Powered by Deep Web Technologies
Note: This page contains sample records for the topic "determination advanced magnetic" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


1

EERE PROJECT MANAGEMENT CENTER NFPA DETERMINATION RECIPIENT:Advanced Magnet Lab  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

OFENFRGY OFENFRGY EERE PROJECT MANAGEMENT CENTER NFPA DETERMINATION RECIPIENT:Advanced Magnet Lab Page 1 of2 STATE: FL PROJECT TITLE: A Lightweight. Direct Drive, Fully Superconducting Generator for Large Wind Turbines Funding Opportunity Announcement Number Pnx:uumeDtlnstrument Number NEPA Control Number CIO Number DE-FOA-0000439 DE-EEOOO5140 GF()"()()()5140-001 EE5140 Based on my review of.he information concerning tbe proposed action, as NEPA Compliance Officer (authorized under- DOE Order 4SI.IA), I have made tbe following determination: ex, EA, [IS APPENDIX AND NUMBER: Description: A9 Information gathering (including , but not limited to, literature surveys, inventories, audits), data analysis (including computer modeling), document preparation (such as conceptual design or feasibility studies, analytical energy supply and

2

Technology advances for magnetic bearings  

Science Journals Connector (OSTI)

This paper describes the state?of?the?art in magnetic bearing technology and applications and some of advances under development through the joint efforts of Rocketdyne Division of Rockwell International and Auburn University. Advances in the areas of nonlinear control systems design digital controller implementation and power electronics are discussed.

Steve Nolan; John Y. Hung

1996-01-01T23:59:59.000Z

3

Advanced Magnetic Resonance Workshop Report | EMSL  

NLE Websites -- All DOE Office Websites (Extended Search)

Magnetic Resonance Workshop Report Advanced Magnetic Resonance Workshop Report NMR and EPR Workshop: Mueller KT, Washton NM, Pruski M, Lipton AS. 2013. "Science Drivers and...

4

Categorical Exclusion Determinations: Advanced Research Projects  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Advanced Research Projects Advanced Research Projects Agency-Energy Categorical Exclusion Determinations: Advanced Research Projects Agency-Energy Categorical Exclusion Determinations issued by Advanced Research Projects Agency-Energy. DOCUMENTS AVAILABLE FOR DOWNLOAD June 10, 2013 CX-010529: Categorical Exclusion Determination Electroalcoholgenesis CX(s) Applied: B3.6 Date: 06/10/2013 Location(s): South Carolina, Washington Offices(s): Advanced Research Projects Agency-Energy May 23, 2013 CX-010566: Categorical Exclusion Determination Massachusetts Institute of Technology- Scalable, Self-Powered Purification Technology for Brackish and Heavy Metal Contaminated Water CX(s) Applied: B3.6 Date: 05/23/2013 Location(s): Massachusetts Offices(s): Advanced Research Projects Agency-Energy May 22, 2013

5

Categorical Exclusion Determinations: Advanced Technology Vehicles  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Technology Vehicles Technology Vehicles Manufacturing Loan Program Categorical Exclusion Determinations: Advanced Technology Vehicles Manufacturing Loan Program Categorical Exclusion Determinations issued by Advanced Technology Vehicles Manufacturing Loan Program. DOCUMENTS AVAILABLE FOR DOWNLOAD May 29, 2012 CX-008810: Categorical Exclusion Determination One Nevada Optimization of Microwave Telecommunication System CX(s) Applied: B1.19, B4.6 Date: 05/29/2012 Location(s): Nevada, Nevada Offices(s): Advanced Technology Vehicles Manufacturing Loan Program January 24, 2012 CX-007677: Categorical Exclusion Determination Project Eagle Phase 1 Direct Wafer/Cell Solar Facility CX(s) Applied: B1.31 Date: 01/24/2012 Location(s): Massachusetts Offices(s): Advanced Technology Vehicles Manufacturing Loan Program

6

Categorical Exclusion Determinations: Advanced Research Projects  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

August 14, 2010 August 14, 2010 CX-004957: Categorical Exclusion Determination General Compression, Inc. -Fuel-Free, Ubiquitous, Compressed Air Energy Storage CX(s) Applied: B3.6 Date: 08/14/2010 Location(s): Watertown, Massachusetts Office(s): Advanced Research Projects Agency - Energy August 14, 2010 CX-004953: Categorical Exclusion Determination Fluidic Inc. -Enhanced Metal-Air Energy Storage System CX(s) Applied: B3.6 Date: 08/14/2010 Location(s): Scottsdale, Arizona Office(s): Advanced Research Projects Agency - Energy August 14, 2010 CX-004941: Categorical Exclusion Determination Makani Power, Inc. - Advanced Wind Turbine CX(s) Applied: B3.6 Date: 08/14/2010 Location(s): Alameda, California Office(s): Advanced Research Projects Agency - Energy August 13, 2010 CX-004925: Categorical Exclusion Determination

7

Categorical Exclusion Determinations: Advanced Research Projects  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

December 18, 2009 December 18, 2009 CX-000850: Categorical Exclusion Determination 25A4274 - Energy Efficient Capture of Carbon Dioxide from Coal Flue Gas CX(s) Applied: B3.6 Date: 12/18/2009 Location(s): Illinois Office(s): Advanced Research Projects Agency - Energy December 18, 2009 CX-000841: Categorical Exclusion Determination 25A1381 - Affordable Energy from Water and Sunlight CX(s) Applied: B3.6 Date: 12/18/2009 Location(s): Massachusetts Office(s): Advanced Research Projects Agency - Energy December 18, 2009 CX-000585: Categorical Exclusion Determination 25A1152 - 1366 Direct Wafer: Enabling Terawatt Photovoltaics CX(s) Applied: B3.6 Date: 12/18/2009 Location(s): Massachusetts Office(s): Advanced Research Projects Agency - Energy December 18, 2009 CX-009901: Categorical Exclusion Determination

8

Categorical Exclusion Determinations: Advanced Research Projects  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

October 18, 2012 October 18, 2012 CX-009518: Categorical Exclusion Determination (0674-1585) Xilectric, Inc. - Low Cost Transportation Batteries CX(s) Applied: B3.6 Date: 10/18/2012 Location(s): Rhode Island, New York Offices(s): Advanced Research Projects Agency-Energy September 27, 2012 CX-010530: Categorical Exclusion Determination Electro-Autotrophic Synthesis of Higher Alcohols CX(s) Applied: B3.6 Date: 09/27/2012 Location(s): California, North Carolina, North Carolina Offices(s): Advanced Research Projects Agency-Energy September 19, 2012 CX-009902: Categorical Exclusion Determination Agrivida - Conditionally Activated Enzymes Expressed in Cellulosic Energy Crops CX(s) Applied: B3.6 Date: 09/19/2012 Location(s): Massachusetts, Connecticut Offices(s): Advanced Research Projects Agency-Energy

9

Categorical Exclusion Determinations: Advanced Research Projects  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

November 21, 2011 November 21, 2011 CX-007697: Categorical Exclusion Determination Autogrid, Inc. - Highly Dispatchable and Distributed Demand Response for the Integration of Distributed Generation CX(s) Applied: A9, B1.7 Date: 11/21/2011 Location(s): New York, California Offices(s): Advanced Research Projects Agency-Energy November 18, 2011 CX-007689: Categorical Exclusion Determination Georgia Tech Research Corporation- Prosumer-Based Distributed Autonomous Cyber-Physical Architecture for Ultra-Reliable Green Electricity Internetworks CX(s) Applied: A9 Date: 11/18/2011 Location(s): Georgia Offices(s): Advanced Research Projects Agency-Energy November 18, 2011 CX-007684: Categorical Exclusion Determination Texas Engineering Experiment Station - Robust Adaptive Topology Control

10

Categorical Exclusion Determinations: Advanced Research Projects  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

July 25, 2012 July 25, 2012 CX-008873: Categorical Exclusion Determination Oregon State University- Natural Gas Self-contained Home Filling Station CX(s) Applied: B3.6 Date: 07/25/2012 Location(s): Oregon, Colorado, Michigan Offices(s): Advanced Research Projects Agency-Energy April 17, 2012 CX-008671: Categorical Exclusion Determination Arizona State University - Cyanobacteria Designed for Solar-Powered Highly Efficient Production of Biofuels - Phase II CX(s) Applied: A9, B3.6 Date: 04/17/2012 Location(s): Arizona, Arizona, Arizona, Minnesota, North Carolina Offices(s): Advanced Research Projects Agency-Energy February 17, 2012 CX-007812: Categorical Exclusion Determination Smart Wire Grid, Inc. - Distributed Power Flow Control Using Smart Wires for Energy Routing CX(s) Applied: A9, B1.7, B3.6

11

Categorical Exclusion Determinations: Advanced Research Projects  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

June 2, 2010 June 2, 2010 CX-003144: Categorical Exclusion Determination ATK - A High Efficiency Inertial Carbon Dioxide Extraction System CX(s) Applied: B3.6 Date: 06/02/2010 Location(s): New York Office(s): Advanced Research Projects Agency - Energy June 2, 2010 CX-003132: Categorical Exclusion Determination Georgia Institute of Technology Research Corporation - Metal Organic Frameworks in Hollow Fiber Membranes for Carbon Dioxide Capture CX(s) Applied: B3.6 Date: 06/02/2010 Location(s): Georgia Office(s): Advanced Research Projects Agency - Energy June 2, 2010 CX-003131: Categorical Exclusion Determination Lawrence Berkeley National Laboratory & Wildcat Disc. Technology - High Throughput Tools to Screen New Metal Organic Framework Materials CX(s) Applied: B3.6 Date: 06/02/2010

12

Science Drivers and Technical Challenges for Advanced Magnetic Resonance  

SciTech Connect

This report recaps the "Science Drivers and Technical Challenges for Advanced Magnetic Resonance" workshop, held in late 2011. This exploratory workshop's goal was to discuss and address challenges for the next generation of magnetic resonance experimentation. During the workshop, participants from throughout the world outlined the science drivers and instrumentation demands for high-field dynamic nuclear polarization (DNP) and associated magnetic resonance techniques, discussed barriers to their advancement, and deliberated the path forward for significant and impactful advances in the field.

Mueller, Karl T.; Pruski, Marek; Washton, Nancy M.; Lipton, Andrew S.

2013-03-07T23:59:59.000Z

13

Magnetic Structure Determination from Neutron Diffraction Data  

NLE Websites -- All DOE Office Websites (Extended Search)

logo logo Magnetic Structure Determination from Neutron Diffraction Data September 17 - 20, 2012 logo Oak Ridge National Laboratory - Oak Ridge, Tennessee, USA About the Workshop Program Lecture Notes Useful Links Organizers Travel & Lodging Wireless Networking Photos filler About the Workshop molecule The Magnetic Structure Determination Workshop 2012 concluded on September 20. The aim of this workshop was to enhance the community studying magnetism in materials by learning from experts the essential theoretical foundations to magnetic representation analysis and work through real examples to gain experience in solving and refining magnetic structures from neutron powder and single crystal diffraction data. Invited speakers: Juan Rodríguez-Carvajal (ILL, Grenoble)

14

Exploring nanoscale magnetism in advanced materials with polarized X-rays  

E-Print Network (OSTI)

Stoehr and H.C. Siegmann, Magnetism, Springer (2006) [93]Exploring nanoscale magnetism in advanced materials withABSTRACT Nanoscale magnetism is of paramount scientific

Fischer, Peter

2012-01-01T23:59:59.000Z

15

Magnetic Switching under Pressure | Advanced Photon Source  

NLE Websites -- All DOE Office Websites (Extended Search)

Revealing the Secrets of Chemical Bath Deposition Revealing the Secrets of Chemical Bath Deposition DNA Repair Protein Caught in the Act of Molecular Theft Velcro for Nanoparticles A Molecular Fossil Ultrafast Imaging of Electron Waves in Graphene Science Highlights Archives: 2013 | 2012 | 2011 | 2010 2009 | 2008 | 2007 | 2006 2005 | 2004 | 2003 | 2002 2001 | 2000 | 1998 | Subscribe to APS Science Highlights rss feed Magnetic Switching under Pressure DECEMBER 2, 2010 Bookmark and Share A schematic representation of the pressure-induced magnetic switching effect. The colored images highlight the direction of the magnetic orbital (grey plane) for the copper centers (green balls: copper, blue: nitrogen, red: oxygen/water, yellow: fluoride). A material's properties are a critical factor in the way that material

16

Advanced Distributor Products: Noncompliance Determination (2010-SE-0304) |  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Advanced Distributor Products: Noncompliance Determination Advanced Distributor Products: Noncompliance Determination (2010-SE-0304) Advanced Distributor Products: Noncompliance Determination (2010-SE-0304) May 28, 2010 DOE issued a Notice of Noncompliance Determination to Advanced Distributor Products finding that basic model N2H348A(G)KB* + H,GE50560 + *8MPV125 and basic model N2H360A(G)KB* + H,GE50560 + MV16J22**B* do not comport with the energy conservation standards. DOE determined the products were noncompliant based on ADP's certification. ADP must immediately notify each person (or company) to whom ADP distributed the noncompliant products that the product does not meet Federal standards. In addition, ADP must provide to DOE documents and records showing the number of units ADP distributed and to whom. The manufacturer and/or private labeler of the

17

Pulsed Magnetic Welding for Advanced Core and Cladding Steel  

SciTech Connect

To investigate a solid-state joining method, pulsed magnetic welding (PMW), for welding the advanced core and cladding steels to be used in Generation IV systems, with a specific application for fuel pin end-plug welding. As another alternative solid state welding technique, pulsed magnetic welding (PMW) has not been extensively explored on the advanced steels. The resultant weld can be free from microstructure defects (pores, non-matallic inclusions, segregation of alloying elements). More specifically, the following objectives are to be achieved, 1) To design a suitable welding apparatus fixture, and optimize welding parameters for repeatable and acceptable joining of the fuel pin end-plug. The welding will be evaluated using tensile tests for lap joint weldments and helium leak tests for the fuel pin end-plug. 2) investigate the microstructural and mechanical properties changes in PMW weldments of proposed advanced core and cladding alloys. 3) Simulate the irradiation effects on the PWM weldments using ion irradiation.

Cao, Guoping; Yang, Yong

2013-12-19T23:59:59.000Z

18

Determination of Electric-Field, Magnetic-Field, and Electric...  

NLE Websites -- All DOE Office Websites (Extended Search)

Electric-Field, Magnetic-Field, and Electric-Current Distributions of Infrared Optical Antennas: A Near-Field Determination of Electric-Field, Magnetic-Field, and Electric-Current...

19

Determination of a flow generating a neutral magnetic mode  

E-Print Network (OSTI)

The problem of reconstruction of a flow of conducting incompressible fluid generating a given magnetic mode is considered. We use the magnetic induction equation to derive ordinary differential equations along the magnetic field lines, which give an opportunity to determine the generating flow, if additional data is provided on a two-dimensional manifold transversal to magnetic field lines, and show that an arbitrary solenoidal vector field can not be a neutral magnetic mode sustained by any flow of conducting fluid.

V. Zheligovsky

2009-06-30T23:59:59.000Z

20

Determination of Magnetic Helicity Content of Solar Active Regions  

E-Print Network (OSTI)

Determination of Magnetic Helicity Content of Solar Active Regions JONGCHUL CHAE1, YONG-JAE MOON2 and YOUNG-DEUK PARK2,3 1 Astronomy Program, School of Earth and Environmental Science, Seoul National a method of self-consistently determining the rate of change of magnetic helicity using a time series

Note: This page contains sample records for the topic "determination advanced magnetic" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


21

Nuclear magnetic resonance imaging and analysis for determination of porous media properties  

E-Print Network (OSTI)

&M University in partial fulfillment of the requirements for the degree of DOCTOR OF PHILOSOPHY Approved by: Co-Chairs of Committee, A. Ted Watson John C. Slattery Committee Members, Randall L. Eubank David M. Ford Michael A. Bevan Head of Department, Kenneth R... Co?Chairs of Advisory Committee: Dr. A. Ted Watson Dr. John C. Slattery Advanced nuclear magnetic resonance (NMR) imaging methodologies have been developed to determine porous media properties associated with fluid flow pro- cesses. This dissertation...

Uh, Jinsoo

2007-04-25T23:59:59.000Z

22

Developing improved nuclear magnetic resonance marginal oscillator spectrometers for advanced teaching laboratories  

E-Print Network (OSTI)

DEVELOPING IMPROVED NUCLEAR MAGNETIC RESONANCE MARGINAL OSCILLATOR SPECTROMETERS FOR ADVANCED TEACHING LABORATORIES A Thesis by FRANK PHILLIP WILLINGHAM Submitted to the Office of Graduate Studies of Texas ASM University in partial... fulfillment of the requirements for the degree of MASTER OF SCIENCE D e cemb er 1988 Major Subject: Physics DEVELOPING IMPROVED NUCLEAR MAGNETIC RESONANCE MARGINAL OSCILLATOR SPECTROMETERS FOR ADVANCED TEACHING LABORATORIES A Thesis by FRANK PHILLIP...

Willingham, Frank Phillip

1988-01-01T23:59:59.000Z

23

Determining the minimum mass and cost of a magnetic refrigerator  

E-Print Network (OSTI)

An expression is determined for the mass of the magnet and magnetocaloric material needed for a magnetic refrigerator and these are determined using numerical modeling for both parallel plate and packed sphere bed regenerators as function of temperature span and cooling power. As magnetocaloric material Gd or a model material with a constant adiabatic temperature change, representing a infinitely linearly graded refrigeration device, is used. For the magnet a maximum figure of merit magnet or a Halbach cylinder is used. For a cost of \\$40 and \\$20 per kg for the magnet and magnetocaloric material, respectively, the cheapest 100 W parallel plate refrigerator with a temperature span of 20 K using Gd and a Halbach magnet has 0.8 kg of magnet, 0.3 kg of Gd and a cost of \\$35. Using the constant material reduces this cost to \\$25. A packed sphere bed refrigerator with the constant material costs \\$7. It is also shown that increasing the operation frequency reduces the cost. Finally, the lowest cost is also found a...

Bjrk, R; Bahl, C R H; Pryds, N

2014-01-01T23:59:59.000Z

24

Advanced measurements and techniques in high magnetic fields  

SciTech Connect

This is the final report of a one-year, Laboratory-Directed Research and Development (LDRD) project at the Los Alamos National Laboratory (LANL). High magnetic fields present a unique environment for studying the electronic structure of materials. Two classes of materials were chosen for experiments at the national high Magnetic Field Laboratory at Los Alamos: highly correlated electron systems and semiconductors. Magnetotransport and thermodynamic experiments were performed on the renormalized ground states of highly correlated electron systems (such as heavy fermion materials and Kondo insulators) in the presence of magnetic fields that are large enough to disrupt the many-body correlations. A variety of optical measurements in high magnetic fields were performed on semiconductor heterostructures including GaAs/AlGaAs single heterojunctions (HEMT structure), coupled double quantum wells (CDQW), asymmetric coupled double quantum wells (ACDQW), multiple quantum wells and a CdTe single crystal thin film.

Campbell, L.J.; Rickel, D.G. [Los Alamos National Lab., NM (United States); Lacerda, A.H. [Florida State Univ., Tallahassee, FL (United States); Kim, Y. [Northeastern Univ., Boston, MA (United States)

1997-07-01T23:59:59.000Z

25

Determining the exchange parameters of spin-1 metal-organic molecular magnets in pulsed magnetic fields  

SciTech Connect

We nave measured the high-field magnetization of a number of Ni-based metal-organic molecular magnets. These materials are self-assembly coordination polymers formed from transition metal ions and organic ligands. The chemistry of the compounds is versatile allowing many structures with different magnetic properties to be formed. These studies follow on from previous measurements of the Cu-based analogues in which we showed it was possible to extract the exchange parameters of low-dimensional magnets using pulsed magnetic fields. In our recent experiments we have investigated the compound (Ni(HF{sub 2})(pyz){sub 2})PF{sub 6}, where pyz = pyrazine, and the Ni-ions are linked in a quasi-two-dimensional (Q2D) square lattice via the pyrazine molecules, with the layers held together by HF{sub 2} ligands. We also investigated Ni(NCS){sub 2}(pyzdo){sub 2}, where pyzdo = pyrazine dioxide. The samples are grown at Eastern Washington University using techniques described elsewhere. Measurements are performed at the pulsed magnetic field laboratory in Los Alamos. The magnetization of powdered samples is determined using a compensated coil magnetometer in a 65 T short pulse magnet. Temperatures as low as 500 mK are achievable using a {sup 3}He cryostat. The main figure shows the magnetization of the spin-1 [Ni(HF{sub 2})(pyz){sub 2}]PF{sub 6} compound at 1.43 K. The magnetization rises slowly at first, achieving a rounded saturation whose midpoint is around 19 T. A small anomaly is also seen in the susceptibility at low fields ({approx}3 T), which might be attributed to a spin-flop transition. In contrast, the spin-1/2 [Cu(HF{sub 2})(pyz){sub 2}]PF{sub 6} measured previously has a saturation magnetization of 35.5 T and a strongly concave form of M(B) below this field. This latter compound was shown to be a good example of a Q2D Heisenberg antiferromagnet with the strong exchange coupling (J{sub 2D} = 12.4 K, J{sub {perpendicular}}/J{sub 2D} {approx} 10{sup -2}) directed along the Cu-pyz-Cu directions. The structure of the two compounds is similar, but in the case of the Cu-compound the Cu-Cu pathways are linear, whereas in the Ni-compound they are kinked. The pulsed-field data combined with information from temperature-dependent susceptibility, muon-spin rotation, electron-spin resonance and ligand-field calculations suggest that, far from being magnetically Q2D, the Ni-compound is fairly one-dimensional with the dominant exchange (J{sub 1D} = 3.1 K and J{sub {perpendicular}}/J{sub 1D} = 0.63) directed along the Ni-FHF-Ni direction. Ni(NCS){sub 2}(pyzdo){sub 2} was also investigated. Previous ultra-high field measurements using the 100 T magnet have shown that this compound has a saturation field close to 80 T. The purpose of the present studies is to map out the phase diagram of this material at mid-range fields. The data are shown in the inset to the figure. This continuing project probes the ability of organic ligands to mediate magnetic exchange, the link between structure, dimensionality and bulk magnetic properties, as well as the role of spin number in quantum magnets. Ultimately the investigations aim to determine to what extent it is possible to produce self-assembly molecular materials with tailor-made magnetic characteristics.

Mcdonald, Ross D [Los Alamos National Laboratory; Singleton, John [Los Alamos National Laboratory; Lancaster, Tom [OXFORD UNIV.; Goddard, Paul [OXFORD UNIV.; Manson, Jamie [EASTERN WASHINGTON UNIV.

2011-01-14T23:59:59.000Z

26

X-ray Holograms Expose Secret Magnetism | Advanced Photon Source  

NLE Websites -- All DOE Office Websites (Extended Search)

How Dissolved Metal Ions Interact in Solution How Dissolved Metal Ions Interact in Solution One Giant Leap for Radiation Biology? What's in the Cage Matters in Iron Antimonide Thermoelectric Materials Novel Experiments on Cement Yield Concrete Results Watching a Glycine Riboswitch "Switch" Science Highlights Archives: 2013 | 2012 | 2011 | 2010 2009 | 2008 | 2007 | 2006 2005 | 2004 | 2003 | 2002 2001 | 2000 | 1998 | Subscribe to APS Science Highlights rss feed X-ray Holograms Expose Secret Magnetism MAY 11, 2007 Bookmark and Share By observing changes in coherent x-ray speckle pattern, such as the one shown above, researchers are able for the first time to investigate nanoscale dynamics of antiferromagnetic domain walls, and observe a cross over from classical to quantum behavior. (Credit: O. Shpyrko)

27

Lattice Determination of the Anomalous Magnetic Moment of the Muon  

E-Print Network (OSTI)

We compute the leading hadronic contribution to the anomalous magnetic moment of the muon a_mu^HLO using two dynamical flavours of non-perturbatively O(a) improved Wilson fermions. By applying partially twisted boundary conditions we are able to improve the momentum resolution of the vacuum polarisation, an important ingredient for the determination of the leading hadronic contribution. We check systematic uncertainties by studying several ensembles, which allows us to discuss finite size effects and lattice artefacts. The chiral behavior of a_mu^HLO turns out to be non-trivial, especially for small pion masses.

Michele Della Morte; Benjamin Jger; Andreas Jttner; Hartmut Wittig

2011-11-09T23:59:59.000Z

28

Argonne National Laboratory Partners with Advanced Magnet Lab to Develop First Fully Superconducting Direct-Drive Generator  

Energy.gov (U.S. Department of Energy (DOE))

The Department of Energy (DOE) Argonne National Laboratory (ANL) is partnering with Advanced Magnet Lab, in Palm Bay, Florida, on one of six projects recently awarded by DOE to help develop next generation wind turbines and accelerate the deployment of advanced turbines for offshore wind energy in the United States.

29

New chicane magnet design for insertion device straights at the Advanced Light Source  

SciTech Connect

A chicane magnet incorporating counter-rotating permanent magnet pairs together with trim coils has been designed for use in the Advanced Light Source (ALS) straights in conjunction with two insertion devices. In particular, this design is being developed for use in the existing beam line (BL) 4 elliptically polarizing undulator (EPU) straight and in the BL11 EPU straight, currently under design and construction. The purpose of the chicane is to provide a fixed angular separation between two successive EPU photon fans, and to correct steering perturbations resulting from EPU polarization state changes. Polarization changes occur on the time scale of one second; associated steering corrections must be accomplished in less than a second. Hysteresis associated with conventional iron core electromagnets prevents fast steering correction to the required precision. This consideration motivated the iron-free design presented here.

Marks, Steve; Schlueter, Ross; Anderson, David; Gath, William; Jung, Jin-Young; Robin, David; Steier, Christoph; Stevens, Troy

2001-12-10T23:59:59.000Z

30

Categorical Exclusion Determination Form Program or Field Office: Advanced Research Projects Agency -  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

nt of n y nt of n y Categorical Exclusion Determination Form Program or Field Office: Advanced Research Projects Agency - Energy Project Title: (0471-1508) NAVITASMAX - Novel Tuning of Critical Fluctuations for Advanced Thermal Energy Storage Location: *- Multiple States - Arizona, Massachusetts, New York, Colorado Proposed Action or Project Description: American Recovery and Reinvestment Act: D Funding will support a proof-of-concept project that evaluates and optimizes simple and complex supercritical fluids for use as novel heat storage, transfer, and working fluids in solar and nuclear applications. Proposed work consists of indoor laboratory-based research and development (R&D), modeling, and analysis, including (1) developing theoretical models to explore inhomogeneities and heat capacity anomalies in supercritical fluids, and prove potential to increase heat capacity over ranges of

31

Determination of Topology Skeleton of Magnetic Fields in a Solar Active Region  

E-Print Network (OSTI)

The knowledge of magnetic topology is the key to understand magnetic energy release in astrophysics. Based on observed vector magnetograms, we have determined threedimensional (3D) topology skeleton of the magnetic fields in active region NOAA 10720. The skeleton consists of six 3D magnetic nulls and a network of corresponding spines, fans, and null-null lines. For the first time, we have identified a spiral magnetic null in Sun's corona. The magnetic lines of force twisted around the spine of the null, forming a 'magnetic wreath' with excess of free magnetic energy and resembling observed brightening structures at extraultraviolet (EUV) wavebands. We found clear evidence of topology eruptions which are referred to as the catastrophic changes of topology skeleton associated with a coronal mass ejection (CME) and an explosive X-ray flare. These results shed new lights in exploring the structural complexity and its role in explosive magnetic activity. In solar astrophysics and space science, the concept of flux rope has been widely used in modelling explosive magnetic activity, although their observational identity is obscure or, at least, lacking of necessary details. The current work suggests that the magnetic wreath associated with the 3D spiral null is likely an important class of the physical entity of flux ropes.

Hui Zhao; Jing-Xiu Wang; Jun Zhang; Chi-Jie Xiao; Hai-Min Wang

2007-12-20T23:59:59.000Z

32

Advances in surface magnetic field measurement technique for detection and sizing of surface-breaking cracks in offshore structures  

SciTech Connect

In detecting and sizing cracks in metal structures, the two common techniques of eddy-current and potential-drop, suffer from a number of problems which may not be acceptable in offshore environments. This paper describes recent advances in the surface magnetic field measurement (SMFM) technique as an alternative method for integrity evaluation of offshore metal structures.

Mirshekar-Syahkal, D. [Univ. of Essex, Colchester (United Kingdom); Sadeghi, S.H.H. [Amirkabir Univ., Tehran (Iran, Islamic Republic of)

1994-12-31T23:59:59.000Z

33

Application of polarized neutron reflectometry and X-ray resonant magnetic reflectometry for determining the inhomogeneous magnetic structure in Fe/Gd multilayers  

Science Journals Connector (OSTI)

The evolution of the magnetic structure of multilayer [Fe (35 )/Gd (50 )5...] with variation in temperature and an applied magnetic field was determined using a complementary approach combining polarized neutron

E. A. Kravtsov; D. Haskel

2010-10-01T23:59:59.000Z

34

A NATIONAL COLLABORATORY TO ADVANCE THE SCIENCE OF HIGH TEMPERATURE PLASMA PHYSICS FOR MAGNETIC FUSION  

SciTech Connect

This report summarizes the work of the University of Utah, which was a member of the National Fusion Collaboratory (NFC) Project funded by the United States Department of Energy (DOE) under the Scientific Discovery through Advanced Computing Program (SciDAC) to develop a persistent infrastructure to enable scientific collaboration for magnetic fusion research. A five year project that was initiated in 2001, it the NFC built on the past collaborative work performed within the U.S. fusion community and added the component of computer science research done with the USDOE Office of Science, Office of Advanced Scientific Computer Research. The project was itself a collaboration, itself uniting fusion scientists from General Atomics, MIT, and PPPL and computer scientists from ANL, LBNL, and Princeton University, and the University of Utah to form a coordinated team. The group leveraged existing computer science technology where possible and extended or created new capabilities where required. The complete finial report is attached as an addendum. The In the collaboration, the primary technical responsibility of the University of Utah in the collaboration was to develop and deploy an advanced scientific visualization service. To achieve this goal, the SCIRun Problem Solving Environment (PSE) is used on FusionGrid for an advanced scientific visualization service. SCIRun is open source software that gives the user the ability to create complex 3D visualizations and 2D graphics. This capability allows for the exploration of complex simulation results and the comparison of simulation and experimental data. SCIRun on FusionGrid gives the scientist a no-license-cost visualization capability that rivals present day commercial visualization packages. To accelerate the usage of SCIRun within the fusion community, a stand-alone application built on top of SCIRun was developed and deployed. This application, FusionViewer, allows users who are unfamiliar with SCIRun to quickly create visualizations and perform analysis of their simulation data from either the MDSplus data storage environment or from locally stored HDF5 files. More advanced tools for visualization and analysis also were created in collaboration with the SciDAC Center for Extended MHD Modeling. Versions of SCIRun with the FusionViewer have been made available to fusion scientists on the Mac OS X, Linux, and other Unix based platforms and have been downloaded 1163 times. SCIRun has been used with NIMROD, M3D, BOUT fusion simulation data as well as simulation data from other SciDAC application areas (e.g., Astrophysics). The subsequent visualization results - including animations - have been incorporated into invited talks at multiple APS/DPP meetings as well as peer reviewed journal articles. As an example, SCIRun was used for the visualization and analysis of a NIMROD simulation of a disruption that occurred in a DIII-D experiment. The resulting animations and stills were presented as part of invited talks at APS/DPP meetings and the SC04 conference in addition to being highlighted in the NIH/NSF Visualization Research Challenges Report. By achieving its technical goals, the University of Utah played a key role in the successful development of a persistent infrastructure to enable scientific collaboration for magnetic fusion research. Many of the visualization tools developed as part of the NFC continue to be used by Fusion and other SciDAC application scientists and are currently being supported and expanded through follow-on up on SciDAC projects (Visualization and Analytics Center for Enabling Technology, and the Visualization and Analysis in Support of Fusion SAP).

Allen R. Sanderson; Christopher R. Johnson

2006-08-01T23:59:59.000Z

35

Categorical Exclusion Determination Form Program or Field Office: Advanced Research Projects Agency -  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Department of Energy Department of Energy Categorical Exclusion Determination Form Program or Field Office: Advanced Research Projects Agency - Energy Project Title: (0207-1609) Planar Energy - Solid-State All Inorganic Rechargeable Lithium Batteries Location: Florida Proposed Action or Project Description: American Recover), and Reinvestment Act: ~ Funding will support laboratory, bench scale, and pilot scale research and development on lithium battery manufacturing processes for use in electrical energy storage for transportation. Categorical Exclusion(s) Applied: x ~ 83.6 Sitinglconstruct1onJoperationldecommlssloning of facilities for bench-scale research, conventional laboratory operations, smalJ..scale research and development and pilot projects *-For the complete DOE National Environmental Policy Act regulations regarding categorical exclusions, see Subpart D of to CFRIO 21 £::lli:klkrc

36

Categorical Exclusion Determination Form Program or Field Office: Advanced Research Projects Agency -  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

nergy nergy Categorical Exclusion Determination Form Program or Field Office: Advanced Research Projects Agency - Energy Project Title: (0471-1544) Sheetak Inc. - Thermoelectric Reactors for Efficient Automotive Thermal Storage Location: *- Multiple States - New York, Pennsylvania, Texas Proposed Action or Project Description: American Recovery and Reinvestment Act: D Funding will support development of a novel system of thermoelectric reactors for efficient automotive thermal energy storage (TREATS) in electric vehicle and plug-in hybrid electric vehicle Heating, Ventilation, and Cooling (HVAC) systems. Proposed work consists of indoor laboratory-based research and development, including (1) experimentation and analysis to assess the mechanics and dynamics of thermoelectric reactors, (2) design, fabrication, testing, and analysis of hot and cold reactors, (3) design, fabrication, testing, and

37

E-Print Network 3.0 - advanced magnetic resonance Sample Search...  

NLE Websites -- All DOE Office Websites (Extended Search)

(Namikawa, 1985; Gibbs, 1988) channels. These include studies... weak, synchrotron radiation brightness, together with resonant ... Source: Haskel, Daniel - Advanced Photon...

38

Magnetic poly(?-caprolactone)/iron-doped hydroxyapatite nanocomposite substrates for advanced bone tissue engineering  

Science Journals Connector (OSTI)

...Italy 3 International Iberian Nanotechnology Laboratory (INL), , Braga...transduction, describing a magnetic nanotechnology that activates a biochemical...engineering and regenerative medicine [34]. Magnetically actuable...the field of regenerative medicine [38]. A superparamagnetic-like...

2013-01-01T23:59:59.000Z

39

Application of polarized neutron reflectometry and x-ray resonant magnetic reflectometry for determining the inhomogeneous magnetic structure in Fe/Gd multilayers.  

SciTech Connect

The evolution of the magnetic structure of multilayer [Fe (35 {angstrom})/Gd (50 {angstrom}){sub 5}] with variation in temperature and an applied magnetic field was determined using a complementary approach combining polarized neutron and X-ray resonant magnetic reflectometry. Self-consistent simultaneous analysis of X-ray and neutron spectra allowed us to determine the elemental and depth profiles in the multilayer structure with unprecedented accuracy, including the identification of an inhomogeneous intralayer magnetic structure with near-atomic resolution.

Kravtsov, E. A.; Haskel, D.; te Velthuis, S. G. E.; Jiang, J. S.; Kirby, B. J. (Materials Science Division); ( XSD); (Russian Academy of Sciences and Ural Federal Univ.); (Ural State Technical Univ.); (NIST Center for Neutron Research)

2010-01-01T23:59:59.000Z

40

Light weight, high field, stable, superconducting magnets for advanced transportation systems  

SciTech Connect

Although the Guideway may be the most expensive component of a MAGLEV system, the importance of a suitable magnet system should not be underestimated. The reliability of operation of MAGLEV depends on the superconducting magnets performing to their specifications in a reliable manner (i.e., without training or quenching). Besides reliability the magnets should produce high field, be sufficiently stable to withstand reasonable perturbations, be light weight, be protected in the event of a quench, and be economical (although performance should outweigh cost). We propose to develop superconducting magnets that have these features. Our magnet designs are based on internally cooled, cable-in-conduit superconductor with Polymer Matrix Composites (PMC) as the structural reinforcement. Although the initial work is with metallic superconductors such as NbTi, the processes being developed will be applicable to the High Temperature Ceramic Superconductors when they become suitable for magnet applications.

Lubell, M.S.; Dresner, L.; Kenney, W.J.; Lue, J.W.; Luton, J.N.; Schwenterly, S.W.

1991-01-01T23:59:59.000Z

Note: This page contains sample records for the topic "determination advanced magnetic" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


41

Final Scientific/Technical Report for DOE/EERE project Advanced Magnetic Refrigerant Materials  

SciTech Connect

A team led by GE Global Research developed new magnetic refrigerant materials needed to enhance the commercialization potential of residential appliances such as refrigerators and air conditioners based on the magnetocaloric effect (a nonvapor compression cooling cycle). The new magnetic refrigerant materials have potentially better performance at lower cost than existing materials, increasing technology readiness level. The performance target of the new magnetocaloric material was to reduce the magnetic field needed to achieve 4 C adiabatic temperature change from 1.5 Tesla to 0.75 Tesla. Such a reduction in field minimizes the cost of the magnet assembly needed for a magnetic refrigerator. Such a reduction in magnet assembly cost is crucial to achieving commercialization of magnetic refrigerator technology. This project was organized as an iterative alloy development effort with a parallel material modeling task being performed at George Washington University. Four families of novel magnetocaloric alloys were identified, screened, and assessed for their performance potential in a magnetic refrigeration cycle. Compositions from three of the alloy families were manufactured into regenerator components. At the beginning of the project a previously studied magnetocaloric alloy was selected for manufacturing into the first regenerator component. Each of the regenerators was tested in magnetic refrigerator prototypes at a subcontractor at at GE Appliances. The property targets for operating temperature range, operating temperature control, magnetic field sensitivity, and corrosion resistance were met. The targets for adiabatic temperature change and thermal hysteresis were not met. The high thermal hysteresis also prevented the regenerator components from displaying measurable cooling power when tested in prototype magnetic refrigerators. Magnetic refrigerant alloy compositions that were predicted to have low hysteresis were not attainable with conventional alloy processing methods. Preliminary experiments with rapid solidification methods showed a path towards attaining low hysteresis compositions should this alloy development effort be continued.

Johnson, Francis

2014-06-30T23:59:59.000Z

42

Probing Spin Liquids with a New Pulsed-Magnet System | Advanced Photon  

NLE Websites -- All DOE Office Websites (Extended Search)

a Magnetic Moment in a Split Picosecond a Magnetic Moment in a Split Picosecond Unpeeling Atoms and Molecules from the Inside Out Butterfly Wing Yields Clues to Light-Altering Structures Squeezing Information from Materials under Extreme Pressure Quick-Change Molecules Caught in the Act Science Highlights Archives: 2013 | 2012 | 2011 | 2010 2009 | 2008 | 2007 | 2006 2005 | 2004 | 2003 | 2002 2001 | 2000 | 1998 | Subscribe to APS Science Highlights rss feed Probing Spin Liquids with a New Pulsed-Magnet System AUGUST 26, 2010 Bookmark and Share The (008) intensity color map on a θ vs. 2θ mesh. With increasing magnetic field the peak splits at a critical field of H ~29 T, which is a hallmark of a structural phase transition with a reduction from cubic to tetragonal or orthorhombic symmetry. Above the critical field,

43

E-Print Network 3.0 - advanced magnetic materials Sample Search...  

NLE Websites -- All DOE Office Websites (Extended Search)

B. ParkerJ. Cozzolino S. Peggs... W. Louie E. WillenJ. Muratore 12;Construction and Test of the Magnetic Mirror Model of the HTS RIA Source: Gupta, Ramesh - Superconducting...

44

High-precision determination of the electric and magnetic form factors of the proton  

E-Print Network (OSTI)

New precise results of a measurement of the elastic electron-proton scattering cross section performed at the Mainz Microtron MAMI are presented. About 1400 cross sections were measured with negative four-momentum transfers squared up to Q^2=1 (GeV/c)^2 with statistical errors below 0.2%. The electric and magnetic form factors of the proton were extracted by fits of a large variety of form factor models directly to the cross sections. The form factors show some features at the scale of the pion cloud. The charge and magnetic radii are determined to be r_E=0.879(5)(stat.)(4)(syst.)(2)(model)(4)(group) fm and r_M=0.777(13)(stat.)(9)(syst.)(5)(model)(2)(group) fm.

J. C. Bernauer; P. Achenbach; C. Ayerbe Gayoso; R. Bhm; D. Bosnar; L. Debenjak; M. O. Distler; L. Doria; A. Esser; H. Fonvieille; J. M. Friedrich; J. Friedrich; M. Gmez Rodrguez de la Paz; M. Makek; H. Merkel; D. G. Middleton; U. Mller; L. Nungesser; J. Pochodzalla; M. Potokar; S. Snchez Majos; B. S. Schlimme; S. irca; Th. Walcher; M. Weinriefer

2010-07-28T23:59:59.000Z

45

Re-analysis of Magic Angle Spinning Nuclear Magnetic Resonance Determination of Interlamellar Waters in Lipid Bilayer Dispersions  

E-Print Network (OSTI)

Re-analysis of Magic Angle Spinning Nuclear Magnetic Resonance Determination of Interlamellar Waters in Lipid Bilayer Dispersions John F. Nagle,*# Yufeng Liu,* Stephanie Tristram-Nagle,# Richard M of multilamellar lipid vesicles using magic angle spinning nuclear magnetic resonance has been re

Nagle, John F.

46

Solid state nuclear magnetic resonance methodology and applications to structure determination of peptides, proteins and amyloid fibrils  

E-Print Network (OSTI)

Several methodological developments and applications of multidimensional solid-state nuclear magnetic resonance to biomolecular structure determination are presented. Studies are performed in uniformly 3C, 15N isotope ...

Jaroniec, Christopher P

2003-01-01T23:59:59.000Z

47

Site-Selective Determination of Magnetic Helices in BaTiCoFe{sub 10}O{sub 19} by Resonant Magnetic Scattering  

SciTech Connect

Synchrotron radiation intensity measurements were made for single crystals of ferrimagnetic BaTiCoFe{sub 10}O{sub 19} at the BL-6C(3A) beamline of the Photon Factory. The resonant x-ray magnetic scattering (RXMS) method at the Fe K edge makes it possible to determine the magnetic crystal structure, having the magnetic helices for Fe ions in tetrahedral 4f{sub 1}, bipyramidal 2b, and octahedral 2a, 4f{sub 2} and 12k sites. Based on the information on x-ray magnetic circular dichroism (XMCD) and a resonant magnetic scattering factor f''{sub m} ( = 0.23) estimated from BaFe{sub 12}O{sub 19} at E = 7128.2 eV, the magnetic structures have been determined from an asymmetrical ratio {Delta}R (Y{sup +}-Y{sup -})/(Y{sup +}+Y{sup -}), where Y{sup +} and Y{sup -} are scattering intensities for left- and right-circular polarizations, respectively. Spin orientations were estimated in the least-squares procedure to minimize a residual factor of {Sigma}({Delta}R{sub obs}-{Delta}R{sub calc}){sup 2}. The canting angles estimated in this study are 180 deg., 19 deg., 118 deg., 180 deg. and 65 deg. for the magnetic moments of Fe ions in 4f{sub 1}, 2b, 2a, 4f{sub 2} and 12k sites, respectively.

