ? Red Mountain Transmission Line CX(s) Applied: B1.3 Date: 01/27/2010 Location(s): Yakama County, Washington Office(s): Bonneville Power Administration Remove and replace wood poles in kind within the footprint of the existing structures. Equipment likely to disturb the ground includes a combination of the following: a boom truck with an auger attachment, a bucket truck, and or a crane. The wood pole will be removed; an auger will be used to remove any soil from the hole and a wood pole of the same size and diameter will be placed back within the existing hole.

Note: This page contains sample records for the topic "determination gila-knob structure" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


CX-003196: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

196: Categorical Exclusion Determination 196: Categorical Exclusion Determination CX-003196: Categorical Exclusion Determination Emergency Crossarm Replacement at Structure 39/7 and Access Road Maintenance along the Existing Tucson-Apache 115-Kilovolt Transmission Line in Pima County, Arizona CX(s) Applied: B1.3 Date: 07/08/2010 Location(s): Pima County, Arizona Office(s): Western Area Power Administration-Desert Southwest Region Western Area Power Administration proposes to conduct Emergency Crossarm Replacement at Structure 39/7 and Access Road Maintenance along the existing Tucson-Apache 115-kilovolt transmission line. This will consist of blading and leveling out areas of the existing access road using a dozer and bucket trucks, crew trucks and pickup trucks to replace the crossarm at the structure. This work is necessary to maintain the safety and


CX-007164: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

164: Categorical Exclusion Determination 164: Categorical Exclusion Determination CX-007164: Categorical Exclusion Determination Prescott-Pinnacle Peak & Pinnacle Peak-Rogers Aerial Marker Ball Addition CX(s) Applied: B1.9 Date: 01/07/2011 Location(s): Maricopa County, Arizona Office(s): Western Area Power Administration-Desert Southwest Region Western proposes removing two existing marker balls at structures 0/4 & 0/5 of the Pinnacle Peak-Rogers #1 & #2 230-kilovolt (kV) double circuit transmission line & installing aerial marker ball equipment on all static wires (overhead ground wires) of the Prescott-Pinnacle Peak 230-kV transmission line on the north side of structures 216/1-216/3 & the southeast side of structures 0/3-0/5 on the Pinnacle Peak-Rogers #1 & #2 230-kV double circuit transmission line. The diverters will be installed


CX-005410: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

410: Categorical Exclusion Determination 410: Categorical Exclusion Determination CX-005410: Categorical Exclusion Determination North Bonneville-Alcoa Number 1 and 2 Transmission Line Corridor CX(s) Applied: B1.3 Date: 03/03/2011 Location(s): Clark County, Washington Office(s): Bonneville Power Administration Bonneville Power Administration (BPA) proposes to perform road reconstruction work to improve vehicle access to structures 16/6, 16/7 and 17/1 of the North Bonneville-Alcoa Number 1 and 2 transmission line corridor from southeast 37th Street to the right-of-way, then to structure 16/6 to the east, and structure 17/1 to the west. The total distance of this project is approximately 2200 feet. Project work may include, but is not limited to: vegetation removal to clear a 20-foot width, grading and


CX-005852: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

852: Categorical Exclusion Determination 852: Categorical Exclusion Determination CX-005852: Categorical Exclusion Determination Stegall-Wayside 230 Kilovolt Access Road Extension CX(s) Applied: B1.13 Date: 05/05/2011 Location(s): Dawes County, Wyoming Office(s): Western Area Power Administration-Rocky Mountain Region Western Power Administration plans to construct an extension of an existing access road between structures 111-1 and 111-2 on the Stegall-Wayside 230 kilovolt transmission line. This road construction will provide access for removal of previously felled hazard trees along the transmission line right-of-way on private land. The project will extend the existing access road to the south from its present terminus at structure 111-1 and terminate before reaching structure 111-2. DOCUMENT(S) AVAILABLE FOR DOWNLOAD



E-Print Network (OSTI)

AN ATLAS-BASED DEEP BRAIN STRUCTURE SEGMENTATION METHOD: FROM COARSE POSITIONING TO FINE SHAPING Segmentation of deep brain structures is a challenging task for MRI images due to blurry structure boundaries brain structures and determine an optimal sequence for the structure- by-structure segmentation. After

Chung, Albert C. S.


Airfoil structure  

DOE Patents (OSTI)

Past airfoil configurations have been used to improve aerodynamic performance and engine efficiencies. The present airfoil configuration further increases component life and reduces maintenance by reducing internal stress within the airfoil itself. The airfoil includes a chord and a span. Each of the chord and the span has a bow being summed to form a generally "C" configuration of the airfoil. The generally "C" configuration includes a compound bow in which internal stresses resulting from a thermal temperature gradient are reduced. The structural configuration reduces internal stresses resulting from thermal expansion.

Frey, Gary A. (Poway, CA); Twardochleb, Christopher Z. (Alpine, CA)



Airfoil structure  

DOE Patents (OSTI)

Past airfoil configurations have been used to improve aerodynamic performance and engine efficiencies. The present airfoil configuration further increases component life and reduces maintenance by reducing internal stress within the airfoil itself. The airfoil includes a chord and a span. Each of the chord and the span has a bow being summed to form a generally ``C`` configuration of the airfoil. The generally ``C`` configuration includes a compound bow in which internal stresses resulting from a thermal temperature gradient are reduced. The structural configuration reduces internal stresses resulting from thermal expansion. 6 figs.

Frey, G.A.; Twardochleb, C.Z.



Categorical Exclusion Determinations: B1.8 | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

8 8 Categorical Exclusion Determinations: B1.8 Existing Regulations B1.8: Screened water intake and outflow structures Modifications to screened water intake and outflow structures such that intake velocities and volumes and water effluent quality and volumes are consistent with existing permit limits. DOCUMENTS AVAILABLE FOR DOWNLOAD November 8, 2012 CX-009551: Categorical Exclusion Determination Brigham City Hydro Generation Project CX(s) Applied: B1.8, B5.2 Date: 11/08/2012 Location(s): Utah Offices(s): Golden Field Office July 16, 2012 CX-009099: Categorical Exclusion Determination Routine Maintenance CX(s) Applied: B1.3, B1.4, B1.8, B1.16, B1.17 Date: 07/16/2012 Location(s): Washington Offices(s): Pacific Northwest Site Office December 13, 2010 CX-004840: Categorical Exclusion Determination


CX-008377: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

377: Categorical Exclusion Determination 377: Categorical Exclusion Determination CX-008377: Categorical Exclusion Determination Alcova-Casper North 115 Kilovolt Transmission Line Pole Replacements CX(s) Applied: B1.3 Date: 04/10/2012 Location(s): Wyoming Offices(s): Western Area Power Administration-Rocky Mountain Region Western Area Power Administration's (Western) Casper Field Office proposes to replace deteriorating poles on 18 wood H-frame structures along its Alcova-Casper North 115 kilovolt (kV) transmission line. The project structures are located on the transmission line between Township 33 North, Range 80 West, Section 12 and Township 30 North, Range 82 West, Section 18, 6th Principle Meridian near Casper, Wyoming in Natrona County. CX-008377.pdf More Documents & Publications CX-010551: Categorical Exclusion Determination


CX-008719: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

19: Categorical Exclusion Determination 19: Categorical Exclusion Determination CX-008719: Categorical Exclusion Determination Wood Pole Replacements As Needed on the Naselle-Tarlett No. 1, Holcomb- Naselle No. 1, and Raymond-Willapa River No. 1, 115 Kilovolt Transmission Lines CX(s) Applied: B1.3 Date: 05/16/2012 Location(s): Washington Offices(s): Bonneville Power Administration Bonneville Power Administration proposes to replace deteriorating wood poles and associated structural/electrical components (e.g. crossarms, insulators, and guy anchors) at existing H-frame structures along the subject transmission lines in Pacific County, Washington. Microsoft Word - CX-PacificCoWAWoodPolesFY12_WEB.doc More Documents & Publications CX-006794: Categorical Exclusion Determination EIS-0285-SA-118: Supplement Analysis


CX-007509: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

9: Categorical Exclusion Determination 9: Categorical Exclusion Determination CX-007509: Categorical Exclusion Determination Record of Categorical Exclusion for Use of RW Surge Line to Big Hill Anhydrite Pond for Raw Water Intake Structure Recycle CX(s) Applied: B1.3 Date: 11/28/2011 Location(s): Texas Offices(s): Strategic Petroleum Reserve Field Office DOE M&O Contractor will cap the existing recycle line at the Big Hill raw water intake structure for repair work and install a valve in place of the existing surge relief valve to serve as a recycle valve to control flow from the Big Hill raw water intake pumps. The raw water surge line will discharge to the Big Hill anhydrite pond while repairs are being made to the recycle line. CX-007509.pdf More Documents & Publications CX-000482: Categorical Exclusion Determination


CX-008714: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

8714: Categorical Exclusion Determination 8714: Categorical Exclusion Determination CX-008714: Categorical Exclusion Determination Wood Pole Replacements on the Alvey-Fairview No. 1 230 Kilovolt (kV), Alvey- Martin Creek 115-kV, and Martin Creek-Drain #1 115-kV Transmission Line Rights-of-way CX(s) Applied: B1.3 Date: 05/21/2012 Location(s): Oregon, Oregon Offices(s): Bonneville Power Administration Bonneville Power Administration proposes to replace 18 deteriorating wood poles and associated structural/electrical components (e.g. cross arms, insulators, guy anchors, etc.) as well as cross arms on three other structures along the subject transmission lines. Microsoft Word - CX-Alvey-FairviewAlvey-MartinCreek-DrainWoodPolesFY12_WEB.doc More Documents & Publications CX-010344: Categorical Exclusion Determination



Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Structure Replacement Hayden-Gore Pass 138-kV transmission line (Structure 25/5) Spring 20 I 0 Structure Replacement Hayden-Gore Pass 138-kV transmission line (Structure 25/5) Spring 20 I 0 A. Brief Description of Proposal: Western proposes to replace structure 25/5 on the Hayden-Gore Pass 138-kV transmission line. The structure is located on U.S. Forest Service lands (T.2N, R. 82W, Section 35; Gore Pass 7.5' USGS quadrangle map. B. Number and Title of the Categorical Exclusion Being Applied: (See text in 10 CFR 1021, Subpart D.) B 4.6 Additions or modifications to electric power h'ansmission facilities that would not affect the environment beyond the previously developed facility area including, but not limited to, switchyard rock, grounding upgrades, secondary containment projects, paving projects, seismic upgrading, tower modifications, changing insulators and


Bayesian Methods for Aircraft Structural Health  

E-Print Network (OSTI)

.1 Introduction Aircraft structures, whether metallic or composite, are subject to service damage which requires on the inspection results obtained. If damage is detected from an inspection, the decision whether to repair as well dynamically, and compared to a model of the structure such that damage can be located and a determination made

Henderson, Thomas C.


Structural Characterization  

NLE Websites -- All DOE Office Websites (Extended Search)

Characterization Characterization and Comparison of Switchgrass Ball-milled Lignin Before and After Dilute Acid Pretreatment Reichel Samuel & Yunqiao Pu & Babu Raman & Arthur J. Ragauskas Received: 25 April 2009 / Accepted: 10 August 2009 # Humana Press 2009 Abstract To reduce the recalcitrance and enhance enzymatic activity, dilute H 2 SO 4 pretreatment was carried out on Alamo switchgrass (Panicum virgatum). Ball-milled lignin was isolated from switchgrass before and after pretreatment. Its structure was characterized by 13 C, HSQC, and 31 P NMR spectroscopy. It was confirmed that ball-milled switchgrass lignin is of HGS type with a considerable amount of p-coumarate and felurate esters of lignin. The major ball-milled lignin interunit was the β-O-4 linkage, and a minor amount of phenylcoumarin, resinol, and spirodienone units were also present. As a result of the acid pretreatment,


Armor structures  

DOE Patents (OSTI)

An armor structure includes first and second layers individually containing a plurality of i-beams. Individual i-beams have a pair of longitudinal flanges interconnected by a longitudinal crosspiece and defining opposing longitudinal channels between the pair of flanges. The i-beams within individual of the first and second layers run parallel. The laterally outermost faces of the flanges of adjacent i-beams face one another. One of the longitudinal channels in each of the first and second layers faces one of the longitudinal channels in the other of the first and second layers. The channels of the first layer run parallel with the channels of the second layer. The flanges of the first and second layers overlap with the crosspieces of the other of the first and second layers, and portions of said flanges are received within the facing channels of the i-beams of the other of the first and second layers.

Chu, Henry Shiu-Hung [Idaho Falls, ID; Lacy, Jeffrey M [Idaho Falls, ID



GEET DUGGAL Algorithms for Determining  

E-Print Network (OSTI)

Relationship to Gene Regulation Final Public Oral Examination Doctor of Philosophy Recent genome sequencing. Analyses from them have shown that the 3D structure of DNA may be closely linked to genome functions structure of DNA and genome function on the scale of the whole genome. Specifically, we designed algorithms


First JAM results on the determination of polarized parton distributions  

SciTech Connect

The Jefferson Lab Angular Momentum (JAM) Collaboration is a new initiative to study the angular momentum dependent structure of the nucleon. First results on the determination of spin-dependent parton distribution functions at intermediate and large x from world data on polarized deep-inelastic scattering are presented. Different aspects of global QCD analysis are discussed, including the effects of nuclear structure of deuterium and {sup 3}He targets, target mass corrections and higher twist contributions to the g{sub 1} and g{sub 2} structure functions.

Accardi, Alberto [Hampton Univ., VA and JLAB, Newport News, VA (United States); Jimenez-Delgado, Pedro [JLAB, Newport News, VA (United States); Melnitchouk, Wally [JLAB, Newport News, VA (United States)



The structure of nickel clusters  

SciTech Connect

The reactions of nickel clusters with ammonia and with water are used to probe cluster geometrical structure. Ammonia uptake experiments allow the determination of the number of preferred binding sites on cluster surfaces. This number shows pronounced minima in the 50- to 116- atom size range for many of the cluster sizes that appear as magic numbers in mass spectra of rare gas clusters. Since these magic numbers arise from closings of shells and subshells of the Mackay icosahedra, the correlation suggests that ammoniated nickel clusters in this size region also have icosahedral structure. Similar structure is found for ammoniated clusters smaller than {similar to}30 atoms, but is not seen for room temperature clusters in the vicinity of the third shell closing at 147 atoms. Icosahedral features do appear for the larger clusters at elevated temperatures. For many clusters above 50 atoms, prolonged exposure to ammonia causes a conversion from the icosahedral structure to some other structure that binds more ammonia molecules, and often the two structures are seen together. The equilibrium reaction of a single water molecule with the bare clusters probes the strength of the cluster--water bond. Enhanced water adsorption is often seen for clusters one atom larger than those showing minima in ammonia uptake, suggesting that these bare clusters likewise have icosahedral structure. The reasons for minima in ammonia uptake and maxima in water binding are discussed.

Parks, E.K.; Winter, B.J.; Klots, T.D.; Riley, S.J. (Chemistry Division, Argonne National Laboratory, Argonne, Illinois 60439 (US))



CX-000257: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

57: Categorical Exclusion Determination 57: Categorical Exclusion Determination CX-000257: Categorical Exclusion Determination Maryland County Baltimore CX(s) Applied: A9, A11, B2.2, B5.1 Date: 12/20/2009 Location(s): Baltimore County, Maryland Office(s): Energy Efficiency and Renewable Energy, Golden Field Office Energy Efficiency and Conservation Block Grant for: Renovation for the Green Resource Center, Energy Audits for Business & Government Structures, Revolving Loan Fund, Energy Retrofits for Governments Buildings, Residential Retrofits, Residential Retrofits (Audits), Energy Conservation Public Outreach/Education and Tracking, (Sheet 1) Energy Efficiency & Conservation for Building & Facilities, (Sheet 2) Energy Efficiency & Conservation for Building & Facilities, Development & Implementation of

Note: This page contains sample records for the topic "determination gila-knob structure" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Categorical Exclusion Determinations: B2.1 | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

1 1 Categorical Exclusion Determinations: B2.1 Existing Regulations B2.1: Workplace enhancements Modifications within or contiguous to an existing structure, in a previously disturbed or developed area, to enhance workplace habitability (including, but not limited to, installation or improvements to lighting, radiation shielding, or heating/ventilating/air conditioning and its instrumentation, and noise reduction). Previous Regulations Categorical Exclusion Determinations dated before November 14th, 2011 were issued under previous DOE NEPA regulations. See the Notice of Final Rulemaking (76 FR 63763, 10/13/2011) for information changes to this categorical exclusion. DOCUMENTS AVAILABLE FOR DOWNLOAD September 11, 2013 CX-011028: Categorical Exclusion Determination


NMR and Structural Genomics  

Science Journals Connector (OSTI)

NMR and Structural Genomics ... The role of NMR in structural genomics is outlined, with particular emphasis on using protein domains as targets. ... Targets in Structural Genomics ...