Okube, Maki; Kaneko, Yuhei; Ohsawa, Seiji; Sasaki, Satoshi [Materials and Structures Laboratory, Tokyo Institute of Technology, Nagatsuta 4259, Yokohama 226-8503 (Japan); Toyoda, Takeshi [Industrial Research Institute of Ishikawa, Kuratsuki 2-1, Kanazawa 920-8203 (Japan); Mori, Takeharu [Photon Factory, Institute of Materials Structure Science, KEK, Oho 1-1, Tsukuba 305-0801 (Japan)

2010-06-23T23:59:59.000Z

48

Magnetism  

Science Journals Connector (OSTI)

Historically, magnetism is related to rock magnetism, due to a few minerals exhibiting spontaneous magnetization. Attractive properties of magnetite were already known in Antiquity and were used for navigation...

Guillaume Morin

1998-01-01T23:59:59.000Z

49

magnetism  

Science Journals Connector (OSTI)

magnetism [A class of physical phenomena associated with moving electricity, including the mutual mechanical forces among magnets and electric currents] ? Magnetismus m

2014-08-01T23:59:59.000Z

50

Vital Alert's C1000 mine and tunnel radios use magnetic induction, advanced  

NLE Websites -- All DOE Office Websites (Extended Search)

Millions in cost reduction and advantageous diaper products result Millions in cost reduction and advantageous diaper products result from LANL projects Millions in cost reduction and advantageous diaper products result from LANL projects LANL technology successfully optimized diaper manufacturing and manufacturing design, permitting Laboratory scientists to validate and expand the capabilities of the software. April 3, 2012 Technology to successfully optimize diaper manufacturing and manufacturing design allows LANL scientists to validate and expand the capabilities of the software. Technology to successfully optimize diaper manufacturing and manufacturing design allows LANL scientists to validate and expand the capabilities of the software. CFDLib is now available to U.S. industry as part of President Barack Obama's recently announced advanced manufacturing initiative

51

Making a Magnetic Moment in a Split Picosecond | Advanced Photon Source  

NLE Websites -- All DOE Office Websites (Extended Search)

Unpeeling Atoms and Molecules from the Inside Out Unpeeling Atoms and Molecules from the Inside Out Butterfly Wing Yields Clues to Light-Altering Structures Squeezing Information from Materials under Extreme Pressure Quick-Change Molecules Caught in the Act The Molecular Mechanics of Hearing and Deafness Science Highlights Archives: 2013 | 2012 | 2011 | 2010 2009 | 2008 | 2007 | 2006 2005 | 2004 | 2003 | 2002 2001 | 2000 | 1998 | Subscribe to APS Science Highlights rss feed Making a Magnetic Moment in a Split Picosecond JULY 1, 2010 Bookmark and Share Michel van Veenendaal (left) and Jun Chang in van Veenendaal's office at the APS, discussing figure 3 from their Physical Review Letters article, "Model of Ultrafast Intersystem Crossing in Photoexcited Transition-Metal Organic Compounds." A wide range of phenomena in nature and technology depend on changes that

52

MCAMC: An Advanced Algorithm for Kinetic Monte Carlo Simulations: from Magnetization Switching to Protein Folding  

E-Print Network (OSTI)

We present the Monte Carlo with Absorbing Markov Chains (MCAMC) method for extremely long kinetic Monte Carlo simulations. The MCAMC algorithm does not modify the system dynamics. It is extremely useful for models with discrete state spaces when low-temperature simulations are desired. To illustrate the strengths and limitations of this algorithm we introduce a simple model involving random walkers on an energy landscape. This simple model has some of the characteristics of protein folding and could also be experimentally realizable in domain motion in nanoscale magnets. We find that even the simplest MCAMC algorithm can speed up calculations by many orders of magnitude. More complicated MCAMC simulations can gain further increases in speed by orders of magnitude.

M. A. Novotny; Shannon M. Wheeler

2002-11-02T23:59:59.000Z

53

Coronal magnetic field and the plasma beta determined from radio and multiple satellite observations  

E-Print Network (OSTI)

We derived the coronal magnetic field, plasma density, and temperature from the observation of polarization and intensity of radio thermal free-free emission using the Nobeyama Radioheliograph (NoRH) and extreme ultraviolet (EUV) observations. We observed a post-flare loop on the west limb 11 April 2013. The line-of-sight magnetic field was derived from the circularly polarized free-free emission observed by NoRH. The emission measure and temperature were derived from the Atmospheric Imaging Assembly (AIA) onboard Solar Dynamics Observatory (SDO). The derived temperature was used to estimate the emission measure from the NoRH radio free-free emission observations. The derived density from NoRH was larger than that determined using AIA, which can be explained by the fact that the low temperature plasma is not within the temperature coverage of the AIA filters used in this study. We also discuss the other observation of the post-flare loops by the EUV Imager onboard the Solar Terrestrial Relations Observatory (...

Iwai, Kazumasa; Nozawa, Satoshi; Takahashi, Takuya; Sawada, Shinpei; Kitagawa, Jun; Miyawaki, Shun; Kashiwagi, Hirotaka

2014-01-01T23:59:59.000Z

54

Rapid determination of sugar content in biomass hydrolysates using nuclear magnetic resonance spectroscopy  

NLE Websites -- All DOE Office Websites (Extended Search)

Biofuels and Environmental Biotechnology Biotechnology and Bioengineering Biofuels and Environmental Biotechnology Biotechnology and Bioengineering DOI 10.1002/bit.24741 Rapid determination of sugar content in biomass hydrolysates using nuclear magnetic resonance spectroscopy † Erica Gjersing*, Renee M. Happs, Robert W. Sykes, Crissa Doeppke, and Mark F. Davis National Bioenergy Center, National Renewable Energy Laboratory, 1617 Cole Blvd., Golden, CO 80401 *Address correspondence to: Erica.Gjersing@nrel.gov; phone: 303-384-7984; fax: 303-384- 6363 Key Words: hydrolysate, Partial Least Squares, 1H NMR, PLS regression † This article has been accepted for publication and undergone full peer review but has not been through the copyediting, typesetting, pagination and proofreading process, which may lead to

55

Magnetism  

Science Journals Connector (OSTI)

... dipoles in applied fields". It deals with the classical (Langevin) theory of para-magnetism, anisotropy fields and magnetic measurements. In the next chapter "Atomic structure" the author ... special relevance to ferrites and the inclusion of a quite lengthy discussion of Pauli para-magnetism and of Stoner's treatment of itinerant electron ferromagnetism, though it does much to ...

E. W. LEE

1972-03-31T23:59:59.000Z

56

10 CFR 830 Major Modification Determination for Advanced Test Reactor RDAS and LPCIS Replacement  

SciTech Connect

The replacement of the ATR Control Complex's obsolete computer based Reactor Data Acquisition System (RDAS) and its safety-related Lobe Power Calculation and Indication System (LPCIS) software application is vitally important to ensure the ATR remains available to support this national mission. The RDAS supports safe operation of the reactor by providing 'real-time' plant status information (indications and alarms) for use by the reactor operators via the Console Display System (CDS). The RDAS is a computer support system that acquires analog and digital information from various reactor and reactor support systems. The RDAS information is used to display quadrant and lobe powers via a display interface more user friendly than that provided by the recorders and the Control Room upright panels. RDAS provides input to the Nuclear Engineering ATR Surveillance Data System (ASUDAS) for fuel burn-up analysis and the production of cycle data for experiment sponsors and the generation of the Core Safety Assurance Package (CSAP). RDAS also archives and provides for retrieval of historical plant data which may be used for event reconstruction, data analysis, training and safety analysis. The RDAS, LPCIS and ASUDAS need to be replaced with state-of-the-art technology in order to eliminate problems of aged computer systems, and difficulty in obtaining software upgrades, spare parts, and technical support. The major modification criteria evaluation of the project design did not lead to the conclusion that the project is a major modification. The negative major modification determination is driven by the fact that the project requires a one-for-one equivalent replacement of existing systems that protects and maintains functional and operational requirements as credited in the safety basis.

David E. Korns

2012-05-01T23:59:59.000Z

57

A FEASIBILITY AND OPTIMIZATION STUDY TO DETERMINE COOLING TIME AND BURNUP OF ADVANCED TEST REACTOR FUELS USING A NONDESTRUCTIVE TECHNIQUE  

SciTech Connect

The goal of this study presented is to determine the best available non-destructive technique necessary to collect validation data as well as to determine burn-up and cooling time of the fuel elements onsite at the Advanced Test Reactor (ATR) canal. This study makes a recommendation of the viability of implementing a permanent fuel scanning system at the ATR canal and leads3 to the full design of a permanent fuel scan system. The study consisted at first in determining if it was possible and which equipment was necessary to collect useful spectra from ATR fuel elements at the canal adjacent to the reactor. Once it was establish that useful spectra can be obtained at the ATR canal the next step was to determine which detector and which configuration was better suited to predict burnup and cooling time of fuel elements non-destructively. Three different detectors of High Purity Germanium (HPGe), Lanthanum Bromide (LaBr3), and High Pressure Xenon (HPXe) in two system configurations of above and below the water pool were used during the study. The data collected and analyzed was used to create burnup and cooling time calibration prediction curves for ATR fuel. The next stage of the study was to determine which of the three detectors tested was better suited for the permanent system. From spectra taken and the calibration curves obtained, it was determined that although the HPGe detector yielded better results, a detector that could better withstand the harsh environment of the ATR canal was needed. The in-situ nature of the measurements required a rugged fuel scanning system, low in maintenance and easy to control system. Based on the ATR canal feasibility measurements and calibration results it was determined that the LaBr3 detector was the best alternative for canal in-situ measurements; however in order to enhance the quality of the spectra collected using this scintillator a deconvolution method was developed. Following the development of the deconvolution method for ATR applications the technique was tested using one-isotope, multi-isotope and fuel simulated sources. Burnup calibrations were perfomed using convoluted and deconvoluted data. The calibrations results showed burnup prediction by this method improves using deconvolution. The final stage of the deconvolution method development was to perform an irradiation experiment in order to create a surrogate fuel source to test the deconvolution method using experimental data. A conceptual design of the fuel scan system is path forward using the rugged LaBr3 detector in an above the water configuration and deconvolution algorithms.

Jorge Navarro

2013-12-01T23:59:59.000Z

58

Magnetism  

Science Journals Connector (OSTI)

... THIS is a good book, and we are glad to see the subject of magnetism fully treated in a popularly written text-book. It is a second edition of ... of importance, accuracy, and exhaustiveness, places the present treatise, as far as terrestrial magnetism is concerned, much before any similar book with which we are acquainted. The correction ...

JAMES STUART

1872-03-07T23:59:59.000Z

59

Magneto-optical granulometry: on the determination of the statistics of magnetically induced particle chains in concentrated ferrofluids from linear dichroism experiments  

E-Print Network (OSTI)

An analytical theoretical model for the influence of the magnetically induced nanoparticle chaining on the linear dichroism in ferrofluids was developed. The model is based on a statistical theory for magnetic nanoparticle chaining in ferrofluids. Together with appropriate experimental approach and data processing strategy, the model grounds a magneto-optical granulometry method able to determine the magnetic field dependence of the statistics of magnetically induced particle chains in concentrated ferrofluids.

V. Socoliuc; L. B. Popescu

2014-10-09T23:59:59.000Z

60

Determination of the Multipolarity of Nuclear Electromagnetic Transitions Using a Magnetic Pair Spectrometer  

Science Journals Connector (OSTI)

An intermediate-image magnetic pair spectrometer has been modified so as to respond to positron-electron internal pairs emitted at large relative angles (50???90) thereby making the pair-line transmission depend sensitively on the multipolarity of electromagnetic transitions above 2 MeV. The modification consists of a specially designed spiral baffle system which selects pairs emitted within 105 azimuthal sectors on opposite sides of the axis. Measurements are made of the net yield of an internal-pair-conversion coincidence line, both in the normal spectrometer operation (pairs with relative angles 0???90) and with the spiral baffle installed, giving a reduction ratio R?=Ywith baffle Ywithout baffle . Experimental ratios were determined for 14 known transitions including E0, E1, M1, E2, M2, and E3 multipoles between 3 and 7 MeV. Theoretical calculations were carried out on the spectrometer transmission, when using the baffle, for E0, E1 through E4, and M1 through M4 transitions from nonaligned nuclei over a wide energy range. These transmissions were combined with previous calculations of the transmission without the baffle in order to derive curves of R?(l) versus transition energy for the various multipoles. A best fit to the experimental ratios for the known multipoles was made in the calculations by adjusting slightly the values of the mean spectrometer-entrace angle and the sector angle ? of the baffle. The various ratio curves thus obtained are spaced widely enough apart to allow clear multipole assignments to be made in most cases. For mixed transitions from aligned nuclei, calculations were made of correction factors to be applied to the experimentally determined ratios. It is shown how the correction factors can be derived from separate measurements of the angular distributions of the corresponding gamma rays. The method has been applied to a number of previously unassigned transitions in Be10, B10, C14, and N14 leading to new spin and parity information on certain levels in these nuclei. In particular, it is found that the Be10 6.18-MeV level and the C14 6.58-MeV level are both 0+ and the N14 5.10-MeV level has odd parity.

E. K. Warburton; D. E. Alburger; A. Gallmann; P. Wagner; L. F. Chase; Jr.

1964-01-13T23:59:59.000Z

Note: This page contains sample records for the topic "determination advanced magnetic" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


61

Model-independent determination of the magnetic radius of the proton from spectroscopy of ordinary and muonic hydrogen  

E-Print Network (OSTI)

To date the magnetic radius of the proton has been determined only by means of electron-proton scattering, which is not free of controversies. Any existing atomic determinations are irrelevant because they are strongly model-dependent. We consider a so-called Zemach contribution to the hyperfine interval in ordinary and muonic hydrogen and derive a self-consistent model-independent value of the magnetic radius of the proton. More accurately, we constrain not a value of the magnetic radius by itself, but its certain combination with the electric-charge radius of the proton, namely, R_E^2+R_M^2. The result from the ordinary hydrogen is found to be R_E^2+R_M^2=1.35(12) fm^2, while the derived muonic value is 1.49(18) fm^2. That allows us to constrain the value of the magnetic radius of proton R_M=0.78(8) fm at the 10% level.

Karshenboim, Savely G

2014-01-01T23:59:59.000Z

62

The development of magnetic resonance imaging for the determination of porosity in reservoir core samples  

E-Print Network (OSTI)

to increase. This is the resonance condition and is the principle upon which magnetic resonance imaging is founded. The resonance frequency, tu, is directly proportional to the magnetic field and can be expressed as: where y is the gyromagnetic ratio and H... system is also precessing about y' with the same rotational frequency as M. This is the rotating frame of reference. By convention, z' is set equal to z and, therefore, H . As long as H remains at a constant strength and is the only field applied...

Sherman, Byron Blake

2012-06-07T23:59:59.000Z

63

Magnetic moment and plasma environment of HD 209458b as determined from Ly? observations  

Science Journals Connector (OSTI)

...We assume the atmosphere of HD 209458b...consistent with atmospheric models...by the shaded area. One can...shows the thermal atmospheric atoms. Fig...the estimated plasma parameters are from the...209458b at 150 MHz (19). Proximity...not support a larger magnetic moment that exceeds...

Kristina G. Kislyakova; Mats Holmstrm; Helmut Lammer; Petra Odert; Maxim L. Khodachenko

2014-11-21T23:59:59.000Z

64

magnets  

NLE Websites -- All DOE Office Websites (Extended Search)

I I Painless Physics Articles BEAM COOLING August 2, 1996 By Leila Belkora, Office of Public Affairs ACCELERATION August 16, 1996 By Dave Finley, Accelerator Division Head RF August 30, 1996 By Pat Colestock, Accelerator Division FIXED TARGET PHYSICS September 20, 1996 By Peter H. Garbincius, Physics Section FIXED TARGET PHYSICS PART DEUX October 16, 1996 By Peter H. Garbincius, Physics Section and Leila Belkora, Office of Public Affaris CROSS SECTION November 1, 1996 By Doreen Wackeroth, Theoretical Physics Edited by Leila Belkora, Office of Public Affaris MAGNETS PART I November 15, 1996 By Hank Glass, Technical Support Section Edited by Donald Sena, Office of Public Affairs MAGNETS PART II January 10, 1997 By Hank Glass, Technical Support Section Edited by Donald Sena, Office of Public Affairs

65

Supplementary Material An ion-channel-containing model membrane: structural determination by magnetic contrast  

E-Print Network (OSTI)

by magnetic contrast neutron reflectometry Stephen A. Holt,*a Anton P. Le Brun,b Charles F. Majkrzak,c Duncan, UK.; E-mail: Anton.Le-Brun@newcastle.ac.uk: j.h.lakey@ncl.ac.uk c NIST Center for Neutron Research, Auckland 1142, NZ.; E-mail: d.mcgillivray@auckland.ac.nz Keywords: OmpF; Outer membrane; porin; neutron

Loesche, Mathias

66

Determination of the gradient magnetic field above a sunspot based on observations of the HeI and FeI infrared lines  

Science Journals Connector (OSTI)

The magnetic field strength above 36 sunspots was studied using ... 030 nm and FeI 1082.837 nm magnetosensitive lines. The value of the field was determined directly by Zeeman splitting of the lines. The advantag...

L. M. Kozlova; B. V. Somov

2009-10-01T23:59:59.000Z

67

Electrochemical biotin determination based on a screen printed carbon electrode array and magnetic beads  

Science Journals Connector (OSTI)

Abstract A biotin assay using magnetic beads (1?m) and a re-usable 8-chanel screen printed electrochemical array is here reported. The reaction scheme is based on a one step competitive assay between biotin and biotin labeled with horseradish peroxidase (B-HRP). The mixture of magnetic beads modified with streptavidin (Strep-MB), biotin and B-HRP is left 15min under stirring and then a washing step is performed. After that, 20?L of the mixture is dropped twice on the electrodes and left 2min. Then, the drop is removed and 20?L of 3,3?,5,5?-tetramethylbenzidine (TMB) is deposited on the electrode surface. After 20min a potential of ?0.2V is applied during 60s, and 8 analytical signals are obtained. After washing with 0.1M phosphate buffer the screen printed carbon electrode array can be use again. The linear range obtained is between 0.1 and 250nM of biotin and have a sensitivity of 10?2?AnM?1.

Julien Biscay; Mara Begoa Gonzlez Garca; Agustn Costa Garca

2014-01-01T23:59:59.000Z

68

Rapid Determination of Moisture and Fat in Meats By Microwave And Nuclear Magnetic Resonance Analysis  

E-Print Network (OSTI)

Determination of moisture, fat, protein, and other components of meat is important for the evaluation of the quality of raw materials and finished products, the assessment of process control, and for ensuring regulatory compliance of meat products...

Claflin, Amy Elizabeth

2013-08-30T23:59:59.000Z

69

Determination of equilibrium coupling angles in magnetic multilayers by polarized neutron reflectometry  

Science Journals Connector (OSTI)

We have performed polarized neutron reflectometry (PNR) on Co/Cu multilayers grown by sputter deposition at the first antiferromagnetic (AF) maximum of the coupling oscillation. The growth of the Cu spacer layers was paused halfway through each layer for a variable amount of time to allow residual gases to be adsorbed onto the surface. A sample with clean Cu spacers shows good AF coupling, with low remanence and high saturation field. The PNR spectra show a strong 12-order Bragg peak and little splitting between the reflectivities for incident ? and ? spin neutrons at zero field, characteristic of AF ordering. Meanwhile, a more heavily gas-damaged sample with a remanent fraction of ?2/2 has strongly spin-split PNR spectra at the critical edge and nuclear Bragg peak, showing a significant ferromagnetic component. A strong 12-order Bragg peak is still present. We are able to fit accurately the magnetization and PNR data by assuming that such a sample shows considerable biquadratic coupling, with moments coupled close to 90 at zero field.

C. H. Marrows; S. Langridge; B. J. Hickey

2000-11-01T23:59:59.000Z

70

Categorical Exclusion (CX) Determinations By Date | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

9, 2010 9, 2010 CX-003285: Categorical Exclusion Determination Advanced Magnetic Refrigerant Materials CX(s) Applied: B3.6 Date: 08/09/2010 Location(s): Ashburn, Virginia Office(s): Energy Efficiency and Renewable Energy, National Energy Technology Laboratory August 9, 2010 CX-003284: Categorical Exclusion Determination Advanced Magnetic Refrigerant Materials CX(s) Applied: B3.6, B5.1 Date: 08/09/2010 Location(s): Niskayuna, New York Office(s): Energy Efficiency and Renewable Energy, National Energy Technology Laboratory August 9, 2010 CX-003283: Categorical Exclusion Determination Advanced Magnetic Refrigerant Materials CX(s) Applied: B3.6 Date: 08/09/2010 Location(s): Louisville, Kentucky Office(s): Energy Efficiency and Renewable Energy, National Energy Technology Laboratory

71

CX-004140: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

140: Categorical Exclusion Determination 140: Categorical Exclusion Determination CX-004140: Categorical Exclusion Determination High Performance Permanent Magnets for Advanced Motors CX(s) Applied: B3.6, B5.1 Date: 09/14/2010 Location(s): Landisville, Pennsylvania Office(s): Energy Efficiency and Renewable Energy The overall objective of this program is to develop high performance permanent magnets with improved Proposed Action or Project Description American Recovery and Reinvestment Act: magnetic properties at temperatures up to 240 in advanced motor applications, and low cost. For Phase III, Electron Energy Corporation proposes to dedicate further optimization of the identified feasible approaches, development of standard grades of high resistivity magnets, pilot production and beta site testing. Cost reduction

72

CX-000852: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

0852: Categorical Exclusion Determination 0852: Categorical Exclusion Determination CX-000852: Categorical Exclusion Determination 25A4800 - High Energy Permanent Magnets for Hybrid Vehicles and Alternative Energy CX(s) Applied: B3.6 Date: 01/15/2010 Location(s): Delaware Office(s): Advanced Research Projects Agency - Energy This project will exploit recent advances in materials preparation and characterization thechniques, guided by state-of-the-art theoretical and computation methods to develop the next generation permanent magnets with magnetic energy density (maximum energy product) greater than 100 Megagauss-Oersted, a nearly twofold increase over that of the strongest neodymium magnets. DOCUMENT(S) AVAILABLE FOR DOWNLOAD CX-000852.pdf More Documents & Publications George Hadjipanayis, Chairman, Department of Physics and Astronomy,

73

A 57 Ma Pacific plate palaeomagnetic pole determined from a skewness analysis of crossings of marine magnetic anomaly 25r  

Science Journals Connector (OSTI)

......Figure 2. Map of the Pacific basin showing locations of crossings...Figure 2. (Confinued.) Bight (Fig. 2b). The Pacific-Kula...south of the Great Magnetic Bight and north of the Molokai fracture...south of the Great Magnetic Bight and north of the Surveyor fracture......

Katerina E. Petronotis; Richard G. Gordon; Gary D. Acton

1994-09-01T23:59:59.000Z

74

Remanent Magnetism  

Science Journals Connector (OSTI)

... STUDY of the natural remanent magnetism of rocks is becoming a familiar method for determining the direction of the Earth's ... the geomagnetic poles or of the continents themselves. An alternative use for measurements of remanent magnetism, namely, the determination of the temperature of formation of pyroclastic deposits, is described ...

1958-03-22T23:59:59.000Z

75

Effects of strain and buffer layer on interfacial magnetization in Sr2CrReO6 films determined by polarized neutron reflectometry  

Science Journals Connector (OSTI)

We have determined the depth-resolved magnetization structures of a series of highly ordered Sr2CrReO6 (SCRO) ferrimagnetic epitaxial films via combined studies of x-ray reflectometry, polarized neutron reflectometry, and superconducting quantum interference device magnetometry. The SCRO films deposited directly on (LaAlO3)0.3(Sr2AlTaO6)0.7 or SrTiO3 substrates show reduced magnetization of similar width near the interfaces with the substrates, despite having different degrees of strain. When the SCRO film is deposited on a SrCr0.5Nb0.5O3 (SCNO) double perovskite buffer layer, the width of the interfacial region with reduced magnetization is decreased. However, the relative reduction of the magnetization averaged over the interfacial regions is comparable among the three samples. Interestingly, we found that the magnetization suppression region is wider than the Cr/Re antisite disorder region at the interface between SCRO and SCNO.

Yaohua Liu; J. M. Lucy; A. Glavic; H. Ambaye; V. Lauter; F. Y. Yang; S. G. E. te Velthuis

2014-09-19T23:59:59.000Z

76

A Prospective Study of the Utility of Magnetic Resonance Imaging in Determining Candidacy for Partial Breast Irradiation  

SciTech Connect

Purpose: Retrospective data have demonstrated that breast magnetic resonance imaging (MRI) may change a patient's eligibility for partial breast irradiation (PBI) by identifying multicentric, multifocal, or contralateral disease. The objective of the current study was to prospectively determine the frequency with which MRI identifies occult disease and to establish clinical factors associated with a higher likelihood of MRI prompting changes in PBI eligibility. Methods and Materials: At The University of Chicago, women with breast cancer uniformly undergo MRI in addition to mammography and ultrasonography. From June 2009 through May 2011, all patients were screened prospectively in a multidisciplinary conference for PBI eligibility based on standard imaging, and the impact of MRI on PBI eligibility according to National Surgical Adjuvant Breast and Bowel Project protocol B-39/Radiation Therapy Oncology Group protocol 0413 entry criteria was recorded. Univariable analysis was performed using clinical characteristics in both the prospective cohort and in a separate cohort of retrospectively identified patients. Pooled analysis was used to derive a scoring index predictive of the risk that MRI would identify additional disease. Results: A total of 521 patients were screened for PBI eligibility, and 124 (23.8%) patients were deemed eligible for PBI based on standard imaging. MRI findings changed PBI eligibility in 12.9% of patients. In the pooled univariable analysis, tumor size ?2 cm on mammography or ultrasonography (P=.02), age <50 years (P=.01), invasive lobular histology (P=.01), and HER-2/neu amplification (P=.01) were associated with a higher likelihood of MRI changing PBI eligibility. A predictive score was generated by summing the number of significant risk factors. Patients with a score of 0, 1, 2, and 3 had changes to eligibility based on MRI findings in 2.8%, 13.2%, 38.1%, and 100%, respectively (P<.0001). Conclusions: MRI identified additional disease in a significant number of patients eligible for PBI, based on standard imaging. Clinical characteristics may be useful in directing implementation of MRI in the staging of PBI candidates.

Dorn, Paige L.; Al-Hallaq, Hania A.; Haq, Farah; Goldberg, Mira [Department of Radiation and Cellular Oncology, University of Chicago Medical Center, Chicago, Illinois (United States)] [Department of Radiation and Cellular Oncology, University of Chicago Medical Center, Chicago, Illinois (United States); Abe, Hiroyuki [Department of Radiology, University of Chicago Medical Center, Chicago, Illinois (United States)] [Department of Radiology, University of Chicago Medical Center, Chicago, Illinois (United States); Hasan, Yasmin [Department of Radiation and Cellular Oncology, University of Chicago Medical Center, Chicago, Illinois (United States)] [Department of Radiation and Cellular Oncology, University of Chicago Medical Center, Chicago, Illinois (United States); Chmura, Steven J., E-mail: schmura@radonc.uchicago.edu [Department of Radiation and Cellular Oncology, University of Chicago Medical Center, Chicago, Illinois (United States)

2013-03-01T23:59:59.000Z

77

SciDAC Fusiongrid Project--A National Collaboratory to Advance the Science of High Temperature Plasma Physics for Magnetic Fusion  

SciTech Connect

This report summarizes the work of the National Fusion Collaboratory (NFC) Project funded by the United States Department of Energy (DOE) under the Scientific Discovery through Advanced Computing Program (SciDAC) to develop a persistent infrastructure to enable scientific collaboration for magnetic fusion research. A five year project that was initiated in 2001, it built on the past collaborative work performed within the U.S. fusion community and added the component of computer science research done with the USDOE Office of Science, Office of Advanced Scientific Computer Research. The project was a collaboration itself uniting fusion scientists from General Atomics, MIT, and PPPL and computer scientists from ANL, LBNL, Princeton University, and the University of Utah to form a coordinated team. The group leveraged existing computer science technology where possible and extended or created new capabilities where required. Developing a reliable energy system that is economically and environmentally sustainable is the long-term goal of Fusion Energy Science (FES) research. In the U.S., FES experimental research is centered at three large facilities with a replacement value of over $1B. As these experiments have increased in size and complexity, there has been a concurrent growth in the number and importance of collaborations among large groups at the experimental sites and smaller groups located nationwide. Teaming with the experimental community is a theoretical and simulation community whose efforts range from applied analysis of experimental data to fundamental theory (e.g., realistic nonlinear 3D plasma models) that run on massively parallel computers. Looking toward the future, the large-scale experiments needed for FES research are staffed by correspondingly large, globally dispersed teams. The fusion program will be increasingly oriented toward the International Thermonuclear Experimental Reactor (ITER) where even now, a decade before operation begins, a large portion of national program efforts are organized around coordinated efforts to develop promising operational scenarios. Substantial efforts to develop integrated plasma modeling codes are also underway in the U.S., Europe and Japan. As a result of the highly collaborative nature of FES research, the community is facing new and unique challenges. While FES has a significant track record for developing and exploiting remote collaborations, with such large investments at stake, there is a clear need to improve the integration and reach of available tools. The NFC Project was initiated to address these challenges by creating and deploying collaborative software tools. The original objective of the NFC project was to develop and deploy a national FES 'Grid' (FusionGrid) that would be a system for secure sharing of computation, visualization, and data resources over the Internet. The goal of FusionGrid was to allow scientists at remote sites to participate as fully in experiments and computational activities as if they were working on site thereby creating a unified virtual organization of the geographically dispersed U.S. fusion community. The vision for FusionGrid was that experimental and simulation data, computer codes, analysis routines, visualization tools, and remote collaboration tools are to be thought of as network services. In this model, an application service provider (ASP) provides and maintains software resources as well as the necessary hardware resources. The project would create a robust, user-friendly collaborative software environment and make it available to the US FES community. This Grid's resources would be protected by a shared security infrastructure including strong authentication to identify users and authorization to allow stakeholders to control their own resources. In this environment, access to services is stressed rather than data or software portability.

SCHISSEL, D.P.; ABLA, G.; BURRUSS, J.R.; FEIBUSH, E.; FREDIAN, T.W.; GOODE, M.M.; GREENWALD, M.J.; KEAHEY, K.; LEGGETT, T.; LI, K.; McCUNE, D.C.; PAPKA, M.E.; RANDERSON, L.; SANDERSON, A.; STILLERMAN, J.; THOMPSON, M.R.; URAM, T.; WALLACE, G.

2006-08-31T23:59:59.000Z

78

Quench Tests of LHC Magnets with Beam: Studies on Beam Loss development and determination of Quench levels  

E-Print Network (OSTI)

The application of superconducting materials in the field of high energy accelerator physics not only opens the doors to the generation of the magnetic fields unattainable to normal conductors but also demands facing new challenges. A transition fromthe superconducting state, which is characterized by a resistance-free flow of the electric current, to the normal conducting state is called quenching. This process might be extremely dangerous and even lead to destruction of amagnet superconducting coil if no protecting actions are taken. Therefore, the knowledge of a magnet quench level, i.e. amount of energy which causes the transition to the resistive state, is crucial for the safety and operational efficiency of the accelerator. Regarding that, specific thresholds are incorporated to dedicated quench prevention systems in order to suppress the origin of detected energy perturbation, for example beam losses, or mitigate the consequences of the quenching process by dissipating the energy stored in the magnetic...

Priebe, A; Sapinski, M

79

Advances in nanostructured permanent magnets research This article has been downloaded from IOPscience. Please scroll down to see the full text article.  

E-Print Network (OSTI)

motors and wind turbine generators using permanent magnets are more energy efficient compared with other/12/2012 at 05:16 Please note that terms and conditions apply. View the table of contents for this issue, or go conditions on interphase exchange interactions are given. Synthesis techniques for hard magnetic

Liu, J. Ping

80

National High Magnetic Field Laboratory - Magnets and Materials...  

NLE Websites -- All DOE Office Websites (Extended Search)

which joined the Magnet Lab and Florida State University in 2006. The ASC advances the science and technology of superconductivity by investigating low temperature and high...

Note: This page contains sample records for the topic "determination advanced magnetic" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


81

Magnetic and Cryogenic Design of the MICE Coupling Solenoid Magnet System  

E-Print Network (OSTI)

Note 234 Magnetic and Cryogenic Design of the MICE CouplingField, Advances in Cryogenic Engineering 53, p 1299, AIP

Wang, Li

2009-01-01T23:59:59.000Z

82

Magnetic Field Clumping in Massive Star-Forming Regions as Determined from Excited-State OH Absorption and Maser Emission  

E-Print Network (OSTI)

We have observed six high-mass star-forming regions in the 2 Pi 3/2, J = 7/2 lines of OH using the GBT in order to investigate whether the magnetic field, and hence the density, measured in absorption differs from that implied by maser Zeeman splitting. We detect absorption in both the 13441 and 13434 MHz main lines in all six sources. Zeeman splitting in the F = 3-3 absorption line in W3(OH) implies a line-of-sight magnetic field strength of 3.0 +/- 0.3 mG. This is significantly less than full magnetic field strengths detected from OH maser Zeeman splitting, suggesting that OH maser regions may be denser than the non-masing OH material by a factor of several. Zeeman splitting is not detected in other sources, but we are able to place upper limits on B_parallel of 1.2 mG in G10.624-0.385 and 2.9 mG in K3-50. These results are consistent with a density enhancement of the masers, but other explanations for the lower magnetic field in absorption compared to maser emission are possible for these two sources. Absorption in one or both of the 13442 and 13433 MHz satellite lines is also seen in four sources. This is the very first detection of the 2 Pi 3/2, J = 7/2 satellite lines. Ratios of satellite-line to main-line absorption suggest enhancement of the satellite lines from local thermodynamic equilibrium values. Masers are seen in the F = 4-4 and 3-3 transitions of W3(OH) and the 4-4 transition of ON 1. A previously undetected 4-4 maser is seen near -44.85 km/s in W3(OH).

Vincent L. Fish; Mark J. Reid; Karl M. Menten

2005-01-10T23:59:59.000Z

83

On the Application of the Law of the Conservation of Energy to the Determination of the Magnetic Meridian on Board Ship, When out of Reach or out of Sight of Land.  

Science Journals Connector (OSTI)

1850-1854 research-article On the Application of the Law of the Conservation of Energy to the Determination of the Magnetic Meridian...digitize, preserve, and extend access to Abstracts of the Papers Communicated to the Royal Society...

1850-01-01T23:59:59.000Z

84

E-Print Network 3.0 - axially loaded magnetic Sample Search Results  

NLE Websites -- All DOE Office Websites (Extended Search)

magnetic Search Powered by Explorit Topic List Advanced Search Sample search results for: axially loaded magnetic Page: << < 1 2 3 4 5 > >> 1 Wireless Control of Magnetic Helical...

85

E-Print Network 3.0 - analyzing nuclear magnetic Sample Search...  

NLE Websites -- All DOE Office Websites (Extended Search)

nuclear magnetic Search Powered by Explorit Topic List Advanced Search Sample search results for: analyzing nuclear magnetic Page: << < 1 2 3 4 5 > >> 1 Nuclear Magnetic Resonance...

86

E-Print Network 3.0 - aligned magnetic field Sample Search Results  

NLE Websites -- All DOE Office Websites (Extended Search)

magnetic field Search Powered by Explorit Topic List Advanced Search Sample search results for: aligned magnetic field Page: << < 1 2 3 4 5 > >> 1 CHAPTER 20: MAGNETIC PROPERTIES...

87

Determinants and impact of microvascular obstruction in successfully reperfused ST-segment elevation myocardial infarction. Assessment by magnetic resonance imaging  

Science Journals Connector (OSTI)

Microvascular obstruction (MVO) is an important and independent determinant of post-infarct remodeling. Fifty-two patients with a successfully reperfused ST-segment elevation acute myocardial infarction (MI) w...

Jan Bogaert; Maria Kalantzi; Frank E. Rademakers; Steven Dymarkowski

2007-10-01T23:59:59.000Z

88

Advanced Photon Source  

NLE Websites -- All DOE Office Websites (Extended Search)

Home Home Group Members Accelerator Magnets Insertion Devices Facilities Presentations & Publications Internal Magnetic Devices Group The primary mission of the Magnetic Devices (MD) Group is to design, build, and maintain Insertion Devices (IDs) that are reliable and transparent to the electron beam at the Advanced Photon Source (APS). The majority of IDs at the APS are conventional planar hybrid undulators, but an essential part of the mission is to develop novel IDs, such as short-period superconducting undulators and long-period electromagnetic undulators. The capabilities of APS IDs are matched to users' experimental needs. The mission also includes magnetic tuning of the IDs to ensure their near-ideal performance as x-ray sources and calculations to predict the radiation

89

Whirlpools on the Nanoscale Could Multiply Magnetic Memory  

NLE Websites -- All DOE Office Websites (Extended Search)

Whirlpools on the Nanoscale Could Multiply Magnetic Memory Whirlpools on the Nanoscale Could Multiply Magnetic Memory Print Tuesday, 21 May 2013 00:00 Research at the Advanced...

90

High Field Magnet R&D |Superconducting Magnet Division  

NLE Websites -- All DOE Office Websites (Extended Search)

High Field Magnet R&D High Field Magnet R&D The Superconducting Magnet Division is developing advanced magnet designs and magnet-related technologies for high field accelerator magnets. We are currently working on magnets for three inter-related programs: High Field Magnets for Muon Collider Papers, Presentations Common Coil Magnets Papers, Presentations Interaction Region Magnets Papers, Presentations High Temperature Superconductor (HTS) Magnets Papers, Presentations This is part of a multi-lab superconducting magnet development program for new accelerator facilities that would be part of the U.S. High Energy Physics program. These programs (@BNL, @FNAL, @LBNL) are quite complimentary to each other, so that magnet designs and technologies developed at one laboratory can be easily transferred to another. The BNL

91

Rapid determination of endogenous cytokinins in plant samples by combination of magnetic solid phase extraction with hydrophilic interaction chromatographytandem mass spectrometry  

Science Journals Connector (OSTI)

A 2-acrylamido-2-methyl-1-propanesulfonic acid-co-ethylene glycol dimethacrylate (Fe3O4/SiO2/P(AMPS-co-EGDMA)) copolymer was prepared and used as a magnetic solid phase extraction (MSPE) medium for recovery of endogenous cytokinins (CKs) from plant extracts. This magnetic porous polymer was characterized by electron microscopy, nitrogen sorption experiments, elemental analysis and Fourier-transformed infrared spectroscopy. It was demonstrated to have high extraction capacity toward \\{CKs\\} in plants due to its specificity, surface area and porous structure. Coupled with hydrophilic interaction chromatographytandem mass spectrometry (HILICMS/MS), a rapid, simple, and effective MSPEHILICMS/MS analytical method for the quantitative analysis of endogenous \\{CKs\\} in Oryza sativa (O. sativa) roots was successfully established. Good linearities were obtained for all \\{CKs\\} investigated with correlation coefficients (R2)>0.9975. The results showed that \\{LODs\\} (S/N=3) were ranged from 0.18 to 3.65pgmL?1. Reproducibility of the method was obtained with intra-day and inter-day relative standard deviations (RSDs) less than 16.1% and the recoveries in plant samples ranged from 72.8% to 115.5%. Finally, the MSPEHILICMS/MS method was applied to several plant samples, and the amounts of endogenous \\{CKs\\} in O. sativa roots, leaves and Arabidopsis thaliana (A. thaliana) were successfully determined.

Zhao Liu; Bao-Dong Cai; Yu-Qi Feng

2012-01-01T23:59:59.000Z

92

Categorical Exclusion (CX) Determinations By Date | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

9, 2010 9, 2010 CX-003286: Categorical Exclusion Determination Integrated Predictive Demand Response Controller CX(s) Applied: B5.1 Date: 08/09/2010 Location(s): Milwaukee, Wisconsin Office(s): Energy Efficiency and Renewable Energy, National Energy Technology Laboratory August 9, 2010 CX-003285: Categorical Exclusion Determination Advanced Magnetic Refrigerant Materials CX(s) Applied: B3.6 Date: 08/09/2010 Location(s): Ashburn, Virginia Office(s): Energy Efficiency and Renewable Energy, National Energy Technology Laboratory August 9, 2010 CX-003284: Categorical Exclusion Determination Advanced Magnetic Refrigerant Materials CX(s) Applied: B3.6, B5.1 Date: 08/09/2010 Location(s): Niskayuna, New York Office(s): Energy Efficiency and Renewable Energy, National Energy Technology Laboratory

93

Categorical Exclusion Determination Form  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

ergy ergy Categorical Exclusion Determination Form Proposed Action Title: (0472-1569) G~tomics - Double Sator Switched Reluctance Motor (DSSRM) Technology Progi'am or Field Office: Advanced Research Projects Agency - Energy Location(s) (City/County/State): San Diego, CA Proposed Action Description: General Atomics, in conjunction with the University of Texas-Dallas (UT Dallas), proposes to develop double-stator switched reluctance motor (DSSRM) for electric vehicles (EVs) that will eliminate the use of permanent magnet-based motors that rely on rare earth metals in EVs. General Atomics' application was selected for an initial 18-month period (Phase 1) of funding. The ARPA-E Program Director may decide to negotiate and fund project activities for an additional 18-month period (Phase II) after evaluating the work performed in Phase I. ARPA-E has not obligated

94

Categorical Exclusion Determination Form  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

of n y of n y Categorical Exclusion Determination Form Proposed Action Title: (0471-1607) University of Florida - Solar Thermochemical Fuel Production via a Novel Low Pressure, Magnetically Stabilized, Non-Volatile Iron Oxide Looping Process Program or Field Office: Advanced Research Projects Agency - Energy LocationCs) CCity/County/State): Gainesville, FL Proposed Action Description: University of Florida proposes to develop a novel solar thermochemical reactor with inputs of water, recycled carbon dioxide (C02), and concentrated solar energy to cost-effectively produce Syngas, a renewable, carbon-neutral fuel. Project activities will include: (1) modeling, design, and fabrication of a high efficiency 1 OkW reactor prototype; (2) test analysis of bench-scale

95

Categorical Exclusion (CX) Determinations By Date | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

5, 2010 5, 2010 CX-000839: Categorical Exclusion Determination 25A1089 - Electroville: High-Amperage Energy Storage Device-Energy Storage for the Neighborhood CX(s) Applied: B3.6 Date: 01/15/2010 Location(s): Massachusetts Office(s): Advanced Research Projects Agency - Energy January 15, 2010 CX-000845: Categorical Exclusion Determination 25A2445 - Ammonothermal Bulk Gallium Nitride (GaN) Crystal Growth for Energy Efficient Lighting CX(s) Applied: B3.6 Date: 01/15/2010 Location(s): New York Office(s): Advanced Research Projects Agency - Energy January 15, 2010 CX-000852: Categorical Exclusion Determination 25A4800 - High Energy Permanent Magnets for Hybrid Vehicles and Alternative Energy CX(s) Applied: B3.6 Date: 01/15/2010 Location(s): Delaware Office(s): Advanced Research Projects Agency - Energy

96

Nanocomposite Magnets: Transformational Nanostructured Permanent Magnets  

SciTech Connect

Broad Funding Opportunity Announcement Project: GE is using nanomaterials technology to develop advanced magnets that contain fewer rare earth materials than their predecessors. Nanomaterials technology involves manipulating matter at the atomic or molecular scale, which can represent a stumbling block for magnets because it is difficult to create a finely grained magnet at that scale. GE is developing bulk magnets with finely tuned structures using iron-based mixtures that contain 80% less rare earth materials than traditional magnets, which will reduce their overall cost. These magnets will enable further commercialization of HEVs, EVs, and wind turbine generators while enhancing U.S. competitiveness in industries that heavily utilize these alternatives to rare earth minerals.

None

2010-10-01T23:59:59.000Z

97

Advanced Materials  

NLE Websites -- All DOE Office Websites (Extended Search)

Advanced Materials Advanced Materials Advanced Materials Express Licensing Active Terahertz Metamaterial Devices Express Licensing Anion-Conducting Polymer, Composition, And Membrane Express Licensing Analysis Of Macromolecule, Liggands And Macromolecule-Lingand Complexes Express Licensing Carbon Microtubes Express Licensing Chemical Synthesis Of Chiral Conducting Polymers Express Licensing Forming Adherent Coatings Using Plasma Processing Express Licensing Hydrogen Scavengers Express Licensing Laser Welding Of Fused Quartz Express Licensing Multiple Feed Powder Splitter Negotiable Licensing Boron-10 Neutron Detectors for Helium-3 Replacement Negotiable Licensing Insensitive Extrudable Explosive Negotiable Licensing Durable Fuel Cell Membrane Electrode Assembly (MEA) Express Licensing Method of Synthesis of Proton Conducting Materials

98

Solution structure of a fragment of the dimerization domain of DP-1 determined by 1H-nuclear magnetic resonance and distance geometry  

Science Journals Connector (OSTI)

The structure of a synthesized peptide with the sequence of NHILPNESAYDQKNIRRRVYDALNVLMAMNIISK that corresponds to residues 151184 of transcription factor DP-1 (Girling et al., Nature 362 (1993) 8387) was determined by 1H-nuclear magnetic resonance in water and 40% d3-trifluoroethanol/water, respectively. Nuclear Overhauser effect cross peaks, ?H chemical shifts and J-coupling constants of ?HNH show that the peptide consists a helix from Ser-8 to Ser-33 in solution. Fifty structures were constructed with 288 upper distance limits and 21 angle constraints by DIANA (Guntert et al., J. Mol. Biol. 217 (1991) 517530). Although the N-terminal of the peptide exhibits a random conformation, the 20 best structures show a root mean square deviation of 0.890.36 for backbone atoms and 1.800.34 for heavy atoms from residue Ser-8 to Ser-33. This result supports the proposal that DP-1 and E2F-1 may dimerize with a coiled-coil type interaction.

Shouhong Guang; Jihui Wu; Tianning Yu; Youlin Xia; Yunyu Shi

1998-01-01T23:59:59.000Z

99

Solution structure of a fragment of the dimerization domain of E2F-1 determined by circular dichroism, 1H nuclear magnetic resonance and distance geometry  

Science Journals Connector (OSTI)

The structure of a synthesized peptide with the sequence GVVDLNWAAEVLKVQKRRIYDITNVLEGIQ which corresponds to residues 149178 of transcription factor E2F-1 was determined by 1H nuclear magnetic resonance in 40% d3-TFE/water. NOE cross peaks and ?H chemical shifts indicate that the peptide consists of a helix from Ala-8 to Leu-26 in this solution. Circular dichroism measurements confirm the presence of nearly 45% helix in TFE/water solution but show no evidence of helicity in water solution of this peptide. Fifty structures were constructed with 329 upper distance limits by DIANA. The 20 best conformers show a RMSD of 0.78 for backbone atoms and 1.78 for heavy atoms from residue Ala-8 to Leu-26. This result, together with our previous work on the solution structure of a fragment of DP-1, supports the proposal that E2F-1 and DP-1 may dimerize with a coiled-coil type interaction.

Shouhong Guang; Jihui Wu; Limei Tao; Youlin Xia; Yunyu Shi

1998-01-01T23:59:59.000Z

100

Changes Made on a 2.7-m Long Superconducting Solenoid Magnet Cryogenic System that allowed the Magnet to be kept Cold using 4 K Pulse Tube Cooler  

E-Print Network (OSTI)

in Cooler, Advances in Cryogenic Engineering 57, pp 581 -Solenoid Magnet Cryogenic System that allowed the Magnet toof the International Cryogenic Engineering Conference 22,

Green, Michael

2014-01-01T23:59:59.000Z

Note: This page contains sample records for the topic "determination advanced magnetic" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


101

U.S. Department of Energy Categorical Exclusion Determination Form  

NLE Websites -- All DOE Office Websites (Extended Search)

- - - - - - - - - - - - U.S. Department of Energy Categorical Exclusion Determination Form Program or Field Ofice: Advanced Research Projects Agency - Energy Project Title: (0288-1556) CUNY Energy lnstitute - Metacapacitors Location: *- Multi~le States - New York: California Proposed Action or Project Description: American Recovery and Reinvestment Act: Funding will support laboratory research, design, testing, and fabrication of a prototype Metacapacitor, an electrical power capacitor capable of converting energy in a switched-capacitor fashion, while operating as a high power density, low loss technology plafform for load management and power conversion. The proposed work is consistent with the goal of ADEPT: fundamental advances in soft magnetics, high voltage switches, and

102

Department of Advanced Materials Science  

E-Print Network (OSTI)

@k.u-tokyo.ac.jpe-mail 04-7136-3781T E L Environmental-friendly materials process, Metal smelting and re ning process of Advanced Materials Science masashi@issp.u-tokyo.ac.jpe-mail 04-7136-3225T E L Nuclear magnetic resonance New Materials Synthesis, Superconductivity, Quantum Spin Liquid,Topological Hall Effect takatama

Katsumoto, Shingo

103

U.S. Department of Energy Categorical Exclusion Determination Form  

NLE Websites -- All DOE Office Websites (Extended Search)

- - - - - - - - U.S. Department of Energy Categorical Exclusion Determination Form Program or Field Office: Advanced Research Projects Agency - Energy Proiect Title: (0289-1608) Astronautics Corp. of America - Efficient, Green Compact Cooling System Using Magnetic Refrigeration Location: *- Multiple States - New Jersey; Wisconsin Proposed Action or Project Description: American Recovery and Reinvestment Act: Funding will support laboratory research, design, testing, and fabrication of a prototype magnetic refrigeration cooling system capable of achieving the cooling power, temperature span, and efficiency needed for commercial relevance in a variety of heating, ventilation and air conditioning (HVAC) applications. The proposed work is consistent with the goal of BEETIT: to develop energy-efficient building cooling technologies that will

104

Advanced Electric Traction System Technology Development  

SciTech Connect

As a subcontractor to General Motors (GM), Ames Laboratory provided the technical expertise and supplied experimental materials needed to assess the technology of high energy bonded permanent magnets that are injection or compression molded for use in the Advanced Electric Traction System motor. This support was a sustained (Phase 1: 6/07 to 3/08) engineering effort that builds on the research achievements of the primary FreedomCAR project at Ames Laboratory on development of high temperature magnet alloy particulate in both flake and spherical powder forms. Ames Lab also provide guidance and direction in selection of magnet materials and supported the fabrication of experimental magnet materials for development of injection molding and magnetization processes by Arnold Magnetics, another project partner. The work with Arnold Magnetics involved a close collaboration on particulate material design and processing to achieve enhanced particulate properties and magnetic performance in the resulting bonded magnets. The overall project direction was provided by GM Program Management and two design reviews were held at GM-ATC in Torrance, CA. Ames Lab utilized current expertise in magnet powder alloy design and processing, along with on-going research advances being achieved under the existing FreedomCAR Program project to help guide and direct work during Phase 1 for the Advanced Electric Traction System Technology Development Program. The technical tasks included review of previous GM and Arnold Magnets work and identification of improvements to the benchmark magnet material, Magnequench MQP-14-12. Other benchmark characteristics of the desired magnet material include 64% volumetric loading with PPS polymer and a recommended maximum use temperature of 200C. A collaborative relationship was maintained with Arnold Magnets on the specification and processing of the bonded magnet material required by GM-ATC.

Anderson, Iver

2011-01-14T23:59:59.000Z

105

E-Print Network 3.0 - arbitrary magnetic field Sample Search...  

NLE Websites -- All DOE Office Websites (Extended Search)

magnetic field Search Powered by Explorit Topic List Advanced Search Sample search results for: arbitrary magnetic field Page: << < 1 2 3 4 5 > >> 1 Progress In Electromagnetics...

106

E-Print Network 3.0 - axisymmetric magnetic field Sample Search...  

NLE Websites -- All DOE Office Websites (Extended Search)

magnetic field Search Powered by Explorit Topic List Advanced Search Sample search results for: axisymmetric magnetic field Page: << < 1 2 3 4 5 > >> 1 Magnetohydrodynamics in...

107

Advanced Systems  

NLE Websites -- All DOE Office Websites (Extended Search)

Advanced Systems: Advanced Systems: high Performance fenestration systems Research areas: Research activities to improve the performance of windows and other fenestration products must address window systems issues as well as Glazing Materials research. LBNL activities in the area of Advanced Systems include research at both the product level and the building envelope and building systems levels. Highly insulating windows - using non structural center layers Lower cost solutions to more insulating three layer glazing systems, with the potential to turn windows in U.S. heating dominated residential applications into net-energy gainers. Highly Insulating Window Frames In collaboration with the Norwegian University of Science and Technology, we are researching the potentials for highly insulating window frames. Our initial work examines European frames with reported U-factors under 0.15 Btu/hr-ft2-F. Future research aims to analyze these designs, verify these performance levels and ensure that procedures used to calculate frame performance are accurate.

108

CX-100133 Categorical Exclusion Determination  

Office of Energy Efficiency and Renewable Energy (EERE)

Advanced High Torque Density Magnetically Geared Generator Award Number: DE-EE0006801 CX(s) Applied: A9, B5.15 Date: 12/2/2014 Location(s): NC Office(s): Golden Field Office

109

Operational advances in ring current modeling using RAM-SCB  

SciTech Connect

The Ring current Atmosphere interaction Model with Self-Consistently calculated 3D Magnetic field (RAM-SCB) combines a kinetic model of the ring current with a force-balanced model of the magnetospheric magnetic field to create an inner magnetospheric model that is magnetically self consistent. RAM-SCB produces a wealth of outputs that are valuable to space weather applications. For example, the anisotropic particle distribution of the KeV-energy population calculated by the code is key for predicting surface charging on spacecraft. Furthermore, radiation belt codes stand to benefit substantially from RAM-SCB calculated magnetic field values and plasma wave growth rates - both important for determining the evolution of relativistic electron populations. RAM-SCB is undergoing development to bring these benefits to the space weather community. Data-model validation efforts are underway to assess the performance of the system. 'Virtual Satellite' capability has been added to yield satellite-specific particle distribution and magnetic field output. The code's outer boundary is being expanded to 10 Earth Radii to encompass previously neglected geosynchronous orbits and allow the code to be driven completely by either empirical or first-principles based inputs. These advances are culminating towards a new, real-time version of the code, rtRAM-SCB, that can monitor the inner magnetosphere conditions on both a global and spacecraft-specific level. This paper summarizes these new features as well as the benefits they provide the space weather community.

Welling, Daniel T [Los Alamos National Laboratory; Jordanova, Vania K [Los Alamos National Laboratory; Zaharia, Sorin G [Los Alamos National Laboratory; Morley, Steven K [Los Alamos National Laboratory

2010-12-03T23:59:59.000Z

110

residual magnetism  

Science Journals Connector (OSTI)

The magnetization, i.e., the magnetic polarization, that remains in a magnetized material after all attempts to remove the magnetization have been made. Note: An example of residual magnetization is the magnetiza...

2001-01-01T23:59:59.000Z

111

Advanced Motors  

SciTech Connect

Project Summary Transportation energy usage is predicted to increase substantially by 2020. Hybrid vehicles and fuel cell powered vehicles are destined to become more prominent as fuel prices rise with the demand. Hybrid and fuel cell vehicle platforms are both dependent on high performance electric motors. Electric motors for transportation duty will require sizeable low-speed torque to accelerate the vehicle. As motor speed increases, the torque requirement decreases which results in a nearly constant power motor output. Interior permanent magnet synchronous motors (IPMSM) are well suited for this duty. , , These rotor geometries are configured in straight lines and semi circular arc shapes. These designs are of limited configurations because of the lack of availability of permanent magnets of any other shapes at present. We propose to fabricate rotors via a novel processing approach where we start with magnet powders and compact them into a net shape rotor in a single step. Using this approach, widely different rotor designs can be implemented for efficiency. The current limitation on magnet shape and thickness will be eliminated. This is accomplished by co-filling magnet and soft iron powders at specified locations in intricate shapes using specially designed dies and automatic powder filling station. The process fundamentals for accomplishing occurred under a previous Applied Technology Program titled, ???????????????¢????????????????????????????????Motors and Generators for the 21st Century???????????????¢???????????????????????????????. New efficient motor designs that are not currently possible (or cost prohibitive) can be accomplished by this approach. Such an approach to motor fabrication opens up a new dimension in motor design. Feasibility Results We were able to optimize a IPMSM rotor to take advantage of the powder co-filling and DMC compaction processing methods. The minimum low speed torque requirement of 5 N-m can be met through an optimized design with magnet material having a Br capability of 0.2 T. This level of magnetic performance can be met with a variety of bonded magnet compositions. The torque ripple was found to drop significantly by using thinner magnet segments. The powder co-filling and subsequent compaction processing allow for thinner magnet structures to be formed. Torque ripple can be further reduced by using skewing and pole shaping techniques. The techniques can be incorporated into the rotor during the powder co-filling process.

Knoth, Edward A.; Chelluri, Bhanumathi; Schumaker, Edward J.

2012-12-14T23:59:59.000Z

112

Syntheses, Structure, Magnetism, and Optical Properties of the Interlanthanide Sulfides delta-Ln2-xLuxS3 (Ln = Ce, Pr, Nd)  

E-Print Network (OSTI)

Syntheses, Structure, Magnetism, and Optical Properties ofstructure determination, magnetism, and optical propertiesSusceptibility Measurements. Magnetism data were measured on

Jin, Geng Bang

2008-01-01T23:59:59.000Z

113

Nuclear magnetic resonance solution structure of hirudin(151) and comparison with corresponding three-dimensional structures determined using the complete 65-residue hirudin polypeptide chain  

Science Journals Connector (OSTI)

The three-dimensional structure of the N-terminal 51-residue domain of recombinant hirudin in aqueous solution was determined by 1H nuclear magnetic resonance (NMR) spectroscopy, and the resulting high-quality solution structure was compared with corresponding structures obtained from studies with the intact, 65-residue polypeptide chain of hirudin. On the basis of 580 distance constraints derived from nuclear Overhauser effects and 109 dihedral angle constraints, a group of 20 conformers representing the solution structure of hirudin(151) was computed with the program DIANA and energyminimized with a modified version of the program AMBER. Residues 3 to 30 and 37 to 48 form a well-defined molecular core with two antiparallel ?-sheets composed of residues 14 to 16 and 20 to 22, and 27 to 31 and 36 to 40, and three reverse turns at residues 8 to 11 (type II), 17 to 20 (type II?) and 23 to 26 (type II). The average root-mean-square deviation of the individual NMR conformers relative to their mean co-ordinates is 0.38 for the backbone atoms and 0.77 for all heavy atoms of these residues. Increased structural disorder was found for the N-terminal dipeptide segment, the loop at residues 31 to 36, and the C-terminal tripeptide segment. The solution structure of hirudin(151) has the same molecular architecture as the corresponding polypeptide segment in natural hirudin and recombinant desulfatohirudin. It is also closely similar to the crystal structure of the N-terminal 51-residue segment of hirudin in a hirudin-thrombin complex, with root-mean-square deviations of the crystal structure relative to the mean solution structure of 0.61 for the backbone atoms and 0.91 for all heavy atoms of residues 3 to 30 and 37 to 48. Further coincidence is found for the loop formed by residues 31 to 36, which shows increased structural disorder in all available solution structures of hirudin, and of which residues 32 to 35 are not observable in the electron density map of the thrombin complex. Significant local structural differences between hirudin(151) in solution and hirudin in the crystalline thrombin complex were identified mainly for the N-terminal tripeptide segment and residues 17 to 21. These are further analyzed in an accompanying paper.

T. Szyperski; P. Gntert; S.R. Stone; K. Wthrich

1992-01-01T23:59:59.000Z

114

Magnetic line trapping and effective transport in stochastic magnetic fields  

Science Journals Connector (OSTI)

The transport of collisional particles in stochastic magnetic fields is studied using the decorrelation trajectory method. The nonlinear effect of magnetic line trapping is considered together with particle collisions. The running diffusion coefficient is determined for arbitrary values of the statistical parameters of the stochastic magnetic field and of the collisional velocity. The effect of the magnetic line trapping is determined. New anomalous diffusion regimes are found.

M. Vlad; F. Spineanu; J. H. Misguich; R. Balescu

2003-02-07T23:59:59.000Z

115

Categorical Exclusion (CX) Determinations By Date | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

31, 2010 31, 2010 CX-003665: Categorical Exclusion Determination High Performance Buildings Program - Hawthorne Hotel CX(s) Applied: B5.1 Date: 08/31/2010 Location(s): Salem, Massachusetts Office(s): Energy Efficiency and Renewable Energy, National Energy Technology Laboratory August 31, 2010 CX-003619: Categorical Exclusion Determination Advanced Technology Vehicle Manufacturing Project - Model S Manufacturing Facility CX(s) Applied: B1.31 Date: 08/31/2010 Location(s): Fremont, California Office(s): Advanced Technology Vehicles Manufacturing Loan Program August 30, 2010 CX-003641: Categorical Exclusion Determination Demolition and Recycling of the SIX Tesla Superconducting Dipole Magnet System CX(s) Applied: B3.6 Date: 08/30/2010 Location(s): DuPage County, Illinois Office(s): Science, Argonne Site Office

116

CX-004937: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

937: Categorical Exclusion Determination 937: Categorical Exclusion Determination CX-004937: Categorical Exclusion Determination Transphorm, Inc. -High Performance Gallium Nitride High Electron Mobility Transistor Modules for Agile Power Electronics CX(s) Applied: B3.6 Date: 08/05/2010 Location(s): California Office(s): Advanced Research Projects Agency - Energy Funding will support laboratory research, design, testing, and fabrication of the first hybrid multichip power modules for inverters/converters operating at 1 megahertz, capable of being retrofitted to older generation motors, embedded in new motors, and in grid-tied photovoltaic inverters. The proposed work is consistent with the goal of Agile Delivery of Electric Power Technology (ADEPT): fundamental advances in soft magnetics, high voltage switches, and reliable, high-density charge storage. Proposed work

117

Advanced Search  

NLE Websites -- All DOE Office Websites (Extended Search)

Publications Publications Advanced Search Most publications by Environmental Energy Technologies Division authors are searchable from this page, including peer-reviewed publications, book chapters, conference proceedings and LBNL reports. Filter Advanced Search Publications list This publications database is an ongoing project, and not all Division publications are represented here yet. For additional help see the bottom of this page. Documents Found: 4418 Title Keyword LBNL Number Author - Any - Abadie, Marc O Abbey, Chad Abdolrazaghi, Mohamad Aberg, Annika Abhyankar, Nikit Abraham, Marvin M Abshire, James B Abushakra, Bass Acevedo-Ruiz, Manuel Aceves, Salvador Ache, Hans J Ackerly, David D Ackerman, Andrew S Adamkiewicz, Gary Adams, J W Adams, Carl Adamson, Bo Addy, Nathan Addy, Susan E Aden, Nathaniel T Adesola, Bunmi Adhikari,

118

Advanced Combustion  

NLE Websites -- All DOE Office Websites (Extended Search)

Systems Systems Advanced Combustion Background Conventional coal-fired power plants utilize steam turbines to generate electricity, which operate at efficiencies of 35-37 percent. Operation at higher temperatures and pressures can lead to higher efficiencies, resulting in reduced fuel consumption and lower greenhouse gas emissions. Higher efficiency also reduces CO2 production for the same amount of energy produced, thereby facilitating a reduction in greenhouse gas emissions. When combined, oxy-combustion comes with an efficiency hit, so it will actually increase the amount of CO2 to be captured. But without so much N2 in the flue gas, it will be easier and perhaps more efficient to capture, utilize and sequester. NETL's Advanced Combustion Project and members of the NETL-Regional University

119

CX-007725: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

25: Categorical Exclusion Determination 25: Categorical Exclusion Determination CX-007725: Categorical Exclusion Determination Northeastern University - Multiscale Development of L 10 Materials for Rare-Earth-Free Permanent Magnets CX(s) Applied: A9, B3.6 Date: 12/06/2011 Location(s): New York, Michigan, Massachusetts, Nebraska Offices(s): Advanced Research Projects Agency-Energy Funding will support the development of an ultra-strong ferromagnetic magnet material with a tetragonal L 10 structure, that does not contain rare earth materials and is designed for use in clean energy technologies such as electric vehicle motors and wind turbine generators. Northeastern University's application was selected for an initial 18-month period (Phase 1) of funding. The ARPA-E Program Director may decide to negotiate and fund

120

Categorical Exclusion Determinations: Massachusetts | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

December 6, 2011 December 6, 2011 CX-007725: Categorical Exclusion Determination Northeastern University - Multiscale Development of L 10 Materials for Rare-Earth-Free Permanent Magnets CX(s) Applied: A9, B3.6 Date: 12/06/2011 Location(s): New York, Michigan, Massachusetts, Nebraska Offices(s): Advanced Research Projects Agency-Energy December 6, 2011 CX-007491: Categorical Exclusion Determination Development of Radio Frequency Diesel Particulate Filter Sensor and Controls CX(s) Applied: B3.6 Date: 12/06/2011 Location(s): Massachusetts, Michigan, New York, Tennessee Offices(s): National Energy Technology Laboratory November 30, 2011 CX-007410: Categorical Exclusion Determination Deep Geothermal Drilling using Millimeter Wave Technology CX(s) Applied: A9, B3.6 Date: 11/30/2011 Location(s): Massachusetts

Note: This page contains sample records for the topic "determination advanced magnetic" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


121

CX-006039: Categorical Exclusion Determination | Department of...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Exclusion Determination Ohio Advanced Transportation Partnership: Zanesville Energy Biogas Compressed Natural Gas Fueling Infrastructure Date: 06092011 Location(s):...

122

High Performance Permanent Magnets for Advanced Motors  

Energy.gov (U.S. Department of Energy (DOE))

2010 DOE Vehicle Technologies and Hydrogen Programs Annual Merit Review and Peer Evaluation Meeting, June 7-11, 2010 -- Washington D.C.

123

U.S. Department of Energy Categorical Exclusion Determination Form  

NLE Websites -- All DOE Office Websites (Extended Search)

- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - U.S. Department of Energy Categorical Exclusion Determination Form Progrtam or Field Ot'fice: Advanced Research Projects Agency - Energy Proiect Title: (0288-1 570) Cree - 15 kV Sic IGBT Power Modules for Grid Scale Power Conversion Location: *- Multiple States - North Carolina; Washington, D.C. Proposed Action or Project Description: sAmmican Raovaj- and Reinwtmmt Act: Fundingwill support laboratoryscale research and development activities to verify pmof-ofancept for advanced transistor based electrical substations that can help make the electtical grid more flexible and conbllable. The pmposed work is consistent with the goal of ADEPT: fundamental advances in soft magnetics, high voltage switches, and reliable, highdens* charge storage.

124

Advanced Research  

NLE Websites -- All DOE Office Websites (Extended Search)

Ductility EnhancEmEnt of molybDEnum Ductility EnhancEmEnt of molybDEnum PhasE by nano-sizED oxiDE DisPErsions Description Using computational modeling techniques, this research aims to develop predictive capabilities to facilitate the design and optimization of molybdenum (Mo), chromium (Cr), and other high-temperature structural materials to enable these materials to withstand the harsh environments of advanced power generation systems, such as gasification-based systems. These types of materials are essential to the development of highly efficient, clean energy technologies such as low-emission power systems that use coal or other fossil fuels.

125

Advanced Research  

NLE Websites -- All DOE Office Websites (Extended Search)

Super HigH-TemperaTure alloyS and Super HigH-TemperaTure alloyS and CompoSiTeS From nb-W-Cr SySTemS Description The U.S. Department of Energy's Office of Fossil Energy (DOE-FE) has awarded a three-year grant to the University of Texas at El Paso (UTEP) and Argonne National Laboratory (ANL) to jointly explore the high-temperature properties of alloys composed of niobium (Nb), tungsten (W), and chromium (Cr). The grant is administered by the Advanced Research (AR) program of the National

126

Mission Advancing  

NLE Websites -- All DOE Office Websites (Extended Search)

NETL Accomplishments NETL Accomplishments - the lab 2 Mission Advancing energy options to fuel our economy, strengthen our security, and improve our environment. Renewed Prosperity Through Technological Innovation - Letter from the Director NETL: the ENERGY lab 4 6 3 Contents Technology Transfer Patents and Commercialization Sharing Our Expertise Noteworthy Publications 60 62 63 64 66 Environment, Economy, & Supply Carbon Capture and Storage Partnerships Work to Reduce Atmospheric CO 2 Demand-Side Efficiencies New NETL Facility Showcases Green Technologies Environment & Economy Materials Mercury Membranes NETL Education Program Produces Significant Achievement Monitoring Water Economy & Supply NETL's Natural Gas Prediction Tool Aids Hurricane Recovery Energy Infrastructure

127

Brownian motion and magnetism  

Science Journals Connector (OSTI)

We present an interesting connection between Brownian motion and magnetism. We use this to determine the distribution of areas enclosed by the path of a particle diffusing on a sphere. In addition, we find a bound on the free energy of an arbitrary system of spinless bosons in a magnetic field. The work presented here is expected to shed light on polymer entanglement, depolarized light scattering, and magnetic behavior of spinless bosons.

Supurna Sinha and Joseph Samuel

1994-11-01T23:59:59.000Z

128

Dynamic control of spin states in interacting magnetic elements  

DOE Patents (OSTI)

A method for the control of the magnetic states of interacting magnetic elements comprising providing a magnetic structure with a plurality of interacting magnetic elements. The magnetic structure comprises a plurality of magnetic states based on the state of each interacting magnetic element. The desired magnetic state of the magnetic structure is determined. The active resonance frequency and amplitude curve of the desired magnetic state is determined. Each magnetic element of the magnetic structure is then subjected to an alternating magnetic field or electrical current having a frequency and amplitude below the active resonance frequency and amplitude curve of said desired magnetic state and above the active resonance frequency and amplitude curve of the current state of the magnetic structure until the magnetic state of the magnetic structure is at the desired magnetic state.

Jain, Shikha; Novosad, Valentyn

2014-10-07T23:59:59.000Z

129

Advanced Vehicle Testing & Evaluation  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Provide benchmark data for advanced technology vehicles Develop lifecycle cost data for production vehicles utilizing advanced power trains Provide fleet...

130

Advanced LIGO  

E-Print Network (OSTI)

The Advanced LIGO gravitational wave detectors are second generation instruments designed and built for the two LIGO observatories in Hanford, WA and Livingston, LA. The two instruments are identical in design, and are specialized versions of a Michelson interferometer with 4 km long arms. As in initial LIGO, Fabry-Perot cavities are used in the arms to increase the interaction time with a gravitational wave, and power recycling is used to increase the effective laser power. Signal recycling has been added in Advanced LIGO to improve the frequency response. In the most sensitive frequency region around 100 Hz, the design strain sensitivity is a factor of 10 better than initial LIGO. In addition, the low frequency end of the sensitivity band is moved from 40 Hz down to 10 Hz. All interferometer components have been replaced with improved technologies to achieve this sensitivity gain. Much better seismic isolation and test mass suspensions are responsible for the gains at lower frequencies. Higher laser power, larger test masses and improved mirror coatings lead to the improved sensitivity at mid- and high- frequencies. Data collecting runs with these new instruments are planned to begin in mid-2015.

The LIGO Scientific Collaboration

2014-11-17T23:59:59.000Z

131

CX-011274: Categorical Exclusion Determination | Department of...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Determination CX-011274: Categorical Exclusion Determination Ion Advanced Solvent Carbon Dioxide Capture Pilot Project CX(s) Applied: A9, A11 Date: 09262013 Location(s):...

132

CX-011273: Categorical Exclusion Determination | Department of...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Determination CX-011273: Categorical Exclusion Determination Ion Advanced Solvent Carbon Dioxide Capture Pilot Project CX(s) Applied: B3.6 Date: 09262013 Location(s):...

133

CX-011786: Categorical Exclusion Determination | Department of...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Determination CX-011786: Categorical Exclusion Determination Ion Advanced Solvent Carbon Dioxide Capture Pilot Project CX(s) Applied: A9, A11 Date: 02192014 Location(s):...

134

CX-011276: Categorical Exclusion Determination | Department of...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Determination CX-011276: Categorical Exclusion Determination Ion Advanced Solvent Carbon Dioxide Capture Pilot Project CX(s) Applied: B3.6 Date: 09262013 Location(s):...

135

CX-011785: Categorical Exclusion Determination | Department of...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Determination CX-011785: Categorical Exclusion Determination Ion Advanced Solvent Carbon Dioxide Capture Pilot Project CX(s) Applied: A9, A11 Date: 02192014 Location(s):...

136

CX-009134: Categorical Exclusion Determination | Department of...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

34: Categorical Exclusion Determination CX-009134: Categorical Exclusion Determination Wave Energy Technology- New Zealand Multi-Mode Wave Energy Converter Advancement Project...

137

CX-005120: Categorical Exclusion Determination | Department of...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Exclusion Determination CX-005120: Categorical Exclusion Determination Wavebob Advanced Wave Energy Conversion Project CX(s) Applied: A9, B3.6 Date: 01272011 Location(s):...

138

Advanced Materials in Support of EERE Needs to Advance Clean Energy Technologies Program Implementation  

SciTech Connect

The goal of this activity was to carry out program implementation and technical projects in support of the ARRA-funded Advanced Materials in Support of EERE Needs to Advance Clean Energy Technologies Program of the DOE Advanced Manufacturing Office (AMO) (formerly the Industrial Technologies Program (ITP)). The work was organized into eight projects in four materials areas: strategic materials, structural materials, energy storage and production materials, and advanced/field/transient processing. Strategic materials included work on titanium, magnesium and carbon fiber. Structural materials included work on alumina forming austentic (AFA) and CF8C-Plus steels. The advanced batteries and production materials projects included work on advanced batteries and photovoltaic devices. Advanced/field/transient processing included work on magnetic field processing. Details of the work in the eight projects are available in the project final reports which have been previously submitted.

Liby, Alan L [ORNL; Rogers, Hiram [ORNL

2013-10-01T23:59:59.000Z

139

National High Magnetic Field Laboratory - Science Starts Here...  

NLE Websites -- All DOE Office Websites (Extended Search)

Postdoctoral associate, University of Florida, College of Medicine and Advanced Magnetic Resonance Imaging and Spectroscopy facility. Current work Fatma works on C.elegans, a...

140

MagLab - Timeline of Electricity and Magnetism: 1775 - 1799  

NLE Websites -- All DOE Office Websites (Extended Search)

advances in science every year. Torsion Balance Yet in part because electricity and magnetism were not fully understood, many ideas we consider strange today continued to thrive....

Note: This page contains sample records for the topic "determination advanced magnetic" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


141

National High Magnetic Field Laboratory: Museum of Electricity...  

NLE Websites -- All DOE Office Websites (Extended Search)

high-tech advances made it possible for manufacturers to produce fully electronic meters with LCD screens Related Electricity & Magnetism Pages Timeline: 1870 1879...

142

Ground Magnetics | Open Energy Information  

Open Energy Info (EERE)

Ground Magnetics Ground Magnetics Jump to: navigation, search GEOTHERMAL ENERGYGeothermal Home Exploration Technique: Ground Magnetics Details Activities (15) Areas (12) Regions (0) NEPA(1) Exploration Technique Information Exploration Group: Geophysical Techniques Exploration Sub Group: Magnetic Techniques Parent Exploration Technique: Magnetic Techniques Information Provided by Technique Lithology: Presence of magnetic minerals such as magnetite. Stratigraphic/Structural: Mapping of basement structures, horst blocks, fault systems, fracture zones, dykes and intrusions. Hydrological: The circulation of hydrothermal fluid may impact the magnetic susceptibility of rocks. Thermal: Rocks lose their magnetic properties at the Curie temperature (580° C for magnetite) [1] and, upon cooling, remagnetize in the present magnetic field orientation. The Curie point depth in the subsurface may be determined in a magnetic survey to provide information about hydrothermal activity in a region.

143

Advanced Research  

NLE Websites -- All DOE Office Websites (Extended Search)

05/2007 05/2007 NitrogeN evolutioN aNd CorrosioN MeChaNisMs With oxyCoMbustioN of Coal Description Under a grant from the University Coal Research (UCR) program, Brigham Young University (BYU) is leading a three-year research effort to investigate the physical processes that several common types of coal undergo during oxy-fuel combustion. Specifically, research addresses the mixture of gases emitted from burning, particularly such pollutants as nitrogen oxides (NO X ) and carbon dioxide (CO 2 ), and the potential for corrosion at the various stages of combustion. The UCR program is administered by the Advanced Research Program at the National Energy Technology Laboratory (NETL), under the U.S. Department of Energy's Office of

144

Magnetism and magnetic materials probed with neutron scattering  

Science Journals Connector (OSTI)

Abstract Neutron scattering techniques are becoming increasingly accessible to a broader range of scientific communities, in part due to the onset of next-generation, high-power spallation sources, high-performance, sophisticated instruments and data analysis tools. These technical advances also advantageously impact research into magnetism and magnetic materials, where neutrons play a major role. In this Current Perspective series, the achievements and future prospects of elastic and inelastic neutron scattering, polarized neutron reflectometry, small angle neutron scattering, and neutron imaging, are highlighted as they apply to research into magnetic frustration, superconductivity and magnetism at the nanoscale.

S.G.E. te Velthuis; C. Pappas

2014-01-01T23:59:59.000Z

145

Orbital Magnetism: Pros and Cons for Enhancing the Cluster Magnetism  

Science Journals Connector (OSTI)

The discrepancy seen in the experimental and theoretical results on the magnetic moment of a small magnetic cluster has been attributed to the contribution arising from orbital magnetism. In this Letter we show that the magnetic states with large orbital magnetic moment are not always energetically favorable; they could, however, be realizable by coating the cluster or deposing it on appropriate substrates. More importantly, our work shows that the crucial factors that determine the cluster magnetism are found to be the intrinsic, and consequently, the extrinsic properties of the constituent atoms of the cluster.

Antonis N. Andriotis and Madhu Menon

2004-07-09T23:59:59.000Z

146

Magnetic Spinner  

Science Journals Connector (OSTI)

A science toy sometimes called the magnetic spinner is an interesting class demonstration to illustrate the principles of magnetic levitation. It can also be used to demonstrate Faraday's law and a horizontally suspended physical pendulum. The levitated part contains two circular magnets encased in a plastic housing. Each magnet stays above two triangular magnets fixed to the base. The magnetic repulsive force experienced by the circular magnets is independent of their orientation; therefore the holder of these magnets can be rotated without affecting its stability. The holder with the circular magnets can be oscillated up and down as a horizontally suspended physical pendulum.

P. J. Ouseph

2006-01-01T23:59:59.000Z

147

EERE PROJECT MANAGEMENT CENTER NEPA DETERMINATION RECIPIENT  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

!, !, u.s. DEPARThIENT OFENI'RGY EERE PROJECT MANAGEMENT CENTER NEPA DETERMINATION RECIPIENT :Advanced Magnet Lab, Inc. STATE : FL PROJECf TITLE: A Lightweight, Direct Drive, Fully Superconducting Generator for large Wind Turbines Page 1 of3 Funding Opportunity Announcement Number Procurement Instrument Number NEPA Control Number CID Number DE-FOA-0000439 DE-EEOOOS140 GFO-OOOS140-003 G05140 Based on my review of the information concerning tbe proposed action, as NEPA Compliance Officer (authorized under OOE Order 451.1A), I have made the following determination : ex. EA, EIS APPENDIX AND NUMBER: Description: 83.6 Small-scale research and de ve lopment, labo ratory o perations, and pilot projects Siting. construction, modification, operation. and decommiSSioning of facilities for smaliscale research

148

Magnetism Digest  

Science Journals Connector (OSTI)

... and Institute of Electrical and Electronic Engineers, on the occasion of their annual conferences on magnetism and magnetic materials in the United States, have sponsored the production of a Magnetic ... references, drawn from a large number of sources, to work in the field of magnetism and magnetic materials published in the preceding year. They therefore provide a very convenient ...

J. H. PHILLIPS

1966-06-25T23:59:59.000Z

149

Magnetic Techniques | Open Energy Information  

Open Energy Info (EERE)

Magnetic Techniques Magnetic Techniques Jump to: navigation, search GEOTHERMAL ENERGYGeothermal Home Exploration Technique: Magnetic Techniques Details Activities (0) Areas (0) Regions (0) NEPA(1) Exploration Technique Information Exploration Group: Geophysical Techniques Exploration Sub Group: Magnetic Techniques Parent Exploration Technique: Geophysical Techniques Information Provided by Technique Lithology: Presence of magnetic minerals such as magnetite. Stratigraphic/Structural: Mapping of basement structures, horst blocks, fault systems, fracture zones, dykes and intrusions. Hydrological: The circulation of hydrothermal fluid may impact the magnetic susceptibility of rocks. Thermal: Rocks lose their magnetic properties at the Curie temperature (580° C for magnetite) [1] and, upon cooling, remagnetize in the present magnetic field orientation. The Curie point depth in the subsurface may be determined in a magnetic survey to provide information about hydrothermal activity in a region.

150

Advanced Editor Usage Advanced Editor Usage  

E-Print Network (OSTI)

Advanced Editor Usage Advanced Editor Usage Log in and click the edit icon How to navigate of the events will seek the video to where that event starts Page 1 of 11 #12;Advanced Editor Usage How Editor Usage 3. Type in the new caption name, enter any searchable metadata and click OK (the thumbnail

Benos, Panayiotis "Takis"

151

Brett Parker | Superconducting Magnet Division  

NLE Websites -- All DOE Office Websites (Extended Search)

Brett Parker Brett Parker Recent Presentations "BNL Direct Wind Magnets," (pdf) presentation dedicated to the memory of Pat Thompson given at the 22nd Magnet Technology Conference (MT22), September 11 - 16, 2011, Marseille, France A Review of BNL Direct-Wind Superconducting IR Magnet Experience, (pdf) presented at the 30th Advanced ICFA Beam Dynamics Workshop on High Luminosity e+e- Collisions, October 13 - 16, 2003, Stanford, California The Serpentine Coil Design for BEPC-II Superconducting IR Magnets, (pdf) presented at the "Mini-Workshop on BEPC-II IR Design", January 12 - 16, 2004, Beijing, P.R. China Ma nufacture of a Superconducting Octupole Magnet for the ALPHA Experiment at CERN using the Direct Wind Machine Presentations Prior to 2004 Superconducting Final Focus Magnet Issues (pdf), presented at

152

Advanced Manufacturing Office Overview  

Energy.gov (U.S. Department of Energy (DOE))

Overview presentation by the Advanced Manufacturing Office for the Microwave (MW) and Radio Frequency (RF) as Enabling Technologies for Advanced Manufacturing

153

Magnetism.1  

Science Journals Connector (OSTI)

... each complete magnets with a pair of poles. The general character of the earth's magnetism has long been knownthat the earth behaves with regard to magnets as though it ... and that these poles have a slow secular motion. For many years the earth's magnetism has been the subject of careful study by the most powerful minds. Gauss organized ...

1890-01-16T23:59:59.000Z

154

Advanced fusion concepts: project summaries  

SciTech Connect

This report contains descriptions of the activities of all the projects supported by the Advanced Fusion Concepts Branch of the Office of Fusion Energy, US Department of Energy. These descriptions are project summaries of each of the individual projects, and contain the following: title, principle investigators, funding levels, purpose, approach, progress, plans, milestones, graduate students, graduates, other professional staff, and recent publications. Information is given for each of the following programs: (1) reverse-field pinch, (2) compact toroid, (3) alternate fuel/multipoles, (4) stellarator/torsatron, (5) linear magnetic fusion, (6) liners, and (7) Tormac. (MOW)

None

1980-12-01T23:59:59.000Z

155

Earths magnetism  

Science Journals Connector (OSTI)

Earths magnetism, geomagnetism, terrestrial magnetism [The magnetism of the Earth] ? Erdmagnetismus m, Geomagnetismus

2014-08-01T23:59:59.000Z

156

NETL: Advanced Research - Materials  

NLE Websites -- All DOE Office Websites (Extended Search)

High Performance Materials > Chrome Oxide Refractory High Performance Materials > Chrome Oxide Refractory Advanced Research High Performance Materials Chrome Oxide Refractory One notable NETL success is the development of a chrome oxide refractory material capable of working in slagging gasifier conditions. In this project, researchers first determined that one of the major failure mechanisms for chrome oxide refractories exposed to the intense heat and corrosive environment was spalling, or the chipping or flaking of refractory material from an exposed face. They used this information to formulate a high-chrome oxide refractory composition that resists spalling, resulting in a refractory with a longer service life in the gasifier. Inside an ultrasupercritical (USC) pulverized coal power plant, materials are exposed to temperatures up to 760°C and pressures up to 5,000 psi. Operating a USC system can improve power plant efficiency up to 47% and reduce emissions. However, finding boiler and turbine materials that can hold up under extreme conditions requires new high-temperature metal alloys and ceramic coatings, as well as computational modeling research to optimize the processing of these materials. Advanced Research Materials Development program successes in this area include the following:

157

U.S. Department of Energy Categorical Exclusion Determination Form  

NLE Websites -- All DOE Office Websites (Extended Search)

- - U.S. Department of Energy Categorical Exclusion Determination Form Program or Field Office: Advanced Research Projects Agency - Energy Proiect Title: (0288-1506) Virginia Tech - Isolated Converter with Integrated Passives and Low Material Stress Location: *- Multiple States - Virginia; Florida; Texas Proposed Action or Project Description: American Recovery and Reinvestment Act: Funding will support laboratory and bench scale research and development on a monolithic power converter to be used in efficient power adapters for mobile applications. The proposed work is consistent with the goal of ADEPT: fundamental advances in soft magnetics, high voltage switches, and reliable, high-density charge storage. Proposed work consists entirely of RD&D work to be completed in laboratories housed on the campuses of Virginia Tech, the University of Florida,

158

US. Department of Energy Categorical Exclusion Determination Form  

NLE Websites -- All DOE Office Websites (Extended Search)

- - - - - - - - - - -- - - - - - - - - - - - - US. Department of Energy Categorical Exclusion Determination Form Pi-owam or Field Ofice: Advanced Research Projects Agency - Energy Project Title: (0288-1564)Virginia Polytechnic Institute and State University - Power Supplies on a Chip Location: *- Multiple States - Virginia; Delaware; California; Arizona; Texas Proposed Action or Project Description: Ahmican Rt~ovrr)- and Rein-tmmt Act: Funding will support laboratory research, design, testing, and fabrication of a prototype power supply on a chip, a low-voltage, high-current point-of- load converter for powering the next generation of microprocessars, graphics cards, and all forms of communications electronic equipment The proposed work is consistent with the goal of ADEPT: fundamental advances in soft magnetics, high voltage switches, and reliable, highdensity

159

Magnetic bearing development for support of satellite flywheels  

Science Journals Connector (OSTI)

The use of magnetic bearings (MB) for support of space based flywheels can provide significant improvement in efficiency due to reduction in drag torque. A NASA supported program directed through the Texas A&M Center for Space Power has been formed to advance the technology of MBs for satellite flywheel applications. The five areas of the program are: (a) Magnetic Field Simulation (b) MB controller Development (c) Electromechanical Rotordynamics Modeling (d) Testing and (e) Technology Exchange. Planned innovations in these tasks include eddy current drag torque and power loss determination including moving conductor effects digital (DSP) based control for high speed operation MATLAB-based coupled flexible rotor/controller/actuator electromechanical model with fuzzy logic nonlinear control and ultra high speed>100?krpm measurement of drag torque. The paper examines these areas and provides an overview of the project.