David Staunton; Jo Owen; Iain D. Campbell



Categorical Exclusion Determinations: Maine | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

September 9, 2010 September 9, 2010 CX-003770: Categorical Exclusion Determination Maine-County-York CX(s) Applied: A1, A9, A11, B2.5, B5.1 Date: 09/09/2010 Location(s): York County, Maine Office(s): Energy Efficiency and Renewable Energy September 9, 2010 CX-003713: Categorical Exclusion Determination Validation of Coupled Models and Optimization of Materials for Offshore Wind Structures CX(s) Applied: A9, B3.1, B3.3, B3.6 Date: 09/09/2010 Location(s): Maine Office(s): Energy Efficiency and Renewable Energy, Golden Field Office August 23, 2010 CX-003544: Categorical Exclusion Determination Environmental Impact Protocols for Tidal Power CX(s) Applied: A9, B3.1, B3.3, B3.6 Date: 08/23/2010 Location(s): Cobscook Bay, Maine Office(s): Energy Efficiency and Renewable Energy, Golden Field Office


Categorical Exclusion Determinations: Illinois | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

June 8, 2012 June 8, 2012 CX-008816: Categorical Exclusion Determination Renovations and Maintenance Activities for Buildings, Structures, Infrastructures and Equipment CX(s) Applied: B1.3, 61.4, 61.5, B1.11, B1.15, B1.16, B1.17, 81.22, B1.27, 62.1, B2.2, B2.3, 62.5 Date: 06/08/2012 Location(s): Illinois Offices(s): New Brunswick Laboratory June 8, 2012 CX-008817: Categorical Exclusion Determination Indoor Bench Scale Research Projects and Conventional Laboratory Operations CX(s) Applied: B3.6 Date: 06/08/2012 Location(s): Illinois Offices(s): New Brunswick Laboratory May 22, 2012 CX-008809: Categorical Exclusion Determination Wind Energy Installations- Wind Turbine Project (ASO-CX-293) CX(s) Applied: B5.18 Date: 05/22/2012 Location(s): Illinois Offices(s): Argonne Site Office


CX-007546: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

46: Categorical Exclusion Determination 46: Categorical Exclusion Determination CX-007546: Categorical Exclusion Determination Management and Analysis of Extreme Wave and Ice Action in the Great Lakes for Offshore Wind Platform Design CX(s) Applied: A9, B3.1 Date: 01/09/2012 Location(s): Michigan Offices(s): Golden Field Office University of Michigan (UM) with the assistance of the National Oceanic and Atmospheric Administration (NOAA) would utilize DOE and cost share funds to develop, research, model, and publish a study of environmental factors that influence the development of ice and environmental loading on offshore wind turbine structures in the Great Lakes. CX-007546.pdf More Documents & Publications CX-007545: Categorical Exclusion Determination CX-005726: Categorical Exclusion Determination


CX-007901: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

01: Categorical Exclusion Determination 01: Categorical Exclusion Determination CX-007901: Categorical Exclusion Determination Improving Atmospheric Models for Offshore Wind Resource Mapping and Prediction Using LIDAR, Aircraft, and In-Ocean Observations CX(s) Applied: A9, A11, B3.1, B3.2 Date: 02/22/2012 Location(s): New York Offices(s): Golden Field Office DOE is proposing to provide federal funding to State University of New York (SUNY) to develop, research, model, and collect data of environmental factors that influence wind turbine structures along the Atlantic coast. This study would include information gathering, data analysis and modeling, mapping, and reporting. CX-007901.pdf More Documents & Publications CX-009575: Categorical Exclusion Determination CX-009130: Categorical Exclusion Determination


CX-008010: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

10: Categorical Exclusion Determination 10: Categorical Exclusion Determination CX-008010: Categorical Exclusion Determination Small-Scale Research and Development Projects Using Nanoscale Materials CX(s) Applied: B3.15 Date: 12/12/2011 Location(s): Washington Offices(s): Science, Pacific Northwest Site Office The U.S. Department of Energy (DOE) Pacific Northwest Site Office (PNSO) proposes to conduct indoor small-scale research and development projects and small-scale pilot projects using nanoscale materials. Nanoscale materials are engineered materials consisting of, or containing structures of between 1 and 100 nanometers (nm) that make use of properties unique to nanoscale forms of materials. CX-008010.pdf More Documents & Publications CX-008002: Categorical Exclusion Determination CX-008004: Categorical Exclusion Determination


Categorical Exclusion (CX) Determinations By Date | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

7842: Categorical Exclusion Determination 7842: Categorical Exclusion Determination Energy Efficient Windows and Doors for City Owned Buildings CX(s) Applied: B5.1 Date: 11/28/2011 Location(s): Pennsylvania Offices(s): Energy Efficiency and Renewable Energy November 28, 2011 CX-008005: Categorical Exclusion Determination Site Characterization and Environmental Monitoring CX(s) Applied: B3.1 Date: 11/28/2011 Location(s): Washington Offices(s): Science, Pacific Northwest Site Office November 28, 2011 CX-007509: Categorical Exclusion Determination Record of Categorical Exclusion for Use of RW Surge Line to Big Hill Anhydrite Pond for Raw Water Intake Structure Recycle CX(s) Applied: B1.3 Date: 11/28/2011 Location(s): Texas Offices(s): Strategic Petroleum Reserve Field Office November 28, 2011 CX-008004: Categorical Exclusion Determination


CX-009574: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

74: Categorical Exclusion Determination 74: Categorical Exclusion Determination CX-009574: Categorical Exclusion Determination City of Las Vegas, Nevada Energy Efficiency and Conservation Block Grant CX(s) Applied: B5.16 Date: 12/19/2012 Location(s): Nevada Offices(s): Golden Field Office The U.S. DOE is proposing to provide federal funding to the City of Las Vegas, Nevada under the American Recovery and Reinvestment Act of 2009 Energy Efficiency and Conservation Block Grant Program. DOE is proposing to authorize the expenditure of federal funds for the installation of five new solar canopy structures totaling 527 kilowatts of solar photovoltaic capacity. CX-009574.pdf More Documents & Publications CX-009546: Categorical Exclusion Determination CX-002858: Categorical Exclusion Determination CX-001013


CX-009425: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

09425: Categorical Exclusion Determination 09425: Categorical Exclusion Determination CX-009425: Categorical Exclusion Determination Partial Validation of Coupled Models and Optimization of Materials for Offshore Wind Structures CX(s) Applied: B3.3, B3.16, B5.18 Date: 11/05/2012 Location(s): Maine Offices(s): Golden Field Office This NEPA review is being conducted to evaluate activities under Task 1 of the University of Maine's offshore project, specifically for activities conducted at the Castine site added as a preliminary testing site prior to the Monhegan site deployment and the preliminary erection of a small wind turbine on the University's campus. CX-009425.pdf More Documents & Publications CX-007545: Categorical Exclusion Determination CX-010240: Categorical Exclusion Determination CX-002154


CX-003165: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

65: Categorical Exclusion Determination 65: Categorical Exclusion Determination CX-003165: Categorical Exclusion Determination Demonstration of On-Farm Production of a Dedicated Energy Crop Incorporating Multiple Varieties of Switchgrass Seed CX(s) Applied: A9, B3.6, B5.1 Date: 05/11/2010 Location(s): Tennessee Office(s): Energy Efficiency and Renewable Energy, Golden Field Office The University of Tennessee proposes to use federal funds to conduct field trials at local farms to study the chemical and structural properties of a variety of switchgrass and create awareness of switchgrass as an energy crop over a period of 3 years. DOCUMENT(S) AVAILABLE FOR DOWNLOAD CX-003165.pdf More Documents & Publications CX-005749: Categorical Exclusion Determination CX-003882: Categorical Exclusion Determination


CX-010211: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

11: Categorical Exclusion Determination 11: Categorical Exclusion Determination CX-010211: Categorical Exclusion Determination Detachment Faulting and Geothermal Resources - An Innovative Integrated Geological and Geophysical Investigation of Pearl Hot Spring, Nevada CX(s) Applied: A9, B3.1, B3.6 Date: 01/08/2013 Location(s): Nevada Offices(s): Golden Field Office The U.S. Department of Energy (DOE) is proposing to provide federal funding to the University of Texas (UT) to create a 3-D Earth Model for the Pearl Hot Spring and Clayton Valley region of Esmeralda County, Nevada, using structural geology, thermochronometry, active source reflection/refraction seismology and gravity/magnetic measurements. CX-010211.pdf More Documents & Publications CX-010210: Categorical Exclusion Determination CX-007888: Categorical Exclusion Determination


CX-007166: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

6: Categorical Exclusion Determination 6: Categorical Exclusion Determination CX-007166: Categorical Exclusion Determination Pinnacle Peak-Prescott Danger Tree Removal CX(s) Applied: B1.3 Date: 03/18/2010 Location(s): Maricopa County, Arizona Office(s): Western Area Power Administration-Desert Southwest Region Western proposes to cut down or trim vegetation that impacts worker safety and the reliable transmission of electricity on the existing Pinnacle Peak to Prescott 230-kilovolt transmission line between Structures 216/4 and 216/5 in Maricopa County, Arizona. This emergency work must be completed before the line is energized on March 21, 2010. CX-007166.pdf More Documents & Publications CX-007164: Categorical Exclusion Determination CX-007163: Categorical Exclusion Determination CX-007165


CX-009040: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

40: Categorical Exclusion Determination 40: Categorical Exclusion Determination CX-009040: Categorical Exclusion Determination Radiation Tolerance and Mechanical Properties of Nanostructured Ceramic/metal Composites - University of Nebraska CX(s) Applied: B3.6, B3.10 Date: 08/09/2011 Location(s): Nebraska Offices(s): Nuclear Energy This project will consist of studying the ion irradiation and mechanical response of amorphous Si-C-O and Si-Al-C-O alloys, understanding the role of amorphous-ceramic/metal interface on irradiation and mechanical properties, and evaluating structural integrity and overall mechanical performance of the composite under extreme radiation conditions. CX-009040.pdf More Documents & Publications CX-009037: Categorical Exclusion Determination CX-009035: Categorical Exclusion Determination


CX-005938: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

38: Categorical Exclusion Determination 38: Categorical Exclusion Determination CX-005938: Categorical Exclusion Determination Roseville Elverta (RSC-ELV) Optical Ground Wire Replacement Project CX(s) Applied: B4.6, B4.7 Date: 05/04/2011 Location(s): Sacramento, California Office(s): Western Area Power Administration-Sierra Nevada Region Western plans to replace the existing fiber on the Roseville Elverta (RSC-ELV) line with new fiber on the same transmission towers and no new structures or modifications are needed. The project simply replaces the existing fiber in the same location and same towers as the existing fiber. DOCUMENT(S) AVAILABLE FOR DOWNLOAD CX-005938.pdf More Documents & Publications CX-010684: Categorical Exclusion Determination CX-006896: Categorical Exclusion Determination EIS-0323-S1: Draft Supplement Environmental Impact Statement


CX-001489: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

89: Categorical Exclusion Determination 89: Categorical Exclusion Determination CX-001489: Categorical Exclusion Determination Fort Randall-Sioux City Hazard Tree and Vegetation Control/Removal CX(s) Applied: B1.3 Date: 03/29/2010 Location(s): Sioux City, Iowa Office(s): Western Area Power Administration-Upper Great Plains Region Western Area Power Administration (WAPA) proposes to remove hazardous trees and other woody vegetation within 30 feet of the transmission line conductor, or that could fall within 30 feet of the conductor, on WAPA's existing Fort Randall-Sioux City 230 kilovolt transmission line right-of-way between structures 107/4 and 109/5. DOCUMENT(S) AVAILABLE FOR DOWNLOAD CX-001489.pdf More Documents & Publications CX-007166: Categorical Exclusion Determination CX-010105: Categorical Exclusion Determination


CX-004878: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

8: Categorical Exclusion Determination 8: Categorical Exclusion Determination CX-004878: Categorical Exclusion Determination Rock Slough Pole Replacement Project CX(s) Applied: B1.20, B4.6, B4.13 Date: 03/25/2010 Location(s): Oakley, California Office(s): Western Area Power Administration-Sierra Nevada Region The Contra Costa Water District in coordination with Reclamation, Mid-Pacific Region, will be constructing a new fish screen structure as part of an upgrade to the Rock Slough portion of Reclamation's Contra Costa Canal. The screen will be approximately 320 feet and constructed at the entrance to the Rock Slough. DOCUMENT(S) AVAILABLE FOR DOWNLOAD CX-004878.pdf More Documents & Publications CX-002198: Categorical Exclusion Determination CX-001228: Categorical Exclusion Determination CX-004874


CX-004709: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

709: Categorical Exclusion Determination 709: Categorical Exclusion Determination CX-004709: Categorical Exclusion Determination Grants to Promote Midsize Renewables at Private and Government Building - Anne Arundel Community College Power Purchase Agreement CX(s) Applied: A9, A11, B5.1 Date: 12/13/2010 Location(s): Arnold, Maryland Office(s): Energy Efficiency and Renewable Energy, National Energy Technology Laboratory Installation of a 750 kilowatt solar photovoltaic system at the Anne Arundel Community College. The fixed angle system is mounted on carport structures located on top of an existing paved parking lot covering 1.5 acres. DOCUMENT(S) AVAILABLE FOR DOWNLOAD CX-004709.pdf More Documents & Publications CX-000298: Categorical Exclusion Determination CX-000302: Categorical Exclusion Determination


How Sequence Determines Elasticity of Disordered Proteins Shanmei Cheng,  

E-Print Network (OSTI)

How Sequence Determines Elasticity of Disordered Proteins Shanmei Cheng, Murat Cetinkaya sequences of disordered protein to yield the desired coiling properties is not yet well under- stood-strand, b-turn, and irregular structures (3). Disordered proteins show low sequence complexity

Gräter, Frauke


Determination of Parameters of PV Concentrating System With Heliostat  

Science Journals Connector (OSTI)

The structure of PV concentrating system with heliostat is analyzed. The mathematical model of system consisting of PV concentrating module and heliostat is developed. With the use of developed mathematical model the optimal parameters of the system are determined. The results of this work can be used during the design of PV concentrating systems with heliostats.

R. Vardanyan; A. Norsoyan; V. Dallakyan


Note: This page contains sample records for the topic "determination gila-knob structure" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Structural Code Considerations for Solar Rooftop Installations.  

SciTech Connect

Residential rooftop solar panel installations are limited in part by the high cost of structural related code requirements for field installation. Permitting solar installations is difficult because there is a belief among residential permitting authorities that typical residential rooftops may be structurally inadequate to support the additional load associated with a photovoltaic (PV) solar installation. Typical engineering methods utilized to calculate stresses on a roof structure involve simplifying assumptions that render a complex non-linear structure to a basic determinate beam. This method of analysis neglects the composite action of the entire roof structure, yielding a conservative analysis based on a rafter or top chord of a truss. Consequently, the analysis can result in an overly conservative structural analysis. A literature review was conducted to gain a better understanding of the conservative nature of the regulations and codes governing residential construction and the associated structural system calculations.

Dwyer, Stephen F.; Dwyer, Brian P.; Sanchez, Alfred



Structural organization of gap junction channels  

Science Journals Connector (OSTI)

Gap junctions were initially described morphologically, and identified as semi-crystalline arrays of channels linking two cells. This suggested that they may represent an amenable target for electron and X-ray crystallographic studies in much the same way that bacteriorhodopsin has. Over 30 years later, however, an atomic resolution structural solution of these unique intercellular pores is still lacking due to many challenges faced in obtaining high expression levels and purification of these structures. A variety of microscopic techniques, as well as NMR structure determination of fragments of the protein, have now provided clearer and correlated views of how these structures are assembled and function as intercellular conduits. As a complement to these structural approaches, a variety of mutagenic studies linking structure and function have now allowed molecular details to be superimposed on these lower resolution structures, so that a clearer image of pore architecture and its modes of regulation are beginning to emerge.

Gina E. Sosinsky; Bruce J. Nicholson



CX-012342: Categorical Exclusion Determination  

Energy.gov (U.S. Department of Energy (DOE))

Liberty Parker #2 Transmission Line - Erosion Repair at Structure 53/1 CX(s) Applied: B4.6 Date: 06/09/2014 Location(s): Arizona Offices(s): Western Area Power Administration-Desert Southwest Region


CX-000004: Categorical Exclusion Determination  

Energy.gov (U.S. Department of Energy (DOE))

Lane-Wendson #1 Structure 10/5 Access Road Improvement and Pole Replacement ProjectCX(s) Applied: B1.3Date: 10/08/2009Location(s): Lane County, OregonOffice(s): Bonneville Power Administration


CX-010423: Categorical Exclusion Determination  

Energy.gov (U.S. Department of Energy (DOE))

Underwood Tap Structure Replacement and Access Road CX(s) Applied: B4.6 Date: 06/07/2013 Location(s): Washington Offices(s): Bonneville Power Administration


CX-012072: Categorical Exclusion Determination  

Energy.gov (U.S. Department of Energy (DOE))

Archer-Cheyenne North/South 115-kilovolt Transmission Line Structure Replacement CX(s) Applied: B4.13 Date: 03/18/2014 Location(s): Wyoming Offices(s): Western Area Power Administration-Rocky Mountain Region


CX-012084: Categorical Exclusion Determination  

Energy.gov (U.S. Department of Energy (DOE))

Snowy Range-Happy Jack 115-Kilovolt Transmission Line Structure Replacements CX(s) Applied: B1.3 Date: 03/10/2014 Location(s): Wyoming Offices(s): Western Area Power Administration-Rocky Mountain Region


CX-011649: Categorical Exclusion Determination  

Energy.gov (U.S. Department of Energy (DOE))

Hot Crossarm Changeout Training at 6 Structures CX(s) Applied: B1.3 Date: 12/16/2013 Location(s): Arizona Offices(s): Western Area Power Administration-Desert Southwest Region


CX-010527: Categorical Exclusion Determination  

Energy.gov (U.S. Department of Energy (DOE))

Renovations and Maintenance Activities for Buildings, Structures CX(s) Applied: B1.3 Date: 06/03/2013 Location(s): Illinois Offices(s): Ames Site Office


CX-012112: Categorical Exclusion Determination  

Energy.gov (U.S. Department of Energy (DOE))

Chehalis-Mayfield Number 1 Line Impairment Structure Replacements CX(s) Applied: B1.3 Date: 04/03/2014 Location(s): Washington Offices(s): Bonneville Power Administration


CX-008004: Categorical Exclusion Determination  

Energy.gov (U.S. Department of Energy (DOE))

Siting, Construction, Modifying, and Operating Small-Scale Structures CX(s) Applied: B1.15 Date: 11/28/2011 Location(s): Washington Offices(s): Science, Pacific Northwest Site Office


CX-011852: Categorical Exclusion Determination  

Energy.gov (U.S. Department of Energy (DOE))

Blythe-Knob 161 Kilovolt Transmission Line, Structure Maintenance Project CX(s) Applied: B1.3 Date: 01/21/2014 Location(s): California, California Offices(s): Western Area Power Administration-Desert Southwest Region


CX-011210: Categorical Exclusion Determination  

Energy.gov (U.S. Department of Energy (DOE))

Bridgeport-Gering 115-Kilovolt Transmission Line Structure Replacement CX(s) Applied: B1.3 Date: 09/12/2013 Location(s): Nebraska, Nebraska Offices(s): Western Area Power Administration-Rocky Mountain Region


CX-011211: Categorical Exclusion Determination  

Energy.gov (U.S. Department of Energy (DOE))

Box Butte-Chadron 115-Kilovolt Transmission Line Structure Replacements CX(s) Applied: B1.3 Date: 09/26/2013 Location(s): Nebraska, Nebraska Offices(s): Western Area Power Administration-Rocky Mountain Region


CX-008681: Categorical Exclusion Determination  

Energy.gov (U.S. Department of Energy (DOE))

Ostrander-Troutdale No. 1, Structure 16/1, Access Road Improvement Project CX(s) Applied: B1.3 Date: 07/18/2012 Location(s): Oregon Offices(s): Bonneville Power Administration


CX-010215: Categorical Exclusion Determination  

Energy.gov (U.S. Department of Energy (DOE))

Laufer Wind Group National Wind Technology Center Structure Lighting Tests CX(s) Applied: B1.31, B5.15 Date: 05/30/2013 Location(s): Colorado Offices(s): Golden Field Office


CX-009801: Categorical Exclusion Determination  

Energy.gov (U.S. Department of Energy (DOE))

Copper Mountain to Boysen 34.5 Kilovolt Transmission Line Structure Replacement CX(s) Applied: B1.3 Date: 01/11/2013 Location(s): Wyoming Offices(s): Western Area Power Administration-Rocky Mountain Region


CX-011561: Categorical Exclusion Determination  

Energy.gov (U.S. Department of Energy (DOE))

Structural Health Monitoring of Nuclear Spent Fuel Storage Facilities CX(s) Applied: B3.6 Date: 11/19/2013 Location(s): South Carolina Offices(s): Idaho Operations Office


CX-008679: Categorical Exclusion Determination  

Energy.gov (U.S. Department of Energy (DOE))

Olympia-Grand Coulee Structure 85/5 Relocation Project CX(s) Applied: B1.3 Date: 07/19/2012 Location(s): Washington Offices(s): Bonneville Power Administration


CX-004898: Categorical Exclusion Determination  

Energy.gov (U.S. Department of Energy (DOE))

Gila-Wellton-Mohawk (Structure Maintenance)CX(s) Applied: B1.3Date: 11/05/2010Location(s): Yuma County, ArizonaOffice(s): Western Area Power Administration-Desert Southwest Region

Note: This page contains sample records for the topic "determination gila-knob structure" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


CX-011650: Categorical Exclusion Determination  

Energy.gov (U.S. Department of Energy (DOE))

Parker-Gila 161 Kilovolt Transmission Line - Structure 109-8 Relocation CX(s) Applied: B1.3 Date: 12/18/2013 Location(s): Arizona Offices(s): Western Area Power Administration-Desert Southwest Region


Electromagnetic structure of pion  

SciTech Connect

In this work, we analyze the electromagnetic structure of the pion, an elementary particle composed by a quark-antiquark bound state, by considering the calculation of its electromagnetic radius and its electromagnetic form factor in low and intermediate energy range. Such observables are determined by means of a theoretical model that takes into account the constituent quark and antiquark of the pion, in the formalism of the light-front field theory. In particular, it is considered a nonsymmetrical vertex for such a model, in which we have calculated the electromagnetic form factor of the pion in an optimized way, by varying its regulator mass, so that we can obtain the best value for the pion electromagnetic radius when compared with the experimental one. The theoretical calculations are also compared with the most recent experimental data involving the pion electromagnetic form factor and the results show very good agreement.

Mello, Clayton S.; Cruz Filho, Jose P.; Da Silva, Edson O.; El-Bennich, Bruno; De Melo, J. P.; Filho, Victo S. [Laboratorio de Fisica Teorica e Computacional (LFTC), Universidade Cruzeiro do Sul, 01506-000, Sao Paulo (Brazil)



National Mining Association Experimental Determination  

E-Print Network (OSTI)

National Mining Association Experimental Determination of Radon Fluxes over Water #12;Introduction research funded by the National Mining Association (NMA) regarding radon fluxes from water surfaces surfaces at uranium recovery operations are insignificant and approximate background soil fluxes for most


Determining Cropland Share Rental Arrangements  

E-Print Network (OSTI)

Many crop producers rely heavily on rented land in their farming operations. With this publication, they can learn more about determining crop shares and the principles of crop share leases....

Dhuyvetter, Kevin C.; Kastens, Terry L.; Outlaw, Joe



Determining the Appropriate Asset Allocation  

E-Print Network (OSTI)

Asset allocation largely determines the success of one's investments. This publication explains the different types of assets and how to choose the ones that best suit your goals and investment timeline....

Johnson, Jason; Polk, Wade



CX-010493: Categorical Exclusion Determination  

Energy.gov (U.S. Department of Energy (DOE))

Determining Distribution Coefficients by Surface-Enhanced Raman Spectroscopy (SERS) CX(s) Applied: B3.6 Date: 05/14/2013 Location(s): South Carolina Offices(s): Savannah River Operations Office


Categorical Exclusion Determinations: Minnesota | Department...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

December 5, 2013 CX-011428: Categorical Exclusion Determination Staged, High-Pressure Oxy-Combustion Technology: Development and Scale-Up - Phase II CX(s) Applied: A9, A11 Date:...


Elementary Determinants for Electrical Engineers  

Science Journals Connector (OSTI)

... electrical engineering, determinants are useful, and Prof. Fleming showed many years ago how the resistances of networks can be computed by their means. The very complicated formulae which telephone ...



CX-002672: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

2672: Categorical Exclusion Determination 2672: Categorical Exclusion Determination CX-002672: Categorical Exclusion Determination Drell-Yan SeaQuest Project CX(s) Applied: B3.6 Date: 05/19/2010 Location(s): Illinois Office(s): Fermi Site Office, Science The Fermi National Accelerator Laboratory (Fermilab) Experiment (E906) is part of a series of fixed target Drell-Yan experiments designed with the purpose of measuring the quark and antiquark structure of the nucleon and the modifications to that structure which occur when the nucleon is embedded in a nucleus. Fermilab proposes to build and operate a spectrometer in the New Muon 4 (NM4) Hall and renovate the 120 giga-electron volt (GeV) beam line from enclosure B to NM4. The 120 GeV beam is necessary for the experiment and Fermilab is uniquely capable of


CX-003092: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

92: Categorical Exclusion Determination 92: Categorical Exclusion Determination CX-003092: Categorical Exclusion Determination Ross-Lexington Number 1 New Access Road Construction: 15/1 to 15/2 CX(s) Applied: B1.13 Date: 06/08/2010 Location(s): Clark County, Washington Office(s): Bonneville Power Administration Bonneville Power Administration (BPA) proposes to conduct access road construction at a specific site along the Ross-Lexington Number 1, 115-kilovolt transmission line. This new access road is needed in order to provide access to transmission structures 15/1 and 15/2. The previous access road is no longer accessible due to property owner restrictions. Unrestricted access to transmission structures is a critical aspect of the Transmission Line Maintenance Program, which helps to insure the safety,


CX-007157: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

57: Categorical Exclusion Determination 57: Categorical Exclusion Determination CX-007157: Categorical Exclusion Determination North Gila-Senator Wash Pole Replacement CX(s) Applied: B4.6 Date: 11/03/2010 Location(s): Yuma County, Arizona Office(s): Western Area Power Administration-Desert Southwest Region Western proposes to replace a broken wood pole that is a part of a three-pole turning structure and repair guy wires and anchors as needed at Structure 9/7 on the North Gila-Senator Wash 69-kilovolt Transmission Line. The work consists of auguring a new hole, erecting a new pole, removing the broken pole, attaching guy wires, setting guy wire anchors, and attaching conductors and hardware. We may use the following equipment to perform the work: bucket truck, crane, auger, line truck, crew trucks, and a flatbed


CX-007896: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

96: Categorical Exclusion Determination 96: Categorical Exclusion Determination CX-007896: Categorical Exclusion Determination Bottom Fixed Platform Dynamics Models Assessing Surface Ice Interactions for Transitional Depth Structures in the Great Lakes CX(s) Applied: A9 Date: 02/10/2012 Location(s): Michigan Offices(s): Golden Field Office DOE is proposing to provide federal funding to University of Michigan (UM) to develop, research, model, and collect data of ice loading wind turbine structures in Lake Huron and Lake Michigan. This would be accomplished by creating a computer-based ice-loading module that would be coupled to computer software tool maintained by the National Renewable Energy Laboratory for simulating onshore and offshore wind turbine dynamics. This study would include research, data gathering, reporting, and modeling.


CX-001182: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

82: Categorical Exclusion Determination 82: Categorical Exclusion Determination CX-001182: Categorical Exclusion Determination Access Road Improvement Project for Structure 12/1 of the Snoking Tap to Echo Lake-Monroe Number 1 Transmission Line CX(s) Applied: B1.13 Date: 03/12/2010 Location(s): Snohomish, Washington Office(s): Bonneville Power Administration Bonneville Power Administration (BPA) proposes to construct a permanent access road to improve vehicle access to the 115 kilovolt Snoking Tap to Echo Lake-Monroe Number 1 Transmission Line. The project would involve constructing an approximately 760-foot long by 14-foot wide access road to structure 12/1. The project would also involve the installation of three culverts to help preserve the site's existing hydrology and increase the longevity of the proposed access road. Project activities would occur in


CX-005845: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

5845: Categorical Exclusion Determination 5845: Categorical Exclusion Determination CX-005845: Categorical Exclusion Determination Selected Wood Pole Replacement and Minor Access Road Maintenance Along the Grand Coulee-Creston Transmission Line at Miles 14, 15, 21 and 28 CX(s) Applied: B1.3 Date: 05/05/2011 Location(s): Lincoln County, Washington Office(s): Bonneville Power Administration Bonneville Power Administration (BPA) proposes to replace deteriorating wood poles and associated structural/electrical components (e.g. cross arms, insulators, guy anchors, etc.) along the Grand Coulee-Creston #1 115-kilovolt transmission line. The structures scheduled for replacement are identified as 14/6, 14/8, 15/1, 21/9 and 28/7. Replacement will be in-kind and will utilize the existing holes to minimize ground disturbance.