Alan Palazzolo; Mu Li; Andrew Kenny; Shuliang Lei; Danny Havelka; Albert Kascak

1998-01-01T23:59:59.000Z

160

Categorical Exclusion Determinations: New York | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

December 20, 2011 December 20, 2011 CX-007404: Categorical Exclusion Determination National Offshore Wind Energy Resource and Design Data Campaign - Analysis and Collaboration CX(s) Applied: A9, A11 Date: 12/20/2011 Location(s): New York Offices(s): Golden Field Office December 6, 2011 CX-007725: Categorical Exclusion Determination Northeastern University - Multiscale Development of L 10 Materials for Rare-Earth-Free Permanent Magnets CX(s) Applied: A9, B3.6 Date: 12/06/2011 Location(s): New York, Michigan, Massachusetts, Nebraska Offices(s): Advanced Research Projects Agency-Energy December 6, 2011 CX-007491: Categorical Exclusion Determination Development of Radio Frequency Diesel Particulate Filter Sensor and Controls CX(s) Applied: B3.6 Date: 12/06/2011 Location(s): Massachusetts, Michigan, New York, Tennessee

Note: This page contains sample records for the topic "determination advanced magnetic" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


161

Magnetization and EPR studies of the single molecule magnet Ni4 with integrated sensors  

E-Print Network (OSTI)

Magnetization and EPR studies of the single molecule magnet Ni4 with integrated sensors G. de 2007 Integrated magnetic sensors that allow simultaneous EPR and magnetization measurements have been with a micro-Hall effect magnetometer. EPR spectroscopy is used to determine the energy splitting between

del Barco, Enrique

162

Frustrated quantum magnet the pyrochlore structure consists of corner  

E-Print Network (OSTI)

to exotic magnetic ground states. Quantum Spin Ice: Pyrochlore Quantum Magnet Tb2Ti2O7 at Ultra to determine the nature of magnetic ordering -if any- as a function of applied magnetic field using the ultra magnetization plateau below 50 mK (Fig. 2), as predicted for a single-tetrahedron four -spin model. This new

McQuade, D. Tyler

163

Nuclear magnetic resonance analysis of proteinDNA interactions  

Science Journals Connector (OSTI)

...review-article Review articles 1004 30 15 Nuclear magnetic resonance analysis of protein-DNA...instrumental advances in solution-state nuclear magnetic resonance have opened up the...structural biology|protein-DNA complex|nuclear magnetic resonance| 1. Introduction...

2011-01-01T23:59:59.000Z

164

Modern Magnetism  

Science Journals Connector (OSTI)

... BATESS "Modern Magnetism", first published in 1939, is widely appreciated as a general survey in which ... grateful to the author for collecting together so much interesting information about recent work in magnetism. ...

E. C. S.

1948-06-05T23:59:59.000Z

165

CX-011371: Categorical Exclusion Determination | Department of...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

The XRD will primarily be used for research focusing on 1) the determination of corrosion mechanisms of nuclear materials including nuclear fuels and advanced waste forms to...

166

CX-011384: Categorical Exclusion Determination | Department of...  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

Categorical Exclusion Determination Advanced Controls for the Multi-pod Centipod Wave Energy Converter Device CX(s) Applied: A9 Date: 12022013 Location(s): California...

167

CX-002327: Categorical Exclusion Determination | Department of...  

Office of Environmental Management (EM)

CX-002327: Categorical Exclusion Determination Central Facility Area and Advanced Test Reactor-Complex Analytical and Research and Development Laboratory Operation...

168

CX-003569: Categorical Exclusion Determination | Department of...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Determination Ohio Advanced Transportation Partnership - Pike Delta York Schools Propane Vehicle Fueling Station CX(s) Applied: B5.1 Date: 08242010 Location(s): Delta, Ohio...

169

CX-008457: Categorical Exclusion Determination | Department of...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

CX-008457: Categorical Exclusion Determination Ohio Advanced Transportation Partnership - Electrical Vehicle Supply Equipment Installation in Walgreens Parking Lot CX(s) Applied:...

170

CX-008509: Categorical Exclusion Determination | Department of...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

CX-008509: Categorical Exclusion Determination Ohio Advanced Transportation Partnership - Electrical Vehicle Supply Equipment Installation in Walgreens Parking Lot CX(s) Applied:...

171

CX-010741: Categorical Exclusion Determination | Department of...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

CX-010741: Categorical Exclusion Determination Smart Market Advance Retrofit Transformer Program (SMART Scale) CX(s) Applied: A9, B5.1 Date: 08092013 Location(s):...

172

CX-007630: Categorical Exclusion Determination | Department of...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

CX-007630: Categorical Exclusion Determination "Advanced Fuel Cycle Initiative AmericiumCurium Separations CX(s) Applied: B3.6 Date: 01202012 Location(s): South Carolina...

173

CX-003807: Categorical Exclusion Determination | Department of...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Determination Ohio Advanced Transportation Partnership (OATP) - Rumke Compressed Natural Gas Fueling Station CX(s) Applied: B5.1 Date: 09082010 Location(s): Hamilton County,...

174

Migratory magnetism  

Science Journals Connector (OSTI)

... in tune with the Earth's magnetic field. But how, exactly, do creatures sense magnetism? This is one of the most intriguing questions in modern biology - and also ... move preferentially in a north-south direction. This finding hints at the possible influence of magnetism on their movements. ...

Henry Gee

1999-10-06T23:59:59.000Z

175

Advanced Critical Advanced Energy Retrofit Education and Training...  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

Critical Advanced Energy Retrofit Education and Training and Credentialing - 2014 BTO Peer Review Advanced Critical Advanced Energy Retrofit Education and Training and...

176

Magnetic liquefier for hydrogen  

SciTech Connect

This document summarizes work done at the Astronautics Technology Center of the Astronautics Corporation of America (ACA) in Phase 1 of a four phase program leading to the development of a magnetic liquefier for hydrogen. The project involves the design, fabrication, installation, and operation of a hydrogen liquefier providing significantly reduced capital and operating costs, compared to present liquefiers. To achieve this goal, magnetic refrigeration, a recently developed, highly efficient refrigeration technology, will be used for the liquefaction process. Phase 1 project tasks included liquefier conceptual design and analysis, preliminary design of promising configurations, design selection, and detailed design of the selected design. Fabrication drawings and vendor specifications for the selected design were completed during detailed design. The design of a subscale, demonstration magnetic hydrogen liquefier represents a significant advance in liquefaction technology. The cost reductions that can be realized in hydrogen liquefaction in both the subscale and, more importantly, in the full-scale device are expected to have considerable impact on the use of liquid hydrogen in transportation, chemical, and electronic industries. The benefits to the nation from this technological advance will continue to have importance well into the 21st century.

NONE

1992-12-31T23:59:59.000Z

177

AdvAnced  

NLE Websites -- All DOE Office Websites (Extended Search)

AdvAnced test reActor At the InL advanced Unlike large, commercial power reactors, ATR is a low- temperature, low-pressure reactor. A nuclear reactor is basically an elaborate...

178

Magnetic Testing of Bonded Magnets  

Science Journals Connector (OSTI)

Many techniques exist to characterize the magnetic properties of bonded magnets. We will review the common and not so common techniques in use, with emphasis on the advantages and disadvantages of each one, an...

S. R. Trout

2003-01-01T23:59:59.000Z

179

Advanced Search Search Tips  

E-Print Network (OSTI)

Advanced Search Search Tips Advanced Search Search Tips springerlink.com SpringerLink 2,000 40,000 20,000 2010 11 Please visit 7 http://www.springerlink.com GO 1997 1997 SpringerLink Advanced Search Search Tips CONTENT DOI CITATION DOI ISSN ISBN CATEGORY AND DATE LIMITERS Journals Books Protocols

Kinosita Jr., Kazuhiko

180

LABORATORY VI ELECTRICITY FROM MAGNETISM  

E-Print Network (OSTI)

LABORATORY VI ELECTRICITY FROM MAGNETISM Lab VI - 1 In the previous problems you explored by electric currents. This lab will carry that investigation one step further, determining how changing magnetic fields can give rise to electric currents. This is the effect that allows the generation

Minnesota, University of

Note: This page contains sample records for the topic "determination advanced magnetic" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


181

ADVANCED TURBINE SYSTEMS PROGRAM  

SciTech Connect

Natural gas combustion turbines are rapidly becoming the primary technology of choice for generating electricity. At least half of the new generating capacity added in the US over the next twenty years will be combustion turbine systems. The Department of Energy has cosponsored with Siemens Westinghouse, a program to maintain the technology lead in gas turbine systems. The very ambitious eight year program was designed to demonstrate a highly efficient and commercially acceptable power plant, with the ability to fire a wide range of fuels. The main goal of the Advanced Turbine Systems (ATS) Program was to develop ultra-high efficiency, environmentally superior and cost effective competitive gas turbine systems for base load application in utility, independent power producer and industrial markets. Performance targets were focused on natural gas as a fuel and included: System efficiency that exceeds 60% (lower heating value basis); Less than 10 ppmv NO{sub x} emissions without the use of post combustion controls; Busbar electricity that are less than 10% of state of the art systems; Reliability-Availability-Maintainability (RAM) equivalent to current systems; Water consumption minimized to levels consistent with cost and efficiency goals; and Commercial systems by the year 2000. In a parallel effort, the program was to focus on adapting the ATS engine to coal-derived or biomass fuels. In Phase 1 of the ATS Program, preliminary investigators on different gas turbine cycles demonstrated that net plant LHV based efficiency greater than 60% was achievable. In Phase 2 the more promising cycles were evaluated in greater detail and the closed-loop steam-cooled combined cycle was selected for development because it offered the best solution with least risk for achieving the ATS Program goals for plant efficiency, emissions, cost of electricity and RAM. Phase 2 also involved conceptual ATS engine and plant design and technology developments in aerodynamics, sealing, combustion, cooling, materials, coatings and casting development. The market potential for the ATS gas turbine in the 2000-2014 timeframe was assessed for combined cycle, simple cycle and integrated gasification combined cycle, for three engine sizes. The total ATS market potential was forecasted to exceed 93 GW. Phase 3 and Phase 3 Extension involved further technology development, component testing and W501ATS engine detail design. The technology development efforts consisted of ultra low NO{sub x} combustion, catalytic combustion, sealing, heat transfer, advanced coating systems, advanced alloys, single crystal casting development and determining the effect of steam on turbine alloys. Included in this phase was full-load testing of the W501G engine at the McIntosh No. 5 site in Lakeland, Florida.

Gregory Gaul

2004-04-21T23:59:59.000Z

182

APS Bending Magnet X-rays and  

NLE Websites -- All DOE Office Websites (Extended Search)

Irradiation of Nd-Fe-B Permanent Magnets with Irradiation of Nd-Fe-B Permanent Magnets with APS Bending Magnet X-rays and 60 Co γ-rays J. Alderman and P.K. Job APS Operations Division Advanced Photon Source J. Puhl Ionizing Radiation Division National Institute of Standards and Technology June 2000 Table of Contents Introduction Radiation-Induced Demagnetization of Permanent Magnets Resources Required γ-ray Irradiation Results and Analysis of γ-ray Irradiation X-ray Irradiation Results and Analysis of X-ray Irradiation Summary and Conclusions Acknowledgements References Tables and Figures Introduction The Advanced Photon Source (APS), as well as other third-generation synchrotron light sources, uses permanent magnets in the insertion devices to produce x-rays for scientific

183

Session: CSP Advanced Systems -- Advanced Overview (Presentation)  

SciTech Connect

The project description is: (1) it supports crosscutting activities, e.g. advanced optical materials, that aren't tied to a single CSP technology and (2) it supports the 'incubation' of new concepts in preliminary stages of investigation.

Mehos, M.

2008-04-01T23:59:59.000Z

184

E-Print Network 3.0 - accreting magnetic white Sample Search...  

NLE Websites -- All DOE Office Websites (Extended Search)

magnetic white Search Powered by Explorit Topic List Advanced Search Sample search results for: accreting magnetic white Page: << < 1 2 3 4 5 > >> 1 Mon. Not. R. Astron. Soc. 000,...

185

E-Print Network 3.0 - aspect ratio micro-electro-magnetic-mechanical...  

NLE Websites -- All DOE Office Websites (Extended Search)

micro-electro-magnetic-mechanical Search Powered by Explorit Topic List Advanced Search Sample search results for: aspect ratio micro-electro-magnetic-mechanical Page: << < 1 2 3 4...

186

E-Print Network 3.0 - ankle magnetic resonance Sample Search...  

NLE Websites -- All DOE Office Websites (Extended Search)

Search Powered by Explorit Topic List Advanced Search Sample search results for: ankle magnetic resonance Page: << < 1 2 3 4 5 > >> 1 Evaluation of Methods That Locate the...

187

Symmetry and cluster magnetism  

Science Journals Connector (OSTI)

Three possible isomers of 13-atom iron clusters are studied using local-density-functional methods that allow the spin of the cluster to be determined self-consistently. The ground state is the icosahedral structure. It has the greatest magnetic moment because of increased symmetry-required orbital degeneracy for electrons of different spins.

Brett I. Dunlap

1990-05-15T23:59:59.000Z

188

Direct Imaging of Asymmetric Magnetization Reversal  

NLE Websites -- All DOE Office Websites (Extended Search)

Direct Imaging of Asymmetric Magnetization Reversal Print Direct Imaging of Asymmetric Magnetization Reversal Print The phenomenon of exchange bias has transformed how data is read on magnetic hard disks and created an explosion in their information storage density. However, it remains poorly understood, and even the fundamental mechanism of magnetic reversal for exchange-biased systems in changing magnetic fields is unclear. By using x-ray photoemission electron microscopy at the ALS to directly image the magnetic structure of an exchange-biased film, a team from the University of Washington and the Stanford Synchrotron Radiation Laboratory has identified separate magnetic-reversal mechanisms in the two branches of a hysteresis loop. This advance in fundamental understanding will provide new insights for developing the next generation of information storage and sensing devices where exchange bias is expected to play a critical role.

189

ALS superbend magnet system  

SciTech Connect

The Lawrence Berkeley National Laboratory is preparing to upgrade the Advanced Light Source (ALS) with three superconducting dipoles (Superbends). In this paper we present the final magnet system design which incorporates R&D test results and addresses the ALS operational concerns of alignment, availability, and economy. The design incorporates conduction-cooled Nb-Ti windings and HTS current leads, epoxy-glass suspension straps, and a Gifford-McMahon cryocooler to supply steady state refrigeration. We also present the current status of fabrication and testing.

Zbasnik, J.; Wang, S.T.; Chen, J.Y.; DeVries, G.J.; DeMarco, R.; Fahmie, M.; Geyer, A.; Green, M.A.; Harkins, J.; Henderson, T.; Hinkson, J.; Hoyer, E.H.; Krupnick, J.; Marks, S.; Ottens, F.; Paterson, J.A.; Pipersky, P.; Portmann, G.; Robin, D.A.; Schlueter, R.D.; Steier, C.; Taylor, C.E.; Wahrer, R.

2000-09-15T23:59:59.000Z

190

CX-009024: Categorical Exclusion Determination | Department of...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Exclusion Determination CX-009024: Categorical Exclusion Determination "Advanced Low Cost Receivers for Solar Parabolic Trough CX(s) Applied: B3.6, B5.17 Date: 08092012...

191

Ion Rings for Magnetic Fusion  

SciTech Connect

This Final Technical Report presents the results of the program, Ion Rings for Magnetic Fusion, which was carried out under Department of Energy funding during the period August, 1993 to January, 2005. The central objective of the program was to study the properties of field-reversed configurations formed by ion rings. In order to reach this objective, our experimental program, called the Field-reversed Ion Ring Experiment, FIREX, undertook to develop an efficient, economical technology for the production of field-reversed ion rings. A field-reversed configuration (FRC) in which the azimuthal (field-reversing) current is carried by ions with gyro-radius comparable to the magnetic separatrix radius is called a field-reversed ion ring. A background plasma is required for charge neutralization of the ring, and this plasma will be confined within the ring's closed magnetic flux. Ion rings have long been of interest as the basis of compact magnetic fusion reactors, as the basis for a high-power accelerator for an inertial fusion driver, and for other applications of high power ion beams or plasmas of high energy density. Specifically, the FIREX program was intended to address the longstanding question of the contribution of large-orbit ions to the observed stability of experimental FRCs to the MHD tilt mode. Typical experimental FRCs with s {approx} 2-4, where s is the ratio of separatrix radius to ion gyro-radius, have been stable to tilting, but desired values for a fusion reactor, s > 20, should be unstable. The FIREX ring would consist of a plasma with large s for the background ions, but with s {approx} 1 for the ring ions. By varying the proportions of these two populations, the minimum proportion of large-orbit ions necessary for stability could be determined. The incorporation of large-orbit ions, perhaps by neutral-beam injection, into an FRC has been advanced for the purpose of stabilizing, heating, controlling angular momentum, and aiding the formation of a reactor-scale FRC, and the FIREX program was intended to test the ideas behind this approach. We will describe in this report the technological development path and advances in physics understanding that allowed FIREX to reach a regime in which ion rings were reproducibly created with up to about half the current necessary to produce field reversal. Unfortunately, the experiments were limited to this level by a fundamental, unanticipated aspect of the physics of strong ion rings in plasma. The FIREX ring is a strongly anisotropic, current-carrying population of ions moving faster than the Alfven speed in the background plasma. The rapidly changing ring current excites very large-amplitude Alfven waves in the plasma, and these waves strongly affect the ring, causing rapid energy loss in a way that is not compatible with the success of the ring trapping scenario around which FIREX was designed. The result was that FIREX rings were always very short-lived. We will discuss the implication of these results for possible future use of large-orbit ions in FRCs. In short, it appears that a certain range of the parameters characterizing the ring Alfven mach number and distribution function must be avoided to allow the existence of a long-lived energetic ion component in an FRC. This report will explain why FIREX experimental results cannot be directly scaled to quantitatively predict this range for a particular FRC configuration. This will require accurate, three-dimensional simulations. FIREX results do constitute a very good dataset for validating such a code, and simulations already carried out during this program provide a guide to the important physics involved.

Greenly, John, B.

2005-07-31T23:59:59.000Z

192

Magnetic shielding  

DOE Patents (OSTI)

A magnetically-conductive filler material bridges the gap between a multi-part magnetic shield structure which substantially encloses a predetermined volume so as to minimize the ingress or egress of magnetic fields with respect to that volume. The filler material includes a heavy concentration of single-magnetic-domain-sized particles of a magnetically conductive material (e.g. soft iron, carbon steel or the like) dispersed throughout a carrier material which is generally a non-magnetic material that is at least sometimes in a plastic or liquid state. The maximum cross-sectional particle dimension is substantially less than the nominal dimension of the gap to be filled. An epoxy base material (i.e. without any hardening additive) low volatility vacuum greases or the like may be used for the carrier material. The structure is preferably exposed to the expected ambient magnetic field while the carrier is in a plastic or liquid state so as to facilitate alignment of the single-magnetic-domain-sized particles with the expected magnetic field lines. 3 figs.

Kerns, J.A.; Stone, R.R.; Fabyan, J.

1987-10-06T23:59:59.000Z

193

Magnetic shielding  

DOE Patents (OSTI)

A magnetically-conductive filler material bridges the gap between a multi-part magnetic shield structure which substantially encloses a predetermined volume so as to minimize the ingress or egress of magnetic fields with respect to that volume. The filler material includes a heavy concentration of single-magnetic-domain-sized particles of a magnetically conductive material (e.g. soft iron, carbon steel or the like) dispersed throughout a carrier material which is generally a non-magnetic material that is at least sometimes in a plastic or liquid state. The maximum cross-sectional particle dimension is substantially less than the nominal dimension of the gap to be filled. An epoxy base material (i.e. without any hardening additive) low volatility vacuum greases or the like may be used for the carrier material. The structure is preferably exposed to the expected ambient magnetic field while the carrier is in a plastic or liquid state so as to facilitate alignment of the single-magnetic-domain-sized particles with the expected magnetic field lines.

Kerns, John A. (Livermore, CA); Stone, Roger R. (Walnut Creek, CA); Fabyan, Joseph (Livermore, CA)

1987-01-01T23:59:59.000Z

194

Strange Magnetism  

E-Print Network (OSTI)

We present an analytic and parameter-free expression for the momentum dependence of the strange magnetic form factor of the nucleon and its corresponding radius which has been derived in Heavy Baryon Chiral Perturbation Theory. We also discuss a model-independent relation between the isoscalar magnetic and the strange magnetic form factors of the nucleon based on chiral symmetry and SU(3) only. These limites are used to derive bounds on the strange magnetic moment of the proton from the recent measurement by the SAMPLE collaboration.

Thomas R. Hemmert; Ulf-G. Meissner; Sven Steininger

1998-11-09T23:59:59.000Z

195

Optical Magnetism  

Science Journals Connector (OSTI)

Magnetic dipole radiation one fourth as intense as electric dipole radiation, as well as a novel nonlinear magneto-optical effect are reported in dielectric media.

Oliveira, Samuel L; Rand, Stephen C

196

Magnetic Field Safety Magnetic Field Safety  

E-Print Network (OSTI)

Magnetic Field Safety Training #12;Magnetic Field Safety Strong Magnetic Fields exist around energized magnets. High magnetic fields alone are a recognized hazard only for personnel with certain medical conditions such as pacemakers, magnetic implants, or embedded shrapnel. In addition, high magnetic

McQuade, D. Tyler

197

Magnetic Field Safety Training  

NLE Websites -- All DOE Office Websites (Extended Search)

Safety Training Magnetic Field Safety Strong Magnetic Fields exist around energized magnets. High magnetic fields alone are a recognized hazard only for personnel with certain...

198

Advanced Materials | ORNL  

NLE Websites -- All DOE Office Websites (Extended Search)

Research Areas Research Areas Research Highlights Facilities and Capabilities Science to Energy Solutions News & Awards Events and Conferences Supporting Organizations Directionally Solidified Materials Using high-temperature optical floating zone furnace to produce monocrystalline molybdenum alloy micro-pillars Home | Science & Discovery | Advanced Materials Advanced Materials | Advanced Materials SHARE ORNL has the nation's most comprehensive materials research program and is a world leader in research that supports the development of advanced materials for energy generation, storage, and use. We have core strengths in three main areas: materials synthesis, characterization, and theory. In other words, we discover and make new materials, we study their structure,

199

Advanced Concepts Breakout Group  

NLE Websites -- All DOE Office Websites (Extended Search)

Workshop Workshop Advanced Concepts Working Group Facilitator: John J. Petrovic Scribe: Sherry Marin Advanced Storage Techniques/ Approaches in Priority Order 1. Crystalline Nanoporous Materials (15) 2. Polymer Microspheres (12) Self-Assembled Nanocomposites (12) 3. Advanced Hydrides (11) Metals - Organic (11) 4. BN Nanotubes (5) Hydrogenated Amorphous Carbon (5) 5. Mesoporous materials (4) Bulk Amorphous Materials (BAMs) (4) 6. Iron Hydrolysis (3) 7. Nanosize powders (2) 8. Metallic Hydrogen (1) Hydride Alcoholysis (1) Overarching R&D Questions for All Advanced Materials * Maximum storage capacity - theoretical model * Energy balance / life cycle analysis * Hydrogen absorption / desorption kinetics * Preliminary cost analysis - potential for low cost, high

200

Institute for Advanced Studies  

NLE Websites -- All DOE Office Websites (Extended Search)

Institute for Advanced Studies Institute for Advanced Studies Institute for Advanced Studies NMC leverages the strengths of three research universities to build joint programs, develop strategic partnerships, provide common organization and facilities. Contact Leader TBD LANL Program Administrator Pam Hundley (505) 663-5453 Email Building regional partnerships in education, leveraging strengths of three research universities The Institute for Advanced Studies (IAS) works with the three New Mexico research universities (University of New Mexico, New Mexico Tech, and New Mexico State University) to develop research and educational collaborations and partnerships. To facilitate interactions between the universities and LANL, the three New Mexico schools established the New Mexico Consortium (NMC), a nonprofit

Note: This page contains sample records for the topic "determination advanced magnetic" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


201

Advanced Cathode Catalysts  

Energy.gov (U.S. Department of Energy (DOE))

This presentation, which focuses on advanced cathode catalysts, was given by Piotr Zelenay of Los Alamos National laboratory at a February 2007 meeting on new fuel cell projects.

202

Advance Care Planning Safeguards  

Science Journals Connector (OSTI)

Regardless of which goals of advance care planning are featured, safeguards, as reviewed in my article and by...5 we inadvertently may be doing harm.

J. Andrew Billings MD

2012-11-01T23:59:59.000Z

203

Advanced Reciprocating Engine Systems  

Energy.gov (U.S. Department of Energy (DOE))

The Advanced Reciprocating Engine Systems (ARES) program is designed to promote separate but parallel engine development between the major stationary, gaseous fueled engine manufacturers in the...

204

Advanced Fuel Cycle Program  

NLE Websites -- All DOE Office Websites (Extended Search)

Working with INL Community Outreach Visitor Information Calendar of Events ATR National Scientific User Facility Center for Advanced Energy Studies Light Water Reactor...

205

Advances in Physical Chemistry  

NLE Websites -- All DOE Office Websites (Extended Search)

Hindawi Publishing Corporation Advances in Physical Chemistry Volume 2011, Article ID 907129, 18 pages doi:10.11552011907129 Review Article Contrast and Synergy between...

206

People | Advanced Photon Source  

NLE Websites -- All DOE Office Websites (Extended Search)

User Office Floor Coordinators Beamline Phones Sectors Directory Media Contact Rick Fenner (630) 252-5280 Webmaster Kelly Cunningham (630) 252-0619 Mailing Address Advanced...

207

Advances in photosynthesis  

Science Journals Connector (OSTI)

Advances in photosynthesis ... This article emphasizes the relation between photosynthetic chemistry and the molecular architecture of the photosynthetic center in plant cells. ...

Roderic B. Park

1962-01-01T23:59:59.000Z

208

Magnetic insulation  

Science Journals Connector (OSTI)

... by Winterberg1, led me to look into the background of the idea of 'magnetic insulation'. The purpose of this letter is to point out that the scheme described in ... were presented earlier in a longer article2. In that article he suggested that 'magnetic insulation' might make possible a transformer for 109 V. A year later the same objections ...

JOHN P. BLEWETT

1974-06-28T23:59:59.000Z

209

Magnetism1  

Science Journals Connector (OSTI)

... is reached, the rate of diminution becomes very rapid indeed, until, finally, the magnetism of the iron disappears at the same time as for small forces. Instead of ... a lower maximum, and its rise is less rapid. The critical temperature at which magnetism disappears changes rapidly with the composition of the steel. For very soft charcoal iron ...

1890-01-23T23:59:59.000Z

210

Magnetism Group  

Science Journals Connector (OSTI)

... of the Institute of Physics and the Physical Society has announced the establishment of a Magnetism Group. The aim of the new Group is to further interest in ... Group. The aim of the new Group is to further interest in magnetism by holding regular discussion meetings and in other ways. It is intended that these ...

1965-09-04T23:59:59.000Z

211

Terrestrial Magnetism*  

Science Journals Connector (OSTI)

... A similar investigation of the effect of the moon's action on terrestrial magnetism requires a series of observations made at much less distant intervals than the monthly ones ... heat, from the central body of our system, or merely having its own inherent magnetism modified by solar action, then we must choose as our unit the lunation, or ...

1873-01-09T23:59:59.000Z

212

Terrestrial Magnetism*  

Science Journals Connector (OSTI)

... IN bringing before you this evening, gentlemen, the subject of terrestrial magnetism, it is not my intention to attempt to present you with an exhaustive paper ... clearly as I am able, what is the actual condition of our knowledge respecting the magnetism of the globe, and what the nature of its complex variations, without, however, ...

1873-01-02T23:59:59.000Z

213

Terrestrial Magnetism  

Science Journals Connector (OSTI)

... THE present activity of the department of terrestrial magnetism of the Carnegie Institution of Washington and the largeness of its future aims are alike ... a progress report which he contributes to the latest (March) number of Terrestrial Magnetism. The department, which has lately entered on its eleventh year, has under construetion ...

C. CHREE

1914-07-23T23:59:59.000Z

214

Magnetic shielding  

DOE Patents (OSTI)

A magnetically-conductive filler material bridges the gap between a multi-part magnetic shield structure which substantially encloses a predetermined volume so as to minimize the ingress or egress of magnetic fields with respect to that volume. The filler material includes a heavy concentration of single-magnetic-domain-sized particles of a magnetically conductive material (e.g. soft iron, carbon steel or the like) dispersed throughout a carrier material which is generally a non-magnetic material that is at least sometimes in a plastic or liquid state. The maximum cross-sectional particle dimension is substantially less than the nominal dimension of the gap to be filled. An epoxy base material (i.e. without any hardening additive) low volatility vacuum greases or the like may be used for the carrier material. The structure is preferably exposed to the expected ambient field while the carrier is in a plastic or liquid state so as to facilitate alignment of the single-magnetic-domain-sized particles with the expected magnetic field lines.

Kerns, J.A.; Stone, R.R.; Fabyan, J.

1985-02-12T23:59:59.000Z

215

New classes of magnetoelectric materials promise advances in computing  

NLE Websites -- All DOE Office Websites (Extended Search)

New classes of magnetoelectric materials promise advances in computing New classes of magnetoelectric materials promise advances in computing technology By Jared Sagoff * February 7, 2013 Tweet EmailPrint ARGONNE, Ill. - Although scientists have been aware that magnetism and electricity are two sides of the same proverbial coin for almost 150 years, researchers are still trying to find new ways to use a material's electric behavior to influence its magnetic behavior, or vice versa. Thanks to new research by an international team of researchers led by the U.S. Department of Energy's Argonne National Laboratory, physicists have developed new methods for controlling magnetic order in a particular class of materials known as "magnetoelectrics." Magnetoelectrics get their name from the fact that their magnetic and electric properties are coupled to each other. Because this physical link

216

Superconducting Magnets  

NLE Websites -- All DOE Office Websites (Extended Search)

Mit Hilfe der Technologie supraleitender Magnete lassen sich in Mit Hilfe der Technologie supraleitender Magnete lassen sich in Ringbeschleunigern höhere Energien erreichen. Weil supraleitende Spulen keinen elektrischen Widerstand aufweisen, können damit stärkere Magnetfelder erzeugt werden. In normal leitenden Elektromagneten wird - wegen des elektrischen Widerstands der Drähte - die Spule aufgeheizt. Auf diese Weise geht sehr viel Energie in Form von Wärme verloren, was die Energiekosten dieser Magnete in die Höhe treibt. Supraleitende Spulen erlauben es, Magnete grosser Feldstärke unter günstigen Bedingungen zu betreiben und damit die Energiekosten zu senken. Durch den Einbau supraleitender Spulen in den Ringbeschleuniger von Fermilab konnte dessen Energie verdoppelt werden.Auch der im Bau befindliche "Large Hadron Collider" am CERN wird supraleitende Magnete

217

Magnetic nanotubes  

DOE Patents (OSTI)

A magnetic nanotube includes bacterial magnetic nanocrystals contacted onto a nanotube which absorbs the nanocrystals. The nanocrystals are contacted on at least one surface of the nanotube. A method of fabricating a magnetic nanotube includes synthesizing the bacterial magnetic nanocrystals, which have an outer layer of proteins. A nanotube provided is capable of absorbing the nanocrystals and contacting the nanotube with the nanocrystals. The nanotube is preferably a peptide bolaamphiphile. A nanotube solution and a nanocrystal solution including a buffer and a concentration of nanocrystals are mixed. The concentration of nanocrystals is optimized, resulting in a nanocrystal to nanotube ratio for which bacterial magnetic nanocrystals are immobilized on at least one surface of the nanotubes. The ratio controls whether the nanocrystals bind only to the interior or to the exterior surfaces of the nanotubes. Uses include cell manipulation and separation, biological assay, enzyme recovery, and biosensors.

Matsui, Hiroshi (Glen Rock, NJ); Matsunaga, Tadashi (Tokyo, JP)

2010-11-16T23:59:59.000Z

218

Magnetic Anisotropy as an Aid to Identifying CRM and DRM in Red Sedimentary Rocks  

Science Journals Connector (OSTI)

To further evaluate the potential of magnetic anisotropy techniques for determining the origin of the natural remanent magnetization (NRM) in sedimentary rocks, several new remanence anisotropy measurement tec...

K.P. Kodama; M.J. Dekkers

2004-10-01T23:59:59.000Z

219

Magnetic neutron scattering (invited)  

Science Journals Connector (OSTI)

The application of neutron scattering techniques to magnetic problems is reviewed. We will first discuss diffraction techniques used to solve magnetic structures as well as to measure magnetic form factors order parameters critical phenomena and the scattering from low?dimensional systems. We will also discuss inelastic scattering techniques including polarized beam methods utilized to determine the spin dynamics of various materials. Information will be provided about the types of spectrometers available at the user?oriented national facilities located at Argonne National Laboratory Brookhaven National Laboratory Los Alamos National Laboratory The National Institute of Standards and Technology and Oak Ridge National Laboratory as well as the spectrometers at the Missouri University Research Reactor.

J. W. Lynn

1994-01-01T23:59:59.000Z

220

Kansas Advanced Semiconductor Project  

SciTech Connect

KASP (Kansas Advanced Semiconductor Project) completed the new Layer 0 upgrade for D0, assumed key electronics projects for the US CMS project, finished important new physics measurements with the D0 experiment at Fermilab, made substantial contributions to detector studies for the proposed e+e- international linear collider (ILC), and advanced key initiatives in non-accelerator-based neutrino physics.

Baringer, P.; Bean, A.; Bolton, T.; Horton-Smith, G.; Maravin, Y.; Ratra, B.; Stanton, N.; von Toerne, E.; Wilson, G.

2007-09-21T23:59:59.000Z

Note: This page contains sample records for the topic "determination advanced magnetic" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


221

Magnetic measurements at Lawrence Berkeley Laboratory. Revision  

SciTech Connect

Recent magnetic measurement activities at LBL have been concentrated in two separate areas, electro-magnets and permanent magnets for the Advanced Light Source (ALS), and superconducting magnets for the Superconducting Super Collider Laboratory (SSCL). A survey of the many different measurement systems is presented. These include: AC magnetic measurements of an ALS booster dipole engineering model magnet, dipole moment measurements of permanent magnet blocks for ALS wigglers and undulators, permeability measurements of samples destined for wiggler and undulator poles, harmonic error analysis of SSC one meter model dipoles and quadrupoles and five meter long SSC prototype quadrupoles, harmonic error analysis of ALS dipoles, quadrupoles, and sextupoles, precision Hall probe mapping of ALS storage ring combined function magnets, and the design of the ALS insertion device magnets mapping system. We also describe a new UNIX based data acquisition system that is being developed for the SSC. Probes used for magnetic measurements include Helmholtz coils, integral coils, point coils, and bucking harmonic analysis coils, several different types of Hall probes, and nuclear magnetic resonance magnetometers. Both analog and digital integrators are used with the coils. Some problems that occurred and their rectification is described. The mechanisms used include rotating systems with optical encoders, X-Y mapping systems with optical encoders and a laser position measuring device. 10 refs., 3 figs., 1 tab.

Green, M.I.; Barale, P.; Callapp, L.; Case-Fortier, M.; Lerner, D.; Nelson, D.; Schermer, R.; Skipper, G.; Van Dyke, D.; Cork, C.; Halbach, K.; Hassenzahl, W.; Hoyer, E.; Marks, S.; Harten, T.; Luchini, K.; Milburn, J.; Tanabe, J.; Zucca, F.; Keller, R.; Selph, F.; Gilbert, W.; Green, M.A.; O`Neil, J.; Schafer, R.; Taylor, C.; Greiman, W.; Hall, D.; MacFarlane, J.

1991-08-01T23:59:59.000Z

222

Advanced Hydrogen Turbine Development  

SciTech Connect

Siemens has developed a roadmap to achieve the DOE goals for efficiency, cost reduction, and emissions through innovative approaches and novel technologies which build upon worldwide IGCC operational experience, platform technology, and extensive experience in G-class operating conditions. In Phase 1, the technologies and concepts necessary to achieve the program goals were identified for the gas turbine components and supporting technology areas and testing plans were developed to mitigate identified risks. Multiple studies were conducted to evaluate the impact in plant performance of different gas turbine and plant technologies. 2015 gas turbine technologies showed a significant improvement in IGCC plant efficiency, however, a severe performance penalty was calculated for high carbon capture cases. Thermodynamic calculations showed that the DOE 2010 and 2015 efficiency targets can be met with a two step approach. A risk management process was instituted in Phase 1 to identify risk and develop mitigation plans. For the risks identified, testing and development programs are in place and the risks will be revisited periodically to determine if changes to the plan are necessary. A compressor performance prediction has shown that the design of the compressor for the engine can be achieved with additional stages added to the rear of the compressor. Tip clearance effects were studied as well as a range of flow and pressure ratios to evaluate the impacts to both performance and stability. Considerable data was obtained on the four candidate combustion systems: diffusion, catalytic, premix, and distributed combustion. Based on the results of Phase 1, the premixed combustion system and the distributed combustion system were chosen as having the most potential and will be the focus of Phase 2 of the program. Significant progress was also made in obtaining combustion kinetics data for high hydrogen fuels. The Phase 1 turbine studies indicate initial feasibility of the advanced hydrogen turbine that meets the aggressive targets set forth for the advanced hydrogen turbine, including increased rotor inlet temperature (RIT), lower total cooling and leakage air (TCLA) flow, higher pressure ratio, and higher mass flow through the turbine compared to the baseline. Maintaining efficiency with high mass flow Syngas combustion is achieved using a large high AN2 blade 4, which has been identified as a significant advancement beyond the current state-of-the-art. Preliminary results showed feasibility of a rotor system capable of increased power output and operating conditions above the baseline. In addition, several concepts were developed for casing components to address higher operating conditions. Rare earth modified bond coat for the purpose of reducing oxidation and TBC spallation demonstrated an increase in TBC spallation life of almost 40%. The results from Phase 1 identified two TBC compositions which satisfy the thermal conductivity requirements and have demonstrated phase stability up to temperatures of 1850 C. The potential to join alloys using a bonding process has been demonstrated and initial HVOF spray deposition trials were promising. The qualitative ranking of alloys and coatings in environmental conditions was also performed using isothermal tests where significant variations in alloy degradation were observed as a function of gas composition. Initial basic system configuration schematics and working system descriptions have been produced to define key boundary data and support estimation of costs. Review of existing materials in use for hydrogen transportation show benefits or tradeoffs for materials that could be used in this type of applications. Hydrogen safety will become a larger risk than when using natural gas fuel as the work done to date in other areas has shown direct implications for this type of use. Studies were conducted which showed reduced CO{sub 2} and NOx emissions with increased plant efficiency. An approach to maximize plant output is needed in order to address the DOE turbine goal for 20-30% reduction o

Joesph Fadok

2008-01-01T23:59:59.000Z

223

Advanced Windows Test Facility  

NLE Websites -- All DOE Office Websites (Extended Search)

Exterior of Advanced Windows Test Facility Exterior of Advanced Windows Test Facility Advanced Windows Test Facility This multi-room laboratory's purpose is to test the performance and properties of advanced windows and window systems such as electrochromic windows, and automatically controlled shutters and blinds. The lab simulates real-world office spaces. Embedded instrumentation throughout the lab records solar gains and losses for specified time periods, weather conditions, energy use, and human comfort indicators. Electrochromic glazings promise to be a major advance in energy-efficient window technology, helping to achieve the goal of transforming windows and skylights from an energy liability in buildings to an energy source. The glazing can be reversibly switched from a clear to a transparent, colored

224

Advanced Fuels Synthesis  

NLE Websites -- All DOE Office Websites (Extended Search)

Advanced Fuels Synthesis Advanced Fuels Synthesis Coal and Coal/Biomass to Liquids Advanced Fuels Synthesis The Advanced Fuels Synthesis Key Technology is focused on catalyst and reactor optimization for producing liquid hydrocarbon fuels from coal/biomass mixtures, supports the development and demonstration of advanced separation technologies, and sponsors research on novel technologies to convert coal/biomass to liquid fuels. Active projects within the program portfolio include the following: Fischer-Tropsch fuels synthesis Small Scale Coal Biomass Liquids Production Using Highly Selective Fischer Tropsch Catalyst Small Scale Pilot Plant for the Gasification of Coal and Coal/Biomass Blends and Conversion of Derived Syngas to Liquid Fuels Via Fischer-Tropsch Synthesis Coal Fuels Alliance: Design and Construction of Early Lead Mini Fischer-Tropsch Refinery

225

Linear chain magnetism  

Science Journals Connector (OSTI)

Linear chain magnetism ... A brief introduction to this concept, which is also called lower dimensional magnetism. ...

Richard L. Carlin

1991-01-01T23:59:59.000Z

226

NETL: Mercury Emissions Control Technologies - Advanced Utility  

NLE Websites -- All DOE Office Websites (Extended Search)

Advanced Utility Mercury-Sorbent Field Testing Program Advanced Utility Mercury-Sorbent Field Testing Program Sorbent Technologies Corporation, will test an advanced halgenated activated carbon to determine the mercury removal performance and relative costs of sorbent injection for advanced sorbent materials in large-scale field trials of a variety of combinations of coal-type and utility plant-configuration. These include one site (Detroit Edison's St. Clair Station) with a cold-side ESP using subbituminous coal, or blend of subbituminous and bituminous coal, and one site (Duke Energy's Buck Plant) with a hot-side ESP which burns a bituminous coal. Related Papers and Publications: Semi-Annual Technical Progress Report for the period April 1 - October 31, 2004 [PDF-2275KB] Semi-Annual Technical Progress Report for the period of October 2003 - March 2004 [PDF-1108KB]

227

A Methodology to Integrate Magnetic Resonance and Acoustic Measurements for Reservoir Characterization  

SciTech Connect

The objective of this project was to develop an advanced imaging method, including pore scale imaging, to integrate magnetic resonance (MR) techniques and acoustic measurements to improve predictability of the pay zone in two hydrocarbon reservoirs. This was accomplished by extracting the fluid property parameters using MR laboratory measurements and the elastic parameters of the rock matrix from acoustic measurements to create poroelastic models of different parts of the reservoir. Laboratory measurements were compared with petrographic analysis results to determine the relative roles of petrographic elements such as porosity type, mineralogy, texture, and distribution of clay and cement in creating permeability heterogeneity.

Parra, J.O.

2001-01-26T23:59:59.000Z

228

Low dimensional magnetism  

E-Print Network (OSTI)

Magnetism in Ultracold Gases 4 Magnetic phase diagram of aMagnetism . . . . . . . . . . . .1.3 Magnetism in condensedIntroduction 1 Brief introduction to magnetism 1.1 Classic

Kjall, Jonas Alexander

2012-01-01T23:59:59.000Z

229

Compatibility of Physics and Engineering in Magnetic Fusion White Paper on Magnetic Fusion Priorities  

E-Print Network (OSTI)

the magnetic field lines within the plasma. In a fusion plasma, the last two of these are largely self magnetic fields, (2) the plasma pressure profile, and (3) the profile of the net current flowing along- determined, so the freedom of physics design is primarily in the externally produced magnetic field

230

Magnetic Viscosity  

Science Journals Connector (OSTI)

1 January 1893 research-article Magnetic Viscosity J. Hopkinson E. Wilson F. Lydall The Royal Society is collaborating with JSTOR to digitize, preserve, and extend access to Proceedings of the Royal Society of London. www.jstor.org

1893-01-01T23:59:59.000Z

231

Rock magnetism  

Science Journals Connector (OSTI)

The past three decades have witnessed a new paradigm, the plate tectonics paradigm, in Earth sciences. The record of the Earth's magnetic field stored in rocks played a major role in the establishment of this par...

Ronald T. Merrill

1989-01-01T23:59:59.000Z

232

Learning About Magnets!  