CX-003648: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

648: Categorical Exclusion Determination 648: Categorical Exclusion Determination CX-003648: Categorical Exclusion Determination Energy Efficiency Measures at City Parking Structures CX(s) Applied: B2.2, B2.5, B5.1 Date: 08/30/2010 Location(s): Culver City, California Office(s): Energy Efficiency and Renewable Energy Energy Efficiency and Conservation Block Grant fund. The City of Culver City is proposing to hire a qualified consultant to prepare technical specifications and prepare appropriate plans/drawings for lighting retrofit upgrade at two parking structures to energy efficient lighting. The selected contractor will also provide project management of actual retrofit. The proposed lighting will include but is not limited to light-emitting diode (LED) lighting, induction lighting; hybrid combination


Categorical Exclusion (CX) Determinations By Date | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

December 5, 2011 December 5, 2011 CX-007511: Categorical Exclusion Determination Record of Categorical Exclusion for Repair Erosion Problems at Big Hill Raw Water Intake Structure CX(s) Applied: B1.3 Date: 12/05/2011 Location(s): Texas Offices(s): Strategic Petroleum Reserve Field Office December 5, 2011 CX-007789: Categorical Exclusion Determination Associated Electric Cooperative, Inc. Substation Improvements CX(s) Applied: B4.6 Date: 12/05/2011 Location(s): Missouri Offices(s): Southwestern Power Administration December 5, 2011 CX-007390: Categorical Exclusion Determination Hot Carrier Collection in Thin Film Silicon with Tailored Nanocrystalline/Amorphous Structure CX(s) Applied: B3.15, A9, B3.6 Date: 12/05/2011 Location(s): Colorado Offices(s): Golden Field Office December 5, 2011


CX-004899: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

9: Categorical Exclusion Determination 9: Categorical Exclusion Determination CX-004899: Categorical Exclusion Determination Gila-Yuma Tap (Transmission Line Reconstruction) CX(s) Applied: B4.6 Date: 07/19/2010 Location(s): Yuma County, Arizona Office(s): Western Area Power Administration-Desert Southwest Region Western Area Power Administration proposes to rebuild and upgrade approximately 9.8 miles of the existing Gila-Yuma Tap 34.5-kilovolt transmission line to maintain and improve the reliability of electrical service to customers in the Yuma, Arizona, area. The work involves removing the existing wood structures and conductor; and installing steel pole structures, 69-kilovolt conductor, and overhead ground wire. DOCUMENT(S) AVAILABLE FOR DOWNLOAD CX-004899.pdf More Documents & Publications


CX-007136: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

6: Categorical Exclusion Determination 6: Categorical Exclusion Determination CX-007136: Categorical Exclusion Determination Coolidge-Oracle Pole Replacement CX(s) Applied: B4.6 Date: 11/13/2009 Location(s): Pinal County, Arizona Office(s): Western Area Power Administration-Desert Southwest Region Western plans to replace deteriorated wood poles, cross arms and X-braces at 59 existing H-frame or three-pole-turning structures located along the Coolidge-Oracle 115-kilovolt Transmission Line in Pinal County, Arizona. Built in 1943, its aging components are beyond repair and require replacement. These poles performed poorly during structural tests, and we consider them unstable, This project ensures the safety of Western's workers and the public as well as reliability of the bulk electric system.


CX-005937: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

7: Categorical Exclusion Determination 7: Categorical Exclusion Determination CX-005937: Categorical Exclusion Determination Boyd-Valley Transmission Line Optical Ground Wire Fiber Optic Installation, Larimer County, Colorado CX(s) Applied: B4.7 Date: 05/18/2011 Location(s): Larimer County, Colorado Office(s): Western Area Power Administration-Rocky Mountain Region Western plans to install fiber optic cable on existing transmission line structures on the Boyd to Valley Transmission Line in Loveland, Colorado within Larimer County. The new cable will replace one of the existing ground wires; the wire is located on the north side of the single pole steel structures. The new cable will not be visible different from the existing ground wire. DOCUMENT(S) AVAILABLE FOR DOWNLOAD CX-005937.pdf More Documents & Publications


CX-007366: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

7366: Categorical Exclusion Determination 7366: Categorical Exclusion Determination CX-007366: Categorical Exclusion Determination Inland Power & Light 230-kilovolt Substation Project CX(s) Applied: B4.6 Date: 11/17/2011 Location(s): Washington Offices(s): Bonneville Power Administration To provide a tap point for IP&L, Bonneville Power Administration (BPA) would do the following: 1. Install two new 35-foot tall disconnect switch structures under the BPA Bell-Boundary line located about 50 feet south of tower 5/2 and 50 feet north of tower 5/5. Construction of each lattice-steel, disconnect switch structure would require four holes 6-8 feet deep in a rectangular pattern 34 feet wide (to match the lines above) by 10 feet, and would be located on BPA Right-of-Way (ROW) underneath the existing transmission line. 2. BPA may need to construct a new wood pole

Note: This page contains sample records for the topic "determination gila-knob structure" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


CX-006253: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

53: Categorical Exclusion Determination 53: Categorical Exclusion Determination CX-006253: Categorical Exclusion Determination North Bonneville-Ross #1 230-Kilovolt, North Bonneville-Troutdale #2 230-Kilovolt Transmission Line Maintenance CX(s) Applied: B4.13 Date: 06/14/2011 Location(s): Clark County, Washington Office(s): Bonneville Power Administration Bonneville Power Administration (BPA) proposes to conduct transmission line maintenance along a portion of the North Bonneville-Ross #1 and North Bonneville-Troutdale #2 230-kilovolt transmission lines. The maintenance activities will take place within the existing transmission line and access road right-of-way easements and includes upgrading existing roads, developing new roads, installing two new wood pole structures and two new steel tower structures.


CX-007141: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

07141: Categorical Exclusion Determination 07141: Categorical Exclusion Determination CX-007141: Categorical Exclusion Determination Electrical District 4 - Electrical District 5 - Structure Replacement CX(s) Applied: B4.6 Date: 09/01/2011 Location(s): Pinal County, Arizona Office(s): Western Area Power Administration-Desert Southwest Region Western proposes to replace 9.2 miles of 115-kilovolt (kV) wood H-frame structures with 230-kV double-circuit steel monopoles and the existing conductor with a single circuit of 1272 kcmil ACSS. The second circuit will not be installed as a part of this project. The rebuild will include new hardware and insulators as well as one optical ground wire (OPGW) for the entire length of the line. Western will use existing access roads to bring personnel and equipment to the work area. The new lines will be designed to


Categorical Exclusion Determinations: B1.9 | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

9 9 Categorical Exclusion Determinations: B1.9 Existing Regulations B1.9: Airway safety markings and painting Placement of airway safety markings on, painting of, and repair and in-kind replacement of lighting on powerlines and antenna structures, wind turbines, and similar structures in accordance with applicable requirements (such as Federal Aviation Administration standards). Previous Regulations Categorical Exclusion Determinations dated before November 14th, 2011 were issued under previous DOE NEPA regulations. See the Notice of Final Rulemaking (76 FR 63763, 10/13/2011) for information changes to this categorical exclusion. DOCUMENTS AVAILABLE FOR DOWNLOAD January 7, 2011 CX-007164: Categorical Exclusion Determination Prescott-Pinnacle Peak & Pinnacle Peak-Rogers Aerial Marker Ball Addition


CX-004892: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

92: Categorical Exclusion Determination 92: Categorical Exclusion Determination CX-004892: Categorical Exclusion Determination Oracle-Tucson Transmission Line Structure Relocation CX(s) Applied: B4.13 Date: 12/31/2009 Location(s): Pima County, Arizona Office(s): Western Area Power Administration-Desert Southwest Region Western Area Power Administration proposes to relocate part of its Oracle-Tucson 115 kilovolt transmission line in cooperation with Pima County Department of Transportation for their La Canada Drive roadway expansion (Pima County Project Number 4LCRRI). This project involves removing 17 existing transmission line pole structures, and will furnish and install 17 new monopoles in a new location within Western's right-of-way. DOCUMENT(S) AVAILABLE FOR DOWNLOAD CX-004892.PDF More Documents & Publications


CX-005679: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

79: Categorical Exclusion Determination 79: Categorical Exclusion Determination CX-005679: Categorical Exclusion Determination Cowlitz Tap to Chehalis-Covington #1 Transmission Line Wood Pole Replacement CX(s) Applied: B1.3 Date: 04/18/2011 Location(s): Pierce County, Washington Office(s): Bonneville Power Administration Bonneville Power Administration (BPA) proposes to replace deteriorating wood poles and associated structural/electrical components (e.g. crossarms, insulators, guy anchors) at structure 2/12 within the subject transmission line. Pole replacement will be in-kind and will utilize the existing holes to minimize ground disturbance. If necessary, an auger will be used to remove any loose soil from the existing hole prior to new wood pole replacement. Landing construction is not planned or anticipated at this


CX-007172: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

07172: Categorical Exclusion Determination 07172: Categorical Exclusion Determination CX-007172: Categorical Exclusion Determination Tucson-Apache Erosion Repair & Cactus Relocation CX(s) Applied: B1.3 Date: 02/23/2011 Location(s): Pima County, Arizona Office(s): Western Area Power Administration-Desert Southwest Region Western proposes to construct a new access road along the existing Tucson-Apache 115-kilovolt (kV) transmission line within the existing right-of-way and to repair erosion damage at transmission line structures. Access road construction will consist of stripping, clearing and removing vegetation and blading and leveling to create a road within the existing right-of-way between structures 24/7-25/2 & 25/3- 26/5. We will be installing two gates to limit right-of-way access from Houghton Road. We


CX-007158: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

58: Categorical Exclusion Determination 58: Categorical Exclusion Determination CX-007158: Categorical Exclusion Determination Oracle-Tucson Pole Replacement CX(s) Applied: B4.6 Date: 04/16/2010 Location(s): Pima County, Arizona Office(s): Western Area Power Administration-Desert Southwest Region Western plans to replace deteriorated wood poles, cross arms and X-braces at two existing H-frame structures located along the Oracle Tucson 115-kilovolt Transmission Line in Pima, Arizona. Built in 1943, its aging components are beyond repair and require replacement. These poles performed poorly during structural tests, and we consider them unstable. This replacement project will ensure the safety of Western's workers and the public as well as reliability of the bulk electric system. CX-007158.pdf More Documents & Publications


CX-000637: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

37: Categorical Exclusion Determination 37: Categorical Exclusion Determination CX-000637: Categorical Exclusion Determination Characterizing Structural Controls of Enhanced Geothermal System-Candidate and Conventional Geothermal Reservoirs in the Great Basin: Developing Successful Exploration Strategies in Extended Terranes CX(s) Applied: A9, B3.1 Date: 01/28/2010 Location(s): Nevada Office(s): Energy Efficiency and Renewable Energy, Golden Field Office Board of Regents, Nevada System of Higher Education, on behalf of University of Nevada, Reno (UNR) would characterize the structural controls of Enhanced Geothermal Systems Candidate and conventional geothermal reservoris in the Great Basin. The field work would take place in Eastern, Central, and Western Nevada. The lab work would take place at UNR in Reno,


CX-006819: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

19: Categorical Exclusion Determination 19: Categorical Exclusion Determination CX-006819: Categorical Exclusion Determination Replace Aging Wood Poles on Trans Alta?s Centralia Tap to Chehalis-Covington No. 1 230-Kilovolt Transmission Line CX(s) Applied: B1.3 Date: 09/16/2011 Location(s): Lewis County, Washington Office(s): Bonneville Power Administration Bonneville Power Administration (BPA) will perform routine maintenance and replacement of aging wood pole transmission line support structures, including all hardware and guy support structures on the Centralia Tap to Chehalis-Covington No. 1 230-kilovolt (kV) transmission line. The transmission line is owned and operated by Trans Alta and BPA maintains the line at Trans Alta?s expense. Trans Alta is contracting with BPA to complete the maintenance work.


CX-006605: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

5: Categorical Exclusion Determination 5: Categorical Exclusion Determination CX-006605: Categorical Exclusion Determination West Hackenberry Raw Water Intake Structure Clear Zone CX(s) Applied: B1.3 Date: 06/29/2011 Location(s): Lake Charles, Louisiana Office(s): Strategic Petroleum Reserve Field Office Subcontractor shall provide all labor, tools, equipment, transportation, and supervision required to cut trees, brush and grass to make a "clear zone" approximately 110 feet around the perimeter of the West Hackenberry Raw Water Intake Structure. Tasks include machine clearing standing vegetation performed with cutting/grinding equipment that minimizes disturbance of the surface of the soil or root system. Trees and brush shall be removed down to approximately ground/water level. Trees and bush


CX-003792: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

792: Categorical Exclusion Determination 792: Categorical Exclusion Determination CX-003792: Categorical Exclusion Determination Replacement of Overhead Ground Wire - Fairview-Rogue Number 1 230-Kilovolt Transmission Line CX(s) Applied: B1.3 Date: 09/01/2010 Location(s): Curry County, Oregon Office(s): Bonneville Power Administration Bonneville Power Administration (BPA) proposes to replace the overhead ground wire because routine inspections revealed that it has failed due to corrosion. Project activities will include the removal and replacement of the two existing overhead ground wires and their supporting hardware in the last mile of the transmission line. This will also require replacement of the small steel attachment brackets on five Fairview-Rogue lattice steel structures (structures 66/1, 66/2, 66/3, and 66/4). In addition, up to five


CX-004439: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

9: Categorical Exclusion Determination 9: Categorical Exclusion Determination CX-004439: Categorical Exclusion Determination Protective, Modular Wave Power Generation System CX(s) Applied: A9, B3.6 Date: 11/16/2010 Location(s): Corvallis, Oregon Office(s): Energy Efficiency and Renewable Energy, Golden Field Office Shift Power Solutions is proposing to use Department of Energy funding to design and build a protective, modular wave power generation system. The purpose of this system is two-fold: 1) to harness wave energy as a power source and 2) to protect the structural integrity of breakwaters, embankments and other marine structures. Designing and building a modular wave power generation system and assessing the feasibility and risks associated with the technology are the main goals of the project.


CX-006786: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

6: Categorical Exclusion Determination 6: Categorical Exclusion Determination CX-006786: Categorical Exclusion Determination Ross Control House Seismic Upgrades CX(s) Applied: B2.5 Date: 09/02/2011 Location(s): Vancouver, Washington Office(s): Bonneville Power Administration Bonneville Power Administration (BPA) proposes to retrofit the Ross Control House, located on the J.D. Ross Complex to address existing structural concerns that limit the building?s ability to withstand a seismic event. The work involves a series of modifications to the 1939 stucco-clad concrete shell and hollow clay tile interior walls that will provide increased lateral support to the structural walls. Other improvements will reinforce the existing flat roof to further strengthen the volume, while additionally allowing improved energy efficiencies and an enhanced working


CX-003195: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

95: Categorical Exclusion Determination 95: Categorical Exclusion Determination CX-003195: Categorical Exclusion Determination Oracle-Tucson 115-Kilovolt Transmission Line in Pima County, Arizona CX(s) Applied: B4.13 Date: 06/10/2010 Location(s): Pima County, Arizona Office(s): Western Area Power Administration-Desert Southwest Region Western Area Power Administration proposes to relocate 5 steel monopole transmission line structures on our Oracle-Tucson 115-kilovolt transmission line to accommodate Federal Highway Administration's La Canada Road Widening Project in Tucson. This project involves removing structures 19/4, 19/11, 20/1, 20/2, 20/3, and furnishing and installing 5 new steel monopoles and foundations in a new location within Western's Right of Way. DOCUMENT(S) AVAILABLE FOR DOWNLOAD


CX-001121: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

121: Categorical Exclusion Determination 121: Categorical Exclusion Determination CX-001121: Categorical Exclusion Determination Transmission Line Structure Relocation of Existing Oracle-Tucson 115-kilovolt Transmission Line CX(s) Applied: B4.13 Date: 12/31/2009 Location(s): Pima County, Arizona Office(s): Western Area Power Administration-Desert Southwest Region Relocate part of Oracle-Tucson 115 kilovolt transmission line in cooperation with Pima County Department of Transportation for their La Canada Drive roadway expansion. This project involves removing 17 existing transmission line pole structures, and will furnish and install 17 new monopoles in a new location within within Western's right-of-way. Western will be using existing access roads and vehicles such as an auger, pickup trucks, crew trucks, backhoes and bucket trucks to bring personnel and


CX-003237: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

237: Categorical Exclusion Determination 237: Categorical Exclusion Determination CX-003237: Categorical Exclusion Determination Chehalis-Raymond Number 1 2010 Line Rebuild CX(s) Applied: B4.6 Date: 07/19/2010 Location(s): Lewis County, Washington Office(s): Bonneville Power Administration Bonneville Power Administration (BPA) is proposing to rebuild the first 19 miles of the Chehalis-Raymond Number 1, 115 kilovolt transmission line from Chehalis Substation to Pe Ell Substation. The subject transmission line has reached its designed service age and needs to be replaced to insure system reliability and the safe operation. The proposed project includes replacement of all wood pole support structures, electrical conductor, support guys, and associated hardware. Additionally, some minor road maintenance will be completed to gain access to structures where road


CX-006296: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

6296: Categorical Exclusion Determination 6296: Categorical Exclusion Determination CX-006296: Categorical Exclusion Determination Cardwell-Cowlitz 2011 Access Road Maintenance CX(s) Applied: B1.3 Date: 07/21/2011 Location(s): Cowlitz County, Washington Office(s): Bonneville Power Administration Bonneville Power Administration (BPA) proposes to perform routine road maintenance and reconstruction activities along existing access roads, both on and off the right-of-way. The work involves approximately 4.7 miles of road reconstruction or improvement work on or leading to the Cardwell-Cowlitz No. 1, 115- kilovolt transmission line right-of-way between Cardwell Substation and structure 7/8. The roadwork is needed to improve access for crews that will be replacing the transmission line support structures within the transmission line corridor.


CX-009806: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

806: Categorical Exclusion Determination 806: Categorical Exclusion Determination CX-009806: Categorical Exclusion Determination C-CA-CAM Building Complex Demolition and Site Restoration CX(s) Applied: B1.11, B1.16, B1.17, B1.23, B1.24, B1.27, B1.30, B1.33, B1.34 Date: 01/09/2013 Location(s): Pennsylvania Offices(s): Naval Nuclear Propulsion Program The scope of the C-CA-CAM Building Complex demolition includes removal and disposal of concrete, gypsum, roof and wall panels, structural steel, abandoned interior and exterior utilities, and ancillary components and structures not suitable for reuse. The C-CA-CAM Building Complex site restoration will include backfilling, grading, and hydro seeding for erosion control. With a building footprint reduction of 25,448 square feet, a total of approximately 40,000 square feet total of site area will become


CX-007155: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

5: Categorical Exclusion Determination 5: Categorical Exclusion Determination CX-007155: Categorical Exclusion Determination Mead-Perkins Avian Nest Removal & Access Road Maintenance CX(s) Applied: B1.3 Date: 05/10/2010 Location(s): Maricopa County, Arizona Office(s): Western Area Power Administration-Desert Southwest Region Western proposes to conduct access road maintenance between structures 180/1 & 188/2 of the existing Mead-Perkins 500-kilovolt transmission line. This will consist of blading and leveling out areas of the existing access road using dozers, bucket trucks, crew trucks and pickup trucks. This work is needed to facilitate avian nest removal at structures 180/1, 182/2, 186/2 & 188/2. This work is necessary to maintain the safety and reliability of the bulk electrical system.


CX-009806: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

806: Categorical Exclusion Determination 806: Categorical Exclusion Determination CX-009806: Categorical Exclusion Determination C-CA-CAM Building Complex Demolition and Site Restoration CX(s) Applied: B1.11, B1.16, B1.17, B1.23, B1.24, B1.27, B1.30, B1.33, B1.34 Date: 01/09/2013 Location(s): Pennsylvania Offices(s): Naval Nuclear Propulsion Program The scope of the C-CA-CAM Building Complex demolition includes removal and disposal of concrete, gypsum, roof and wall panels, structural steel, abandoned interior and exterior utilities, and ancillary components and structures not suitable for reuse. The C-CA-CAM Building Complex site restoration will include backfilling, grading, and hydro seeding for erosion control. With a building footprint reduction of 25,448 square feet, a total of approximately 40,000 square feet total of site area will become

Note: This page contains sample records for the topic "determination gila-knob structure" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Categorical Exclusion Determinations: B6.6 | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

6 6 Categorical Exclusion Determinations: B6.6 Existing Regulations B6.6: Modification of facilities for storing, packaging, and repacking waste Modification (excluding increases in capacity) of an existing structure used for storing, packaging, or repacking waste other than high-level radioactive waste or spent nuclear fuel, to handle the same class of waste as currently handled at that structure. DOCUMENTS AVAILABLE FOR DOWNLOAD August 16, 2013 CX-010766: Categorical Exclusion Determination Interim Storage Area for Interim Storage Containers (ISCs) at the Radioactive Scrap and Waste Facility (RSWF) CX(s) Applied: B6.6 Date: 08/16/2013 Location(s): Idaho Offices(s): Nuclear Energy May 22, 2013 CX-010488: Categorical Exclusion Determination N-Area Temporary Asbestos Storage Containment Area


CX-007152: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

7152: Categorical Exclusion Determination 7152: Categorical Exclusion Determination CX-007152: Categorical Exclusion Determination Gila-Senator Wash Structure & Access Road Maintenance CX(s) Applied: B1.3 Date: 11/13/2009 Location(s): Imperial County, California Office(s): Western Area Power Administration-Desert Southwest Region Western proposes to conduct maintenance on access roads leading to structure 16/5 of the Gila-Senator Wash 69 kilovolt Transmission Line. All work will be done along existing access roads. This will consist of blading and leveling out areas of the existing access road using dozers, bucket trucks, crew trucks and pickup trucks. A backhoe will be used during replacement of the anchor guy and down guys. This work is necessary to maintain the safety and reliability of the bulk electrical system.


CX-004876: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

4876: Categorical Exclusion Determination 4876: Categorical Exclusion Determination CX-004876: Categorical Exclusion Determination Casa Grande-Empire (Double Circuit Upgrade) CX(s) Applied: B4.13 Date: 09/15/2010 Location(s): Pinal County, Arizona Office(s): Bonneville Power Administration Western proposes to work with Salt River Project on an upgrade to a double circuit on its Casa Grande-Empire 115 kilowatt transmission line. This project involves the removal of the existing H-frame wooden structures and the installation of new steel monopole structures. This will require auger trucks, bulldozers, bucket trucks and cranes. Existing access roads and the existing right-of-way will be used for vehicles such as pickup trucks, crew trucks, backhoes and bucket trucks to bring personnel and equipment to the


CX-007142: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

07142: Categorical Exclusion Determination 07142: Categorical Exclusion Determination CX-007142: Categorical Exclusion Determination Electrical District 5 - Saguaro Structure Maintenance CX(s) Applied: B1.3 Date: 02/09/2011 Location(s): Pinal County, Arizona Office(s): Western Area Power Administration-Desert Southwest Region Western plans to conduct maintenance work to maintain or improve the reliability and safety of electrical transmission along 17 miles of the Test Track (formerly Maricopa)-Saguaro 115-kilovolt Transmission Line between Electrical District 5 and Saguaro Steam Plant Substations. The work includes replacing wood poles, cross arms, and knee braces in-kind at 27 structures because the wood poles failed stability tests, cross arms are beyond repair and arms and braces need to be changed to a more modern


CX-004540: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

540: Categorical Exclusion Determination 540: Categorical Exclusion Determination CX-004540: Categorical Exclusion Determination Remote Monitoring of the Structural Health of Hydrokinetic Composite Turbine Blades CX(s) Applied: A9, B3.6 Date: 11/24/2010 Location(s): Missouri Office(s): Energy Efficiency and Renewable Energy, Golden Field Office The Curators of the University of Missouri for Missouri University of Science and Technology are proposing to use Department of Energy funding to complete a proof-of-concept demonstration of a composite turbine blade that can acquire and transmit data about its structural health. The proposed project seeks to experimentally demonstrate the critical fabrication and function of the blade and monitoring component, thereby providing the concept. DOCUMENT(S) AVAILABLE FOR DOWNLOAD


Gender determination of avian embryo  

DOE Patents (OSTI)

Disclosed is a method for gender determination of avian embryos. During the embryo incubation process, the outer hard shells of eggs are drilled and samples of allantoic fluid are removed. The allantoic fluids are directly introduced into an ion mobility spectrometer (IMS) for analysis. The resulting spectra contain the relevant marker peaks in the positive or negative mode which correlate with unique mobilities which are sex-specific. This way, the gender of the embryo can be determined.

Daum, Keith A. (Idaho Falls, ID); Atkinson, David A. (Idaho Falls, ID)



CX-011104: Categorical Exclusion Determination | Department of...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Determination CX-011104: Categorical Exclusion Determination Coupled Thermo-Mechanical and Photo-Chemical Degradation Mechanisms that Determine the Reliability and...



Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

tor the addition ot bird tor the addition ot bird diversion equipment along the existing Prescott-Pinnacle Peak 230-kV transmission line right-ot-way located in Yavapai County, Arizona . RECORD OF CATEGORICAL EXCLUSION DETERMINATION A. Proposed Action: Western proposes installing Firefly type bird diversion equipment onto static wires (overhead ground wires) of the Prescott-Pinnacle Peak 230-kV transmission line between structures 144/3 and 145/2. The diverters will be spaced approximately 15 ft apart alternating between the two static lines. The diverters will be installed using a hot stick from a helicopter or by accessing the line using existing access roads and rubber-tired vehicles such as cherry pickers, pickup trucks, crew trucks. All work will be done within Westerns existing right-of-way. This



Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

infrastructure infrastructure replacementalong the existing ED4-ED5 transmission line in Pinal County, Arizona RECORD OF CATEGORICAL EXCLUSION DETERMINATION A . Proposed Action: Western proposes to replace 9.2 miles of 115-kV wood H-frame structures with 230-kV double-circuit steel monopoles and the existing conductor with a single circuit of 1272 kcmil ACSS. The second circuit will not be installed as a part of this project. The rebuild will include new hardware and insulators as well as one optical groundwire (OPGW) for the entire length of the line. Western will use existing access roads to bring personnel and equipment to the work area. The new lines will be designed to accommodate growth in the area by providing additional clearances from encroachments. Work will be conducted within Western's 100-foot


CX-012303: Categorical Exclusion Determination | Department of...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Exclusion Determination CX-012303: Categorical Exclusion Determination Post Combustion Carbon Capture Using Polyethylenimine (PEI) Functionalized Titanate Nanotubes CX(s)...


CX-007854: Categorical Exclusion Determination | Department of...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Exclusion Determination CX-007854: Categorical Exclusion Determination Streamlining Solar Standards & Processes: The Southern California Rooftop Solar Challenge CX(s)...


CX-000292: Categorical Exclusion Determination | Department of...  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

Exclusion Determination CX-000292: Categorical Exclusion Determination A Novel Biogas Desulphurization Sorbent Technology for Molten Carbonate Fuel Cell - Based Combined...


CX-000293: Categorical Exclusion Determination | Department of...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Exclusion Determination CX-000293: Categorical Exclusion Determination A Novel Biogas Desulphurization Sorbent Technology for Molten Carbonate Fuel Cell - Based Combined...


CX-000294: Categorical Exclusion Determination | Department of...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Exclusion Determination CX-000294: Categorical Exclusion Determination A Novel Biogas Desulphurization Sorbent Technology for Molten Carbonate Fuel Cell- Based Combined...


CX-001996: Categorical Exclusion Determination | Department of...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Categorical Exclusion Determination CX-001996: Categorical Exclusion Determination Oklahoma State Energy Program (SEP) American Recovery and Reinvestment Act (ARRA) - Washita...


CX-001998: Categorical Exclusion Determination | Department of...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Categorical Exclusion Determination CX-001998: Categorical Exclusion Determination Oklahoma State Energy Program (SEP) American Recovery and Reinvestment Act (ARRA) - Shawnee...


CX-004730: Categorical Exclusion Determination | Department of...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Categorical Exclusion Determination CX-004730: Categorical Exclusion Determination Oklahoma State Energy Program American Recovery and Reinvestment Act - Oklahoma Municipal...


CX-007573: Categorical Exclusion Determination | Department of...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

3: Categorical Exclusion Determination CX-007573: Categorical Exclusion Determination Oklahoma State Energy Program American Recovery and Reinvestment Act - Oklahoma Municipal...


CX-008602: Categorical Exclusion Determination | Department of...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Categorical Exclusion Determination CX-008602: Categorical Exclusion Determination Oklahoma State Energy Program- Oklahoma Municipal Power Authority Large Systems Request AO...


CX-007412: Categorical Exclusion Determination | Department of...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Categorical Exclusion Determination CX-007412: Categorical Exclusion Determination OKLAHOMA State Energy Program American Recovery and Reinvestment Act - Oklahoma Municipal...

Note: This page contains sample records for the topic "determination gila-knob structure" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


CX-009009: Categorical Exclusion Determination | Department of...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Categorical Exclusion Determination CX-009009: Categorical Exclusion Determination "Oklahoma State Energy Program American Recovery and Reinvestment Act - Oklahoma Municipal...


CX-000771: Categorical Exclusion Determination | Department of...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Categorical Exclusion Determination CX-000771: Categorical Exclusion Determination New York Revised Narrative Information Worksheet for Energy Efficiency Program for...


CX-012223: Categorical Exclusion Determination | Department of...  

Office of Environmental Management (EM)

& Publications CX-012402: Categorical Exclusion Determination CX-012224: Categorical Exclusion Determination National Offshore Wind Energy Grid Interconnection Study (NOWEGIS)...


CX-001459: Categorical Exclusion Determination | Department of...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Categorical Exclusion Determination CX-001459: Categorical Exclusion Determination Air Quality VIII: An International Conference on Carbon Management, Mercury, Trace Elements,...


CX-012136: Categorical Exclusion Determination | Department of...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Exclusion Determination CX-012136: Categorical Exclusion Determination Distributed Fiber Optic Arrays: Integrated Temperature and Seismic Sensing for Detection of Carbon...


CX-011013: Categorical Exclusion Determination | Department of...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Exclusion Determination CX-011013: Categorical Exclusion Determination Distributed Fiber Optic Arrays: Integrated Temperature and Seismic Sensing for Detection of Carbon...


CX-011017: Categorical Exclusion Determination | Department of...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Exclusion Determination CX-011017: Categorical Exclusion Determination Distributed Fiber Optic Arrays: Integrated Temperature and Seismic Sensing for Detection of Carbon...


CX-006140: Categorical Exclusion Determination | Department of...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Exclusion Determination CX-006140: Categorical Exclusion Determination Revised Market Title for Energy Efficiency Program for Municipalities, Schools, Hospitals, Public...


CX-000669: Categorical Exclusion Determination | Department of...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

69: Categorical Exclusion Determination CX-000669: Categorical Exclusion Determination Illinois Energy Conservation Plan for State Facilities - Capital Development Board Projects...


CX-000670: Categorical Exclusion Determination | Department of...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

70: Categorical Exclusion Determination CX-000670: Categorical Exclusion Determination Energy Efficiency and Conservation Block Grant State of Illinois Categorical Exclusion...


CX-009310: Categorical Exclusion Determination | Department of...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Categorical Exclusion Determination CX-009310: Categorical Exclusion Determination Optimization of Reservoir Storage Capacity in Different Depositional Environments (Rock...


CX-001473: Categorical Exclusion Determination | Department of...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Exclusion Determination CX-001473: Categorical Exclusion Determination Direct Coal Liquefaction Process Development Date: 04022010 Location(s): Grand Forks, North...


CX-003975: Categorical Exclusion Determination | Department of...  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

Categorical Exclusion Determination CX-003975: Categorical Exclusion Determination State Energy Program - American Recovery and Reinvestment Act Green Jobs Training Program -...


CX-011555: Categorical Exclusion Determination | Department of...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Determination CX-011555: Categorical Exclusion Determination Managing Zirconium Chemistry and Phase Compatibility in Combined Process Separations for Minor Actinide...


Determine Institutional Change Sustainability Goals | Department...  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

Determine Institutional Change Sustainability Goals Determine Institutional Change Sustainability Goals Institutional Change Continuous Improvement Cycle The first step in the...


CX-002556: Categorical Exclusion Determination | Department of...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Exclusion Determination CX-002556: Categorical Exclusion Determination Technical Consultant Services to Assist City In Development of Energy Efficiency and Conservation...


CX-001278: Categorical Exclusion Determination | Department of...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

8: Categorical Exclusion Determination CX-001278: Categorical Exclusion Determination Energy Efficiency (EE) and Conservation Strategy, Technical Consultant, Revolving Loan...


CX-011610: Categorical Exclusion Determination | Department of...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Determination CX-011610: Categorical Exclusion Determination Mission Support Alliance Annual Categorical Exclusion for Training Exercises and Simulations under 10 CFR...


CX-011607: Categorical Exclusion Determination | Department of...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Determination CX-011607: Categorical Exclusion Determination Mission Support Alliance Annual Categorical Exclusion for Air Conditioning Systems for Existing Equipment...