NLE Websites -- All DOE Office Websites (Extended Search)

the the National High Magnetic Field Laboratory Learning About Name A magnet is a material or object that creates a magnetic fi eld. This fi eld is invisible, but it creates a force that can "attract" or "repel" other magnets and magnetic materials, like iron or nickel. What is a Magnet? This bar magnet is a permanent magnet. Permanent magnets can be found in the Earth as rocks and metals. Magnets have

233

MAGNETIC NEUTRON SCATTERING  

SciTech Connect

Much of our understanding of the atomic-scale magnetic structure and the dynamical properties of solids and liquids was gained from neutron-scattering studies. Elastic and inelastic neutron spectroscopy provided physicists with an unprecedented, detailed access to spin structures, magnetic-excitation spectra, soft-modes and critical dynamics at magnetic-phase transitions, which is unrivaled by other experimental techniques. Because the neutron has no electric charge, it is an ideal weakly interacting and highly penetrating probe of matter's inner structure and dynamics. Unlike techniques using photon electric fields or charged particles (e.g., electrons, muons) that significantly modify the local electronic environment, neutron spectroscopy allows determination of a material's intrinsic, unperturbed physical properties. The method is not sensitive to extraneous charges, electric fields, and the imperfection of surface layers. Because the neutron is a highly penetrating and non-destructive probe, neutron spectroscopy can probe the microscopic properties of bulk materials (not just their surface layers) and study samples embedded in complex environments, such as cryostats, magnets, and pressure cells, which are essential for understanding the physical origins of magnetic phenomena. Neutron scattering is arguably the most powerful and versatile experimental tool for studying the microscopic properties of the magnetic materials. The magnitude of the cross-section of the neutron magnetic scattering is similar to the cross-section of nuclear scattering by short-range nuclear forces, and is large enough to provide measurable scattering by the ordered magnetic structures and electron spin fluctuations. In the half-a-century or so that has passed since neutron beams with sufficient intensity for scattering applications became available with the advent of the nuclear reactors, they have became indispensable tools for studying a variety of important areas of modern science, ranging from large-scale structures and dynamics of polymers and biological systems, to electronic properties of today's technological materials. Neutron scattering developed into a vast field, encompassing many different experimental techniques aimed at exploring different aspects of matter's atomic structure and dynamics. Modern magnetic neutron scattering includes several specialized techniques designed for specific studies and/or particular classes of materials. Among these are magnetic reflectometry aimed at investigating surfaces, interfaces, and multilayers, small-angle scattering for the large-scale structures, such as a vortex lattice in a superconductor, and neutron spin-echo spectroscopy for glasses and polymers. Each of these techniques and many others offer exciting opportunities for examining magnetism and warrant extensive reviews, but the aim of this chapter is not to survey how different neutron-scattering methods are used to examine magnetic properties of different materials. Here, we concentrate on reviewing the basics of the magnetic neutron scattering, and on the recent developments in applying one of the oldest methods, the triple axis spectroscopy, that still is among the most extensively used ones. The developments discussed here are new and have not been coherently reviewed. Chapter 2 of this book reviews magnetic small-angle scattering, and modern techniques of neutron magnetic reflectometry are discussed in Chapter 3.

ZALIZNYAK,I.A.; LEE,S.H.

2004-07-30T23:59:59.000Z

234

Carbon Joins the Magnetic Club  

NLE Websites -- All DOE Office Websites (Extended Search)

Press Release 29 May 2007 Carbon Joins the Magnetic Club summary written by Brad Plummer, SLAC Communication Office The exclusive club of magnetic elements officially has a new member-carbon. Using a proton beam and advanced x-ray techniques, SLAC researchers in collaboration with colleagues from LBNL and the University of Leipzig in Germany have finally put to rest doubts about carbon's ability to be made magnetic. "In the past, some groups thought they had discovered magnetic carbon," said Hendrik Ohldag, the paper's lead author and SSRL staff scientist. "Unfortunately, they realized later that they were misled by small amounts of iron, cobalt or nickel in their samples." In Leipzig, Ohldag's team applied a beam of protons to disrupt and align a portion of the electrons in samples of pure carbon, magnetizing tiny, measurable spots within the carbon. The team then used the x-ray microscope at ALS to obtain images of the magnetized portions-a measurement only possible with a state-of-the-art microscope that uses the brilliant x-ray beams generated when electrons accelerate around the ring of a synchrotron. The x-ray beam also enabled the team to verify beyond doubt that the sample remained free of impurities during the experiments, unlike the case in previous studies.

235

Controlling Magnetism at the Nanoscale  

E-Print Network (OSTI)

Manipulation of Magnetism - External148 Conclusion A The Magnetism Cheat Sheet A.1 Magnetic157 A.2 Magnetism Unit Conversion

Wong, Jared

2012-01-01T23:59:59.000Z

236

Water: Advanced Irrigation Technologies  

Science Journals Connector (OSTI)

Abstract Limited opportunities to further expand the volume of global freshwaters allocated to irrigation means that advanced irrigation technologies, aiming to improve efficiency of existing systems, are timely needed and are of paramount importance. This article Advanced Irrigation Technologies describes the latest advances in irrigation application methods, irrigation management, and other novel developments. It provides a vision for the future, including emerging risks, opportunities, and technical challenges, as the world gears up to supply 50% more food to an additional 2 billion people by 2050.

C.B. Hedley; J.W. Knox; S.R. Raine; R. Smith

2014-01-01T23:59:59.000Z

237

ADVANCES IN ENVIRONMENTAL REACTION KINETICS AND THERMODYNAMICS  

E-Print Network (OSTI)

1262 ADVANCES IN ENVIRONMENTAL REACTION KINETICS AND THERMODYNAMICS: LONG-TERM FATE thermodynamic and kinetic data is available with regard to the formation of these mixed metal precipitate phases to six months from the initial addition of aqueous nickel. Additionally, we have determined thermodynamic

Sparks, Donald L.

238

Formation of magnetic islands due to field perturbations in toroidal stellarators  

SciTech Connect

An explicit formulation is developed to determine the width of a magnetic island separatrix generated by magnetic field perturbations in a general toroidal stellarator geometry. A conventional method is employed to recast the analysis in a magnetic flux coordinate system without using any simplifying approximations. The island width is seen to be proportional to the square root of the Fourier harmonic of B{sup {rho}}/B{sup {zeta}} that is in resonance with the rational value of the rotational transform, where B{sup {rho}} and B{sup {zeta}} are contravariant normal and toroidal components of the perturbed magnetic field, respectively. The procedure, which is based on a representation of three-dimensional flux surfaces by double Fourier series, allows rapid and fairly accurate calculation of the island widths in real vacuum field configurations, without the need to follow field lines through numerical integration of the field line equations. Numerical results of the island width obtained in the flux coordinate representation for the Advanced Toroidal Facility agree closely with those determined from Poincare puncture points obtained by following field lines. 22 refs., 1 fig., 1 tab.

Lee, Deok Kyo.

1990-01-01T23:59:59.000Z

239

Advances in Transportation Technologies | Department of Energy  

Office of Environmental Management (EM)

Advances in Transportation Technologies Advances in Transportation Technologies Advances in Transportation Technologies More Documents & Publications TEC Working Group Topic Groups...

240

Draft Advanced Nuclear Energy Projects Solicitation | Department...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Projects Solicitation Draft Advanced Nuclear Energy Projects Solicitation Federal loan guarantee solicitation announcement -- Advanced Nuclear Energy Projects. Draft Advanced...

Note: This page contains sample records for the topic "determination advanced magnetic" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


241

Advanced Nuclear Energy Projects Solicitation | Department of...  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

Advanced Nuclear Energy Projects Solicitation Advanced Nuclear Energy Projects Solicitation INFORMATIONAL MATERIALS ADVANCED NUCLEAR ENERGY PROJECTS SOLICITATION Solicitation...

242

Draft Advanced Nuclear Energy Projects Solicitation | Department...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Draft Advanced Nuclear Energy Projects Solicitation Draft Advanced Nuclear Energy Projects Solicitation INFORMATIONAL MATERIALS DRAFT ADVANCED NUCLEAR ENERGY PROJECTS SOLICITATION...

243

Advanced Technology Vehicles Manufacturing Incentive Program...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Advanced Technology Vehicles Manufacturing Incentive Program Advanced Technology Vehicles Manufacturing Incentive Program A fact sheet detailling the advanced technology vehicles...

244

Neutrino magnetic moment in a magnetized plasma  

E-Print Network (OSTI)

The contribution of a magnetized plasma to the neutrino magnetic moment is calculated. It is shown that only part of the additional neutrino energy in magnetized plasma connecting with its spin and magnetic field strength defines the neutrino magnetic moment. It is found that the presence of magnetized plasma does not lead to the considerable increase of the neutrino magnetic moment in contrast to the results presented in literature previously.

N. V. Mikheev; E. N. Narynskaya

2010-11-08T23:59:59.000Z

245

NETL: Advanced Research  

NLE Websites -- All DOE Office Websites (Extended Search)

AR AR Coal and Power Systems Advanced Research 12.11.13: Request for Information entitled "Novel Crosscutting Research and Development to Support Advanced Energy Systems". Application due date is January 15, 2014. The RFI and/or instructions can be found on the FedConnect site at FedConnect. Achieving Successes in High Performance Materials, Coal Utilization Sciences, Sensors & Controls Innovations, Computational Energy Sciences, Cooperative Research and Development, and sponsoring Education Initiatives. The Advanced Research (AR) program within NETL's Office of Coal and Power Systems fosters the development of innovative, cost-effective technologies for improving the efficiency and environmental performance of advanced coal and power systems. In addition, AR bridges the gap between fundamental

246

Advanced Hydraulic Wind Energy  

Science Journals Connector (OSTI)

The Jet Propulsion Laboratory, California Institute of Technology, has developed a novel advanced hydraulic wind energy design, which has up to 23% performance improvement over conventional wind turbine and conventional hydraulic wind energy systems ... Keywords: wind, tide, energy, power, hydraulic

Jack A. Jones; Allan Bruce; Adrienne S. Lam

2013-04-01T23:59:59.000Z

247

The Advanced Manufacturing Partnership  

E-Print Network (OSTI)

;ve Manufacturing Technologies (led by Dow, Honeywell and MIT) Manufacturing Ins;tutes (led, Honeywell and MIT GOALS § To launch public-private ini:a:ves to advance transforma

Das, Suman

248

Advance Care Planning Safeguards  

Science Journals Connector (OSTI)

To the Editors:We read with interest the recent article by Dr. Billings.1...In the article, Dr. Billings defines the goal of advance care planning as promoting the autonomy of decisionally incapac...

Sangeeta C. Ahluwalia PhD; MPH; Howard S. Gordon MD

2012-11-01T23:59:59.000Z

249

Search Asia Advanced Search  

E-Print Network (OSTI)

Asia Times Search Asia Times Advanced Search Southeast Asia Malaysia tackles illegal logging:52:14 AM Search #12;Asia Times illegal logging," he said, adding that nine Malaysians had been arrested

250

Search Asia Advanced Search  

E-Print Network (OSTI)

Asia Times Search Asia Times Advanced Search Southeast Asia Indonesia looks to curb log smuggling.html (1 of 2)9/4/2007 12:59:34 PM Search #12;Asia Times No material from Asia Times Online may

251

Advanced Review Geometry optimization  

E-Print Network (OSTI)

Advanced Review Geometry optimization H. Bernhard Schlegel Geometry optimization is an important part of most quantum chemical calcu- lations. This article surveys methods for optimizing equilibrium geometries, lo- cating transition structures, and following reaction paths. The emphasis is on optimizations

Schlegel, H. Bernhard

252

People | Advanced Photon Source  

NLE Websites -- All DOE Office Websites (Extended Search)

apsuser@aps.anl.gov (630) 252-9090 8:30 am - 5:30 pm, Monday-Friday Media Contact Rick Fenner (630) 252-5280 Webmaster Kelly Cunningham (630) 252-0619 Mailing Address Advanced...

253

Photon Magnetic Moment and Vacuum Magnetization in an Asymptotically Large Magnetic Field  

E-Print Network (OSTI)

We consider the effect of the photon radiative correction on the vacuum energy in a superstrong magnetic field. The notion of a photon anomalous magnetic moment is analyzed and its connection with the quasiparticle character of the electromagnetic radiation is established. In the infrared domain the magnetic moment turns out to be a vector with two orthogonal components in correspondence with the cylindrical symmetry imposed by the external field. The possibility of defining such quantity in the high energy limit is studied as well. Its existence suggests that the electromagnetic radiation is a source of magnetization to the whole vacuum and thus its electron-positron zero-point energy is slightly modified. The corresponding contribution to the vacuum magnetization density is determined by considering the individual contribution of each vacuum polarization eigenmode in the Euler-Heisenberg Lagrangian. A paramagnetic response is found in one of them, whereas the remaining ones are diamagnetic. Additional issues concerning the transverse pressures are analyzed.

Selym Villalba Chavez

2009-10-27T23:59:59.000Z

254

Distinct local electronic structure and magnetism for Mn in amorphous Si and Ge  

E-Print Network (OSTI)

Li, A. P. et al. Magnetism in Mn x Ge 1-x semiconductorsElectronic Structure and Magnetism for Mn in Amorphous Sistructure that determines magnetism. Figure 3 shows XAS data

Zeng, Li

2010-01-01T23:59:59.000Z

255

High Field Magnetic Resonance Facility  

NLE Websites -- All DOE Office Websites (Extended Search)

HFMRF Overview HFMRF Overview Section 2-3-1 High Field Magnetic Resonance Facility The High Field Magnetic Resonance Facility (HFMRF) focuses a significant portion of its research on developing a fundamental, molecular-level understanding of biochemical and biological systems and their response to environmental effects. A secondary focus is materials science, including catalysis and chemical mechanisms and processes. Staff and science consultants within this facility offer expertise in the areas of structural biology, solid-state materials characterization, and magnetic resonance imaging (MRI) techniques. Research activities in the HFMRF include: * structure determination of large molecular assemblies such as protein-DNA (normal and damaged DNA) and protein-RNA complexes

256

ccsd00001971, Generation of quasi static magnetic eld in the  

E-Print Network (OSTI)

ccsd­00001971, version 1 ­ 23 Oct 2004 Generation of quasi static magnetic #12;eld, Hideo Nagatomoz, and Yoshiro Owadanoy y National Institute of Advanced Industrial Science and Technology. The magnetic #12;eld generation by a relativistic laser light irradiated on a thin target at the oblique

257

Magnetic signature of indoor air pollution: Household dust study  

Science Journals Connector (OSTI)

The combination of magnetic and geochemical methods was used to determine the mineralogy, grain size and domain structure of magnetic particles in indoor dust collected in 195 sites in Warsaw, Poland. Data sho...

Beata Grka-Kostrubiec; Maria Jele?ska; El?bieta Krl

2014-12-01T23:59:59.000Z

258

Role of Microstructural Phenomena in Magnetic Thin Films. Final Report  

SciTech Connect

Over the period of the program we systematically varied microstructural features of magnetic thin films in an attempt to better identify the role which each feature plays in determining selected extrinsic magnetic properties. This report summarizes the results.

Laughlin, D. E.; Lambeth, D. N.

2001-04-30T23:59:59.000Z

259

A.C.C. Sips, Advanced scenarios for ITER operation ICPP 2004 Advanced scenarios for ITER operation  

E-Print Network (OSTI)

of fusion energy. ITER is to produce and study plasmas dominated by self heating. This would give unique@ipp.mpg.de Abstract In thermonuclear fusion research using magnetic confinement, the tokamak is the leading candidate to provide a #12;A.C.C. Sips, Advanced scenarios for ITER operation ICPP 2004 2 better understanding, control

Paris-Sud XI, Université de

260

THE U.S. ADVANCED TOKAMAK FUSION SCIENCE PROGRAM A White Paper  

E-Print Network (OSTI)

Version 14 5/20/99 THE U.S. ADVANCED TOKAMAK FUSION SCIENCE PROGRAM A White Paper Executive Overview Tokamak research shows that magnetic fusion energy deserves serious consideration as a viable and pursue greater understanding of the new advanced-tokamak (AT) regimes to increase the economic

Note: This page contains sample records for the topic "determination advanced magnetic" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


261

Advanced Distillation Final Report  

SciTech Connect

The Advanced Distillation project was concluded on December 31, 2009. This U.S. Department of Energy (DOE) funded project was completed successfully and within budget during a timeline approved by DOE project managers, which included a one year extension to the initial ending date. The subject technology, Microchannel Process Technology (MPT) distillation, was expected to provide both capital and operating cost savings compared to conventional distillation technology. With efforts from Velocys and its project partners, MPT distillation was successfully demonstrated at a laboratory scale and its energy savings potential was calculated. While many objectives established at the beginning of the project were met, the project was only partially successful. At the conclusion, it appears that MPT distillation is not a good fit for the targeted separation of ethane and ethylene in large-scale ethylene production facilities, as greater advantages were seen for smaller scale distillations. Early in the project, work involved flowsheet analyses to discern the economic viability of ethane-ethylene MPT distillation and develop strategies for maximizing its impact on the economics of the process. This study confirmed that through modification to standard operating processes, MPT can enable net energy savings in excess of 20%. This advantage was used by ABB Lumus to determine the potential impact of MPT distillation on the ethane-ethylene market. The study indicated that a substantial market exists if the energy saving could be realized and if installed capital cost of MPT distillation was on par or less than conventional technology. Unfortunately, it was determined that the large number of MPT distillation units needed to perform ethane-ethylene separation for world-scale ethylene facilities, makes the targeted separation a poor fit for the technology in this application at the current state of manufacturing costs. Over the course of the project, distillation experiments were performed with the targeted mixture, ethane-ethylene, as well as with analogous low relative volatility systems: cyclohexane-hexane and cyclopentane-pentane. Devices and test stands were specifically designed for these efforts. Development progressed from experiments and models considering sections of a full scale device to the design, fabrication, and operation of a single-channel distillation unit with integrated heat transfer. Throughout the project, analytical and numerical models and Computational Fluid Dynamics (CFD) simulations were validated with experiments in the process of developing this platform technology. Experimental trials demonstrated steady and controllable distillation for a variety of process conditions. Values of Height-to-an-Equivalent Theoretical Plate (HETP) ranging from less than 0.5 inch to a few inches were experimentally proven, demonstrating a ten-fold performance enhancement relative to conventional distillation. This improvement, while substantial, is not sufficient for MPT distillation to displace very large scale distillation trains. Fortunately, parallel efforts in the area of business development have yielded other applications for MPT distillation, including smaller scale separations that benefit from the flowsheet flexibility offered by the technology. Talks with multiple potential partners are underway. Their outcome will also help determine the path ahead for MPT distillation.

Maddalena Fanelli; Ravi Arora; Annalee Tonkovich; Jennifer Marco; Ed Rode

2010-03-24T23:59:59.000Z

262

Petroglyphs, Lighting, and Magnetism  

E-Print Network (OSTI)

1950 Electricity and Magnetism: Theory and Applications.I Petroglyphs, Lightning, and Magnetism | Walker Figure 8.I Petroglyphs, Lightning, and Magnetism | Walker Figure IL

Walker, Merle F

2007-01-01T23:59:59.000Z

263

Advanced Mechanical Heat Pump Technologies for Industrial Applications  

E-Print Network (OSTI)

, advanced chemical and mechanical heat pump technologies are being developed for industrial application. Determining which technologies are appropriate for particular industrial applications and then developing those technologies is a stepped process which...

Mills, J. I.; Chappell, R. N.

264

STATEMENT OF CONSIDERATIONS ADVANCE WAIVER OF PATENT RIGHTS TO...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

been determined that this advance waiver of patent rights will best -2- WAIVER ACTION - ABSTRACT W(A)-06-020 (CH-1376) REQUESTOR CONTRACT SCOPE OF WORK RATIONALE FOR DECISION...

265

SOLAR MAGNETIC TRACKING. IV. THE DEATH OF MAGNETIC FEATURES  

SciTech Connect

The removal of magnetic flux from the quiet-Sun photosphere is important for maintaining the statistical steady state of the magnetic field there, for determining the magnetic flux budget of the Sun, and for estimating the rate of energy injected into the upper solar atmosphere. Magnetic feature death is a measurable proxy for the removal of detectable flux, either by cancellation (submerging or rising loops, or reconnection in the photosphere) or by dispersal of flux. We used the SWAMIS feature tracking code to understand how nearly 2 Multiplication-Sign 10{sup 4} magnetic features die in an hour-long sequence of Hinode/SOT/NFI magnetograms of a region of the quiet Sun. Of the feature deaths that remove visible magnetic flux from the photosphere, the vast majority do so by a process that merely disperses the previously detected flux so that it is too small and too weak to be detected, rather than completely eliminating it. The behavior of the ensemble average of these dispersals is not consistent with a model of simple planar diffusion, suggesting that the dispersal is constrained by the evolving photospheric velocity field. We introduce the concept of the partial lifetime of magnetic features, and show that the partial lifetime due to Cancellation of magnetic flux, 22 hr, is three times slower than previous measurements of the flux turnover time. This indicates that prior feature-based estimates of the flux replacement time may be too short, in contrast with the tendency for this quantity to decrease as resolution and instrumentation have improved. This suggests that dispersal of flux to smaller scales is more important for the replacement of magnetic fields in the quiet Sun than observed bipolar cancellation. We conclude that processes on spatial scales smaller than those visible to Hinode dominate the processes of flux emergence and cancellation, and therefore also the quantity of magnetic flux that threads the photosphere.

Lamb, D. A.; Howard, T. A.; DeForest, C. E. [Southwest Research Institute, 1050 Walnut Street, Suite 300, Boulder, CO 80302 (United States); Parnell, C. E. [School of Mathematics and Statistics, University of St. Andrews, St. Andrews, KY16 9SS (United Kingdom); Welsch, B. T., E-mail: derek@boulder.swri.edu [Space Sciences Laboratory, University of California-Berkeley, 7 Gauss Way, Berkeley, CA 94720 (United States)

2013-09-10T23:59:59.000Z

266

Magnetic Catalysis vs Magnetic Inhibition  

E-Print Network (OSTI)

We discuss the fate of chiral symmetry in an extremely strong magnetic field B. We investigate not only quark fluctuations but also neutral meson effects. The former would enhance the chiral-symmetry breaking at finite B according to the Magnetic Catalysis, while the latter would suppress the chiral condensate once B exceeds the scale of the hadron structure. Using a chiral model we demonstrate how neutral mesons are subject to the dimensional reduction and the low dimensionality favors the chiral-symmetric phase. We point out that this effect, the Magnetic Inhibition, can be a feasible explanation for recent lattice-QCD data indicating the decreasing behavior of the chiral-restoration temperature with increasing B.

Kenji Fukushima; Yoshimasa Hidaka

2012-09-06T23:59:59.000Z

267

Magnetic Stereoscopy  

E-Print Network (OSTI)

The space mission STEREO will provide images from two viewpoints. An important aim of the STEREO mission is to get a 3D view of the solar corona. We develop a program for the stereoscopic reconstruction of 3D coronal loops from images taken with the two STEREO spacecraft. A pure geometric triangulation of coronal features leads to ambiguities because the dilute plasma emissions complicates the association of features in image 1 with features in image 2. As a consequence of these problems the stereoscopic reconstruction is not unique and multiple solutions occur. We demonstrate how these ambiguities can be resolved with the help of different coronal magnetic field models (potential, linear and non-linear force-free fields). The idea is that, due to the high conductivity in the coronal plasma, the emitting plasma outlines the magnetic field lines. Consequently the 3D coronal magnetic field provides a proxy for the stereoscopy which allows to eliminate inconsistent configurations. The combination of stereoscopy and magnetic modelling is more powerful than one of these tools alone. We test our method with the help of a model active region and plan to apply it to the solar case as soon as STEREO data become available.

Thomas Wiegelmann; Bernd Inhester

2006-12-21T23:59:59.000Z

268

U.S. DOE Office of Energy Efficiency and Renewable Energy Categorical Exclusion Determination Form  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Electron Energy Corporation Electron Energy Corporation Location: Landisville, PA Project Title High Performance Permanent Magnets for Advanced Motors The overall objective of this program is to develop high performance permanent magnets with improved Proposed Action or Project Description American Recovery and Reinvestment Act: magnetic properties at temperatures up to 240 in advanced motor applications, and low cost. In the phase I and Phase II effort, Electron Energy Corporation (EEC) prepared samples in the lab with high resistivity and high magnetic performance. The approaches comprised of compositional and process optimization, such as atomic substitutions and additions in conjunction with process parameter optimization to yield the highest magnetic properties, and

269

Advanced Accessory Power Supply Topologies  

SciTech Connect

This Cooperative Research and Development Agreement (CRADA) began December 8, 2000 and ended September 30, 2009. The total funding provided by the Participant (General Motors Advanced Technology Vehicles [GM]) during the course of the CRADA totaled $1.2M enabling the Contractor (UT-Battelle, LLC [Oak Ridge National Laboratory, a.k.a. ORNL]) to contribute significantly to the joint project. The initial task was to work with GM on the feasibility of developing their conceptual approach of modifying major components of the existing traction inverter/drive to develop low cost, robust, accessory power. Two alternate methods for implementation were suggested by ORNL and both were proven successful through simulations and then extensive testing of prototypes designed and fabricated during the project. This validated the GM overall concept. Moreover, three joint U.S. patents were issued and subsequently licensed by GM. After successfully fulfilling the initial objective, the direction and duration of the CRADA was modified and GM provided funding for two additional tasks. The first new task was to provide the basic development for implementing a cascaded inverter technology into hybrid vehicles (including plug-in hybrid, fuel cell, and electric). The second new task was to continue the basic development for implementing inverter and converter topologies and new technology assessments for hybrid vehicle applications. Additionally, this task was to address the use of high temperature components in drive systems. Under this CRADA, ORNL conducted further research based on GMs idea of using the motor magnetic core and windings to produce bidirectional accessory power supply that is nongalvanically coupled to the terminals of the high voltage dc-link battery of hybrid vehicles. In order not to interfere with the motors torque, ORNL suggested to use the zero-sequence, highfrequency harmonics carried by the main fundamental motor current for producing the accessory power. Two studies were conducted at ORNL. One was to put an additional winding in the motor slots to magnetically link with the high frequency of the controllable zero-sequence stator currents that do not produce any zero-sequence harmonic torques. The second approach was to utilize the corners of the square stator punching for the high-frequency transformers of the dc/dc inverter. Both approaches were successful. This CRADA validated the feasibility of GMs desire to use the motors magnetic core and windings to produce bidirectional accessory power supply. Three joint U.S. patents with GM were issued to ORNL and GM by the U.S. Patent Office for the research results produced by this CRADA.

Marlino, L.D.

2010-06-15T23:59:59.000Z

270

NETL: Advanced Research - Successes  

NLE Websites -- All DOE Office Websites (Extended Search)

Successes Successes Advanced Research Successes Sensors & Controls "...Optical grade single-crystal sapphire optical fiber waveguides are especially attractive for fabricating sensors for the harsh high-temperature, corrosive environments found in gasifiers." Read More... "Industry adoption of CCADS will open the door to a new generation of more efficient, ultra-low emission turbines in advanced energy systems" Read More... Bioprocessing " Successful development and commercial application of this environmentally safe bacterial toxin will allow power plants to reduce or eliminate the use of chlorination, reducing the risk of harmful effects on aquatic ecosystems." Advanced Materials " This project will benefit gasification technology development and deployment by improving materials to contain and monitor gasification processes." Read More...

271

Geothermal: Advanced Search  

NLE Websites -- All DOE Office Websites (Extended Search)

Advanced Search Advanced Search Geothermal Technologies Legacy Collection Help/FAQ | Site Map | Contact Us | Admin Log On Home/Basic Search About Publications Advanced Search New Hot Docs News Related Links You may need to turn on Javascript in your browser to use the Find Subject and Find Author features. Sort By: Relevance Publication Date System Entry Date Document Type Title Research Org Sponsoring Org OSTI Identifier Report Number DOE Contract Number Ascending Descending Enter search criteria into as few or as many fields as desired. Search In For Term(s) (Place phrase in "double quotes") All Fields: Bibliographic Data: Full Text: Creator/Author Select : Title: Subject Select : Identifier Numbers: Journal Info.: Conference Info.: Patent Info.: Research Org.: Sponsoring Org.:

272

NIST's Advanced Technology Program  

NLE Websites -- All DOE Office Websites (Extended Search)

NIST's Advanced NIST's Advanced Technology Program NIST's Advanced Technology Program DOE Workshop on Hydrogen Separation and Purification Technologies Arlington, VA, Sept. 8-9, 2004 Jason Huang 301-975-4197 National Institute of Standards and Technology 100 Bureau Drive Stop 4730 Gaithersburg, MD 20899-4730 http://www.atp.nist.gov National Institute of Standards and Technology * Technology Administration * U.S. Department of Commerce ATP is part of NIST Helping America Measure Up NIST Mission ATP is part of NIST NIST Mission: Strengthen the U.S. economy and improve the quality of life by working with industry to develop and apply technology, measurements, and standards. * * * * * * 3,000 employees $771 million annual budget 2,000 field agents 1,800 guest researchers $2.2 billion co-funding of

273

Revolutionizing Clean Energy Technology with Advanced Composites...  

NLE Websites -- All DOE Office Websites (Extended Search)

Revolutionizing Clean Energy Technology with Advanced Composites Revolutionizing Clean Energy Technology with Advanced Composites Addthis...

274

Advanced Vehicle Electrification and Transportation Sector Electrifica...  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

More Documents & Publications Advanced Vehicle Electrification and Transportation Sector Electrification Advanced Vehicle Electrification & Transportation Sector...

275

Advances in Animal Biotechnology  

Science Journals Connector (OSTI)

Abstract Animal biotechnology is used to improve food resources, to make biomedical advances and for industrial and commercial purposes. Today, the intersection of technology (genomic sequencing and computing) and biology (including cloning and regenerative medicine) bring a new sense of animal biotechnology, in which new products and experimental models can be imagined and realized. With these advances come challenges regarding product safety and animal welfare, as well as proper regulation. Animal biotechnology is a continually evolving field. Regulations will continue to develop as the field develops.

L.B. Schook; L.A. Rund; W. Hu; K.A. Darfour-Oduro; L.A. Knapp; F.M. Rodrigues; K.M. Schachtschneider

2014-01-01T23:59:59.000Z

276

Advanced Simulation and Computing  

National Nuclear Security Administration (NNSA)

NA-ASC-117R-09-Vol.1-Rev.0 NA-ASC-117R-09-Vol.1-Rev.0 Advanced Simulation and Computing PROGRAM PLAN FY09 October 2008 ASC Focal Point Robert Meisner, Director DOE/NNSA NA-121.2 202-586-0908 Program Plan Focal Point for NA-121.2 Njema Frazier DOE/NNSA NA-121.2 202-586-5789 A Publication of the Office of Advanced Simulation & Computing, NNSA Defense Programs i Contents Executive Summary ----------------------------------------------------------------------------------------------- 1 I. Introduction -------------------------------------------------------------------------------------------------------- 2 Realizing the Vision ------------------------------------------------------------------------------------------------- 2 The Future of the Nuclear Weapons Complex ---------------------------------------------------------------- 2

277

AGATA - Advanced Gamma Tracking Array  

E-Print Network (OSTI)

The Advanced GAmma Tracking Array (AGATA) is a European project to develop and operate the next generation gamma-ray spectrometer. AGATA is based on the technique of gamma-ray energy tracking in electrically segmented high-purity germanium crystals. This technique requires the accurate determination of the energy, time and position of every interaction as a gamma ray deposits its energy within the detector volume. Reconstruction of the full interaction path results in a detector with very high efficiency and excellent spectral response. The realization of gamma-ray tracking and AGATA is a result of many technical advances. These include the development of encapsulated highly-segmented germanium detectors assembled in a triple cluster detector cryostat, an electronics system with fast digital sampling and a data acquisition system to process the data at a high rate. The full characterization of the crystals was measured and compared with detector-response simulations. This enabled pulse-shape analysis algorithms, to extract energy, time and position, to be employed. In addition, tracking algorithms for event reconstruction were developed. The first phase of AGATA is now complete and operational in its first physics campaign. In the future AGATA will be moved between laboratories in Europe and operated in a series of campaigns to take advantage of the different beams and facilities available to maximize its science output. The paper reviews all the achievements made in the AGATA project including all the necessary infrastructure to operate and support the spectrometer.

S. Akkoyun; A. Algora; B. Alikhani; F. Ameil; G. de Angelis; L. Arnold; A. Astier; A. Ata; Y. Aubert; C. Aufranc; A. Austin; S. Aydin; F. Azaiez; S. Badoer; D. L. Balabanski; D. Barrientos; G. Baulieu; R. Baumann; D. Bazzacco; F. A. Beck; T. Beck; P. Bednarczyk; M. Bellato; M. A. Bentley; G. Benzoni; R. Berthier; L. Berti; R. Beunard; G. Lo Bianco; B. Birkenbach; P. G. Bizzeti; A. M. Bizzeti-Sona; F. Le Blanc; J. M. Blasco; N. Blasi; D. Bloor; C. Boiano; M. Borsato; D. Bortolato; A. J. Boston; H. C. Boston; P. Bourgault; P. Boutachkov; A. Bouty; A. Bracco; S. Brambilla; I. P. Brawn; A. Brondi; S. Broussard; B. Bruyneel; D. Bucurescu; I. Burrows; A. Brger; S. Cabaret; B. Cahan; E. Calore; F. Camera; A. Capsoni; F. Carri; G. Casati; M. Castoldi; B. Cederwall; J. -L. Cercus; V. Chambert; M. El Chambit; R. Chapman; L. Charles; J. Chavas; E. Clment; P. Cocconi; S. Coelli; P. J. Coleman-Smith; A. Colombo; S. Colosimo; C. Commeaux; D. Conventi; R. J. Cooper; A. Corsi; A. Cortesi; L. Costa; F. C. L. Crespi; J. R. Cresswell; D. M. Cullen; D. Curien; A. Czermak; D. Delbourg; R. Depalo; T. Descombes; P. Dsesquelles; P. Detistov; C. Diarra; F. Didierjean; M. R. Dimmock; Q. T. Doan; C. Domingo-Pardo; M. Doncel; F. Dorangeville; N. Dosme; Y. Drouen; G. Duchne; B. Dulny; J. Eberth; P. Edelbruck; J. Egea; T. Engert; M. N. Erduran; S. Ertrk; C. Fanin; S. Fantinel; E. Farnea; T. Faul; M. Filliger; F. Filmer; Ch. Finck; G. de France; A. Gadea; W. Gast; A. Geraci; J. Gerl; R. Gernhuser; A. Giannatiempo; A. Giaz; L. Gibelin; A. Givechev; N. Goel; V. Gonzlez; A. Gottardo; X. Grave; J. Gr?bosz; R. Griffiths; A. N. Grint; P. Gros; L. Guevara; M. Gulmini; A. Grgen; H. T. M. Ha; T. Habermann; L. J. Harkness; H. Harroch; K. Hauschild; C. He; A. Hernndez-Prieto; B. Hervieu; H. Hess; T. Hyk; E. Ince; R. Isocrate; G. Jaworski; A. Johnson; J. Jolie; P. Jones; B. Jonson; P. Joshi; D. S. Judson; A. Jungclaus; M. Kaci; N. Karkour; M. Karolak; A. Ka?ka?; M. Kebbiri; R. S. Kempley; A. Khaplanov; S. Klupp; M. Kogimtzis; I. Kojouharov; A. Korichi; W. Korten; Th. Krll; R. Krcken; N. Kurz; B. Y. Ky; M. Labiche; X. Lafay; L. Lavergne; I. H. Lazarus; S. Leboutelier; F. Lefebvre; E. Legay; L. Legeard; F. Lelli; S. M. Lenzi; S. Leoni; A. Lermitage; D. Lersch; J. Leske; S. C. Letts; S. Lhenoret; R. M. Lieder; D. Linget; J. Ljungvall; A. Lopez-Martens; A. Lotod; S. Lunardi; A. Maj; J. van der Marel; Y. Mariette; N. Marginean; R. Marginean; G. Maron; A. R. Mather; W. M?czy?ski; V. Mendz; P. Medina; B. Melon; R. Menegazzo; D. Mengoni; E. Merchan; L. Mihailescu; C. Michelagnoli; J. Mierzejewski; L. Milechina; B. Million; K. Mitev; P. Molini; D. Montanari; S. Moon; F. Morbiducci; R. Moro; P. S. Morrall; O. Mller; A. Nannini; D. R. Napoli; L. Nelson; M. Nespolo; V. L. Ngo; M. Nicoletto; R. Nicolini; Y. Le Noa; P. J. Nolan; M. Norman; J. Nyberg; A. Obertelli; A. Olariu; R. Orlandi; D. C. Oxley; C. zben; M. Ozille; C. Oziol; E. Pachoud; M. Palacz; J. Palin; J. Pancin; C. Parisel; P. Pariset; G. Pascovici; R. Peghin; L. Pellegri; A. Perego; S. Perrier; M. Petcu; P. Petkov; C. Petrache; E. Pierre; N. Pietralla; S. Pietri; M. Pignanelli; I. Piqueras; Z. Podolyak; P. Le Pouhalec; J. Pouthas; D. Pugnre; V. F. E. Pucknell; A. Pullia; B. Quintana; R. Raine; G. Rainovski; L. Ramina; G. Rampazzo; G. La Rana; M. Rebeschini; F. Recchia; N. Redon; M. Reese; P. Reiter; P. H. Regan; S. Riboldi; M. Richer; M. Rigato; S. Rigby; G. Ripamonti; A. P. Robinson; J. Robin; J. Roccaz; J. -A. Ropert; B. Ross; C. Rossi Alvarez; D. Rosso; B. Rubio; D. Rudolph; F. Saillant; E. ?ahin; F. Salomon; M. -D. Salsac; J. Salt; G. Salvato; J. Sampson; E. Sanchis; C. Santos; H. Schaffner; M. Schlarb; D. P. Scraggs; D. Seddon; M. ?enyi?it; M. -H. Sigward; G. Simpson; J. Simpson; M. Slee; J. F. Smith; P. Sona; B. Sowicki; P. Spolaore; C. Stahl; T. Stanios; E. Stefanova; O. Stzowski; J. Strachan; G. Suliman; P. -A. Sderstrm; J. L. Tain; S. Tanguy; S. Tashenov; Ch. Theisen; J. Thornhill; F. Tomasi; N. Toniolo; R. Touzery; B. Travers; A. Triossi; M. Tripon; K. M. M. Tun-Lano; M. Turcato; C. Unsworth; C. A. Ur; J. J. Valiente-Dobon; V. Vandone; E. Vardaci; R. Venturelli; F. Veronese; Ch. Veyssiere; E. Viscione; R. Wadsworth; P. M. Walker; N. Warr; C. Weber; D. Weisshaar; D. Wells; O. Wieland; A. Wiens; G. Wittwer; H. J. Wollersheim; F. Zocca; N. V. Zamfir; M. Zi?bli?ski; A. Zucchiatti

2011-11-24T23:59:59.000Z

278

Innovative Sensors for Pipeline Crawlers: Rotating Permanent Magnet Inspection  

SciTech Connect

Internal inspection of pipelines is an important tool for ensuring safe and reliable delivery of fossil energy products. Current inspection systems that are propelled through the pipeline by the product flow cannot be used to inspect all pipelines because of the various physical barriers they may encounter. To facilitate inspection of these ''unpiggable'' pipelines, recent inspection development efforts have focused on a new generation of powered inspection platforms that are able to crawl slowly inside a pipeline and can maneuver past the physical barriers that limit internal inspection applicability, such as bore restrictions, low product flow rate, and low pressure. The first step in this research was to review existing inspection technologies for applicability and compatibility with crawler systems. Most existing inspection technologies, including magnetic flux leakage and ultrasonic methods, had significant implementation limitations including mass, physical size, inspection energy coupling requirements and technology maturity. The remote field technique was the most promising but power consumption was high and anomaly signals were low requiring sensitive detectors and electronics. After reviewing each inspection technology, it was decided to investigate the potential for a new inspection method. The new inspection method takes advantage of advances in permanent magnet strength, along with their wide availability and low cost. Called rotating permanent magnet inspection (RPMI), this patent pending technology employs pairs of permanent magnets rotating around the central axis of a cylinder to induce high current densities in the material under inspection. Anomalies and wall thickness variations are detected with an array of sensors that measure local changes in the magnetic field produced by the induced current flowing in the material. This inspection method is an alternative to the common concentric coil remote field technique that induces low-frequency eddy currents in ferromagnetic pipes and tubes. Since this is a new inspection method, both theory and experiment were used to determine fundamental capabilities and limitations. Fundamental finite element modeling analysis and experimental investigations performed during this development have led to the derivation of a first order analytical equation for designing rotating magnetizers to induce current and positioning sensors to record signals from anomalies. Experimental results confirm the analytical equation and the finite element calculations provide a firm basis for the design of RPMI systems. Experimental results have shown that metal loss anomalies and wall thickness variations can be detected with an array of sensors that measure local changes in the magnetic field produced by the induced current flowing in the material. The design exploits the phenomenon that circumferential currents are easily detectable at distances well away from the magnets. Current changes at anomalies were detectable with commercial low cost Hall Effect sensors. Commercial analog to digital converters can be used to measure the sensor output and data analysis can be performed in real time using PC computer systems. The technology was successfully demonstrated during two blind benchmark tests where numerous metal loss defects were detected. For this inspection technology, the detection threshold is a function of wall thickness and corrosion depth. For thinner materials, the detection threshold was experimentally shown to be comparable to magnetic flux leakage. For wall thicknesses greater than three tenths of an inch, the detection threshold increases with wall thickness. The potential for metal loss anomaly sizing was demonstrated in the second benchmarking study, again with accuracy comparable to existing magnetic flux leakage technologies. The rotating permanent magnet system has the potential for inspecting unpiggable pipelines since the magnetizer configurations can be sufficiently small with respect to the bore of the pipe to pass obstructions that limit the application of many i

J. Bruce Nestleroth; Richard J. Davis; Stephanie Flamberg

2006-09-30T23:59:59.000Z

279

Advanced fuel chemistry for advanced engines.  

SciTech Connect

Autoignition chemistry is central to predictive modeling of many advanced engine designs that combine high efficiency and low inherent pollutant emissions. This chemistry, and especially its pressure dependence, is poorly known for fuels derived from heavy petroleum and for biofuels, both of which are becoming increasingly prominent in the nation's fuel stream. We have investigated the pressure dependence of key ignition reactions for a series of molecules representative of non-traditional and alternative fuels. These investigations combined experimental characterization of hydroxyl radical production in well-controlled photolytically initiated oxidation and a hybrid modeling strategy that linked detailed quantum chemistry and computational kinetics of critical reactions with rate-equation models of the global chemical system. Comprehensive mechanisms for autoignition generally ignore the pressure dependence of branching fractions in the important alkyl + O{sub 2} reaction systems; however we have demonstrated that pressure-dependent 'formally direct' pathways persist at in-cylinder pressures.

Taatjes, Craig A.; Jusinski, Leonard E.; Zador, Judit; Fernandes, Ravi X.; Miller, James A.

2009-09-01T23:59:59.000Z

280

CX-002357: Categorical Exclusion Determination | Department of...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

CX-002357: Categorical Exclusion Determination Advanced, High Power, Next Scale, Wave Energy Conversion Device CX(s) Applied: B3.6, A9 Date: 05132010 Location(s): New...

Note: This page contains sample records for the topic "determination advanced magnetic" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


281

CX-011452: Categorical Exclusion Determination | Department of...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Exclusion Determination Pilot-Scale Evaluation of an Advanced Carbon Sorbent-Based Process for Post-Combustion Carbon Capture CX(s) Applied: A9 Date: 11122013 Location(s):...

282

CX-007700: Categorical Exclusion Determination | Department of...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Categorical Exclusion Determination University of Utah - A New Generation High Density Thermal Battery Based on Advanced Metal Hydrides CX(s) Applied: A9, B3.6 Date: 11182011...

283

CX-002968: Categorical Exclusion Determination | Department of...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Categorical Exclusion Determination Clean Energy Advanced Manufacturing Phase 2 - URV USA CX(s) Applied: B3.6, B5.1 Date: 07082010 Location(s): Rochester, Michigan Office(s):...