CX-011598: Categorical Exclusion Determination | Department of...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Determination CX-011598: Categorical Exclusion Determination Mission Support Alliance Annual Categorical Exclusion for Building and Equipment Instrumentation under 10 CFR...

Note: This page contains sample records for the topic "determination gila-knob structure" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


CX-009661: Categorical Exclusion Determination | Department of...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Determination CX-009661: Categorical Exclusion Determination Mission Support Alliance Annual Categorical Exclusion for Installation or Relocation of Machinery and...


CX-009664: Categorical Exclusion Determination | Department of...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Determination CX-009664: Categorical Exclusion Determination Mission Support Alliance Annual Categorical Exclusion for Routine Maintenance and Custodial Services under 10...


CX-011602: Categorical Exclusion Determination | Department of...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Determination CX-011602: Categorical Exclusion Determination Mission Support Alliance Annual Categorical Exclusion for Disconnection of Utilities under 10 CFR 1021,...


CX-011601: Categorical Exclusion Determination | Department of...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Determination CX-011601: Categorical Exclusion Determination Mission Support Alliance Annual Categorical Exclusion for Installation or Relocation of Machinery and...


CX-011597: Categorical Exclusion Determination | Department of...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Determination CX-011597: Categorical Exclusion Determination Mission Support Alliance Annual Categorical Exclusion for Facility Safety and Environmental Improvements under...


CX-011608: Categorical Exclusion Determination | Department of...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Determination CX-011608: Categorical Exclusion Determination Mission Support Alliance Annual Categorical Exclusion for Routine Maintenance and Custodial Services under 10...


CX-009657: Categorical Exclusion Determination | Department of...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Determination CX-009657: Categorical Exclusion Determination "Mission Support Alliance Annual Categorical Exclusion for Site Characterization and Environmental Monitoring...


CX-009656: Categorical Exclusion Determination | Department of...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Determination CX-009656: Categorical Exclusion Determination Mission Support Alliance Annual Categorical Exclusion for Facility Safety and Environmental Improvements...


CX-011596: Categorical Exclusion Determination | Department of...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Determination CX-011596: Categorical Exclusion Determination Mission Support Alliance Annual Categorical Exclusion for Site Characterization and Environmental Monitoring...


CX-009662: Categorical Exclusion Determination | Department of...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Determination CX-009662: Categorical Exclusion Determination Mission Support Alliance Annual Categorical Exclusion for Training Exercises and Simulations under 10 CFR...


CX-009655: Categorical Exclusion Determination | Department of...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Determination CX-009655: Categorical Exclusion Determination Mission Support Alliance Annual Categorical Exclusion for Building and Equipment Instrumentation under 10 CFR...


CX-011604: Categorical Exclusion Determination | Department of...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Determination CX-011604: Categorical Exclusion Determination Mission Support Alliance Annual Categorical Exclusion for Polychlorinated Biphenyl Removal under 10 CFR 1021,...


CX-009668: Categorical Exclusion Determination | Department of...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Determination CX-009668: Categorical Exclusion Determination Mission Support Alliance Annual Categorical Exclusion for Polychlorinated Biphenyl Removal under 10 CFR 1021,...



Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

CAT CAT EGORICAL EXC L USION DETERMINATION Rocky Mountain Region, Western Area Power Administra tion E rosion Control Measures Structure No. ItO-3 Dave John ston to Stegall 230-kV Transmission Line Gos hen Coun ty, W yoming A. Brief Description of Proposal: Western Area Power Administration (Western) will repa ir eros ion damage at Structure No. 110-3 of the Dave Johnston to Stegall 230-kV transmission li ne located near southeast Torrington. Wyom ing. Flood flows along the North Platte River in 2011 migrated the act ive channel bank towards Structure No. 110-3. The potenti al exists fo r future channel meandering to undeml ine the fou ndation supports of the 80 foot steel latt ice structure. To mitigate this potent ial. Western proposes to construct an in-ground modular block reta



Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

25/3 25/3 maintenance along the existing Rogers- Coolidge 230-kV transmission line in Pinal COunty, Arizona RECORD OF CATEGORICAL EXCLUSION DETERMINATION A. Proposed Action: Western proposes to replace damaged structure foundation and leg extension at structure 25/3 along the existing Rogers-Coolidge 230-kV transmission line. This will include providing temporary bracing to the structure, placing it on a steel plate laying across the surface of the ground during removal and replacement of the damaged leg and replacing the foundation, reinforced steel and associated hardware. The foundation replacement will occur within a 20-foot-wide x 20-foot-long x 10-foot-deep area. Western will access structures using crew trucks and pickup trucks along existing access roads. This work is necessary to maintain



Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

along the existing along the existing Empire-EDS 11S-kV transmission line, Pinal County, Arizona RECORD OF CATEGORICAL EXCLUSION DETERMINATION A. Proposed Action: Western proposes to replace structures and upgrade to a double circuit 230-kV transmission line on its Empire-ED5 115-kV transmission line, within Western's existing right-of-way. This will include the rebuild of 9.2 miles of transmission line, replacing the H-frame structures with steel monopole structures with foundations, hardware and insulator replacement and adding a overhead ground-wire over the entire length of the project. Western will access the structure using crew trucks along the existing access roads. This work is necessary to maintain the safety and reliability of the bulk electrical system.



Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

maintenance maintenance on 19 structures of the existing Liberty- Coolidge 230-kV transmission line in Maricopa County, Arizona RECORD OF CATEGORICAL EXCLUSION DETERMINATION A. Proposed Action: Western proposes to conduct vegetation removal and maintenance at structures 2/1, 3/3, 3/5, 10/2, 13/5, 17/5, 18/5, 20/2, 20/3, 22/4, 22/8, 23/2,23/3,24/1,24/3,33/6,51/2,5413 & 56/3 of the existing Liberty-Coolidge 230- kV transmission line. This work will consist of replacing bad structure poles, ground wires and anchors, crossarms & cross braces, insulators, conductors and hardware. Western will access structures using crew trucks and pickup trucks along existing access roads. This work is necessary to maintain the safety and reliability of the bulk electrical system.


Kinetically determined shapes of grain boundaries in CVD graphene  

E-Print Network (OSTI)

Predicting the shape of grain boundaries is essential to control results of the growth of large graphene crystals. A global energy minimum search predicting the most stable final structure contradicts experimental observations. Here we present Monte Carlo simulation of kinetic formation of grain boundaries (GB) in graphene during collision of two growing graphene flakes. Analysis of the resulting GBs for the full range of misorientation angles $\\alpha$ allowed us to identify a hidden (from post facto analysis such as microscopy) degree of freedom - the edge misorientation angle $\\beta$. Edge misorientation characterizes initial structure rather than final structure and therefore provides more information about growth conditions. Use of $\\beta$ enabled us to explain disagreements between the experimental observations and theoretical work. Finally, we report an analysis of an interesting special case of zero-tilt GBs for which structure is determined by two variables describing the relative shift of initial isl...

Bets, Ksenia V; Yakobson, Boris I



CX-008790: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

90: Categorical Exclusion Determination 90: Categorical Exclusion Determination CX-008790: Categorical Exclusion Determination Routine Maintenance of Hesperus-Montrose 345 Kilovolt Transmission Line Access Roads San Miguel, Ouray, Montrose, Montezuma, La Plata, and Dolores Counties, Colorado CX(s) Applied: B1.3 Date: 06/05/2012 Location(s): Colorado Offices(s): Western Area Power Administration-Rocky Mountain Region Western Area Power Administration (Western) proposes to perform routine maintenance of existing access roads and right-of-way (ROW) along the Hesperus-Montrose (HSP-MTR) 345-kilovolt (kV) transmission line to safely access structures 64, 67, 81, 82, 93, 97, 99, 100, 122, 125, and 143 (approximately 20 miles). CX-008790.pdf More Documents & Publications CX-009411: Categorical Exclusion Determination


CX-004889: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

89: Categorical Exclusion Determination 89: Categorical Exclusion Determination CX-004889: Categorical Exclusion Determination Casa Grande-Empire (Geological Boring) CX(s) Applied: B3.1 Date: 08/19/2010 Location(s): Pinal County, Arizona Office(s): Western Area Power Administration-Desert Southwest Region Western Area Power Administration proposes to do geologic boring within our right-of-way at structures 18/2, 21/2, 25/1, 37/5, and 41/5 along the existing Casa Grande-Empire 115 kilovolt transmission line. This project involves accessing each bore hole location with a auger/drill and light crew trucks, setting up the drill rig, drilling, collecting soil samples and breaking down the drilling setup. DOCUMENT(S) AVAILABLE FOR DOWNLOAD CX-004889.pdf More Documents & Publications CX-007130: Categorical Exclusion Determination

Note: This page contains sample records for the topic "determination gila-knob structure" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Categorical Exclusion (CX) Determinations By Date | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

8004: Categorical Exclusion Determination 8004: Categorical Exclusion Determination Siting, Construction, Modifying, and Operating Small-Scale Structures CX(s) Applied: B1.15 Date: 11/28/2011 Location(s): Washington Offices(s): Science, Pacific Northwest Site Office November 28, 2011 CX-007758: Categorical Exclusion Determination Nuclear Engineering Teaching and Research Facilities Upgrade at the University of Illinois at Urbana Champaign CX(s) Applied: B3.6 Date: 11/28/2011 Location(s): Illinois Offices(s): Nuclear Energy, Idaho Operations Office November 28, 2011 CX-007757: Categorical Exclusion Determination Multipurpose Target Chamber for High-Temperature Ion Irradation - University of Tennessee CX(s) Applied: B3.10 Date: 11/28/2011 Location(s): Tennessee Offices(s): Nuclear Energy, Idaho Operations Office


CX-003626: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

3626: Categorical Exclusion Determination 3626: Categorical Exclusion Determination CX-003626: Categorical Exclusion Determination Swapping Substation Bay Terminals of Bonneville Power Administration?s (BPA) White Bluffs-Richland Number 1 and Department of Energy B3-S4-White Bluffs Number 1 Transmission Lines CX(s) Applied: B1.3 Date: 08/09/2010 Location(s): Benton County, Washington Office(s): Bonneville Power Administration Bonneville Power Administration (BPA) has a need to replace/modify wood pole structures in order to swap the substation bay terminations of BPA?s White Bluffs-Richland Number 1 and the Department of Energy (DOE) B3 S4-White Bluffs Number 1 transmission lines. DOCUMENT(S) AVAILABLE FOR DOWNLOAD CX-003626.pdf More Documents & Publications CX-005673: Categorical Exclusion Determination


Categorical Exclusion (CX) Determinations By Date | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

May 30, 2013 May 30, 2013 CX-010215: Categorical Exclusion Determination Laufer Wind Group National Wind Technology Center Structure Lighting Tests CX(s) Applied: B1.31, B5.15 Date: 05/30/2013 Location(s): Colorado Offices(s): Golden Field Office May 30, 2013 CX-010483: Categorical Exclusion Determination Man Hole Cover Assembly Replacement CX(s) Applied: B1.3 Date: 05/30/2013 Location(s): South Carolina Offices(s): Savannah River Operations Office May 29, 2013 CX-010508: Categorical Exclusion Determination Cloud County Community College Wind Turbine CX(s) Applied: A9, A11, B3.14 Date: 05/29/2013 Location(s): Kansas Offices(s): Golden Field Office May 29, 2013 CX-010480: Categorical Exclusion Determination Development of a Multi-User Network Testbed for Wide-Area Monitoring and


CX-005187: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

5187: Categorical Exclusion Determination 5187: Categorical Exclusion Determination CX-005187: Categorical Exclusion Determination Hex Block Shipment Project CX(s) Applied: B3.6 Date: 01/25/2011 Location(s): Idaho Office(s): Nuclear Energy, Idaho Operations Office This project involves the shipment of two irradiated stainless steel hex blocks presently located at the Idaho National Laboratory (INL) Materials and Fuels Complex (MFC) to a Westinghouse facility located in Pittsburgh, Pennsylvania to support Research and Development (R&D) activities. This research and demonstration (R&D) work will be performed by a private contractor and will involve the use of ultrasonic equipment to determine the extent of swelling in irradiated structural stainless steel. Thick sections of irradiated stainless steel (as contained in the hex blocks) are


CX-004369: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

4369: Categorical Exclusion Determination 4369: Categorical Exclusion Determination CX-004369: Categorical Exclusion Determination Validation of Coupled Models and Optimization of Materials for Offshore Wind Structures CX(s) Applied: A9, B3.1, B3.6 Date: 11/01/2010 Location(s): Maine Office(s): Energy Efficiency and Renewable Energy, Golden Field Office This National Environmental Policy Act determination is being revised due to the reorganization of the Statement of Project Objective. All tasks requiring an Environmental Assessment have been combined under this 2010 Congressionally Directed Project. The University of Maine proposes to use federal funding to validate and test offshore wind platforms. Tasks 1 and 2 would consist of studies of environmental impacts and regulatory compliance activities, a laboratory-based feasibility study of steps necessary for


CX-007135: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

7135: Categorical Exclusion Determination 7135: Categorical Exclusion Determination CX-007135: Categorical Exclusion Determination Coolidge-Oracle Crossarm Replacement CX(s) Applied: B1.3 Date: 07/29/2010 Location(s): Pinal County, Arizona Office(s): Western Area Power Administration-Desert Southwest Region Western proposes to conduct Emergency Crossarm Replacement at Structures 3/3 and 38/8 along the existing Coolidge-Oracle 115-kilovolt transmission line. We will use existing access roads and rubber tired vehicles such as pickup trucks, crew trucks, and bucket trucks to bring personnel and equipment to the work area. This work is necessary to maintain the safety and reliability of the bulk electrical system. CX-007135.pdf More Documents & Publications CX-004891: Categorical Exclusion Determination


CX-008754: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

4: Categorical Exclusion Determination 4: Categorical Exclusion Determination CX-008754: Categorical Exclusion Determination A High Resolution Digital System in Support of Neutron Imaging at the PULSTAR Reactor - North Carolina State University CX(s) Applied: B3.6 Date: 05/17/2012 Location(s): Idaho Offices(s): Idaho Operations Office The objective of this project is to establish t he capability of high resolution digital neutron imaging at the North Carolina State University (NCSU) PULSTAR reactor. It will be integrated into the existing neutron imaging facility at PULSTAR, and it will be supported by the user facility structure of the Nuclear Reactor Program at NCSU. Microsoft Word - DOE-ID-12-007 NC State EC.doc More Documents & Publications CX-010208: Categorical Exclusion Determination


CX-000556: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

56: Categorical Exclusion Determination 56: Categorical Exclusion Determination CX-000556: Categorical Exclusion Determination Willoby Substation Construction Project-Weld County, Colorado CX(s) Applied: B4.11 Date: 12/16/2009 Location(s): Weld County, Colorado Office(s): Western Area Power Administration-Rocky Mountain Region Western Area Power Administration proposes to construct the new 115-kilovolt Willoby Substation in Weld County, Colorado. The proposed substation would replace the Prospect Valley Tap structures at the juncture of the existing Kiowa Creek-Well 115-kilovolt transmission line and the Prospect Valley-Prospect Valley Tap 115-kilovolt transmission line. DOCUMENT(S) AVAILABLE FOR DOWNLOAD CX-000556.pdf More Documents & Publications CX-010549: Categorical Exclusion Determination


Categorical Exclusion (CX) Determinations By Date | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

2, 2010 2, 2010 CX-003624: Categorical Exclusion Determination Replacement of Twenty 22-L Structures on the Satsop-Aberdeen Number 2 230-kilovolt Transmission Line CX(s) Applied: B1.3 Date: 08/12/2010 Location(s): Gray's Harbor County, Washington Office(s): Bonneville Power Administration August 12, 2010 CX-004896: Categorical Exclusion Determination Davis Dam Switchyards (Erosion Control) CX(s) Applied: B1.3 Date: 08/12/2010 Location(s): Mohave County, Arizona Office(s): Western Area Power Administration-Desert Southwest Region August 12, 2010 CX-003417: Categorical Exclusion Determination Energy Efficiency Projects CX(s) Applied: B5.1 Date: 08/12/2010 Location(s): Plover, Wisconsin Office(s): Energy Efficiency and Renewable Energy, Golden Field Office August 12, 2010 CX-003405: Categorical Exclusion Determination


Categorical Exclusion (CX) Determinations By Date | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

October 4, 2012 October 4, 2012 CX-009220: Categorical Exclusion Determination CH2MHill Plateau Remediation Company - Siting, Construction, and Operation of Support Buildings and Support Structures CX(s) Applied: B1.15 Date: 10/04/2012 Location(s): Washington Offices(s): River Protection-Richland Operations Office October 4, 2012 CX-009170: Categorical Exclusion Determination Low Cost Arc-Fault Detection and Protection for Photovoltaic Systems-Tigo Energy, Inc. CX(s) Applied: B3.6 Date: CX: none Location(s): California Offices(s): Golden Field Office October 3, 2012 CX-009410: Categorical Exclusion Determination Granby (Farr) Pumping Plant Nest Removal Project CX(s) Applied: B1.3 Date: 10/03/2012 Location(s): Colorado Offices(s): Western Area Power Administration October 2, 2012 CX-009219: Categorical Exclusion Determination


CX-002263: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

3: Categorical Exclusion Determination 3: Categorical Exclusion Determination CX-002263: Categorical Exclusion Determination Nef Conformational Change Upon Membrane Association CX(s) Applied: B3.6 Date: 03/08/2010 Location(s): New Mexico Office(s): NNSA-Headquarters, Sandia Site Office Sandia National Laboratories/New Mexico (SNL/NM) proposes to perform neutron reflectivity and fluorescence microscopy studies of the structure and activity of the negative factor (Nef) protein from Human Immunodeficiency Virus (HIV) bound to lipid membranes. Some of the proposed work with the recombinant proteins - the neutron reflective (NR) - would be performed at national neutron-scattering user facilities across the country. DOCUMENT(S) AVAILABLE FOR DOWNLOAD CX-002263.pdf More Documents & Publications CX-002262: Categorical Exclusion Determination


CX-003728: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

28: Categorical Exclusion Determination 28: Categorical Exclusion Determination CX-003728: Categorical Exclusion Determination Improved Structure and Fabrication of Large, High-Power Kinetic Hydropower System Rotors - Year 2 CX(s) Applied: A9, B3.1, B5.1 Date: 09/16/2010 Location(s): New York Office(s): Energy Efficiency and Renewable Energy, Golden Field Office Verdant Power will use the Department of Energy funding to design and test, both in lab and in-water, a next generation advanced waterpower technology: large, high power Kinetic Hydropower System rotors. This determination is being made for the project's Phase 2 tasks which include prototype fabrication; test stand and in-water testing at the Roosevelt Island Tidal Energy Project site; and project management activities. DOCUMENT(S) AVAILABLE FOR DOWNLOAD


Categorical Exclusion Determinations: B4.6 | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

June 20, 2012 June 20, 2012 CX-008773: Categorical Exclusion Determination Airport to Boyd 115 Kilovolt Transmission Line Structure Replacements Larimer County, Colorado CX(s) Applied: B1.3, B4.6 Date: 06/20/2012 Location(s): Colorado Offices(s): Western Area Power Administration-Rocky Mountain Region June 18, 2012 CX-008769: Categorical Exclusion Determination Platform Construction for Power Pole Work CX(s) Applied: B1.13, B2.5, B4.6 Date: 06/18/2012 Location(s): Wyoming Offices(s): RMOTC June 18, 2012 CX-008769: Categorical Exclusion Determination Platform Construction for Power Pole Work CX(s) Applied: B1.13, B2.5, B4.6 Date: 06/18/2012 Location(s): Wyoming Offices(s): RMOTC June 12, 2012 CX-008696: Categorical Exclusion Determination Power Circuit Breaker Replacement Project


Categorical Exclusion Determinations: A9 | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

June 13, 2012 June 13, 2012 CX-008563: Categorical Exclusion Determination Northeast Photovoltaic Regional Training Provider CX(s) Applied: A9, A11, B3.14 Date: 06/13/2012 Location(s): New York Offices(s): Golden Field Office June 13, 2012 CX-008563: Categorical Exclusion Determination Northeast Photovoltaic Regional Training Provider CX(s) Applied: A9, A11, B3.14 Date: 06/13/2012 Location(s): New York Offices(s): Golden Field Office June 12, 2012 CX-008541: Categorical Exclusion Determination High Efficiency Structural Flowthrough Rotor With Active Flap Control CX(s) Applied: A9 Date: 06/12/2012 Location(s): California Offices(s): Golden Field Office June 12, 2012 CX-008469: Categorical Exclusion Determination Ultra-Deepwater Riser Concepts for High Motion Vessels CX(s) Applied: A9


CX-002583: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

583: Categorical Exclusion Determination 583: Categorical Exclusion Determination CX-002583: Categorical Exclusion Determination Digital Hadron Calorimeter CX(s) Applied: B3.6 Date: 03/30/2010 Location(s): Illinois Office(s): Fermi Site Office, Science For the proposed Digital Hadron Calorimeter, Argonne would provide up to 50 cassettes with a weight of approximately 40 pounds each that contain Resistive Plate Chambers as the active element and include a front-end electronic readout. These cassettes would be inserted into the existing hadron calorimeter structure of the CAlorimeter for the LInear Collider Experiment (CALICE) collaboration which is currently located in the Meson Test Beam area. DOCUMENT(S) AVAILABLE FOR DOWNLOAD CX-002583.pdf More Documents & Publications CX-001736: Categorical Exclusion Determination


Categorical Exclusion (CX) Determinations By Date | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

5, 2011 5, 2011 CX-007789: Categorical Exclusion Determination Associated Electric Cooperative, Inc. Substation Improvements CX(s) Applied: B4.6 Date: 12/05/2011 Location(s): Missouri Offices(s): Southwestern Power Administration December 5, 2011 CX-007390: Categorical Exclusion Determination Hot Carrier Collection in Thin Film Silicon with Tailored Nanocrystalline/Amorphous Structure CX(s) Applied: B3.15, A9, B3.6 Date: 12/05/2011 Location(s): Colorado Offices(s): Golden Field Office December 5, 2011 CX-007500: Categorical Exclusion Determination Carbon Absorber Retrofit Equipment (CARE) CX(s) Applied: B3.6 Date: 12/05/2011 Location(s): Colorado Offices(s): National Energy Technology Laboratory December 3, 2011 CX-008674: Categorical Exclusion Determination ATK - A High Efficiency Inertial Carbon Dioxide Extraction System


Categorical Exclusion Determinations: Washington, D.C. | Department of  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Washington, D.C. Washington, D.C. Categorical Exclusion Determinations: Washington, D.C. Location Categorical Exclusion Determinations issued for actions in Washington, D.C. DOCUMENTS AVAILABLE FOR DOWNLOAD June 11, 2013 CX-010460: Categorical Exclusion Determination Novel Low Cost Environmentally Friendly Synthetic Approaches toward Core-Shell Structured Micro CX(s) Applied: B3.6 Date: 06/11/2013 Location(s): District of Columbia Offices(s): National Energy Technology Laboratory March 28, 2013 CX-010567: Categorical Exclusion Determination Lawrence Berkeley National Laboratory - Rapid Automated Modeling and Simulation of Existing Buildings for Energy Efficiency CX(s) Applied: B3.6 Date: 02/28/2013 Location(s): California, District of Columbia Offices(s): Advanced Research Projects Agency-Energy


CX-007991: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

991: Categorical Exclusion Determination 991: Categorical Exclusion Determination CX-007991: Categorical Exclusion Determination Wood Pole Replacements Along the Drummond-Macks Inn, Macks Inn-Madison, and Targhee Tap 115-Kilovolt Transmission Line Right-of-ways CX(s) Applied: B1.3 Date: 02/10/2012 Location(s): Idaho Offices(s): Bonneville Power Administration Bonneville Power Administration proposes to replace deteriorating wood poles and associated structural/electrical components (e.g. cross arms, insulators, guy anchors, etc.) along the subject transmission lines. Microsoft Word - CX-Drummond-MacksInn_WoodPoleReplacementFY12_WEB.doc More Documents & Publications CX-009709: Categorical Exclusion Determination EIS-0267: Final Environmental Impact Statement EIS-0285-SA-82: Supplemental Analysis


CX-000014: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

4: Categorical Exclusion Determination 4: Categorical Exclusion Determination CX-000014: Categorical Exclusion Determination Olympia Substation Bay Addition CX(s) Applied: B4.6 Date: 12/03/2009 Location(s): Thurston County,Washington Office(s): Bonneville Power Administration Puget Sound Energy (PSE) has requested a new 115-kilovolt Point of Delivery from Bonneville Power Administration's (BPA) Olympia Substation. In order to accommodate this request, BPA will construct a new bay, including a circuit breaker and disconnect switches, within the Olympia Substation and terminate the last span of PSE's 115-kilovolt line segment at a dead end structure within the substation. DOCUMENT(S) AVAILABLE FOR DOWNLOAD CX-000014.pdf More Documents & Publications CX-000607: Categorical Exclusion Determination


Categorical Exclusion (CX) Determinations By Date | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

June 3, 2013 June 3, 2013 CX-010527: Categorical Exclusion Determination Renovations and Maintenance Activities for Buildings, Structures CX(s) Applied: B1.3 Date: 06/03/2013 Location(s): Illinois Offices(s): Ames Site Office June 3, 2013 CX-010526: Categorical Exclusion Determination Bench-Scale Research Projects and Conventional Laboratory Operations CX(s) Applied: B3.6 Date: 06/03/2013 Location(s): Illinois Offices(s): Ames Site Office June 3, 2013 CX-010512: Categorical Exclusion Determination Blackfeet Energy Efficiency Retrofits CX(s) Applied: B5.1 Date: 06/03/2013 Location(s): Montana Offices(s): Golden Field Office June 3, 2013 CX-010507: Categorical Exclusion Determination Development and Demonstration of Smart Grid Inverters for High-Penetration Photovoltaic Applications

Note: This page contains sample records for the topic "determination gila-knob structure" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


CX-002774: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

74: Categorical Exclusion Determination 74: Categorical Exclusion Determination CX-002774: Categorical Exclusion Determination Vera Tap to Trentwood Valley Way #1 Project CX(s) Applied: B4.6, B4.13 Date: 06/03/2010 Location(s): Trentwood, Washington Office(s): Bonneville Power Administration Bonneville Power Administration proposes to add a disconnect switch and 2 wood poles between two existing pole structures on its Vera Tap to Trentwood Valley Way Number 1, 115-kilovolt transmission line in eastern Washington. The project will improve system reliability for its customer, Vera Water and Power, by allowing better sectionalizing of the transmission line for maintenance. DOCUMENT(S) AVAILABLE FOR DOWNLOAD CX-002774.pdf More Documents & Publications CX-005009: Categorical Exclusion Determination


Categorical Exclusion Determinations: B1.3 | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

June 20, 2013 June 20, 2013 CX-010551: Categorical Exclusion Determination Alcova-Miracle Mile East 115 Kilovolt Transmission Line Structure Replace and Road Maintenance, Carbon and Natrona Counties, Wyoming CX(s) Applied: B1.3 Date: 06/20/2013 Location(s): Wyoming, Wyoming Offices(s): Western Area Power Administration-Rocky Mountain Region June 20, 2013 CX-010655: Categorical Exclusion Determination Roof Repair on Crane Maintenance Area Roof CX(s) Applied: B1.3 Date: 06/20/2013 Location(s): South Carolina Offices(s): Savannah River Operations Office June 18, 2013 CX-010656: Categorical Exclusion Determination Stormwater Drainage Repair CX(s) Applied: B1.3 Date: 06/18/2013 Location(s): South Carolina Offices(s): Savannah River Operations Office June 17, 2013 CX-010662: Categorical Exclusion Determination


CX-002299: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

2299: Categorical Exclusion Determination 2299: Categorical Exclusion Determination CX-002299: Categorical Exclusion Determination Passive Acoustic Detection of Wind Turbine In-Flow Conditions for Active Control and Optimization CX(s) Applied: B3.1, B3.6, A9 Date: 05/13/2010 Location(s): Mississippi Office(s): Energy Efficiency and Renewable Energy, Golden Field Office The University of Mississippi proposes to use federal funds to study and analyze wind data to predict wind gusts accurately that have detrimental effects on wind turbine lifespan. This research is aimed at reducing operating costs, protecting the wind turbine structure, and lowering wind turbine generated noise. DOCUMENT(S) AVAILABLE FOR DOWNLOAD CX-002299.pdf More Documents & Publications CX-002276: Categorical Exclusion Determination


Categorical Exclusion Determinations: B3.6 | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

13, 2012 13, 2012 CX-008951: Categorical Exclusion Determination Fundamental Understanding of Oxygen Reduction and Reaction Behavior and Developing High Performance... CX(s) Applied: B3.6 Date: 08/13/2012 Location(s): West Virginia Offices(s): National Energy Technology Laboratory August 9, 2012 CX-009024: Categorical Exclusion Determination Advanced Low Cost Receivers for Solar Parabolic Trough CX(s) Applied: B3.6, B5.17 Date: 08/09/2012 Location(s): Vermont Offices(s): Golden Field Office August 9, 2012 CX-009041: Categorical Exclusion Determination Pd-Rh Powder Production Project CX(s) Applied: B3.6 Date: 08/09/2012 Location(s): South Carolina Offices(s): Savannah River Operations Office August 9, 2012 CX-009039: Categorical Exclusion Determination SiC-SiC Composite for Fuel Structure Applications - Electric Power


Categorical Exclusion (CX) Determinations By Date | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

16, 2011 16, 2011 CX-006574: Categorical Exclusion Determination Purchase of the Diamond B Conservation Easement CX(s) Applied: B1.25 Date: 08/16/2011 Location(s): Flathead County, Montana Office(s): Bonneville Power Administration August 16, 2011 CX-006572: Categorical Exclusion Determination Energy Efficient Lighting for Traffic Signals, Building Lighting and Street Lighting CX(s) Applied: B2.5, B5.1 Date: 08/16/2011 Location(s): Aberdeen, South Dakota Office(s): Energy Efficiency and Renewable Energy August 16, 2011 CX-006540: Categorical Exclusion Determination Wells Fargo Property Structure Removal CX(s) Applied: B1.23 Date: 08/16/2011 Location(s): Golden, Colorado Office(s): Energy Efficiency and Renewable Energy, Golden Field Office August 16, 2011 CX-006538: Categorical Exclusion Determination


CX-007769: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

69: Categorical Exclusion Determination 69: Categorical Exclusion Determination CX-007769: Categorical Exclusion Determination Nuclear Infrastructure Upgrade to Enhance Teaching Capabilities in the Nuclear Systems Technology Program at Midlands Technical College CX(s) Applied: B1.28 Date: 11/28/2011 Location(s): South Carolina Offices(s): Nuclear Energy, Idaho Operations Office Midlands Technical College will purchase a metallographic microscope and imaging workstation to allow students to perform structural defect analysis is simulated radiation-damaged, thermal shocked, and stress and corrosion damaged materials, as well as evaluate other surface properties of materials. Microsoft Word - DOE-ID-11-016 Midlands EC.doc More Documents & Publications CX-009631: Categorical Exclusion Determination


CX-012090: Categorical Exclusion Determination  

Energy.gov (U.S. Department of Energy (DOE))

Henderson-Mead Number 2 230-Kilovolt Transmission Line, Erosion Repair at Structure 2/4 CX(s) Applied: B1.3 Date: 09/11/2013 Location(s): Nevada, Nevada Offices(s): Western Area Power Administration-Desert Southwest Region


CX-010369: Categorical Exclusion Determination  

Energy.gov (U.S. Department of Energy (DOE))