284

Voluntary Protection Program Onsite Review, Advanced Technologies and Laboratories, Inc., Hanford Feb 2014  

Energy.gov (U.S. Department of Energy (DOE))

Evaluation to determine whether Advanced Technologies and Laboratories, Inc., Hanford is performing at a level deserving DOE-VPP Star recognition.

285

Voluntary Protection Program Onsite Review, Advanced Mixed Waste Treatment Project- May 2009  

Energy.gov (U.S. Department of Energy (DOE))

Evaluation to determine whether Advanced Mixed Waste Treatment Project is continuing to perform at a level deserving DOE-VPP Star recognition.

286

Voluntary Protection Program Onsite Review, Advanced Technologies and Laboratories International, Inc.- January 2008  

Energy.gov (U.S. Department of Energy (DOE))

Evaluation to determine whether Advanced Technologies and Laboratories International, Inc. is performing at a level deserving DOE-VPP Star recognition.

287

Magnetism of Europium Garnet  

Science Journals Connector (OSTI)

The theoretical expressions for the magnetic moment of a trivalent europium ion in a molecular field arising from exchange are applied to Pauthenet's measurements on europium iron garnet. It is a good approximation to assume that the exchange interaction stems entirely from the coupling with the iron atoms, which greatly simplifies the theory since the molecular field on the europium is then an impressed one and does not have to be determined self-consistently. The calculated variation of the magnetization with temperature is in excellent accord with experiment. The magnitude of the exchange interaction is compared with that in the other rare earth iron garnets; it is almost exactly the same as in gadolinium iron garnet.

W. P. Wolf and J. H. Van Vleck

1960-06-15T23:59:59.000Z

288

Fundamental Scientific Problems in Magnetic Recording  

SciTech Connect

Magnetic data storage technology is presently leading the high tech industry in advancing device integration--doubling the storage density every 12 months. To continue these advancements and to achieve terra bit per inch squared recording densities, new approaches to store and access data will be needed in about 3-5 years. In this project, collaboration between Oak Ridge National Laboratory (ORNL), Center for Materials for Information Technology (MINT) at University of Alabama (UA), Imago Scientific Instruments, and Seagate Technologies, was undertaken to address the fundamental scientific problems confronted by the industry in meeting the upcoming challenges. The areas that were the focus of this study were to: (1) develop atom probe tomography for atomic scale imaging of magnetic heterostructures used in magnetic data storage technology; (2) develop a first principles based tools for the study of exchange bias aimed at finding new anti-ferromagnetic materials to reduce the thickness of the pinning layer in the read head; (3) develop high moment magnetic materials and tools to study magnetic switching in nanostructures aimed at developing improved writers of high anisotropy magnetic storage media.

Schulthess, T.C.; Miller, M.K.

2007-06-27T23:59:59.000Z

289

advancing ou r intellectual  

E-Print Network (OSTI)

Grand Challenge: Energy, Environment, and Infrastructure Grand Challenge: Health 2. Investing in Faculty ambition to transform Lehigh University by advanc- ing our intellectual footprint. The students and future' ability to compete in that world. · Globalization · Energy, environment, and infrastructure · Health Adv

Napier, Terrence

290

Advanced Test Reactor Tour  

SciTech Connect

The Advanced Test Reactor at Idaho National Laboratory is the foremost nuclear materials test reactor in the world. This virtual tour describes the reactor, how experiments are conducted, and how spent nuclear fuel is handled and stored. For more information about INL research, visit http://www.facebook.com/idahonationallaboratory.

Miley, Don

2011-01-01T23:59:59.000Z

291

International for Advanced Studies  

E-Print Network (OSTI)

and Technology at the University of Ulm ICAS-Affiliations The International Center for Advanced Studies in Health in medical technology and pharma- ceutical industry. The International Advisory Panel of ICAS consists, transfer of state-of-the-art clinical technologies, and utilization of methodologies appropriate

Pfeifer, Holger

292

Advanced Biotechnology and Medicine  

E-Print Network (OSTI)

, Training and Technology Transfer 43 Lectures and Seminars 44 CABM Lecture Series 45 Annual Retreat 46 15th An Advanced Technology Center of The New Jersey Commission on Science and Technology Jointly Administered from CABM laboratories have appeared in high impact international journals including Development, Genes

293

Advanced Biotechnology and Medicine  

E-Print Network (OSTI)

Shatkin 41 Education, Training and Technology Transfer 43 Lectures and Seminars 44 CABM Lecture Series 45 An Advanced Technology Center of The New Jersey Commission on Science and Technology Jointly Administered for the improvement of human health. In 2002 peer-reviewed CABM studies were published in leading international

294

Advanced Biotechnology and Medicine  

E-Print Network (OSTI)

Vikas Nanda 63 Protein Crystallography Ann Stock 67 Education, Training and Technology Transfer 71 Report An Advanced Technology Center of the New Jersey Commission on Science and Technology Jointly, the CIPR will house the Rutgers-based Protein Data Bank (PDB), an international repository directed

295

Advanced Drivetrain Manufacturing  

Energy.gov (U.S. Department of Energy (DOE))

The U.S. Department of Energy (DOE) supports advanced manufacturing techniques that are leading to the "next-generation" of more reliable, affordable, and efficient wind turbine drivetrains. As turbines continue to increase in size, each and every component must also be scaled to meet the demands for renewable energy.

296

RECENT ADVANCES COMPUTATIONAL METHODS  

E-Print Network (OSTI)

RECENT ADVANCES ON COMPUTATIONAL METHODS FOR STRUCTURED INVERSE QUADRATIC EIGENVALUE PROBLEMS by Biswa Nath Datta Department of Mathematical Sciences Northern Illinois University DeKalb, IL 60115 E-Element Model Updating in Aerospace and Au- tomobile Industries. 10 #12;Quadratic Inverse Eigenvalue Problems

Datta, Biswa

297

Advanced Test Reactor Tour  

ScienceCinema (OSTI)

The Advanced Test Reactor at Idaho National Laboratory is the foremost nuclear materials test reactor in the world. This virtual tour describes the reactor, how experiments are conducted, and how spent nuclear fuel is handled and stored. For more information about INL research, visit http://www.facebook.com/idahonationallaboratory.

Miley, Don

2013-05-28T23:59:59.000Z

298

Standard version Advanced version  

E-Print Network (OSTI)

: gasoline, jet fuel, and heating oil. The average octane levels must be: Gasoline Jet fuel Heating oil Distilled 2 Naphtha Distill (barrels) 0.25 0.25 0.5 Distilled naphtha can be used only to produce gasoline version Advanced version Margaret Oil - basic (3) Crude Distill Naphtha Gasoline Distilled 1 Jet fuel

Hall, Julian

299

magnets2  

NLE Websites -- All DOE Office Websites (Extended Search)

II II Painless Physics Articles BEAM COOLING August 2, 1996 By Leila Belkora, Office of Public Affairs ACCELERATION August 16, 1996 By Dave Finley, Accelerator Division Head RF August 30, 1996 By Pat Colestock, Accelerator Division FIXED TARGET PHYSICS September 20, 1996 By Peter H. Garbincius, Physics Section FIXED TARGET PHYSICS PART DEUX October 16, 1996 By Peter H. Garbincius, Physics Section and Leila Belkora, Office of Public Affaris CROSS SECTION November 1, 1996 By Doreen Wackeroth, Theoretical Physics Edited by Leila Belkora, Office of Public Affaris MAGNETS PART I November 15, 1996 By Hank Glass, Technical Support Section Edited by Donald Sena, Office of Public Affairs MAGNETS PART II January 10, 1997 By Hank Glass, Technical Support Section Edited by Donald Sena, Office of Public Affairs

300

Advanced Vehicle Testing Activity: Overview  

NLE Websites -- All DOE Office Websites (Extended Search)

Overview to Overview to someone by E-mail Share Advanced Vehicle Testing Activity: Overview on Facebook Tweet about Advanced Vehicle Testing Activity: Overview on Twitter Bookmark Advanced Vehicle Testing Activity: Overview on Google Bookmark Advanced Vehicle Testing Activity: Overview on Delicious Rank Advanced Vehicle Testing Activity: Overview on Digg Find More places to share Advanced Vehicle Testing Activity: Overview on AddThis.com... Home Overview Light-Duty Vehicles Medium- and Heavy-Duty Vehicles Publications Overview The marketplace for advanced transportation technologies and the focus, direction, and funding of transportation programs are continually changing. The Advanced Vehicle Testing Activity's "2005 Overview of Advanced Technology Transportation" (PDF 736 KB) gives the latest information about

Note: This page contains sample records for the topic "determination advanced magnetic" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


301

Geometric properties of magnetic field lines on toroidal magnetic surfaces in the context of plasma equilibrium  

SciTech Connect

An analysis of plasma equilibrium in a magnetic confinement system includes studies of how the shape of the magnetic surfaces is distorted with varying magnitude and profile of the plasma pressure. Such studies allow one, in particular, to determine the maximum {beta} value consistent with equilibrium, {beta}{sub eq}, i.e., the maximum plasma pressure above which the equilibrium in a confinement system under analysis is impossible. Since the magnetic field lines form magnetic surfaces, their global relationship with equilibrium is obvious. Here, special attention is paid to a local relationship between equilibrium and geometric properties of the magnetic field lines.

Skovoroda, A. A. [Russian Research Centre Kurchatov Institute, Nuclear Fusion Institute (Russian Federation)

2007-08-15T23:59:59.000Z

302

The physics of magnetic fusion reactors  

Science Journals Connector (OSTI)

During the past two decades there have been substantial advances in magnetic fusion research. On the experimental front, progress has been led by the mainline tokamaks, which have achieved reactor-level values of temperature and plasma pressure. Comparable progress, when allowance is made for their smaller programs, has been made in complementary configurations such as the stellarator, reversed-field pinch and field-reversed configuration. In this paper, the status of understanding of the physics of toroidal plasmas is reviewed. It is shown how the physics performance, constrained by technological and economic realities, determines the form of reference toroidal reactors. A comparative study of example reactors is not made, because the level of confidence in projections of their performance varies widely, reflecting the vastly different levels of support which each has received. Success with the tokamak has led to the initiation of the International Thermonuclear Experimental Reactor project. It is designed to produce 1500 MW of fusion power from a deuterium-tritium plasma for pulses of 1000 s or longer and to demonstrate the integration of the plasma and nuclear technologies needed for a demonstration reactor.

John Sheffield

1994-07-01T23:59:59.000Z

303

Magnetic Reconnection  

SciTech Connect

We review the fundamental physics of magnetic reconnection in laboratory and space plasmas, by discussing results from theory, numerical simulations, observations from space satellites, and the recent results from laboratory plasma experiments. After a brief review of the well-known early work, we discuss representative recent experimental and theoretical work and attempt to interpret the essence of significant modern findings. In the area of local reconnection physics, many significant findings have been made with regard to two- uid physics and are related to the cause of fast reconnection. Profiles of the neutral sheet, Hall currents, and the effects of guide field, collisions, and micro-turbulence are discussed to understand the fundamental processes in a local reconnection layer both in space and laboratory plasmas. While the understanding of the global reconnection dynamics is less developed, notable findings have been made on this issue through detailed documentation of magnetic self-organization phenomena in fusion plasmas. Application of magnetic reconnection physics to astrophysical plasmas is also brie y discussed.

Masaaki Yamada, Russell Kulsrud and Hantao Ji

2009-09-17T23:59:59.000Z

304

THE ADVANCED CHEMISTRY BASINS PROJECT  

SciTech Connect

In the next decades, oil exploration by majors and independents will increasingly be in remote, inaccessible areas, or in areas where there has been extensive shallow exploration but deeper exploration potential may remain; areas where the collection of data is expensive, difficult, or even impossible, and where the most efficient use of existing data can drive the economics of the target. The ability to read hydrocarbon chemistry in terms of subsurface migration processes by relating it to the evolution of the basin and fluid migration is perhaps the single technological capability that could most improve our ability to explore effectively because it would allow us to use a vast store of existing or easily collected chemical data to determine the major migration pathways in a basin and to determine if there is deep exploration potential. To this end a the DOE funded a joint effort between California Institute of Technology, Cornell University, and GeoGroup Inc. to assemble a representative set of maturity and maturation kinetic models and develop an advanced basin model able to predict the chemistry of hydrocarbons in a basin from this input data. The four year project is now completed and has produced set of public domain maturity indicator and maturation kinetic data set, an oil chemistry and flash calculation tool operable under Excel, and a user friendly, graphically intuitive basin model that uses this data and flash tool, operates on a PC, and simulates hydrocarbon generation and migration and the chemical changes that can occur during migration (such as phase separation and gas washing). The DOE Advanced Chemistry Basin Model includes a number of new methods that represent advances over current technology. The model is built around the concept of handling arbitrarily detailed chemical composition of fluids in a robust finite-element 2-D grid. There are three themes on which the model focuses: chemical kinetic and equilibrium reaction parameters, chemical phase equilibrium, and physical flow through porous media. The chemical kinetic scheme includes thermal indicators including vitrinite, sterane ratios, hopane ratios, and diamonoids; and a user-modifiable reaction network for primary and secondary maturation. Also provided is a database of type-specific kerogen maturation schemes. The phase equilibrium scheme includes modules for primary and secondary migration, multi-phase equilibrium (flash) calculations, and viscosity predictions.

William Goddard; Peter Meulbroek; Yongchun Tang; Lawrence Cathles III

2004-04-05T23:59:59.000Z

305

Interactions between comoving magnetic microswimmers  

Science Journals Connector (OSTI)

The artificial microswimmer [R. Dreyfus et al., Nature (London) 437, 862 (2005)] whose mechanism of propulsion is the magnetically driven undulation of a flagellum-like tail composed of chemically linked paramagnetic beads can be used as a physical model with which to study low-Reynolds-number swimming. Understanding how such swimmers interact provides insight into the related problem of quantifying the hydrodynamic interactions between microorganisms. In this study, particle-based numerical simulations are conducted of two comoving artificial swimmers. The resulting swimming speeds are determined over a range of separations for swimmers driven by planar and rotational magnetic fields. The far-field hydrodynamic interactions are analyzed and found to decay as h?2 where h is the separation distance. Additionally, the role of the interswimmer magnetic forces is determined.

Eric E. Keaveny and Martin R. Maxey

2008-04-16T23:59:59.000Z

306

Magnetic charge crystals imaged in artificial spin ice  

NLE Websites -- All DOE Office Websites (Extended Search)

Magnetic charge crystals imaged in artificial spin ice Magnetic charge crystals imaged in artificial spin ice Magnetic charge crystals imaged in artificial spin ice Potential data storage and computational advances could follow August 27, 2013 Potential data storage and computational advances could follow A 3-D depiction of the honeycomb artificial spin ice topography after the annealing and cooling protocols. The light and dark colors represent the north and south magnetic poles of the islands. Image by Ian Gilbert, U. of I. Department of Physics and Frederick Seitz Materials Research Laboratory Contact Nancy Ambrosiano Communications Office (505) 667-0471 Email Siv Schwink U. Illinois (217) 300-2201 Email "The emergence of magnetic monopoles in spin ice systems is a particular case of what physicists call fractionalization, or deconfinement of

307

Magnetic Susceptibility of an Electron Gas at High Density  

Science Journals Connector (OSTI)

The magnetic susceptibility of an electron gas at high density is determined using the exact theory of Gell-Mann and Brueckner.

K. A. Brueckner and K. Sawada

1958-10-15T23:59:59.000Z

308

MagLab - Pioneers in Electricity and Magnetism  

NLE Websites -- All DOE Office Websites (Extended Search)

help his students easily determine the directional relationships between a current, its magnetic field and electromotive force. Luigi Galvani Luigi Galvani (1737-1798) - Luigi...

309

Refrigeration options for the Advanced Light Source Superbend Dipole Magnets  

E-Print Network (OSTI)

The photon energy in selected ports can be increased byenergy is 1.9 GeV. These photons can be delivered to users through forty-eight ports

Green, M.A.

2011-01-01T23:59:59.000Z

310

NICTA Advanced Course Advanced Topics in Software Verification  

E-Print Network (OSTI)

.g. c) § Have syntax 'a :: c for: type 'a supports the operations of c § Can write abstract polymorphicCOMP 4161 NICTA Advanced Course Advanced Topics in Software Verification Gerwin Klein, June

Klein, Gerwin

311

Lensless Imaging of Magnetic Nanostructures  

NLE Websites -- All DOE Office Websites (Extended Search)

Lensless Imaging of Magnetic Lensless Imaging of Magnetic Nanostructures Lensless Imaging of Magnetic Nanostructures Print Wednesday, 28 March 2012 00:00 Magnetism is useful for many devices and techniques, from electric motors and computer hard drives to magnetic resonance imaging used in medicine. By studying the basics of magnetism, scientists aim to better understand the fundamental physical principles that govern magnetic systems, perhaps leading to important new technologies. The high brightness and coherence of the ALS's soft x-rays have enabled scientists to apply lensless x-ray imaging for the first time to nanometer-scale magnetic structures in an alloy. Many Ways To See You open your eyes and detect the light rays streaming through your bedroom window (transmission), illuminating your socks on the floor (scattering). You put on your glasses (refraction) to detect the state of your image in the mirror (reflection). If you are an ALS scientist, perhaps you go to work and shine some x-ray light on a crystal to detect the arrangement of the atoms in the crystal (diffraction). Now, thanks to Turner et al., you can also shine some x-ray light on a magnetic sample to detect the arrangement of its electron spins through a method known as lensless imaging. This last example is an equally valid way to "see," but instead of using windows, lenses, or mirrors to manipulate light and construct an image, mathematical formulas are used to describe the effects that particles and fields in the sample have on the light. These formulas have always contained terms that relate to the electron spin of magnetic atoms, but they were previously ignored. Using the full formula allows for the determination of not only crystal structure, but magnetic spin distribution and orientation as well, with a spatial resolution limited only by the wavelength of x-rays used. This promising method can be used at any coherent light source, including modern x-ray free-electron lasers, where ultrashort pulses would freeze-frame magnetic changes, offering the potential for imaging in unprecedented detail the structure and motion of boundaries between regions with different magnetic orientation.

312

Whirlpools on the Nanoscale Could Multiply Magnetic Memory  

NLE Websites -- All DOE Office Websites (Extended Search)

Whirlpools on the Nanoscale Could Whirlpools on the Nanoscale Could Multiply Magnetic Memory Whirlpools on the Nanoscale Could Multiply Magnetic Memory Print Tuesday, 21 May 2013 00:00 Research at the Advanced Light Source may lead to four-bit magnetic cells housed on nanoscale metal disks, instead of the two-bit magnetic domains of standard magnetic memories. In magnetic vortices, parallel electron spins point either clockwise or counterclockwise, while in their crowded centers the spins point either down or up. "From the scientist's point of view, magnetism is about controlling electron spin," says Peter Fischer of the Materials Sciences Division, who leads the work at beamline 6.1.2. Four orientations could provide multibits in a new kind of memory. The next step is to control the states independently and simultaneously.

313

The Helioseismic and Magnetic Imager (HMI) Vector Magnetic Field Pipeline: Overview and Performance  

E-Print Network (OSTI)

The Helioseismic and Magnetic Imager (HMI) began near-continuous full-disk solar measurements on 1 May 2010 from the Solar Dynamics Observatory (SDO). An automated processing pipeline keeps pace with observations to produce observable quantities, including the photospheric vector magnetic field, from sequences of filtergrams. The primary 720s observables were released in mid 2010, including Stokes polarization parameters measured at six wavelengths as well as intensity, Doppler velocity, and the line-of-sight magnetic field. More advanced products, including the full vector magnetic field, are now available. Automatically identified HMI Active Region Patches (HARPs) track the location and shape of magnetic regions throughout their lifetime. The vector field is computed using the Very Fast Inversion of the Stokes Vector (VFISV) code optimized for the HMI pipeline; the remaining 180 degree azimuth ambiguity is resolved with the Minimum Energy (ME0) code. The Milne-Eddington inversion is performed on all full-di...

Hoeksema, J Todd; Hayashi, Keiji; Sun, Xudong; Schou, Jesper; Couvidat, Sebastien; Norton, Aimee; Bobra, Monica; Centeno, Rebecca; Leka, K D; Barnes, Graham; Turmon, Michael J

2014-01-01T23:59:59.000Z

314

Magnetic excitations and polarized neutrons  

SciTech Connect

We review the historical development of polarized beam techniques for studies of condensed matter physics. In particular we describe, in some detail, the recent advance of the triple axis technique with polarization analysis. It is now possible to carry out quantitative characterization of magnetic cross sections S(Q,..omega..), in absolute units, for a wide range of energy and momentum transfers. We will discuss some examples of recent inelastic measurements on 3d ferromagnets and heavy Fermions. 35 refs., 11 figs., 2 tabs.

Shirane, G.

1985-01-01T23:59:59.000Z

315

Effect of Minimal lengths on Electron Magnetism  

E-Print Network (OSTI)

We study the magnetic properties of electron in a constant magnetic field and confined by a isotropic two dimensional harmonic oscillator on a space where the coordinates and momenta operators obey generalized commutation relations leading to the appearance of a minimal length. Using the momentum space representation we determine exactly the energy eigenvalues and eigenfunctions. We prove that the usual degeneracy of Landau levels is removed by the presence of the minimal length in the limits of weak and strong magnetic field.The thermodynamical properties of the system, at high temperature, are also investigated showing a new magnetic behavior in terms of the minimal length.

Khireddine Nouicer

2007-07-13T23:59:59.000Z

316

Magnetic Reconnection in Astrophysical and  

E-Print Network (OSTI)

Magnetic Reconnection in Astrophysical and Laboratory Plasmas Ellen G. Zweibel1 and Masaaki Yamada2 astrophysics, magnetic fields, magnetic reconnection Abstract Magnetic reconnection is a topological rearrangement of magnetic field that converts magnetic energy to plasma energy. Astrophysical flares, from

317

Herty Advanced Materials Development Center  

Energy.gov (U.S. Department of Energy (DOE))

Session 1-B: Advancing Alternative Fuels for the Military and Aviation Sector Breakout Session 1: New Developments and Hot Topics Jill Stuckey, Acting Director, Herty Advanced Materials Development Center

318

Search Advanced Search Home > News  

E-Print Network (OSTI)

Search Advanced Search Home > News [-] Text [+] Email Print tweet 0 tweets RSS Feeds Newsletters with bodily tissues, "these approaches might have the potential to redefine design strategies for advanced

Rogers, John A.

319

Electronic Structure and Magnetism in Diluted Magnetic Semiconductors  

NLE Websites -- All DOE Office Websites (Extended Search)

Electronic Structure and Magnetism in Diluted Magnetic Semiconductors Electronic Structure and Magnetism in Diluted Magnetic Semiconductors Print Wednesday, 29 November 2006 00:00...

320

National High Magnetic Field Laboratory Audio Dictionary: Magnetic...  

NLE Websites -- All DOE Office Websites (Extended Search)

Links Magnets from Mini to Mighty Meet the Magnets How to Make an Electromagnet (audio slideshow) Compasses in Magnetic Fields (interactive tutorial) Magnetic Field Around a...

Note: This page contains sample records for the topic "determination advanced magnetic" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


321

Overview | Advanced Photon Source  

NLE Websites -- All DOE Office Websites (Extended Search)

APS Overview: APS Overview: Introduction APS Systems Map LINAC Booster Synchrotron Storage Ring Insertion Devices Experiment Hall LOMs & Beamlines Overview of the APS The Advanced Photon Source (APS) at the U.S. Department of Energy's Argonne National Laboratory provides this nation's (in fact, this hemisphere's) brightest storage ring-generated x-ray beams for research in almost all scientific disciplines. Photo: Aerial Photo of APS Aerial photo of the Advanced Photon Source These x-rays allow scientists to pursue new knowledge about the structure and function of materials in the center of the Earth and in outer space, and all points in between. The knowledge gained from this research can impact the evolution of combustion engines and microcircuits, aid in the development of new pharmaceuticals, and pioneer nanotechnologies whose

322

NETL: Advanced Research - Ultrasupercritical  

NLE Websites -- All DOE Office Websites (Extended Search)

High Performance Materials > Ultrasupercritical High Performance Materials > Ultrasupercritical Advanced Research High Performance Materials Ultrasupercritical Increasing the temperature and pressure of steam improves the efficiency of boilers and turbines that use steam as the working fluid. These higher efficiency boilers and turbines require less coal and produce less greenhouse gases. Identifying materials that can operate for long periods of time at extreme temperatures and pressures is a major goal of NETL's Advanced Research Materials Program. Phase diagram of water Figure 1: Phase diagram of water To understand the terminology of boilers and turbines, it is first necessary to understand the basics of the water/steam phase diagram (see Figure 1). The normal boiling point (nbp) of water occurs at 1 atmosphere

323

Advanced Photon Source  

NLE Websites -- All DOE Office Websites (Extended Search)

Tomography Interest Group Contact: Robert Winarski, Center for Nanoscale Materials winarski@anl.gov Contact: Francesco De Carlo, Advanced Photon Source decarlo@aps.anl.gov The tomography special interest group of the Advanced Photon Source (APS) at Argonne National Laboratory has been created to promote awareness of the tomography facilities at the APS and to foster communications between the various research groups. Through this group, we believe we can build a strong user community for tomography. The following beamlines have active tomography research programs: 2-BM-B (XOR) http://www.aps.anl.gov/Xray_Science_Division/Xray_Microscopy_and_Imaging/Science_and_Research/Techniques/Tomography/index.html Information about the beamline: http://beam.aps.anl.gov/pls/apsweb/beamline_display_pkg.display_beamline?p_beamline_num_c=31

324

Posters | Advanced Photon Source  

NLE Websites -- All DOE Office Websites (Extended Search)

Your Cart (0 Posters) Your Cart (0 Posters) Your cart is empty. checkout Subtotal: $0.00 update empty Posters Order a printed APS poster! 11 in. x 17 in. prints will be mailed in the order requests are received. 36 in. x 36 in. posters will be sent to school addresses once all orders are processed. The Advanced Photon Source Is The Advanced Photon Source Is Qty: 1 add to cart Technologies from Materials Science Technologies from Materials Science Qty: 1 add to cart Materials Under Extreme Pressure Materials Under Extreme Pressure Qty: 1 add to cart Biological Macromolecules in Action Biological Macromolecules in Action Qty: 1 add to cart Journey to the Center of the Earth Journey to the Center of the Earth Qty: 1 add to cart Earthshaking Monitor Earthshaking Monitor Qty: 1 add to cart Imaging with X-rays

325

Advanced Simulation Capability for  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Simulation Capability for Simulation Capability for Environmental Management (ASCEM) ASCEM is being developed to provide a tool and approach to facilitate robust and standardized development of perfor- mance and risk assessments for cleanup and closure activi- ties throughout the EM complex. The ASCEM team is composed of scientists from eight National Laboratories. This team is leveraging Department of Energy (DOE) investments in basic science and applied research including high performance computing codes developed through the Advanced Scientific Computing Research and Advanced Simulation & Computing pro- grams as well as collaborating with the Offices of Science, Fossil Energy, and Nuclear Energy. Challenge Current groundwater and soil remediation challenges that will continue to be addressed in the next decade include

326

Advanced Technology Vehicle Testing  

SciTech Connect

The goal of the U.S. Department of Energy's Advanced Vehicle Testing Activity (AVTA) is to increase the body of knowledge as well as the awareness and acceptance of electric drive and other advanced technology vehicles (ATV). The AVTA accomplishes this goal by testing ATVs on test tracks and dynamometers (Baseline Performance testing), as well as in real-world applications (Fleet and Accelerated Reliability testing and public demonstrations). This enables the AVTA to provide Federal and private fleet managers, as well as other potential ATV users, with accurate and unbiased information on vehicle performance and infrastructure needs so they can make informed decisions about acquiring and operating ATVs. The ATVs currently in testing include vehicles that burn gaseous hydrogen (H2) fuel and hydrogen/CNG (H/CNG) blended fuels in internal combustion engines (ICE), and hybrid electric (HEV), urban electric, and neighborhood electric vehicles. The AVTA is part of DOE's FreedomCAR and Vehicle Technologies Program.

James Francfort

2004-06-01T23:59:59.000Z

327

Advanced Separation Consortium  

SciTech Connect

The Center for Advanced Separation Technologies (CAST) was formed in 2001 under the sponsorship of the US Department of Energy to conduct fundamental research in advanced separation and to develop technologies that can be used to produce coal and minerals in an efficient and environmentally acceptable manner. The CAST consortium consists of seven universities - Virginia Tech, West Virginia University, University of Kentucky, Montana Tech, University of Utah, University of Nevada-Reno, and New Mexico Tech. The consortium brings together a broad range of expertise to solve problems facing the US coal industry and the mining sector in general. At present, a total of 60 research projects are under way. The article outlines some of these, on topics including innovative dewatering technologies, removal of mercury and other impurities, and modelling of the flotation process. 1 photo.

NONE

2006-01-01T23:59:59.000Z

328

Advanced steel reheat furnace  

SciTech Connect

Energy and Environmental Research Corp. (EER) under a contract from the Department of Energy is pursuing the development and demonstration of an Advanced Steel Reheating Furnace. This paper reports the results of Phase 1, Research, which has evaluated an advanced furnace concept incorporating two proven and commercialized technologies previously applied to other high temperature combustion applications: EER`s gas reburn technology (GR) for post combustion NOx control; and Air Product`s oxy-fuel enrichment air (OEA) for improved flame heat transfer in the heating zones of the furnace. The combined technologies feature greater production throughput with associated furnace efficiency improvements; lowered NOx emissions; and better control over the furnace atmosphere, whether oxidizing or reducing, leading to better control over surface finish.

Moyeda, D.; Sheldon, M.; Koppang, R. [Energy and Environmental Research Corp., Irvine, CA (United States); Lanyi, M.; Li, X.; Eleazer, B. [Air Products and Chemicals, Inc., Allentown, PA (United States)

1997-10-01T23:59:59.000Z

329

Advanced Photon Source  

NLE Websites -- All DOE Office Websites (Extended Search)

0 Advanced Photon Source 0 Advanced Photon Source A U.S. Department of Energy, Office of Science, Office of Basic Energy Sciences national synchrotron x-ray research facility Search Button About Welcome Overview Visiting the APS Mission & Goals Find People Organization Charts Committees Job Openings User Information Prospective Users New Users Current Users APS User Portal Macromolecular Crystallographers Administrators Find a Beamline Apply for Beam Time Contacts Calendars Community Scientific Access Site Access Training Science & Education Science & Research Highlights Conferences Seminars Publications Annual Reports APS Upgrade Courses and Schools Graduate Programs Scientific Software Media Center Calendar of Events APS News User News Argonne/APS Press Releases Argonne/APS Feature Stories Argonne/APS In The News

330

Structural Study on Moving Magnet Compressor for Stirling Engine  

Science Journals Connector (OSTI)

The article describes a structural study on moving magnet compressor for Stirling engine. The performance of Stirling engine is determined by the linear compressor. The article first establishes mathematics models for ordinary linear compressors and ... Keywords: Stirling engine, moving magnet linear compressor, CAE, magnet field analysis

Ding Guozhong; Zhang Xiaoqing; He Mingshun; Shu Shuiming

2010-06-01T23:59:59.000Z

331

Pulsed Nuclear Magnetic Resonance: Spin Echoes MIT Department of Physics  

E-Print Network (OSTI)

Pulsed Nuclear Magnetic Resonance: Spin Echoes MIT Department of Physics (Dated: February 5, 2014) In this experiment, the phenomenon of Nuclear Magnetic Resonance (NMR) is used to determine the magnetic moments-factor in atomic spectroscopy and is given by g = (µ/µN )/I, (2) and µN is the nuclear magneton, e /2mp

Seager, Sara

332

Advanced Energy Guides  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Energy Guides Energy Guides Shanti Pless National Renewable Energy Laboratory shanti.pless@nrel.gov 303-384-6365 April 4 2013 2 | Building Technologies Office eere.energy.gov Advanced Energy Design Guides Provide prescriptive energy savings guidance and recommendations by building type and geographic location: * Design packages and strategies to help owners and designers achieve 50% site energy savings over Standard 90.1 * Two series: - 30% savings over 90.1-1999

333

Advanced Energy Guides  

NLE Websites -- All DOE Office Websites (Extended Search)

Energy Guides Energy Guides Shanti Pless National Renewable Energy Laboratory shanti.pless@nrel.gov 303-384-6365 April 4 2013 2 | Building Technologies Office eere.energy.gov Advanced Energy Design Guides Provide prescriptive energy savings guidance and recommendations by building type and geographic location: * Design packages and strategies to help owners and designers achieve 50% site energy savings over Standard 90.1 * Two series: - 30% savings over 90.1-1999

334

ADVANCED CHEMISTRY BASINS MODEL  

SciTech Connect

The advanced Chemistry Basin Model project has been operative for 48 months. During this period, about half the project tasks are on projected schedule. On average the project is somewhat behind schedule (90%). Unanticipated issues are causing model integration to take longer then scheduled, delaying final debugging and manual development. It is anticipated that a short extension will be required to fulfill all contract obligations.

William Goddard III; Lawrence Cathles III; Mario Blanco; Paul Manhardt; Peter Meulbroek; Yongchun Tang

2004-05-01T23:59:59.000Z

335

Advancing Next-Generation Vehicles  

NLE Websites -- All DOE Office Websites (Extended Search)

the U.S. Department of Energy's (DOE's) lead laboratory for researching advanced vehicle technologies, including hy- the U.S. Department of Energy's (DOE's) lead laboratory for researching advanced vehicle technologies, including hy- brid, plug-in hybrid, battery electric, and alternative fuel vehicles, Argonne provides transportation research critical to advancing the development of next-generation vehicles. Central to this effort is the Lab's Advanced Powertrain Research Facility (APRF), an integrated four-wheel drive chassis dynamometer and component test facility.

336

Advanced Microturbine Systems  

SciTech Connect

Dept. of Energy (DOE) Cooperative Agreement DE-FC02-00-CH11061 was originally awarded to Honeywell International, Inc. ?? Honeywell Power Systems Inc. (HPSI) division located in Albuquerque, NM in October 2000 to conduct a program titled Advanced Microturbine Systems (AMS). The DOE Advanced Microturbines Systems Program was originally proposed as a five-year program to design and develop a high efficiency, low emissions, durable microturbine system. The period of performance was to be October 2000 through September 2005. Program efforts were underway, when one year into the program Honeywell sold the intellectual property of Honeywell Power Systems Inc. and HPSI ceased business operations. Honeywell made an internal decision to restructure the existing program due to the HPSI shutdown and submitted a formal request to DOE on September 24, 2001 to transfer the Cooperative Agreement to Honeywell Engines, Systems and Services (HES&S) in Phoenix, AZ in order to continue to offer support for DOE's Advanced Microturbine Program. Work continued on the descoped program under Cooperative Agreement No. DE-FC26-00-CH11061 and has been completed.

None

2005-12-31T23:59:59.000Z

337

Advancement of Electrochromic Windows  

NLE Websites -- All DOE Office Websites (Extended Search)

Advancement of Electrochromic Windows Advancement of Electrochromic Windows Title Advancement of Electrochromic Windows Publication Type Report LBNL Report Number LBNL-59821 Year of Publication 2006 Authors Lee, Eleanor S., Stephen E. Selkowitz, Robert D. Clear, Dennis L. DiBartolomeo, Joseph H. Klems, Luis L. Fernandes, Gregory J. Ward, Vorapat Inkarojrit, and Mehry Yazdanian Date Published 04/2006 Other Numbers CEC-500-2006-052 Keywords commercial buildings, daylight, daylighting controls, Electrochromic windows, energy efficiency, human factors, peak demand, switchable windows, visual comfort Abstract This guide provides consumer-oriented information about switchable electrochromic (EC) windows. Electrochromic windows change tint with a small applied voltage, providing building owners and occupants with the option to have clear or tinted windows at any time, irrespective of whether it's sunny or cloudy. EC windows can be manually or automatically controlled based on daylight, solar heat gain, glare, view, energy-efficiency, peak electricity demand response, or other criteria. Window controls can be integrated with other building systems, such as lighting and heating/cooling mechanical systems, to optimize interior environmental conditions, occupant comfort, and energy-efficiency.

338

Lensless Imaging of Magnetic Nanostructures  

NLE Websites -- All DOE Office Websites (Extended Search)

Lensless Imaging of Magnetic Nanostructures Print Lensless Imaging of Magnetic Nanostructures Print Magnetism is useful for many devices and techniques, from electric motors and computer hard drives to magnetic resonance imaging used in medicine. By studying the basics of magnetism, scientists aim to better understand the fundamental physical principles that govern magnetic systems, perhaps leading to important new technologies. The high brightness and coherence of the ALS's soft x-rays have enabled scientists to apply lensless x-ray imaging for the first time to nanometer-scale magnetic structures in an alloy. Many Ways To See You open your eyes and detect the light rays streaming through your bedroom window (transmission), illuminating your socks on the floor (scattering). You put on your glasses (refraction) to detect the state of your image in the mirror (reflection). If you are an ALS scientist, perhaps you go to work and shine some x-ray light on a crystal to detect the arrangement of the atoms in the crystal (diffraction). Now, thanks to Turner et al., you can also shine some x-ray light on a magnetic sample to detect the arrangement of its electron spins through a method known as lensless imaging. This last example is an equally valid way to "see," but instead of using windows, lenses, or mirrors to manipulate light and construct an image, mathematical formulas are used to describe the effects that particles and fields in the sample have on the light. These formulas have always contained terms that relate to the electron spin of magnetic atoms, but they were previously ignored. Using the full formula allows for the determination of not only crystal structure, but magnetic spin distribution and orientation as well, with a spatial resolution limited only by the wavelength of x-rays used. This promising method can be used at any coherent light source, including modern x-ray free-electron lasers, where ultrashort pulses would freeze-frame magnetic changes, offering the potential for imaging in unprecedented detail the structure and motion of boundaries between regions with different magnetic orientation.

339

Lensless Imaging of Magnetic Nanostructures  

NLE Websites -- All DOE Office Websites (Extended Search)

Lensless Imaging of Magnetic Nanostructures Print Lensless Imaging of Magnetic Nanostructures Print Magnetism is useful for many devices and techniques, from electric motors and computer hard drives to magnetic resonance imaging used in medicine. By studying the basics of magnetism, scientists aim to better understand the fundamental physical principles that govern magnetic systems, perhaps leading to important new technologies. The high brightness and coherence of the ALS's soft x-rays have enabled scientists to apply lensless x-ray imaging for the first time to nanometer-scale magnetic structures in an alloy. Many Ways To See You open your eyes and detect the light rays streaming through your bedroom window (transmission), illuminating your socks on the floor (scattering). You put on your glasses (refraction) to detect the state of your image in the mirror (reflection). If you are an ALS scientist, perhaps you go to work and shine some x-ray light on a crystal to detect the arrangement of the atoms in the crystal (diffraction). Now, thanks to Turner et al., you can also shine some x-ray light on a magnetic sample to detect the arrangement of its electron spins through a method known as lensless imaging. This last example is an equally valid way to "see," but instead of using windows, lenses, or mirrors to manipulate light and construct an image, mathematical formulas are used to describe the effects that particles and fields in the sample have on the light. These formulas have always contained terms that relate to the electron spin of magnetic atoms, but they were previously ignored. Using the full formula allows for the determination of not only crystal structure, but magnetic spin distribution and orientation as well, with a spatial resolution limited only by the wavelength of x-rays used. This promising method can be used at any coherent light source, including modern x-ray free-electron lasers, where ultrashort pulses would freeze-frame magnetic changes, offering the potential for imaging in unprecedented detail the structure and motion of boundaries between regions with different magnetic orientation.

340

Lensless Imaging of Magnetic Nanostructures  

NLE Websites -- All DOE Office Websites (Extended Search)

Lensless Imaging of Magnetic Nanostructures Print Lensless Imaging of Magnetic Nanostructures Print Magnetism is useful for many devices and techniques, from electric motors and computer hard drives to magnetic resonance imaging used in medicine. By studying the basics of magnetism, scientists aim to better understand the fundamental physical principles that govern magnetic systems, perhaps leading to important new technologies. The high brightness and coherence of the ALS's soft x-rays have enabled scientists to apply lensless x-ray imaging for the first time to nanometer-scale magnetic structures in an alloy. Many Ways To See You open your eyes and detect the light rays streaming through your bedroom window (transmission), illuminating your socks on the floor (scattering). You put on your glasses (refraction) to detect the state of your image in the mirror (reflection). If you are an ALS scientist, perhaps you go to work and shine some x-ray light on a crystal to detect the arrangement of the atoms in the crystal (diffraction). Now, thanks to Turner et al., you can also shine some x-ray light on a magnetic sample to detect the arrangement of its electron spins through a method known as lensless imaging. This last example is an equally valid way to "see," but instead of using windows, lenses, or mirrors to manipulate light and construct an image, mathematical formulas are used to describe the effects that particles and fields in the sample have on the light. These formulas have always contained terms that relate to the electron spin of magnetic atoms, but they were previously ignored. Using the full formula allows for the determination of not only crystal structure, but magnetic spin distribution and orientation as well, with a spatial resolution limited only by the wavelength of x-rays used. This promising method can be used at any coherent light source, including modern x-ray free-electron lasers, where ultrashort pulses would freeze-frame magnetic changes, offering the potential for imaging in unprecedented detail the structure and motion of boundaries between regions with different magnetic orientation.

Note: This page contains sample records for the topic "determination advanced magnetic" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


341

Lensless Imaging of Magnetic Nanostructures  

NLE Websites -- All DOE Office Websites (Extended Search)

Lensless Imaging of Magnetic Nanostructures Print Lensless Imaging of Magnetic Nanostructures Print Magnetism is useful for many devices and techniques, from electric motors and computer hard drives to magnetic resonance imaging used in medicine. By studying the basics of magnetism, scientists aim to better understand the fundamental physical principles that govern magnetic systems, perhaps leading to important new technologies. The high brightness and coherence of the ALS's soft x-rays have enabled scientists to apply lensless x-ray imaging for the first time to nanometer-scale magnetic structures in an alloy. Many Ways To See You open your eyes and detect the light rays streaming through your bedroom window (transmission), illuminating your socks on the floor (scattering). You put on your glasses (refraction) to detect the state of your image in the mirror (reflection). If you are an ALS scientist, perhaps you go to work and shine some x-ray light on a crystal to detect the arrangement of the atoms in the crystal (diffraction). Now, thanks to Turner et al., you can also shine some x-ray light on a magnetic sample to detect the arrangement of its electron spins through a method known as lensless imaging. This last example is an equally valid way to "see," but instead of using windows, lenses, or mirrors to manipulate light and construct an image, mathematical formulas are used to describe the effects that particles and fields in the sample have on the light. These formulas have always contained terms that relate to the electron spin of magnetic atoms, but they were previously ignored. Using the full formula allows for the determination of not only crystal structure, but magnetic spin distribution and orientation as well, with a spatial resolution limited only by the wavelength of x-rays used. This promising method can be used at any coherent light source, including modern x-ray free-electron lasers, where ultrashort pulses would freeze-frame magnetic changes, offering the potential for imaging in unprecedented detail the structure and motion of boundaries between regions with different magnetic orientation.

342

COBRA: Determining Atomic Positions in Thin-Film Structures and Interfaces  

NLE Websites -- All DOE Office Websites (Extended Search)

COBRA: Determining Atomic Positions in Thin-Film Structures and Interfaces COBRA: Determining Atomic Positions in Thin-Film Structures and Interfaces Coherent Bragg rod analyses (COBRA) experiments using synchrotron x-rays at Argonne's Advanced Photon Source (MHATT-CAT and PNC-CAT beamlines) directly revealed the sub-angstrom atomic interaction of epitaxial films with substrates. Information on how atoms in the adjoining layers of the film and substrate rearrange to mimic each other may lead to improvements in semiconductor manufacturing and the development of novel heterostructure materials, such as multilayer ferroelectrics, magnetic nanostructures and thin film superconductors. COBRA electron density map of a Gd2O3 film on a gallium arsenide substrate. The peaks correspond to folded Gd atomic positions parallel to the plane of the substrate.

343

Fossil Energy Advanced Technologies (2008 - 2009) | Department...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Fossil Energy Advanced Technologies (2008 - 2009) Fossil Energy Advanced Technologies (2008 - 2009) Fossil Energy Advanced Technologies (2008 - 2009) Amendment: Energy and...

344

Thermomagnetic burn control for magnetic fusion reactor  

DOE Patents (OSTI)

Apparatus is provided for controlling the plasma energy production rate of a magnetic-confinement fusion reactor, by controlling the magnetic field ripple. The apparatus includes a group of shield sectors (30a, 30b, etc.) formed of ferromagnetic material which has a temperature-dependent saturation magnetization, with each shield lying between the plasma (12) and a toroidal field coil (18). A mechanism (60) for controlling the temperature of the magnetic shields, as by controlling the flow of cooling water therethrough, thereby controls the saturation magnetization of the shields and therefore the amount of ripple in the magnetic field that confines the plasma, to thereby control the amount of heat loss from the plasma. This heat loss in turn determines the plasma state and thus the rate of energy production.

Rawls, John M. (Del Mar, CA); Peuron, Unto A. (Solana Beach, CA)

1982-01-01T23:59:59.000Z

345

Thermomagnetic burn control for magnetic fusion reactor  

DOE Patents (OSTI)

Apparatus is provided for controlling the plasma energy production rate of a magnetic-confinement fusion reactor, by controlling the magnetic field ripple. The apparatus includes a group of shield sectors formed of ferromagnetic material which has a temperature-dependent saturation magnetization, with each shield lying between the plasma and a toroidal field coil. A mechanism for controlling the temperature of the magnetic shields, as by controlling the flow of cooling water therethrough, thereby controls the saturation magnetization of the shields and therefore the amount of ripple in the magnetic field that confines the plasma, to thereby control the amount of heat loss from the plasma. This heat loss in turn determines the plasma state and thus the rate of energy production.

Rawls, J.M.; Peuron, A.U.

1980-07-01T23:59:59.000Z

346

Superconducting magnet  

DOE Patents (OSTI)

A superconducting magnet designed to produce magnetic flux densities of the order of 4 to 5 Webers per square meter is constructed by first forming a cable of a plurality of matrixed superconductor wires with each wire of the plurality insulated from each other one. The cable is shaped into a rectangular cross-section and is wound with tape in an open spiral to create cooling channels. Coils are wound in a calculated pattern in saddle shapes to produce desired fields, such as dipoles, quadrupoles, and the like. Wedges are inserted between adjacent cables as needed to maintain substantially radial placement of the long dimensions of cross sections of the cables. After winding, individual strands in each of the cables are brought out to terminals and are interconnected to place all of the strands in series and to maximize the propagation of a quench by alternating conduction from an inner layer to an outer layer and from top half to bottom half as often as possible. Individual layers are separated from others by spiraled aluminum spacers to facilitate cooling. The wound coil is wrapped with an epoxy tape that is cured by heat and then machined to an interference fit with an outer aluminum pipe which is then affixed securely to the assembled coil by heating it to make a shrink fit. In an alternate embodiment, one wire of the cable is made of copper or the like to be heated externally to propagate a quench.

Satti, John A. (Naperville, IL)

1980-01-01T23:59:59.000Z

347

X-Ray Diffraction Microscopy of Magnetic Structures  

NLE Websites -- All DOE Office Websites (Extended Search)

X-Ray Diffraction Microscopy of Magnetic Structures Print X-Ray Diffraction Microscopy of Magnetic Structures Print science brief icon Scientists working at ALS Beamline 12.0.2.2 have demonstrated a new x-ray technique for producing short-exposure nanoscale images of the magnetic structure of materials. The new method combines aspects of coherent x-ray diffraction, which can determine 3-D charge distributions, and resonant magnetic scattering, which is sensitive to magnetic structures. Physicists have used coherent x-ray diffraction to measure the electron density of complicated molecules. The formula used to make these calculations contains terms that relate to the electron spin of magnetic atoms, but these terms are traditionally ignored since coherent x-ray diffraction has not been used to retrieve magnetic information. Using the full formula allows for the determination of not only the electron density, but also the magnetic spin distribution and its orientation.

348

X-Ray Diffraction Microscopy of Magnetic Structures  

NLE Websites -- All DOE Office Websites (Extended Search)

X-Ray Diffraction Microscopy of Magnetic Structures Print X-Ray Diffraction Microscopy of Magnetic Structures Print science brief icon Scientists working at ALS Beamline 12.0.2.2 have demonstrated a new x-ray technique for producing short-exposure nanoscale images of the magnetic structure of materials. The new method combines aspects of coherent x-ray diffraction, which can determine 3-D charge distributions, and resonant magnetic scattering, which is sensitive to magnetic structures. Physicists have used coherent x-ray diffraction to measure the electron density of complicated molecules. The formula used to make these calculations contains terms that relate to the electron spin of magnetic atoms, but these terms are traditionally ignored since coherent x-ray diffraction has not been used to retrieve magnetic information. Using the full formula allows for the determination of not only the electron density, but also the magnetic spin distribution and its orientation.

349

X-Ray Diffraction Microscopy of Magnetic Structures  

NLE Websites -- All DOE Office Websites (Extended Search)

X-Ray Diffraction Microscopy of Magnetic Structures Print X-Ray Diffraction Microscopy of Magnetic Structures Print science brief icon Scientists working at ALS Beamline 12.0.2.2 have demonstrated a new x-ray technique for producing short-exposure nanoscale images of the magnetic structure of materials. The new method combines aspects of coherent x-ray diffraction, which can determine 3-D charge distributions, and resonant magnetic scattering, which is sensitive to magnetic structures. Physicists have used coherent x-ray diffraction to measure the electron density of complicated molecules. The formula used to make these calculations contains terms that relate to the electron spin of magnetic atoms, but these terms are traditionally ignored since coherent x-ray diffraction has not been used to retrieve magnetic information. Using the full formula allows for the determination of not only the electron density, but also the magnetic spin distribution and its orientation.

350

STATEMENT OF CONSIDERATIONS REQUEST BY DUPONT SUPERCONDUCTIVITY FOR AN ADVANCE  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

DUPONT SUPERCONDUCTIVITY FOR AN ADVANCE DUPONT SUPERCONDUCTIVITY FOR AN ADVANCE WAIVER OF DOMESTIC AND FOREIGN PATENT RIGHTS UNDER DOE CONTRACT NO. DE-FC36-99GO10287; W(A)-99-008; CH-1002 The Petitioner, DuPont Superconductivity (hereinafter "DuPont"), has requested a waiver of domestic and foreign patent rights for all subject inventions arising from its participation under the above referenced contract entitled "High Temperature Superconducting Reciprocating Magnetic Separator". This contract relates to the construction of 1/4 commercial scale High Temperature Superconducting (hereinafter "HTS") Reciprocating Magnetic Separations Unit for the purification ofkaoline clay and titanium dioxide. It is anticipated that this project will be performed in three phases, over a period of

351

Plasmoids as magnetic flux ropes  

SciTech Connect

Observational constraints on the magnetic topology and orientation of plasmoids is examined using a magnetic field model. The authors develop a magnetic flux rope model to examine whether principal axis analysis (PAA) of magnetometer signatures from a single satellite pass is sufficient to determine the magnetic topology of plasmoids and if plasmoid observations are best explained by the flux rope, closed loop, or large-amplitude wave picture. Satellite data are simulated by extracting the magnetic field along a path through the model of a magnetic flux rope. They then examine the results using PAA. They find that the principal axis directions (and therefore the interpretation of structure orientation) is highly dependent on several parameters including the satellite trajectory through the structure. Because of this they conclude that PAA of magnetometer data from a single satellite pass is insufficient to differentiate between magnetic closed loop and flux rope models. They also compare the model results to ISEE 3 magnetometer data of plasmoid events in various coordinate frames including principal axis and geocentric solar magnetospheric. They find that previously identified plasmoid events that have been explained as closed loop structures can also be modeled as flux ropes. They also searched the literature for previously reported flux rope and closed loop plasmoid events to examine if these structures had any similarities and/or differences. The results of the modeling efforts and examination of both flux rope and plasmoid events lead them to favor the flux rope model of plasmoid formation, as it is better able to unify the observations of various magnetic structures observed by ISEE 3.

Moldwin, M.B.; Hughes, W.J. (Boston Univ., MA (United States))

1991-08-01T23:59:59.000Z

352

Advanced Modular Inverter Technology Development  

SciTech Connect

Electric and hybrid-electric vehicle systems require an inverter to convert the direct current (DC) output of the energy generation/storage system (engine, fuel cells, or batteries) to the alternating current (AC) that vehicle propulsion motors use. Vehicle support systems, such as lights and air conditioning, also use the inverter AC output. Distributed energy systems require an inverter to provide the high quality AC output that energy system customers demand. Today's inverters are expensive due to the cost of the power electronics components, and system designers must also tailor the inverter for individual applications. Thus, the benefits of mass production are not available, resulting in high initial procurement costs as well as high inverter maintenance and repair costs. Electricore, Inc. (www.electricore.org) a public good 501 (c) (3) not-for-profit advanced technology development consortium assembled a highly qualified team consisting of AeroVironment Inc. (www.aerovironment.com) and Delphi Automotive Systems LLC (Delphi), (www.delphi.com), as equal tiered technical leads, to develop an advanced, modular construction, inverter packaging technology that will offer a 30% cost reduction over conventional designs adding to the development of energy conversion technologies for crosscutting applications in the building, industry, transportation, and utility sectors. The proposed inverter allows for a reduction of weight and size of power electronics in the above-mentioned sectors and is scalable over the range of 15 to 500kW. The main objective of this program was to optimize existing AeroVironment inverter technology to improve power density, reliability and producibility as well as develop new topology to reduce line filter size. The newly developed inverter design will be used in automotive and distribution generation applications. In the first part of this program the high-density power stages were redesigned, optimized and fabricated. One of the main tasks was to design and validate new gate drive circuits to provide the capability of high temp operation. The new power stages and controls were later validated through extensive performance, durability and environmental tests. To further validate the design, two power stages and controls were integrated into a grid-tied load bank test fixture, a real application for field-testing. This fixture was designed to test motor drives with PWM output up to 50kW. In the second part of this program the new control topology based on sub-phases control and interphase transformer technology was successfully developed and validated. The main advantage of this technology is to reduce magnetic mass, loss and current ripple. This report summarizes the results of the advanced modular inverter technology development and details: (1) Power stage development and fabrication (2) Power stage validation testing (3) Grid-tied test fixture fabrication and initial testing (4) Interphase transformer technology development

Adam Szczepanek

2006-02-04T23:59:59.000Z

353

Categorical Exclusion Determination Form  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

2-1556) Texas A&M University (TAMU) - System Development for Vehicular Natural Gas Storage Using Advanced Porous Materials Program or Field Office: Advanced Research Projects...

354

Materials Characterization | Advanced Materials | ORNL  

NLE Websites -- All DOE Office Websites (Extended Search)

Electron Microscopy X-ray Scattering Neutron Scattering Mechanical Properties Thermal Optical Spectroscopy Nuclear Magnetic Resonance Macromolecular Characterization Nuclear...

355

Learning About Magnets!  

NLE Websites -- All DOE Office Websites (Extended Search)

by the National High Magnetic Field Laboratory Learning About Name A magnet is a material or object that creates a magnetic fi eld. This fi eld is invisible, but it creates a...

356

Interface Magnetism in Multiferroics  

E-Print Network (OSTI)

1.2.1 Magnetism . . . . . . . . . . . . . . . . . . . 1.2.2domain walls . . . . . 3 Magnetism of domain walls in BiFeOof electrical control of magnetism in mixed phase BiFeO 3

He, Qing

2011-01-01T23:59:59.000Z

357

ADVANCED SULFUR CONTROL CONCEPTS  

SciTech Connect

Conventional sulfur removal in integrated gasification combined cycle (IGCC) power plants involves numerous steps: COS (carbonyl sulfide) hydrolysis, amine scrubbing/regeneration, Claus process, and tail-gas treatment. Advanced sulfur removal in IGCC systems involves typically the use of zinc oxide-based sorbents. The sulfides sorbent is regenerated using dilute air to produce a dilute SO{sub 2} (sulfur dioxide) tail gas. Under previous contracts the highly effective first generation Direct Sulfur Recovery Process (DSRP) for catalytic reduction of this SO{sub 2} tail gas to elemental sulfur was developed. This process is currently undergoing field-testing. In this project, advanced concepts were evaluated to reduce the number of unit operations in sulfur removal and recovery. Substantial effort was directed towards developing sorbents that could be directly regenerated to elemental sulfur in an Advanced Hot Gas Process (AHGP). Development of this process has been described in detail in Appendices A-F. RTI began the development of the Single-step Sulfur Recovery Process (SSRP) to eliminate the use of sorbents and multiple reactors in sulfur removal and recovery. This process showed promising preliminary results and thus further process development of AHGP was abandoned in favor of SSRP. The SSRP is a direct Claus process that consists of injecting SO{sub 2} directly into the quenched coal gas from a coal gasifier, and reacting the H{sub 2}S-SO{sub 2} mixture over a selective catalyst to both remove and recover sulfur in a single step. The process is conducted at gasifier pressure and 125 to 160 C. The proposed commercial embodiment of the SSRP involves a liquid phase of molten sulfur with dispersed catalyst in a slurry bubble-column reactor (SBCR).

Apostolos A. Nikolopoulos; Santosh K. Gangwal; William J. McMichael; Jeffrey W. Portzer

2003-01-01T23:59:59.000Z

358

Advanced Biofuels Workshop  

Gasoline and Diesel Fuel Update (EIA)

August 1, 2012 August 1, 2012 In Attendance U.S. Energy Information Administration 1000 Independence Ave. SW, Room 2E-069 Washington, DC 20585 Adam Sieminski EIA Terry Higgins Hart Downstream Energy Services Peter Ryus RSB Services Foundation Zia Haq DOE Robert Kozak Atlantic Biomass Conversion Leticia Phillips UNICA/Brazillian Sugarecane Industry Assoc. Paul Kamp Leifmark, LLC/Inbicon Biomass Steve Gerber Fiberight Joanne Ivancic Advanced Biofuels USA John G. Cowie Agenda 2020 Technology Alliance Jeff Hazle American Fuel & Petrochemical Manufacturers Bryan Just American Petroleum Institute Barry Bernfeld Bunge Global Agribusiness Michael Corbin CLF Partners International LLC Paul Grabowski DOE, Office of Biomass Program

359

Advanced Demand Responsive Lighting  

NLE Websites -- All DOE Office Websites (Extended Search)

Demand Demand Responsive Lighting Host: Francis Rubinstein Demand Response Research Center Technical Advisory Group Meeting August 31, 2007 10:30 AM - Noon Meeting Agenda * Introductions (10 minutes) * Main Presentation (~ 1 hour) * Questions, comments from panel (15 minutes) Project History * Lighting Scoping Study (completed January 2007) - Identified potential for energy and demand savings using demand responsive lighting systems - Importance of dimming - New wireless controls technologies * Advanced Demand Responsive Lighting (commenced March 2007) Objectives * Provide up-to-date information on the reliability, predictability of dimmable lighting as a demand resource under realistic operating load conditions * Identify potential negative impacts of DR lighting on lighting quality Potential of Demand Responsive Lighting Control

360

Advanced Remediation Technologies  

SciTech Connect

The United States Department of Energy (DOE), Office of Environmental Management (EM) is responsible for the cleanup of nation's nuclear weapons program legacy wastes, along with waste associated with nuclear energy programs and research. The EM cleanup efforts continue to progress, however the cleanup continues to be technologically complex, heavily regulated, long-term; and the effort also has a high life cycle cost estimate (LCCE) effort. Over the past few years, the EM program has undergone several changes to accelerate its cleanup efforts with varying degrees of success. This article will provide some insight into the Advanced Remediation Technologies (ART) projects that may enhance cleanup efforts and reduce life cycle costs. (authors)

Krahn, St.; Miller, C.E. [The United States Department of Energy, Office of Environmental Management, Washington, D.C. (United States)

2008-07-01T23:59:59.000Z

Note: This page contains sample records for the topic "determination advanced magnetic" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


361

Advanced NTR options. [Ta  

SciTech Connect

Advanced NTR concepts which offer performance improvements over the ROVER/NERVA designs have been investigated. In addition, the deliverable performance of low pressure operation and materials issues have been investigated. Based on current experience, a maximum exit gas temperature of 3200 K is likely achievable with a ZrC based PBR design. At 3200 K a low pressure NTR would have marginal performance advantage (Isp) over a high pressure system. If tantalum or other high melting point carbides are used then an exit gas temperature of 3500 K may be feasible. At 3500 K low pressure operation offers more significant performance improvements which could outweigh associated size and mass penalties.

Davis, J.W.; Mills, J.C.; Glass, J.F.; Tu, W. (Rockwell International/Rocketdyne Division, 6633 Canoga Avenue, MS HB23 Canoga Park, California 81303 (US))

1991-01-05T23:59:59.000Z

362

Horizontal Advanced Tensiometer  

DOE Patents (OSTI)

An horizontal advanced tensiometer is described that allows the monitoring of the water pressure of soil positions, particularly beneath objects or materials that inhibit the use of previous monitoring wells. The tensiometer includes a porous cup, a pressure transducer (with an attached gasket device), an adaptive chamber, at least one outer guide tube which allows access to the desired horizontal position, a transducer wire, a data logger and preferably an inner guide tube and a specialized joint which provides pressure on the inner guide tube to maintain the seal between the gasket of the transducer and the adaptive chamber.

Hubbell, Joel M.; Sisson, James B.

2004-06-22T23:59:59.000Z

363

Advanced Manufacture of Reflectors  

Energy.gov (U.S. Department of Energy (DOE))

The Advance Manufacture of Reflectors fact sheet describes a SunShot Initiative project being conducted research team led by the University of Arizona, which is working to develop a novel method for shaping float glass. The technique developed by this research team can drastically reduce the time required for the shaping step. By enabling mass production of solar concentrating mirrors at high speed, this project should lead to improved performance and as much as a 40% reduction in manufacturing costs for reflectors made in very high volume.

364

Advanced Design Studies. Final report  

SciTech Connect

The ARIES-CS project was a multi-year multi-institutional project to assess the feasibility of a compact stellarator as a fusion power plant. The work herein describes efforts to help design one aspect of the device, the divertor, which is responsible for the removal of particle and heat flux from the system, acting as the first point of contact between the magnetically confined hot plasma and the outside world. Specifically, its location and topology are explored, extending previous work on the sub ject. An optimized design is determined for the thermal particle flux using a suite of 3D stellarator design codes which trace magnetic field lines from just inside the confined plasma edge to their strike points on divertor plates. These divertor plates are specified with a newly developed plate design code. It is found that a satisfactory thermal design exists which maintains the plate temperature and heat load distribution below tolerable engineering limits. The design is unique, including a toroidal taper on the outboard plates which was found to be important to our results. The maximum thermal heat flux for the final design was 3.61 M W/m2 and the maximum peaking factor was 10.3, below prescribed limits of 10 M W/m2 and 15.6, respectively. The median length of field lines reaching the plates is about 250 m and their average angle of inclination to the surface is 2 deg. Finally, an analysis of the fast alphas, resulting from fusion in the core, which escape the plasma was performed. A method is developed for obtaining the mapping from magnetic coordinates to real-space coordinates for the ARIES-CS. This allows the alpha exit locations to be identified in real space for the first time. These were then traced using the field line algorithm as well as a guiding center routine accounting for their mass, charge, and specific direction and energy. Results show that the current design is inadequate for accommodating the alpha heat flux, capturing at most 1/3 of lost alphas. However the distribution of the alphas on the device first wall indicates that a viable solution likely exists. It is noted that future designs must be sought which specifically address the fusion alphas through an integrated approach involving physics and engineering teams.

Steiner, Don [Rensselaer Polytechnic Institute, Troy, NY (United States)

2012-12-01T23:59:59.000Z

365

Vehicle Technologies Office: Advanced Combustion Engines  

NLE Websites -- All DOE Office Websites (Extended Search)

Advanced Combustion Advanced Combustion Engines to someone by E-mail Share Vehicle Technologies Office: Advanced Combustion Engines on Facebook Tweet about Vehicle Technologies Office: Advanced Combustion Engines on Twitter Bookmark Vehicle Technologies Office: Advanced Combustion Engines on Google Bookmark Vehicle Technologies Office: Advanced Combustion Engines on Delicious Rank Vehicle Technologies Office: Advanced Combustion Engines on Digg Find More places to share Vehicle Technologies Office: Advanced Combustion Engines on AddThis.com... Just the Basics Hybrid & Vehicle Systems Energy Storage Advanced Power Electronics & Electrical Machines Advanced Combustion Engines Combustion Engines Emission Control Waste Heat Recovery Fuels & Lubricants Materials Technologies Advanced Combustion Engines

366

Advanced Reactor Technologies | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Advanced Reactor Advanced Reactor Technologies Advanced Reactor Technologies Advanced Reactor Technologies Advanced Reactor Technologies The Office of Advanced Reactor Technologies (ART) sponsors research, development and deployment (RD&D) activities through its Next Generation Nuclear Plant (NGNP), Advanced Reactor Concepts (ARC), and Advanced Small Modular Reactor (aSMR) programs to promote safety, technical, economical, and environmental advancements of innovative Generation IV nuclear energy technologies. The Office of Nuclear Energy (NE) will pursue these advancements through RD&D activities at the Department of Energy (DOE) national laboratories and U.S. universities, as well as through collaboration with industry and international partners. These activities will focus on advancing scientific

367

Femtosecond Opto-Magnetism  

Science Journals Connector (OSTI)

We demonstrate that circularly polarized laser pulses may selectively excite different modes of magnetic resonance, realize quantum control of magnons, trigger magnetic phase...

Kimel, Alexey; Kirilyuk, A; Rasing, Th

368

Categorical Exclusion Determinations: American Recovery and Reinvestment  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

4, 2010 4, 2010 CX-004959: Categorical Exclusion Determination Primus Power -Low Cost, High Performance, 50-Year Electrodes CX(s) Applied: B3.6 Date: 08/14/2010 Location(s): Alameda, California Office(s): Advanced Research Projects Agency - Energy August 14, 2010 CX-004957: Categorical Exclusion Determination General Compression, Inc. -Fuel-Free, Ubiquitous, Compressed Air Energy Storage CX(s) Applied: B3.6 Date: 08/14/2010 Location(s): Watertown, Massachusetts Office(s): Advanced Research Projects Agency - Energy August 14, 2010 CX-004953: Categorical Exclusion Determination Fluidic Inc. -Enhanced Metal-Air Energy Storage System CX(s) Applied: B3.6 Date: 08/14/2010 Location(s): Scottsdale, Arizona Office(s): Advanced Research Projects Agency - Energy August 14, 2010 CX-004941: Categorical Exclusion Determination

369

SCR Performance Optimization Through Advancements in Aftertreatment...  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

Performance Optimization Through Advancements in Aftertreatment Packaging SCR Performance Optimization Through Advancements in Aftertreatment Packaging The impact of improved urea...

370

Advanced Vehicle Electrification and Transportation Sector Electrifica...  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

More Documents & Publications Advanced Vehicle Electrification and Transportation Sector Electrification Plug-in Hybrid (PHEV) Vehicle Technology Advancement and...

371

Smith Electric Vehicles: Advanced Vehicle Electrification + Transporta...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Smith Electric Vehicles: Advanced Vehicle Electrification + Transportation Sector Electrification Smith Electric Vehicles: Advanced Vehicle Electrification + Transportation Sector...

372

Advanced Metering Infrastructure  

SciTech Connect

The report provides an overview of the development of Advanced Metering Infrastructure (AMI). Metering has historically served as the cash register for the utility industry. It measured the amount of energy used and supported the billing of customers for that usage. However, utilities are starting to look at meters in a whole different way, viewing them as the point of contact with customers in supporting a number of operational imperatives. The combination of smart meters and advanced communications has opened up a variety of methods for utilities to reduce operating costs while offering new services to customers. A concise look is given at what's driving interest in AMI, the components of AMI, and the creation of a business case for AMI. Topics covered include: an overview of AMI including the history of metering and development of smart meters; a description of the key technologies involved in AMI; a description of key government initiatives to support AMI; an evaluation of the current market position of AMI; an analysis of business case development for AMI; and, profiles of 21 key AMI vendors.

NONE

2007-10-15T23:59:59.000Z

373

Argonne CNM Highlight: Biofunctionalized magnetic-vortex microdiscs for  

NLE Websites -- All DOE Office Websites (Extended Search)

Biofunctionalized magnetic-vortex microdiscs for targeted cancer-cell destruction Biofunctionalized magnetic-vortex microdiscs for targeted cancer-cell destruction Magnetic microdisks Reflection optical microscope image of a dried suspension of the discs prepared via magnetron sputtering and optical lithography. Magnetic spin vortex Model of magnetic-vortex spin distribution in a disc. Users from Argonne's Materials Science Division and University of Chicago's Pritzker School of Medicine, working collaboratively on a user science project with CNM's Nanobio Interfaces Group, have discovered that nanostructured magnetic materials offer exciting avenues for probing cell mechanics, activating mechanosensitive ion channels, and advancing potential cancer therapies. Their new report describes an approach based on interfacing cells with lithographically defined microdiscs (1-micron

374

Controlling interactions between highly-magnetic atoms with Feshbach resonances  

E-Print Network (OSTI)

This paper reviews current experimental and theoretical progress in the study of dipolar quantum gases of ground and meta-stable atoms with a large magnetic moment. We emphasize the anisotropic nature of Feshbach resonances due to coupling to fast-rotating resonant molecular states in ultracold s-wave collisions between magnetic atoms in external magnetic fields. The dramatic differences in the distribution of resonances of magnetic $^7$S$_3$ chromium and magnetic lanthanide atoms with a submerged 4f shell and non-zero electron angular momentum is analyzed. We focus on Dysprosium and Erbium as important experimental advances have been recently made to cool and create quantum-degenerate gases for these atoms. Finally, we describe progress in locating resonances in collisions of meta-stable magnetic atoms in electronic P states with ground-state atoms, where an interplay between collisional anisotropies and spin-orbit coupling exists.

Svetlana Kotochigova

2014-10-14T23:59:59.000Z

375

Magnetic trap for thulium atoms  

SciTech Connect

For the first time ultra-cold thulium atoms were trapped in a magnetic quadrupole trap with a small field gradient (20 Gs cm{sup -1}). The atoms were loaded from a cloud containing 4x10{sup 5} atoms that were preliminarily cooled in a magneto-optical trap to the sub-Doppler temperature of 80 {mu}K. As many as 4x10{sup 4} atoms were trapped in the magnetic trap at the temperature of 40 {mu}K. By the character of trap population decay the lifetime of atoms was determined (0.5 s) and an upper estimate was obtained for the rate constant of inelastic binary collisions for spin-polarised thulium atoms in the ground state (g{sub in} < 10{sup -11}cm{sup 3} s{sup -1}). (magnetic traps)

Sukachev, D D; Sokolov, A V; Chebakov, K A; Akimov, A V; Kolachevskii, N N; Sorokin, Vadim N [P N Lebedev Physical Institute, Russian Academy of Sciences, Moscow (Russian Federation)

2011-08-31T23:59:59.000Z

376

E-Print Network 3.0 - ambient magnetic field Sample Search Results  

NLE Websites -- All DOE Office Websites (Extended Search)

by Explorit Topic List Advanced Search Sample search results for: ambient magnetic field Page: << < 1 2 3 4 5 > >> 1 The Astrophysical Journal, 623:L89L92, 2005 April 20 2005....

377

Magnetic Refrigeration Technology for High Efficiency Air Conditioning  

SciTech Connect

Magnetic refrigeration was investigated as an efficient, environmentally friendly, flexible alternative to conventional residential vapor compression central air conditioning systems. Finite element analysis (FEA) models of advanced geometry active magnetic regenerator (AMR) beds were developed to minimize bed size and thus magnet mass by optimizing geometry for fluid flow and heat transfer and other losses. Conventional and magnetocaloric material (MCM) regenerator fabrication and assembly techniques were developed and advanced geometry passive regenerators were built and tested. A subscale engineering prototype (SEP) magnetic air conditioner was designed, constructed and tested. A model of the AMR cycle, combined with knowledge from passive regenerator experiments and FEA results, was used to design the regenerator beds. A 1.5 Tesla permanent magnet assembly was designed using FEA and the bed structure and plenum design was extensively optimized using FEA. The SEP is a flexible magnetic refrigeration platform, with individually instrumented beds and high flow rate and high frequency capability, although the current advanced regenerator geometry beds do not meet performance expectations, probably due to manufacturing and assembly tolerances. A model of the AMR cycle was used to optimize the design of a 3 ton capacity magnetic air conditioner, and the system design was iterated to minimize external parasitic losses such as heat exchanger pressure drop and fan power. The manufacturing cost for the entire air conditioning system was estimated, and while the estimated SEER efficiency is high, the magnetic air conditioning system is not cost competitive as currently configured. The 3 ton study results indicate that there are other applications where magnetic refrigeration is anticipated to have cost advantages over conventional systems, especially applications where magnetic refrigeration, through the use of its aqueous heat transfer fluid, could eliminate intermediate heat exchangers or oil distribution issues found in traditional vapor compression systems.

Boeder, A; Zimm, C

2006-09-30T23:59:59.000Z

378

Advanced Manufacturing Office: Motor Systems  

NLE Websites -- All DOE Office Websites (Extended Search)

Motor Systems to Motor Systems to someone by E-mail Share Advanced Manufacturing Office: Motor Systems on Facebook Tweet about Advanced Manufacturing Office: Motor Systems on Twitter Bookmark Advanced Manufacturing Office: Motor Systems on Google Bookmark Advanced Manufacturing Office: Motor Systems on Delicious Rank Advanced Manufacturing Office: Motor Systems on Digg Find More places to share Advanced Manufacturing Office: Motor Systems on AddThis.com... Quick Links Energy Resource Center Technical Publications by Energy System Energy-Efficient Technologies Incentives & Resources by Zip Code Better Plants Superior Energy Performance Contacts Motor Systems Photo of Man Checking Motor Performance Motor-driven equipment accounts for 54% of manufacturing electricity use. Dramatic energy and cost savings can be achieved in motor systems by

379

ADVANCES IN YUCCA MOUNTAIN DESIGN  

SciTech Connect

Since site designation of the Yucca Mountain Project by the President, the U.S. Department of Energy (DOE) has begun the transition from the site characterization phase of the project to preparation of the license application. As part of this transition, an increased focus has been applied to the repository design. Several evolution studies were performed to evaluate the repository design and to determine if improvements in the design were possible considering advances in the technology for handling and packaging nuclear materials. The studies' main focus was to reduce and/or eliminate uncertainties in both the pre-closure and post-closure performance of the repository and to optimize operations. The scope and recommendations from these studies are the subjects of this paper and include the following topics: (1) a more phased approach for the surface facility that utilize handling and packaging of the commercial spent nuclear fuel in a dry environment rather than in pools as was presented in the site recommendation; (2) slight adjustment of the repository footprint and a phased approach for construction and emplacement of the repository subsurface; and (3) simplification of the construction, fabrication and installation of the waste package and drip shield.

Harrington, P.G.; Gardiner, J.T.; Russell, P.R.Z.; Lachman, K.D.; McDaniel, P.W.; Boutin, R.J.; Brown, N.R.; Trautner, L.J.

2003-02-27T23:59:59.000Z

380

Metamaterial anisotropic flux concentrators and magnetic arrays  

E-Print Network (OSTI)

A metamaterial magnetic flux concentrator is investigated in detail in combination with a Halbach cylinder of infinite length. A general analytical solution to the field is determined and the magnetic figure of merit is determined for a Halbach cylinder with a flux concentrator. It is shown that an ideal flux concentrator will not change the figure of merit of a given magnet design, while the non-ideal will always lower it. The geometric parameters producing maximum figure of merit, i.e. the most efficient devices, are determined. The force and torque between two concentric Halbach cylinders with flux concentrators is determined and the maximum torque is found. Finally, the effect of non-ideal flux concentrators and the practical use of flux concentrators, as well as demagnetization issues, is discussed.

Bjrk, R; Bahl, C R H

2014-01-01T23:59:59.000Z

Note: This page contains sample records for the topic "determination advanced magnetic" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


381

Visiting | Advanced Photon Source  

NLE Websites -- All DOE Office Websites (Extended Search)

Visiting the APS Visiting the APS If you have questions or need assistance planning your visit, please contact the APS User Office. Obtaining site access: General info: Visitors and new users | Non-U.S. Citizens Visitor registration: request access as a visitor who will not do hands-on work (guests, family members, students, etc.) Traveling to the APS: Transportation: Resources | University of Chicago Shuttle external link Directions: to Argonne | to the APS User Office Maps: Argonne Campus external link | Conference Center (402) | APS Facility & Beamlines | Parking Currency: The hotels and banks near Argonne do not exchange currency. Plan on using major credit cards, U.S. traveler's checks, or exchange currency in advance at the airport. See also: The Universal Currency Converter(tm) external link

382

Welcome | Advanced Photon Source  

NLE Websites -- All DOE Office Websites (Extended Search)

Welcome Welcome Aerial view of APS Aerial view of the APS Welcome to the Advanced Photon Source (APS) at Argonne National Laboratory. Whether you are a current or potential scientific user of our unique facility or are simply interested in learning more about the APS, we are delighted that you are visiting our website. The APS is funded by the Office of Science, Office of Basic Energy Sciences in the U.S. Department of Energy. We operate a National User Facility that is open to everyone who has a need for extremely brilliant x-ray photon beams. The APS is one of the most technologically complex machines in the world. This premier national research facility provides the brightest x-ray beams in the Western Hemisphere to more than 5,000 (and growing) scientists from

383

ADVANCED HYBRID PARTICULATE COLLECTOR  

SciTech Connect

A new concept in particulate control, called an advanced hybrid particulate collector (AHPC), is being developed under funding from the US Department of Energy. The AHPC combines the best features of electrostatic precipitators (ESPs) and baghouses in a manner that has not been done before. The AHPC concept consists of a combination of fabric filtration and electrostatic precipitation in the same housing, providing major synergism between the two collection methods, both in the particulate collection step and in the transfer of dust to the hopper. The AHPC provides ultrahigh collection efficiency, overcoming the problem of excessive fine-particle emission with conventional ESPs, and it solves the problem of reentrainment and collection of dust in conventional baghouses. The AHPC is currently being tested at the 2.7-MW scale at the Big Stone power station.

Stanley Miller; Rich Gebert; William Swanson

1999-11-01T23:59:59.000Z

384

Advanced drilling systems study.  

SciTech Connect

This report documents the results of a study of advanced drilling concepts conducted jointly for the Natural Gas Technology Branch and the Geothermal Division of the U.S. Department of Energy. A number of alternative rock cutting concepts and drilling systems are examined. The systems cover the range from current technology, through ongoing efforts in drilling research, to highly speculative concepts. Cutting mechanisms that induce stress mechanically, hydraulically, and thermally are included. All functions necessary to drill and case a well are considered. Capital and operating costs are estimated and performance requirements, based on comparisons of the costs for alternative systems to conventional drilling technology, are developed. A number of problems common to several alternatives and to current technology are identified and discussed.

Pierce, Kenneth G.; Livesay, Billy Joe; Finger, John Travis (Livesay Consultants, Encintas, CA)

1996-05-01T23:59:59.000Z

385

Advanced servo manipulator  

DOE Patents (OSTI)

An advanced servo manipulator has modular parts. Modular motor members drive individual input gears to control shoulder roll, shoulder pitch, elbow pitch, wrist yaw, wrist pitch, wrist roll, and tong spacing. The modules include a support member, a shoulder module for controlling shoulder roll, and a sleeve module attached to the shoulder module in fixed relation thereto. The shoulder roll sleeve module has an inner cylindrical member rotatable relative to the outer cylindrical member, and upon which a gear pod assembly is mounted. A plurality of shafts are driven by the gears, which are in turn driven by individual motor modules to transmit rotary power to control elbow pitch as well as to provide four different rotary shafts across the bendable elbow joint to supply rotary motive power to a wrist member and tong member.

Holt, William E. (Knoxville, TN); Kuban, Daniel P. (Oak Ridge, TN); Martin, H. Lee (Knoxville, TN)

1988-01-01T23:59:59.000Z

386

Advanced servo manipulator  

DOE Patents (OSTI)

An advanced servo manipulator has modular parts. Modular motor members drive individual input gears to control shoulder roll, shoulder pitch, elbow pitch, wrist yaw, wrist pitch, wrist roll, and tong spacing. The modules include a support member, a shoulder module for controlling shoulder roll, and a sleeve module attached to the shoulder module in fixed relation thereto. The shoulder roll sleeve module has an inner cylindrical member rotatable relative to the outer cylindrical member, and upon which a gear pod assembly is mounted. A plurality of shafts are driven by the gears, which are in turn driven by individual motor modules to transmit rotary power to control elbow pitch as well as to provide four different rotary shafts across the bendable elbow joint to supply rotary motive power to a wrist member and tong member. 41 figs.

Holt, W.E.; Kuban, D.P.; Martin, H.L.

1988-10-25T23:59:59.000Z

387

ADVANCED CUTTINGS TRANSPORT STUDY  

SciTech Connect

This report includes a review of the progress made in ACTF Flow Loop development and research during 90 days pre-award period (May 15-July 14, 1999) and the following three months after the project approval date (July15-October 15, 1999) The report presents information on the following specific subjects; (a) Progress in Advanced Cuttings Transport Facility design and development, (b) Progress report on the research project ''Study of Flow of Synthetic Drilling Fluids Under Elevated Pressure and Temperature Conditions'', (c) Progress report on the research project ''Study of Cuttings Transport with Foam Under LPAT Conditions (Joint Project with TUDRP)'', (d) Progress report on the research project ''Study of Cuttings Transport with Aerated Muds Under LPAT Conditions (Joint Project with TUDRP)'', (e) Progress report on the research project ''Study of Foam Flow Behavior Under EPET Conditions'', (f) Progress report on the instrumentation tasks (Tasks 11 and 12) (g) Activities towards technology transfer and developing contacts with oil and service company members.

Ergun Kuru; Stefan Miska; Nicholas Takach; Kaveh Ashenayi; Gerald Kane; Len Volk; Mark Pickell; Evren Ozbayoglu; Barkim Demirdal; Paco Vieira; Affonso Lourenco

1999-10-15T23:59:59.000Z

388

Advanced isotope separation  

SciTech Connect

The Study Group briefly reviewed the technical status of the three Advanced Isotope Separation (AIS) processes. It also reviewed the evaluation work that has been carried out by DOE's Process Evaluation Board (PEB) and the Union Carbide Corporation-Nuclear Division (UCCND). The Study Group briefly reviewed a recent draft assessment made for DOE staff of the nonproliferation implications of the AIS technologies. The staff also very briefly summarized the status of GCEP and Advanced Centrifuge development. The Study Group concluded that: (1) there has not been sufficient progress to provide a firm scientific, technical or economic basis on which to select one of the three competing AIS processes for full-scale engineering development at this time; and (2) however, should budgetary restraints or other factors force such a selection, we believe that the evaluation process that is being carried out by the PEB provides the best basis available for making a decision. The Study Group recommended that: (1) any decisions on AIS processes should include a comparison with gas centrifuge processes, and should not be made independently from the plutonium isotope program; (2) in evaluating the various enrichment processes, all applicable costs (including R and D and sales overhead) and an appropriate discounting approach should be included in order to make comparisons on a private industry basis; (3) if the three AIS programs continue with limited resources, the work should be reoriented to focus only on the most pressing technical problems; and (4) if a decision is made to develop the Atomic Vapor Laser Isotope Separation process, the solid collector option should be pursued in parallel to alleviate the potential program impact of liquid collector thermal control problems.

Not Available

1982-05-04T23:59:59.000Z

389

Sandia National Laboratories: Advanced Biofuels  

NLE Websites -- All DOE Office Websites (Extended Search)

Advanced Biofuels Biofuels Blend Right In: Researchers Show Ionic Liquids Effective for Pretreating Mixed Blends of Biofuel Feedstocks On February 26, 2013, in Biofuels, Biomass,...

390

Advanced Bioeconomy Leadership Conference 2015  

Energy.gov (U.S. Department of Energy (DOE))

The Advanced Bioeconomy Leadership Conference will be held on March 1113, at the Capital Hilton in Washington, D.C.

391

Advanced Materials Research Highlights | ORNL  

NLE Websites -- All DOE Office Websites (Extended Search)

Advanced Materials | Research Highlights Research Highlights 1-10 of 93 Results Prev 12345 Next Single Supported Atoms Participate in Catalytic Processes December 04, 2014 -...

392

The Advance of Norwegian Glaciers  

Science Journals Connector (OSTI)

... doubt, is an account of the very remarkable advance of the Buerbr (br is Norsk for glacier) near Odde, on the Srfjrd. I visited the place in 1874, ...

J. INNES ROGERS

1882-03-16T23:59:59.000Z

393

Advance Electronics | Open Energy Information  

Open Energy Info (EERE)

suppressors, automatic voltage stablisers, voltmeters oscilloscopes, and signal generators. References: Advance Electronics1 This article is a stub. You can help OpenEI by...

394

Advanced Integrated Systems Technology Development  

E-Print Network (OSTI)

conditioning in buildings featuring integrated design withconditioning in buildings featuring integrated design withof a building with advanced integrated design involving one

2013-01-01T23:59:59.000Z

395

Video Library | Advanced Photon Source  

NLE Websites -- All DOE Office Websites (Extended Search)

Video Library Related Links: APS Colloquium APS Podcasts APS Today More videos: Introduction to the APS Physics of the Blues Now Playing: Building the Advanced Photon Source This...

396

Advanced Telemetry | Open Energy Information  

Open Energy Info (EERE)

Telemetry Jump to: navigation, search Name: Advanced Telemetry Place: San Diego, California Zip: 92131-2435 Sector: Buildings Product: San Diego-based provider of energy management...

397

Advanced Combustion | Argonne National Laboratory  

NLE Websites -- All DOE Office Websites (Extended Search)

Combustion Advanced Combustion Combustion engines drive a large percentage of our nation's transportation vehicles and power generation and manufacturing facilities. Today's...

398

Categorical Exclusion Determinations: Program and Field Offices |  

NLE Websites -- All DOE Office Websites (Extended Search)

Determinations: Program and Field Offices Determinations: Program and Field Offices Categorical Exclusion Determinations: Program and Field Offices This page contains links (below) to pages on DOE Program, Field, or Site Office websites containing the CX determinations required to be posted under this policy, and also some for which documentation and posting are optional, i.e., determinations involving classes of actions listed in Appendix A or made before the policy's effective date of November 2, 2009. You may browse the determinations posted on each of the websites at the links below (you would be leaving this website), or view them directly on this website. SECRETARIAL OFFICES Advanced Research Projects Agency-Energy Advanced Technology Vehicles Manufacturing Loan Program Civilian Radioactive Waste Management

399

Quadrupole magnets measurement  

SciTech Connect

A rotating coil setup is designed for quadrupole magnet measurement at the Accelerator Test Facility (ATF); Hall probe measurement was also performed for one of each type of quadrupole magnet. Both mechanical and magnetic properties of the quadrupole magnets were measured, the results are reported here. 5 refs., 12 figs., 12 tabs.