Alterations to Existing Buildings Construction of Small-Scale Support Structures and Relocation of Machinery and Equipment CX(s) Applied: B1.11; B1.15; B1.31 Date: 11/09/2012 Location(s): Tennessee, California, Virginia Offices(s): Berkeley Site Office


CX-011858: Categorical Exclusion Determination  

Energy.gov (U.S. Department of Energy (DOE))

Beaver Creek-Sterling 115 Kilovolt Transmission Line Structure Relocation, Morgan County, Colorado CX(s) Applied: B4.13 Date: 01/21/2014 Location(s): Colorado Offices(s): Western Area Power Administration-Rocky Mountain Region


CX-010675: Categorical Exclusion Determination  

Energy.gov (U.S. Department of Energy (DOE))

Parker Dam to Gila 161-kilovolt Transmission Line, Cross Arm Replacement at Structure 0/7 CX(s) Applied: B1.3 Date: 07/22/2013 Location(s): California Offices(s): Western Area Power Administration-Desert Southwest Region


CX-012217: Categorical Exclusion Determination  

Energy.gov (U.S. Department of Energy (DOE))

Deering Lake-Eckley 115 Kilovolt Transmission Line Structure Replacements, Yuma County, Colorado CX(s) Applied: B1.3 Date: 05/19/2014 Location(s): Colorado Offices(s): Western Area Power Administration-Rocky Mountain Region


CX-011700: Categorical Exclusion Determination  

Energy.gov (U.S. Department of Energy (DOE))

Optimal Power Buoy Structure Design for Maximized Power to Weight Ratio and Reduced Installed Capital Cost CX(s) Applied: A9, B3.6 Date: 01/15/2014 Location(s): New Jersey, New Jersey Offices(s): Golden Field Office


CX-012213: Categorical Exclusion Determination  

Energy.gov (U.S. Department of Energy (DOE))

Boysen-Thermopolis 115 Kilovolt Transmission Line Structure Replacement Project, Hot Springs and Fremont Counties, Wyoming CX(s) Applied: B1.3 Date: 05/16/2014 Location(s): Wyoming, Wyoming Offices(s): Western Area Power Administration-Rocky Mountain Region


CX-011857: Categorical Exclusion Determination  

Energy.gov (U.S. Department of Energy (DOE))

Archer-Cheyenne North/South 115 Kilovolt Transmission Line Structure Replacement, Laramie County, Wyoming CX(s) Applied: B4.13 Date: 01/28/2014 Location(s): Wyoming Offices(s): Western Area Power Administration-Rocky Mountain Region


CX-006239: Categorical Exclusion Determination  

Energy.gov (U.S. Department of Energy (DOE))

Structure Replacement, Guernsey Rural Substation to Limestone Substation, Platte County, WyomingCX(s) Applied: B4.6Date: 10/02/2009Location(s): Platte County, WyomingOffice(s): Western Area Power Administration-Rocky Mountain Region


CX-012083: Categorical Exclusion Determination  

Energy.gov (U.S. Department of Energy (DOE))

Rosedale-Willowby-Kiowa Creek 115-Kilovolt Transmission Line Wood H-Structure Replacement CX(s) Applied: B1.3 Date: 04/10/2014 Location(s): Colorado Offices(s): Western Area Power Administration-Rocky Mountain Region


CX-100078: Categorical Exclusion Determination  

Energy.gov (U.S. Department of Energy (DOE))

STM Parking Structure Stairway Restoration – NREL Tracking No. 14-023 Award Number: DE-AC36-08GO28308 CX(s) Applied: DOE/EA 1440 National Renewable Energy Laboratory Date: 10/02/2014 Location(s): Colorado Office(s): Golden Field Office


CX-010883: Categorical Exclusion Determination  

Energy.gov (U.S. Department of Energy (DOE))

PHX-LOB and LIB-LOB 230-Kilovolt Double-Circuit- Replace Insulators at Structure No. 28-2 With NCI Type Polymers CX(s) Applied: B1.3 Date: 08/12/2013 Location(s): Arizona Offices(s): Western Area Power Administration-Desert Southwest Region


CX-100101: Categorical Exclusion Determination  

Office of Energy Efficiency and Renewable Energy (EERE)

Laufer Wind Group NWTC Structure Lighting Tests; NREL Tracking No. 13-014 Award Number: DE-AC36-08GO28308 CX(s) Applied: A9, B1.31, B5.15, B3.3 Date: 10/21/2014 Location(s): Colorado Office(s): Golden Field Office


CX-012214: Categorical Exclusion Determination  

Energy.gov (U.S. Department of Energy (DOE))

Copper Mountain-Pilot Butte 34.5 Kilovolt Transmission Line Structure Pole Replacement Project, Fremont County, Wyoming CX(s) Applied: B1.3 Date: 05/05/2014 Location(s): Wyoming Offices(s): Western Area Power Administration-Rocky Mountain Region

Note: This page contains sample records for the topic "determination gila-knob structure" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


CX-011834: Categorical Exclusion Determination  

Energy.gov (U.S. Department of Energy (DOE))

Ellensburg-Moxee No. 1 Right-Of-Way (ROW) Geotechnical Exploration Between Structures 17/1-22/2 CX(s) Applied: B4.7 Date: 01/22/2014 Location(s): Washington Offices(s): Bonneville Power Administration


Review Process to be determined  

E-Print Network (OSTI)

Program Proposals The request for Authorization to Plan (ATP) must be submitted through the above reviewChancellor VCAA Dean Review Process to be determined within each College Review by Campus-Wide Curriculum Review Body Review by Graduate Council Recommend Approval/Disapproval Refer for Revision Refer

Olsen, Stephen L.


CX-011193: Categorical Exclusion Determination  

Energy.gov (U.S. Department of Energy (DOE))

Categorical Exclusion Determination for Indoor, Small- and Pilot-Scale Research and Development CX(s) Applied: A9, B1.7, B3.6, B3.10, B3.12, B3.15, B5.1, B5.15 Date: 08/05/2013 Location(s): California Offices(s): Berkeley Site Office


CX-100019: Categorical Exclusion Determination  

Energy.gov (U.S. Department of Energy (DOE))

Determination of Rare Earths in Geothermal Brines and Evaluation of Potential Extraction Techniques CX(s) Applied: A9, B3.1, B3.6 Date: 12/13/2011 Location(s): California Offices(s): Golden Field Office Technology Office: Geothermal Technologies Award Number: DE-EE6750


Transmission Line Structure Spotting and Optimization within a Defined Transmission Line Routing Centerline Using Non-Linear Programming Models  

E-Print Network (OSTI)

and optimize structure heights for overhead transmission lines. The modeling tool will address common problems in determining overhead transmission line structure heights and locations. Some of the common problems consist of structure locations often having...

Cockrum, Joshua W.



An ESI-MS Method to Determine Yield and Enantioselectivity in a Single Assay  

Science Journals Connector (OSTI)

A mass spectrometry assay is presented here that allows for the simultaneous determination of yield and enantioselectivity in a single analysis. The assay makes use of molecules that are structurally similar t...

Maureen E. Smith; Steven A. Knolls…



Electromagnetic studies of nucleon and nuclear structure  

SciTech Connect

Important objectives of the group are the study of subatomic structure through experimental measurements and the interpretation of the data through modeling. The common theme that unifies the studies of strong interactions and hadronic systems is the effort to determine the electromagnetic response as completely as possible. The general approach is coincidence detection of exclusive final states and determination of the dependence on the spin variables using polarized beams and targets and outgoing nucleon polarimetry. Direct reaction and giant resonance studies of electron quasi-elastic scattering on {sup 12}C and {sup 16}O are reported, as well as work on nuclear structure models and instrumentation development.

Heisenberg, J.H.; Calarco, J.R.; Hersman, F.W.; Dawson, J.F.



Wave forces on monotower structures fitted with icebreaking cones  

E-Print Network (OSTI)

and theory presently used in the design of offshore tower structures. Presently, wave forces are predicted using a wave- structure interaction approach, diffraction theory, or some combination of the two. An alternative wave force theory was presented... of structures fitted with icebreaking cones. THEORETICAL DEVELOPMENT One of the major difficulties in analyzing the dynamic response of offshore structures is determining the wave-induced excitation forces. There are currently two methods of predicting wave...

Harrington, Michael Gerard



Categorical Exclusion Determinations: B1.15 | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

5 5 Categorical Exclusion Determinations: B1.15 Existing Regulations B1.15: Support buildings Siting, construction or modification, and operation of support buildings and support structures (including, but not limited to, trailers and prefabricated and modular buildings) within or contiguous to an already developed area (where active utilities and currently used roads are readily accessible). Covered support buildings and structures include, but are not limited to, those for office purposes; parking; cafeteria services; education and training; visitor reception; computer and data processing services; health services or recreation activities; routine maintenance activities; storage of supplies and equipment for administrative services and routine maintenance activities; security (such as security posts); fire


9 - Structures in Matlab  

Science Journals Connector (OSTI)

This chapter explains both structures and vectors of structures in Matlab. The chapter starts by explaining the need for a structure class in programming usage and how structures can be used to improve the readability of Matlab programs. A number of examples that explain structures in Matlab are given here. The chapter concludes with the fox and rabbit game project. The reader is encouraged here to program this game using structures in order to gain an in-depth understanding of their use and value. Keywords Structures, vectors of structures, fox and rabbit game

Munther Gdeisat; Francis Lilley



DOE Categorical Exclusion Determination Form  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

MI-TRIBE-MATCH-E-BE-NASH-SHE-WISH BAND OF POTTAWATOMI MI-TRIBE-MATCH-E-BE-NASH-SHE-WISH BAND OF POTTAWATOMI INDIANS Location: Tribe MI-TRIBE-MATCH- E-BE-NASH-SHE- WISH BAND OF POTTAWATOMI INDIANS MI American Recovery and Reinvestment Act: Proposed Action or Project Description The Match-E-Be-Nash-She-Wish Tribe of Pottawatomi Indians of Michigan proposes to conduct energy audits and life cycle cost analyses for several Tribal homes (approximately 25). The proposed actions would involve planning and conducting energy audits, which may include environmental monitoring to determine building energy efficiency, for residential and Tribal buildings. Electricity and fuel consumption and associated costs would be determined. The audits are intended to identify potential energy savings. Conditions: None


Estimated Cost Description Determination Date:  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

and posted 2/10/2011 and posted 2/10/2011 *Title, Location Estimated Cost Description Determination Date: uncertain Transmittal to State: uncertain EA Approval: uncertain $50,000 FONSI: uncertain Determination Date: uncertain Transmittal to State: uncertain EA Approval: uncertain FONSI: uncertain Total Estimated Cost $70,000 Attachment: Memo, Moody to Marcinowski, III, SUBJECT: NEPA 2011 APS for DOE-SRS, Dated: Annual NEPA Planning Summary Environmental Assessments (EAs) Expected to be Initiated in the Next 12 Months Department of Energy (DOE) Savannah River Site (SRS) Jan-11 Estimated Schedule (**NEPA Milestones) South Carolina Department of Health and Environmental Control (SCDHEC) issued a National Pollutant Discharge Elimination System (NPDES) Industrial Stormwater General Permit (IGP) # SCR000000 November 12, with an effective date of January


CRAD, Nuclear Facility Construction - Structural Steel, May 29, 2009 |  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Steel, May 29, Steel, May 29, 2009 CRAD, Nuclear Facility Construction - Structural Steel, May 29, 2009 May 29, 2009 Nuclear Facility Construction - Structural Steel (HSS CRAD 64-16, Rev. 0) Nuclear Facility Construction - Structural Steel criteria, review, and approach document, observes construction activities and review records and design documentation to assess the quality of structural steel fabrication and erection and to determine if requirements specified by design basis documents, contracts, and applicable codes and standards have been met. CRAD, Nuclear Facility Construction - Structural Steel, May 29, 2009 More Documents & Publications CRAD, Nuclear Facility Construction - Structural Concrete, May 29, 2009 CRAD, Nuclear Facility Construction - Mechanical Equipment - June 26, 2012


DOE Categorical Exclusion Determination Form  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

U.S. Department of Energy Categorical Exclusion Determination Form Program or Field Office: Energy Efficiency and Conservation Block Grant Program Project Title CA-TRIBE-LOS COYOTES BAND OF CAHUILLA AND CUPENO INDIANS Location: Tribe CA-TRIBE-LOS COYOTES BAND OF CAHUILLA AND CUPENO INDIANS CA American Recovery and Reinvestment Act: Proposed Action or Project Description The Los Coyotes Band of Cahuilla and Cupeno Indians of California proposes to replace tribal members'


DOE Categorical Exclusion Determination Form  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

U.S. Department of Energy Categorical Exclusion Determination Form Program or Field Office: TRIBAL ENERGY PROGRAM Project Title SD-TEP-ROSEBUD SIOUX TRIBE Location: Tribal ROSEBUD SIOUX TRIBE SD American Recovery and Reinvestment Act: Proposed Action or Project Description The Rosebud Sioux Tribe (RST) and Citizens Wind propose to complete the required pre-construction activities necessary to secure funding for the proposed 190 MW North Antelope Highlands wind farm,


DOE Categorical Exclusion Determination Form  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

U.S. Department of Energy Categorical Exclusion Determination Form Program or Field Office: TRIBAL ENERGY PROGRAM NV Project Title NV-TEP-FALLON PAIUTE-SHOSHONE Location: Tribal FALLON PAIUTE-SHOSHONE American Recovery and Reinvestment Act: Proposed Action or Project Description The Fallon Paiute-Shoshone Tribe proposes to develop a sustainable energy park utilizing renewable energy resources at the Tribe's Reservation in Churchill County, Nevada. This proposed energy park


Method for determining gene knockouts  

DOE Patents (OSTI)

A method for determining candidates for gene deletions and additions using a model of a metabolic network associated with an organism, the model includes a plurality of metabolic reactions defining metabolite relationships, the method includes selecting a bioengineering objective for the organism, selecting at least one cellular objective, forming an optimization problem that couples the at least one cellular objective with the bioengineering objective, and solving the optimization problem to yield at least one candidate.

Maranas, Costa D; Burgard, Anthony R; Pharkya, Priti



Toeplitz determinants with merging singularities  

E-Print Network (OSTI)

We study asymptotic behavior for determinants of $n\\times n$ Toeplitz matrices corresponding to symbols with two Fisher-Hartwig singularities at the distance $2t\\ge0$ from each other on the unit circle. We obtain large $n$ asymptotics which are uniform for $0gas, and a conjecture of Fyodorov and Keating on the second moment of powers of the characteristic polynomials of random matrices.

T. Claeys; I. Krasovsky



DOE Categorical Exclusion Determination Form  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

U.S. Department of Energy Categorical Exclusion Determination Form Program or Field Office: TRIBAL ENERGY PROGRAM OK Project Title OK-TEP-CHEROKEE NATION BUSINESSES Location: Tribal CHEROKEE NATION BUSINESSES American Recovery and Reinvestment Act: Proposed Action or Project Description The Cherokee Wind Energy Development proposed project is for development, design, and installation of a 127.5 megawatt wind farm to offset Tribal electrical load; sell excess electricity to local, regional, and



NLE Websites -- All DOE Office Websites (Extended Search)

CATEGORICAL EXCLUSION (CX) DETERMINATION CATEGORICAL EXCLUSION (CX) DETERMINATION BRIEF DESCRIPTION OF PROPOSED ACTION: Southwestern Power Administration (Southwestern) proposes to obtain an easement for an existing access road which is located in Carroll County, Arkansas. The easement will serve to facilitate Southwestern's electrical utility vehicles accessing electrical transmission line 3008, near structure 33, in Carroll County, Arkansas. PROPOSED BY: Southwestern Power Administration- U.S. Dept. of Energy DATE: January 28,2011 NUMBERS AND TITLES OF THE CATEGORICAL EXCLUSIONS BEING APPLIED: 10 CFR 1021, Appendix B to Subpart D, Part B1.24- Transfer, lease, disposition or acquisition of interests in uncontaminated permanent or temporary structures, equipment therein, and only land that is necessary for use of