Wang, Xijie (California Univ., Los Angeles, CA (USA). Center for Advanced Accelerators Physics); Sylvester, C. (Brookhaven National Lab., Upton, NY (USA))

1991-01-01T23:59:59.000Z

400

Magnetic Imaging Wolfgang Kuch  

E-Print Network (OSTI)

Magnetic Imaging Wolfgang Kuch Freie Universit¨at Berlin, Institut f¨ur Experimentalphysik, Arnimallee 14, 14195 Berlin, Germany kuch@physik.fu-berlin.de Abstract. Imaging of magnetic domains has- ern techniques is used nowadays routinely for magnetic imaging of magnetic ma- terials

Kuch, Wolfgang

Note: This page contains sample records for the topic "determination advanced magnetic" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


401

Magnetism in Nanocrystalline Gold  

Science Journals Connector (OSTI)

Magnetism in Nanocrystalline Gold ... Bridging the current gap in experimental study of magnetism in bare gold nanomaterials, we report here on magnetism in gold nanocrystalline films produced by cluster deposition in the aggregate form that can be considered as a crossover state between a nanocluster and a continuous film. ... gold; nanocrystalline film; magnetism; cluster deposition; SQUID magnetometry ...

Vladimir Tuboltsev; Alexander Savin; Alexandre Pirojenko; Jyrki Risnen

2013-07-07T23:59:59.000Z

402

Magnetism of spiral galaxies  

Science Journals Connector (OSTI)

... magnetic fields of spiral galaxies has taken a special place in the study of cosmic magnetism, but magnetic fields are a universal property of all galactic-type objects, as is ... . The past ten years have been notable for rapid, qualitative progress in understanding the magnetism of spiral galaxies, a result of both theoretical and observational developments. A few decades ...

Alexander Ruzmaikin; Dmitry Sokoloff; Anvar Shukurov

1988-11-24T23:59:59.000Z

403

Magnetism in microquasars  

Science Journals Connector (OSTI)

...Lynden-Bell, E. R. Priest and N. O. Weiss Magnetism in microquasars I. F. Mirabel Centre...binaries|magnetic field|plasma physics| Magnetism in microquasars By I. F. Mirabel Centre...Trans. R. Soc. Lond. A (2000) Magnetism in microquasars 843 At rst glance it...

2000-01-01T23:59:59.000Z

404

Early History of Magnetism  

Science Journals Connector (OSTI)

... 2, Dr. J. B. Kramer read a paper on The Early History of Magnetism, in which he discussed the various accounts of the first discovery of a magnet ... accounts of the first discovery of a magnet, and the development of the science of magnetism down to A.D. 1600. His remarks were divided into five sections, the ...

1932-03-19T23:59:59.000Z

405

ARIES-AT: An Advanced Tokamak, Advanced Technology  

E-Print Network (OSTI)

ARIES-AT: An Advanced Tokamak, Advanced Technology Fusion Power Plant Farrokh Najmabadi University & Technical Achievements Periodic Input from Energy Industry Goals and Requirements Evaluation Based Options Balanced Assessment of Attractiveness & Feasibility R&D Needs and Development Plan No: Redesign

406

NICTA Advanced Course Advanced Topics in Software Verification  

E-Print Network (OSTI)

COMP 4161 NICTA Advanced Course Advanced Topics in Software Verification Gerwin Klein, June: § Declare a set of functions with signatures (e.g. plus, zero) § give them a name (e.g. c) § Have syntax 'a :: c for: type 'a supports the operations of c § Can write abstract polymorphic functions that use plus

Klein, Gerwin

407

Advances in induction heating  

SciTech Connect

Electric induction heating, in situ, can distill (underground) high-heat-value (HHV) gas, coal tar, bitumen, and shale oil. This technique permits potentially lower cost exploitation of the solid fossil fuels: coal, oil shale, tar sand, and heavy oil. The products, when brought to the surface in gaseous form and processed, yield chemical feedstocks, natural gas, and petroleum. Residual coke can be converted, in situ, to low-heat-value (LHV) gas by a conventional water-gas process. LHV can be burned at the surface to generate electricity at low cost. The major cost of the installation will have been paid for by the HHV gas and tar distilled from the coal. There are 2 mechanisms of heating by electric induction. One uses displacement currents induced from an electric field. The other uses eddy currents induced by a magnetic field.

Not Available

1980-06-16T23:59:59.000Z

408

Categorical Exclusion Determination Form  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

t t Categorical Exclusion Determination Form Proposed Action Title: (0471-1563) University of South Florida - Development of a Low Cost Thermal Energy Storage System Using Phase Change Materials with Enhanced Radiation Heat Transfer Program or Field Office: Advanced Research Projects Agency - Energy Location(s) (City/County/State): Tampa, FL Proposed Action Description: Funding will support development of low cost, industrially scalable capsules containing high-temperature phase change materials (PCMs) for use in thermal energy storage (TES) systems to enable continuous power supply from concentrated solar thermal and nuclear power plants. No nuclear research and development activities will take place under this project. ARPA-E has undertaken a review of the work to be performed

409

Categorical Exclusion Determination Form  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

n rgy n rgy Categorical Exclusion Determination Form Proposed Action Title: (0474-1555) University of Colorado - Boulder - Wafer-Level Sub-Module Integrated DCfDC Converter Program or Field Office: Advanced Research Projects Agency - Energy LocationCs) CCity/County/State): Colorado, Maine, Virginia Proposed Action Description: Funding will support development of a planar, wafer-level sub-module integrated converter (SubMIC) device that can be integrated into various types of photovoltaic (PV) modules to enable low-cost maximum power point tracking at high power processing efficiencies. Proposed work consists of indoor laboratory-based research and development (R&D), microfabrication activities, and analytical research, including: (1) simulated modeling and design of SubMIC components and integrated units, (2) development, fabrication, testing, and optimization

410

Categorical Exclusion Determination Form  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

1537) Utah State University - 1537) Utah State University - Robust Cell-Level Modeling and Control of Large Battery Packs Program or Field Office: Advanced Research Projects Agency - Energy LocationCs) CCity/County/State): Logan, UT; Colorado Springs, CO; Boulder, CO; Golden, CO; Dearborn, MI Proposed Action Description: Funding will support efforts to develop a novel battery pack architecture supported by algorithms to drive analysis, feedback, and operability. Proposed work will consist of: (1) performing a requirements analysis to determine optimal theoretical design for the battery pack; (2) design and theoretical optimization of the necessary algorithms to control and monitor the cells in the pack; (3) creation , testing, and analysis of a proof-of- concept unit; and (4) application of the algorithmic controls to a commercial battery pack to analyze performance.

411

Ultratrace determination of curium  

SciTech Connect

Development of a method for detection of curium at near single atom levels is being undertaken as a part of the Advanced Concepts Project at Argonne National Laboratory with funding from the US Department of Energy, Office of Arms Control and Nonproliferation. Ultratrace determination of curium, with the ability to quantify the fraction that is curium-242, provides a signature method of detecting clandestine reprocessing of recently irradiated uranium targets. Curium initially present in any of a variety of materials such as air filters, solid or liquid process waste, soil, flora, or fauna can be recovered via current chemical separations processing techniques. Using the ultratrace method being developed, such recovered curium will be quantified with thousand-fold higher sensitivity than the best currently available method which is alpha counting. This high sensitivity arises because, on average, a given trivalent curium (Cm{sup 3+}) ion can emit a very large number of fluorescence photons before alpha decay occurs.

Beitz, J.V.

1995-02-01T23:59:59.000Z

412

Categorical Exclusion Determination Form  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

y y Categorical Exclusion Determination Form Proposed Action Title: (0471-1595) Regents of the University of Minnesota - Thermal Fuel: Solar Fuels via Partial Redox Cycles with Heat Recovery Program or Field Office: Advanced Research Projects Agency - Energy LocationCs) CCity/County/State): Minnesota, California, and Colorado. Proposed Action Description: Funding will support development of a dual zone solar thermochemical reactor to produce fuel using ceria-based reactive materials in partial redox cycles and high heat recovery levels through counter-circulation of solid state components. Proposed work consists of indoor laboratory-based research and development, including: (1) designing, fabricating, and characterizing an optimized ceria-based reactive element for use in the reactor to enable maximum fuel productivity and durability; (2) designing and fabricating a

413

(1) Elementary Electricity and Magnetism (2) Advanced Theory of Electricity and Magnetism  

Science Journals Connector (OSTI)

... abvolt, and abohm for the absolute units of current, E.M.F., and resistance is a feature of the books. The electromagnetic system only is used, and in ... perhaps wise, considering that the practical aspect of the subject predominates. (1) The elementary book commences with a description of the most important phenomena in electricity from a practical ...

J. R.

1915-07-22T23:59:59.000Z

414

Magnetic Fields Analogous to electric field, a magnet  

E-Print Network (OSTI)

characteristic of elementary particles such as an electron #12;Magnetic Fields Magnetic field lines Direction;Magnetic Fields Magnetic field lines enter one end (south) of magnet and exit the other end (north) Opposite magnetic poles attract like magnetic poles repel #12;Like the electric field lines

Bertulani, Carlos A. - Department of Physics and Astronomy, Texas A&M University

415

ESnet: Advanced Networking for Science  

NLE Websites -- All DOE Office Websites (Extended Search)

Similarly, the experiment facilities at the new Spallation Neu- tron Source and Magnetic Fusion Energy facili- ties will start using the network in ways that require...

416

Categorical Exclusion Determinations: American Recovery and Reinvestment  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

8, 2010 8, 2010 CX-002902: Categorical Exclusion Determination DeKalb County/Metropolitan Atlanta Alternative Fuel and Advanced Technology Vehicle Project CX(s) Applied: A1, A7, B5.1 Date: 07/08/2010 Location(s): Tucker, Georgia Office(s): Energy Efficiency and Renewable Energy, National Energy Technology Laboratory July 8, 2010 CX-002901: Categorical Exclusion Determination DeKalb County/Metropolitan Atlanta Alternative Fuel and Advanced Technology Vehicle Project CX(s) Applied: A1, A7, B5.1 Date: 07/08/2010 Location(s): East Point, Georgia Office(s): Energy Efficiency and Renewable Energy, National Energy Technology Laboratory July 8, 2010 CX-002900: Categorical Exclusion Determination DeKalb County/Metropolitan Atlanta Alternative Fuel and Advanced Technology Vehicle Project

417

Categorical Exclusion Determinations: California | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

August 16, 2010 August 16, 2010 CX-003443: Categorical Exclusion Determination Post-Combustion Carbon Dioxide Capture for Existing Post-Combustion Boilers by Self-Concentrating Amine Absorbent CX(s) Applied: A9, A11, A14 Date: 08/16/2010 Location(s): San Francisco, California Office(s): Fossil Energy, National Energy Technology Laboratory August 14, 2010 CX-004959: Categorical Exclusion Determination Primus Power -Low Cost, High Performance, 50-Year Electrodes CX(s) Applied: B3.6 Date: 08/14/2010 Location(s): Alameda, California Office(s): Advanced Research Projects Agency - Energy August 14, 2010 CX-004941: Categorical Exclusion Determination Makani Power, Inc. - Advanced Wind Turbine CX(s) Applied: B3.6 Date: 08/14/2010 Location(s): Alameda, California Office(s): Advanced Research Projects Agency - Energy

418

Structural, Optical, and Magnetic Properties of Highly Ordered Mesoporous MCr2O4 and MCr2xFexO4 (M = Co, Zn) Spinel Thin Films with Uniform 15 nm Diameter Pores and Tunable Nanocrystalline Domain Sizes  

Science Journals Connector (OSTI)

Department of Advanced Interdisciplinary Science, Graduate School of Engineering, Utsunomiya University, Yoto 7-1-2, 321-8585 Utsunomiya, Japan ... Such magnetic ferroelectricity, showing an unprecedented sensitivity to ap plied magnetic fields, occurs in frustrated magnets with competing interactions between spins and complex magnetic orders. ...

Christian Suchomski; Christian Reitz; Kirstin Brezesinski; Clia Tavares de Sousa; Marcus Rohnke; Ken-ichi Iimura; Joao Pedro Esteves de Araujo; Torsten Brezesinski

2011-11-23T23:59:59.000Z

419

Advanced LBB methodology and considerations  

SciTech Connect

LBB applications have existed in many industries and more recently have been applied in the nuclear industry under limited circumstances. Research over the past 10 years has evolved the technology so that more advanced consideration of LBB can now be given. Some of the advanced considerations for nuclear plants subjected to seismic loading evaluations are summarized in this paper.

Olson, R.; Rahman, S.; Scott, P. [Battelle, Columbus, OH (United States)] [and others

1997-04-01T23:59:59.000Z

420

Magnetic fields from second-order interactions  

E-Print Network (OSTI)

It is well known that when two types of perturbations interact in cosmological perturbation theory, the interaction may lead to the generation of a third type. In this article we discuss the generation of magnetic fields from such interactions. We determine conditions under which the interaction of a first-order magnetic field with a first-order scalar-or vector-, or tensor-perturbations would lead to the generation of second order magnetic field. The analysis is done in a covariant-index-free approach, but could be done in the standard covariant indexed-approach.

Bob Osano

2014-03-21T23:59:59.000Z

Note: This page contains sample records for the topic "determination advanced magnetic" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


421

HTS Magnet Program | Superconducting Magnet Division  

NLE Websites -- All DOE Office Websites (Extended Search)

HTS Magnet Program HTS Magnet Program High Temperature Superconductors (HTS) have the potential to revolutionize the field of superconducting magnets for particle accelerators, energy storage and medical applications. This is because of the fact that as compared to the conventional Low Temperature Superconductors (LTS), the critical current density (Jc ) of HTS falls slowly both: as a function of increasing field, and as a function of increasing temperature These unique properties can be utilized to design and build: HTS magnets that produce very high fields (20 - 50 T) HTS magnets that operate at elevated temperatures (20 - 77 K) This is a significant step forward over the convention LTS magnets which generally operate at a temperature of ~4 K and with field usually limited

422

Nuclear Energy Advanced Modeling and Simulation (NEAMS) Software  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Advanced Modeling and Simulation (NEAMS) Software Advanced Modeling and Simulation (NEAMS) Software Verification and Validation (V&V) Plan Requirements Nuclear Energy Advanced Modeling and Simulation (NEAMS) Software Verification and Validation (V&V) Plan Requirements The purpose of the NEAMS Software V&V Plan is to define what the NEAMS program expects in terms of V&V for the computational models that are developed under NEAMS. NEAMS Software Verification and Validation Plan Requirements Version 0.pdf More Documents & Publications NEAMS Quarterly Report for January-March 2013 Nuclear Energy Advanced Modeling and Simulation (NEAMS) Program Plan CRAD, Assessment Criteria and Guidelines for Determining the Adequacy of Software Used in the Safety Analysis and Design of Defense Nuclear Facilities

423

Advanced Light Source  

NLE Websites -- All DOE Office Websites (Extended Search)

Next >> Next >> Visitors Access to the ALS Gate Access guest-house Guest House lab-shuttles Lab Shuttles maps-and-directions Maps and Directions Parking Safety Safety for Users safety-for-staff Safety for Staff In Case of Emergency Resources Acronyms Multimedia Employment staff-intranet Staff Intranet Site Map Contact Digg: ALSBerkeleyLab Facebook Page: 208064938929 Flickr: advancedlightsource Twitter: ALSBerkeleyLab YouTube: AdvancedLightSource January 2014 Sun Mon Tue Wed Thu Fri Sat 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 Recent Science Highlights Minding the Gap Makes for More Efficient Solar Cells Using novel materials to develop thin, flexible, and more efficient photovoltaic cells is one of the hottest topics in current materials research. A class of transition metals undergo a dramatic change that makes them ideal for solar energy applications.

424

Advanced robot locomotion.  

SciTech Connect

This report contains the results of a research effort on advanced robot locomotion. The majority of this work focuses on walking robots. Walking robot applications include delivery of special payloads to unique locations that require human locomotion to exo-skeleton human assistance applications. A walking robot could step over obstacles and move through narrow openings that a wheeled or tracked vehicle could not overcome. It could pick up and manipulate objects in ways that a standard robot gripper could not. Most importantly, a walking robot would be able to rapidly perform these tasks through an intuitive user interface that mimics natural human motion. The largest obstacle arises in emulating stability and balance control naturally present in humans but needed for bipedal locomotion in a robot. A tracked robot is bulky and limited, but a wide wheel base assures passive stability. Human bipedal motion is so common that it is taken for granted, but bipedal motion requires active balance and stability control for which the analysis is non-trivial. This report contains an extensive literature study on the state-of-the-art of legged robotics, and it additionally provides the analysis, simulation, and hardware verification of two variants of a proto-type leg design.

Neely, Jason C.; Sturgis, Beverly Rainwater; Byrne, Raymond Harry; Feddema, John Todd; Spletzer, Barry Louis; Rose, Scott E.; Novick, David Keith; Wilson, David Gerald; Buerger, Stephen P.

2007-01-01T23:59:59.000Z

425

Advanced Chemistry Basins Model  

SciTech Connect

The DOE-funded Advanced Chemistry Basin model project is intended to develop a public domain, user-friendly basin modeling software under PC or low end workstation environment that predicts hydrocarbon generation, expulsion, migration and chemistry. The main features of the software are that it will: (1) afford users the most flexible way to choose or enter kinetic parameters for different maturity indicators; (2) afford users the most flexible way to choose or enter compositional kinetic parameters to predict hydrocarbon composition (e.g., gas/oil ratio (GOR), wax content, API gravity, etc.) at different kerogen maturities; (3) calculate the chemistry, fluxes and physical properties of all hydrocarbon phases (gas, liquid and solid) along the primary and secondary migration pathways of the basin and predict the location and intensity of phase fractionation, mixing, gas washing, etc.; and (4) predict the location and intensity of de-asphaltene processes. The project has be operative for 36 months, and is on schedule for a successful completion at the end of FY 2003.

William Goddard; Mario Blanco; Lawrence Cathles; Paul Manhardt; Peter Meulbroek; Yongchun Tang

2002-11-10T23:59:59.000Z

426

ADVANCED CUTTINGS TRANSPORT STUDY  

SciTech Connect

This is the first quarterly progress report for Year 2 of the ACTS project. It includes a review of progress made in Flow Loop development and research during the period of time between July 14, 2000 and September 30, 2000. This report presents information on the following specific tasks: (a) Progress in Advanced Cuttings Transport Facility design and development (Task 2), (b) Progress on research project (Task 8): ''Study of Flow of Synthetic Drilling Fluids Under Elevated Pressure and Temperature Conditions'', (c) Progress on research project (Task 6): ''Study of Cuttings Transport with Foam Under LPAT Conditions (Joint Project with TUDRP)'', (d) Progress on research project (Task 7): ''Study of Cuttings Transport with Aerated Muds Under LPAT Conditions (Joint Project with TUDRP)'', (e) Progress on research project (Task 9): ''Study of Foam Flow Behavior Under EPET Conditions'', (f) Initiate research on project (Task 10): ''Study of Cuttings Transport with Aerated Mud Under Elevated Pressure and Temperature Conditions'', (g) Progress on instrumentation tasks to measure: Cuttings concentration and distribution (Tasks 11), and Foam properties (Task 12), (h) Initiate a comprehensive safety review of all flow-loop components and operational procedures. Since the previous Task 1 has been completed, we will now designate this new task as: (Task 1S). (i) Activities towards technology transfer and developing contacts with Petroleum and service company members, and increasing the number of JIP members.

Troy Reed; Stefan Miska; Nicholas Takach; Kaveh Ashenayi; Gerald Kane; Mark Pickell; Len Volk; Mike Volk; Barkim Demirdal; Affonso Lourenco; Evren Ozbayoglu; Paco Vieira

2000-10-30T23:59:59.000Z

427

ADVANCED CUTTINGS TRANSPORT STUDY  

SciTech Connect

This is the second quarterly progress report for Year 3 of the ACTS project. It includes a review of progress made in: (1) Flow Loop development and (2) research tasks during the period of time between Oct 1, 2001 and Dec. 31, 2001. This report presents a review of progress on the following specific tasks: (a) Design and development of an Advanced Cuttings Transport Facility (Task 3: Addition of a Cuttings Injection/Collection System), (b) Research project (Task 6): ''Study of Cuttings Transport with Foam Under LPAT Conditions (Joint Project with TUDRP)'', (c) Research project (Task 9): ''Study of Foam Flow Behavior Under EPET Conditions'', (d) Research project (Task 10): ''Study of Cuttings Transport with Aerated Mud Under Elevated Pressure and Temperature Conditions'', (e) Research on instrumentation tasks to measure: Cuttings concentration and distribution in a flowing slurry (Task 11), and Foam properties while transporting cuttings. (Task 12), (f) Development of a Safety program for the ACTS Flow Loop. Progress on a comprehensive safety review of all flow-loop components and operational procedures. (Task 1S). (g) Activities towards technology transfer and developing contacts with Petroleum and service company members, and increasing the number of JIP members.

Troy Reed; Stefan Miska; Nicholas Takach; Kaveh Ashenayi; Gerald Kane; Mark Pickell; Len Volk; Mike Volk; Affonso Lourenco; Evren Ozbayoglu; Lei Zhou

2002-01-30T23:59:59.000Z

428

ADVANCED CUTTINGS TRANSPORT STUDY  

SciTech Connect

This is the third quarterly progress report for Year 3 of the ACTS Project. It includes a review of progress made in: (1) Flow Loop construction and development and (2) research tasks during the period of time between Jan. 1, 2002 and Mar. 31, 2002. This report presents a review of progress on the following specific tasks: (a) Design and development of an Advanced Cuttings Transport Facility (Task 3: Addition of a Cuttings Injection/Separation System), (b) Research project (Task 6): ''Study of Cuttings Transport with Foam Under LPAT Conditions (Joint Project with TUDRP)'', (c) Research project (Task 9b): ''Study of Foam Flow Behavior Under EPET Conditions'', (d) Research project (Task 10): ''Study of Cuttings Transport with Aerated Mud Under Elevated Pressure and Temperature Conditions'', (e) Research on three instrumentation tasks to measure: Cuttings concentration and distribution in a flowing slurry (Task 11), Foam texture while transporting cuttings. (Task 12), and Viscosity of Foam under EPET (Task 9b); (f) Development of a Safety program for the ACTS Flow Loop, progress on a comprehensive safety review of all flow-loop components and operational procedures. (Task 1S); and (g) Activities towards technology transfer and developing contacts with Petroleum and service company members, and increasing the number of JIP members.

Troy Reed; Stefan Miska; Nicholas Takach; Kaveh Ashenayi; Mark Pickell; Len Volk; Mike Volk; Evren Ozbayoglu; Lei Zhou

2002-04-30T23:59:59.000Z

429

ADVANCED CUTTINGS TRANSPORT STUDY  

SciTech Connect

This is the fourth quarterly progress report for Year-3 of the ACTS Project. It includes a review of progress made in: (1) Flow Loop construction and development and (2) research tasks during the period of time between April 1, 2002 and June 30, 2002. This report presents a review of progress on the following specific tasks: (a) Design and development of an Advanced Cuttings Transport Facility (Task 3: Addition of a Cuttings Injection/Separation System), (b) Research project (Task 6): ''Study of Cuttings Transport with Foam Under LPAT Conditions (Joint Project with TUDRP)''; (c) Research project (Task 9b): ''Study of Foam Flow Behavior Under EPET Conditions''; (d) Research project (Task 10): ''Study of Cuttings Transport with Aerated Mud Under Elevated Pressure and Temperature Conditions''; (e) Research on three instrumentation tasks to measure: Cuttings concentration and distribution in a flowing slurry (Task 11), Foam texture while transporting cuttings. (Task 12), and Viscosity of Foam under EPET (Task 9b); (f) Development of a Safety program for the ACTS Flow Loop. Progress on a comprehensive safety review of all flow-loop components and operational procedures. (Task 1S); (g) Activities towards technology transfer and developing contacts with Petroleum and service company members, and increasing the number of JIP members.

Troy Reed; Stefan Miska; Nicholas Takach; Kaveh Ashenayi; Mark Pickell; Len Volk; Mike Volk; Evren Ozbayoglu; Lei Zhou

2002-07-30T23:59:59.000Z

430

ADVANCED CUTTINGS TRANSPORT STUDY  

SciTech Connect

This is the second quarterly progress report for Year 2 of the ACTS project. It includes a review of progress made in Flow Loop development and research during the period of time between Oct 1, 2000 and December 31, 2000. This report presents a review of progress on the following specific tasks: (a) Design and development of an Advanced Cuttings Transport Facility (Task 2: Addition of a foam generation and breaker system), (b) Research project (Task 6): ''Study of Cuttings Transport with Foam Under LPAT Conditions (Joint Project with TUDRP)'', (c) Research project (Task 7): ''Study of Cuttings Transport with Aerated Muds Under LPAT Conditions (Joint Project with TUDRP)'', (d) Research project (Task 8): ''Study of Flow of Synthetic Drilling Fluids Under Elevated Pressure and Temperature Conditions'', (e) Research project (Task 9): ''Study of Foam Flow Behavior Under EPET Conditions'', (f) Research project (Task 10): ''Study of Cuttings Transport with Aerated Mud Under Elevated Pressure and Temperature Conditions'', (g) Research on instrumentation tasks to measure: Cuttings concentration and distribution in a flowing slurry (Task 11), and Foam properties while transporting cuttings. (Task 12), (h) Development of a Safety program for the ACTS Flow Loop. Progress on a comprehensive safety review of all flow-loop components and operational procedures. (Task 1S). (i) Activities towards technology transfer and developing contacts with Petroleum and service company members, and increasing the number of JIP members. The tasks Completed During This Quarter are Task 7 and Task 8.

Troy Reed; Stefan Miska; Nicholas Takach; Kaveh Ashenayi; Gerald Kane; Mark Pickell; Len Volk; Mike Volk; Barkim Demirdal; Affonso Lourenco; Evren Ozbayoglu; Paco Vieira; Lei Zhou

2000-01-30T23:59:59.000Z

431

Magnetic signature of hydrocarbon-contaminated soils and sediments at the former oil field Hnigsen, Germany  

Science Journals Connector (OSTI)

Magnetic properties of hydrocarbon (HC) containing soils and sediments from two sites (Site A and B) of the former oil-field Hnigsen were analyzed in order to determine whether magnetic methods can be employe...

Moti L. Rijal; Katharina Porsch; Erwin Appel

2012-07-01T23:59:59.000Z

432

The correlation of solar flare production with magnetic energy in active regions  

Science Journals Connector (OSTI)

An investigation of 531 active regions was made to determine the correlation between energy released by flares and the available energy in magnetic fields of the regions. Regions with magnetic flux greater tha...

E. B. Mayfield; John K. Lawrence

1985-04-01T23:59:59.000Z

433

Stability of localized MHD perturbations in confinement systems with closed magnetic field lines  

Science Journals Connector (OSTI)

Conditions are determined for the stability of a finite-pressure plasma against perturbations localized near a magnetic field line in a magnetic confinement system without average minimum-B. The marginal stabilit...

V. V. Arsenin

2002-09-01T23:59:59.000Z

434

Progress Report for Advanced Automotive Fuels  

Alternative Fuels and Advanced Vehicles Data Center (EERE)

Energy Energy Office of Advanced Automotive Technologies 1000 Independence Avenue, S.W. Washington, DC 20585-0121 FY 1999 FY 1999 FY 1999 FY 1999 Progress Report for Advanced Automotive Fuels Progress Report for Advanced Automotive Fuels Progress Report for Advanced Automotive Fuels Progress Report for Advanced Automotive Fuels Energy Efficiency and Renewable Energy Energy Efficiency and Renewable Energy Energy Efficiency and Renewable Energy Energy Efficiency and Renewable Energy Office of Transportation Technologies Office of Transportation Technologies Office of Transportation Technologies Office of Transportation Technologies Office of Advanced Automotive Technologies Office of Advanced Automotive Technologies Office of Advanced Automotive Technologies Office of Advanced Automotive Technologies

435

Intermediate wavelength magnetic anomalies over ocean basins  

SciTech Connect

We have examined three very long magnetic field profiles taken over ocean basins for the presence of intermediate wavelength magnetic anomalies. One profile was from the Atlantic Ocean in the Transatlantic Geotraverse area, one ran along latitude 35/sup 0/S in the SE Pacific, and one ran along 150/sup 0/W in the Pacific. All three profiles show the presence of intermediate wavelength (65--1500 km) magnetic anomalies generated in the crust or upper mantle. The analysis of magnetic field power spectra shows that the core field becomes unimportant at about a wavelength of 1500 km. Sea floor spreading anomalies should produce a maximum in power at about a wavelength of 65 km. Between these two wavelengths there should be a minimum in power which is not seen on observed records. Inverting the anomalous field to obtain some idea of the magnetization necessary to explain these intermediate wavelength magnetic anomalies shows that values of magnetization in excess of 1 A m/sup -1/ are needed if the magnetized layer is as thick as the ocean crust. Alternatively, rather large thicknesses of upper mantle material with lower intensities of magnetization need to be used. The reason why such magnetization variations exist is not known. It can be shown that upward continuation of the magnetic anomaly signature to an altitude of 350 km (about the perihelion altitude of MAGSAT) will produce anomalies up to 10 nT in amplitude. These should be capable of being seen by MAGSAT, and thus allow us to determine the spatial arrangement of the intermediate wavelength anomalies and hence, hopefully, a clue as to their origin.

Harrison, C.G.A.; Carle, H.M.

1981-12-10T23:59:59.000Z

436

Categorical Exclusion Determinations: American Recovery and Reinvestment  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

3107: Categorical Exclusion Determination 3107: Categorical Exclusion Determination Harvard Medical School, Wyss Institute - Engineering a Bacterial Reverse Fuel Cell CX(s) Applied: B3.6 Date: 06/02/2010 Location(s): Massachusetts Office(s): Advanced Research Projects Agency - Energy June 2, 2010 CX-003103: Categorical Exclusion Determination The Ohio State University - Bioconversion of Carbon Dioxide to Biofuels CX(s) Applied: B3.6 Date: 06/02/2010 Location(s): Ohio Office(s): Advanced Research Projects Agency - Energy June 1, 2010 CX-002717: Categorical Exclusion Determination Oklahoma Shawnee Tribe CX(s) Applied: B2.5, B5.1 Date: 06/01/2010 Location(s): Miami, Oklahoma Office(s): Energy Efficiency and Renewable Energy June 1, 2010 CX-002477: Categorical Exclusion Determination Demand Energy Networks CX(s) Applied: B3.6, B5.1

437

Categorical Exclusion Determinations: Kentucky | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Kentucky Kentucky Categorical Exclusion Determinations: Kentucky Location Categorical Exclusion Determinations issued for actions in Kentucky. DOCUMENTS AVAILABLE FOR DOWNLOAD September 23, 2013 CX-010919: Categorical Exclusion Determination Advanced Catalytic Solvent for Carbon Dioxide (CO2) Capture CX(s) Applied: B3.6 Date: 09/23/2013 Location(s): Kentucky Offices(s): National Energy Technology Laboratory September 23, 2013 CX-010921: Categorical Exclusion Determination Advanced Catalytic Solvent for Carbon Dioxide (CO2) Capture CX(s) Applied: A9 Date: 09/23/2013 Location(s): Kentucky Offices(s): National Energy Technology Laboratory July 25, 2013 CX-010606: Categorical Exclusion Determination Development of Subsurface Brine Disposal Framework in the Northern Appalachian Basin

438

Tamper resistant magnetic stripes  

DOE Patents (OSTI)

This invention relates to a magnetic stripe comprising a medium in which magnetized particles are suspended and in which the encoded information is recorded by actual physical rotation or alignment of the previously magnetized particles within the flux reversals of the stripe which are 180.degree. opposed in their magnetic polarity. The magnetized particles are suspended in a medium which is solid, or physically rigid, at ambient temperatures but which at moderately elevated temperatures, such as 40.degree. C., is thinable to a viscosity permissive of rotation of the particles therein under applications of moderate external magnetic field strengths within acceptable time limits.

Naylor, Richard Brian (Albuquerque, NM); Sharp, Donald J. (Albuquerque, NM)

1999-01-01T23:59:59.000Z

439

A magnetic spectrometer measurement of the charge ratio of energetic cosmic ray muons  

E-Print Network (OSTI)

" of 35 Bev. Th, . " periment has been carried out with a magnetic momentum spectrometer-telescope consisting of two separate solid- izon magnets in conjun tinn iwith detectors of penetrating ionizing particles. The incident particles recorded were... directions of the particles as they entered the top magnet and the exit directions from the lower magnet. The magnitudes and directions of the deflections in the known magnetic field have then been used to determine the moments and charges...

Bateman, Benjamin Jefferson

2012-06-07T23:59:59.000Z

440

Quantum spins mimic refrigerator magnets - Argonne National Laboratories,  

NLE Websites -- All DOE Office Websites (Extended Search)

Highlights > Quantum spins mimic refrigerator Highlights > Quantum spins mimic refrigerator magnets Quantum spins mimic refrigerator magnets By Joseph Bernstein * October 11, 2012 The behavior of magnetic moments in metal oxides such as layered iridium is dominated by strong spin-orbit coupling effects. In layered compounds such as Sr3Ir2O7 (shown on the left), the direction of these moments (blue arrows) is controlled at the quantum level by dipolar interactions that are akin to those of classical bar magnets. Another outcome is an unprecedented 'magnon gap' (shown at right), which was measured at the Argonne Advanced Photon Source and reveals that these underlying dipolar magnetic interactions are extremely strong. Current electronic devices depend on manipulating charge. Alternative approaches may rely on not only charge but also the spin of electrons.

Note: This page contains sample records for the topic "determination advanced magnetic" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


441

Advanced Powertrain Research Facility  

NLE Websites -- All DOE Office Websites (Extended Search)

95F 95F Vehicle Setup Information Vehicle architecture PHEV Test cell location Front Advanced Powertrain Research Facility Document date 10/18/2013 Vehicle dynamometer Input Revision Number 1 Test weight [lb] 3518 Notes: Target A [lb] 21.47 Target B [lb/mph] 0.21588 Target C [lb/mph^2] 0.012508 Test Fuel Information Revision Number 1 Test weight [lb] 3518 Test Fuel Information Fuel type EPA Tier II EEE HF0437 Fuel density [g/ml] 0.742 Fuel Net HV [BTU/lbm] 18475 Fuel type EPA Tier II EEE HF0437 T e s t I D [ # ] C y c l e C o l d s t a r t ( C S t ) H o t s t a r t [ H S t ] D a t e T e s t C e l l T e m p [ C ] T e s t C e l l R H [ % ] T e s t C e l l B a r o [ i n / H g ] V e h i c l e c o o l i n g f a n s p e e d : S p e e d M a t c h [ S M ] o r c o n s t a n t s p e e d [ C S ] S o l a r L a m p s [ W / m 2 ] V e i c l e C l i m a t e C o n t r o l s e t t i n g s H o o d P o s i t i o n [ U p ] o r [ C l o s e d ] W i n d o w P o s i t i o n [ C l o s e d ] o r [ D o w n ] C y

442

Advanced Geothermal Turbodrill  

SciTech Connect

Approximately 50% of the cost of a new geothermal power plant is in the wells that must be drilled. Compared to the majority of oil and gas wells, geothermal wells are more difficult and costly to drill for several reasons. First, most U.S. geothermal resources consist of hot, hard crystalline rock formations which drill much slower than the relatively soft sedimentary formations associated with most oil and gas production. Second, high downhole temperatures can greatly shorten equipment life or preclude the use of some technologies altogether. Third, producing viable levels of electricity from geothermal fields requires the use of large diameter bores and a high degree of fluid communication, both of which increase drilling and completion costs. Optimizing fluid communication often requires creation of a directional well to intersect the best and largest number of fracture capable of producing hot geothermal fluids. Moineau motor stators made with elastomers cannot operate at geothermal temperatures, so they are limited to the upper portion of the hole. To overcome these limitations, Maurer Engineering Inc. (MEI) has developed a turbodrill that does not use elastomers and therefore can operate at geothermal temperatures. This new turbodrill uses a special gear assembly to reduce the output speed, thus allowing a larger range of bit types, especially tri-cone roller bits, which are the bits of choice for drilling hard crystalline formations. The Advanced Geothermal Turbodrill (AGT) represents a significant improvement for drilling geothermal wells and has the potential to significantly reduce drilling costs while increasing production, thereby making geothermal energy less expensive and better able to compete with fossil fuels. The final field test of the AGT will prepare the tool for successful commercialization.

W. C. Maurer

2000-05-01T23:59:59.000Z

443

NETL: Advanced Research - The Advanced Research (AR) Program  

NLE Websites -- All DOE Office Websites (Extended Search)

AR Program AR Program Advanced Research The Advanced Research (AR) Program Advanced Research Program Diagram CLICK ON GRAPHIC TO ENLARGE CLICK ON GRAPHIC TO ENLARGE AR pursues projects in several key areas that are considered to be of greatest relevance and potential benefit to advanced coal and power systems. Many of AR's projects focus on "breakthrough" technologies or novel applications, striving to balance high risk against the prospect of high payoff in terms of measurable benefits to coal and power systems technologies - improved efficiencies, lower costs, new materials, and new processes. AR manages a portfolio that includes pre-commercial projects that rely on NETL's in-house facilities and depth of expertise, as well as collaborative external arrangements that draw upon diverse outside

444

Advanced thermionic reactor systems design code  

SciTech Connect

An overall systems design code is under development to model an advanced in-core thermionic nuclear reactor system for space applications at power levels of 10 to 50 kWe. The design code is written in an object-oriented programming environment that allows the use of a series of design modules, each of which is responsible for the determination of specific system parameters. The code modules include a neutronics and core criticality module, a core thermal hydraulics module, a thermionic fuel element performance module, a radiation shielding module, a module for waste heat transfer and rejection, and modules for power conditioning and control. The neutronics and core criticality module determines critical core size, core lifetime, and shutdown margins using the criticality calculation capability of the Monte Carlo Neutron and Photon Transport Code System (MCNP). The remaining modules utilize results of the MCNP analysis along with FORTRAN programming to predict the overall system performance.

Lewis, B.R.; Pawlowski, R.A.; Greek, K.J.; Klein, A.C. (Department of Nuclear Engineering, Radiation Center, C116, Oregon State University, Corvallis, Oregon 97331-5902 (US))

1991-01-01T23:59:59.000Z

445

National High Magnetic Field Laboratory: An Introduction to Magnets...  

NLE Websites -- All DOE Office Websites (Extended Search)

resistive magnet is here at the Magnet Lab: It can generate a sustained magnetic field of 35 tesla. (Were not counting here our world-record hybrid magnet or the stronger,...

446

3D analysis of magnetization distribution magnetized by capacitor-discharge impulse magnetizer  

Science Journals Connector (OSTI)

Method for calculating the magnetization distribution magnetized by capacitor-discharge impulse magnetizer is expanded to 3D, and the calculated flux distribution is compared with measured one.

Norio Takahashi

2001-01-01T23:59:59.000Z

447

Sandia National Laboratories: Advanced Electric Systems  

NLE Websites -- All DOE Office Websites (Extended Search)

InfrastructureAdvanced Electric Systems Advanced Electric Systems grid-slide1 grid-slide2 grid-slide3 grid-slide4 Advanced Electric Systems Integrating Renewable Energy into the...

448

CX-006759: Categorical Exclusion Determination | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

759: Categorical Exclusion Determination 759: Categorical Exclusion Determination CX-006759: Categorical Exclusion Determination International Colloquium on Environmentally-Preferred Advanced Power Generation - ICEPAG 2012 CX(s) Applied: A9 Date: 09/14/2011 Location(s): Costa Mesa, California Office(s): Fossil Energy, National Energy Technology Laboratory International Colloquium on Environmentally-Preferred Advanced Power Generation provides an annual venue for communication, on an international scale, of research related to fuel cell/turbine hybrid systems, fuel cells with novel cycles, and hydrogen turbine technology. DOCUMENT(S) AVAILABLE FOR DOWNLOAD CX-006759.pdf More Documents & Publications CX-005658: Categorical Exclusion Determination CX-004108: Categorical Exclusion Determination CX-002810

449

Spin and orbital magnetization loops obtained using magnetic Compton scattering  

SciTech Connect

We present an application of magnetic Compton scattering (MCS) to decompose a total magnetization loop into spin and orbital magnetization contributions. A spin magnetization loop of SmAl{sub 2} was measured by recording the intensity of magnetic Compton scattering as a function of applied magnetic field. Comparing the spin magnetization loop with the total magnetization one measured by a vibrating sample magnetometer, the orbital magnetization loop was obtained. The data display an anti-coupled behavior between the spin and orbital magnetizations and confirm that the orbital part dominates the magnetization.

Itou, M.; Sakurai, Y. [Japan Synchrotron Radiation Research Institute, SPring-8, Hyogo 679-5198 (Japan)] [Japan Synchrotron Radiation Research Institute, SPring-8, Hyogo 679-5198 (Japan); Koizumi, A. [Graduate School of Materials Science, University of Hyogo, Hyogo 678-1297 (Japan)] [Graduate School of Materials Science, University of Hyogo, Hyogo 678-1297 (Japan)

2013-02-25T23:59:59.000Z

450

Surface-enhanced magnetization for uniaxial ferromagnets  

Science Journals Connector (OSTI)

We study the surface magnetic excitations for a semi-infinite anisotropic Heisenberg ferromagnet. We take a single-ion uniaxial anisotropy at the surface, which is different from that of the bulk. We determine the layer magnetization and the surface magnon modes in the region of temperatures above the bulk critical temperature. Our phase diagram presents the paramagnetic, the bulk-ferromagnetic, and the surface-ferromagnetic phases that join on a multicritical point. This point is determined as a function of the single-ion surface anisotropy parameter.

C. A. Queiroz and W. Figueiredo

1989-09-01T23:59:59.000Z

451

JOURNAL OF GEOPHYSICAL RESEARCH: SPACE PHYSICS, VOL. 118, 49985007, doi:10.1002/jgra.50479, 2013 Tracing magnetic separators and their dependence on IMF clock  

E-Print Network (OSTI)

separator, the magnetic field line that connects magnetic nulls (where the magnetic field strength |B| = 0 et al., 2001]. The topology of a magnetic field line is determined by where it maps relative to Earth direction, and half-open field lines only map to Earth in one direction. The magnetic separator marks where

452

> FOR CONFERENCE-RELATED PAPERS, REPLACE THIS LINE WITH YOUR SESSION NUMBER, E.G., AB-02 (DOUBLE-CLICK HERE) Magnetic Field in Internal  

E-Print Network (OSTI)

-CLICK HERE) Magnetic Field in Internal and External Rotor model for the computation of magnetic field distribution in any number of stator slots and rotor poles on subdomain model for predicting magnetic field in any FSM topology with defining in advance the number

Boyer, Edmond

453

Recent lunar magnetism  

E-Print Network (OSTI)

The magnetization of young lunar samples (magnetic fields (e.g. core dynamo and long-lived impact plasma fields) have not been present within the last 1.5 Ga. To better ...

Buz, Jennifer

2011-01-01T23:59:59.000Z

454

Metallic Magnetic Hetrostructures  

E-Print Network (OSTI)

This work studied sputter deposited conventional spin valves (SV) and related structures. In SV layered structures, two ferromagnetic layers are separated by a non-magnetic spacer. Under an external magnetic field, the relative orientation...

Leung, Chi Wah

455

Plasma Magnetic Insulation  

Science Journals Connector (OSTI)

29 June 1987 research-article Plasma Magnetic Insulation B. B. Kadomtsev Theoretically the strong magnetic field of a tokamak should confine electrons and ions in a high-temperature...

1987-01-01T23:59:59.000Z

456

Magnetic assisted statistical assembly  

E-Print Network (OSTI)

The objective of this thesis is to develop a process using magnetic forces to assemble micro-components into recesses on silicon based integrated circuits. Patterned SmCo magnetic thin films at the bottom of recesses are ...

Cheng, Diana I

2008-01-01T23:59:59.000Z

457

Magnetic Nanoparticle NANOMATERIALS  

E-Print Network (OSTI)

Magnetic Nanoparticle Metrology NANOMATERIALS We are developing best practice metrology for characterization of magnetic nanoparticle systems (e.g. blocking temperature, anisotropy, property distributions, T nanoparticles and provide guidelines to the FDA to properly compare systems when approving nanoparticle systems

458

Uranium Monochalcogenides: Magnetic Form Factor and Magnetic Neutron Scattering  

Science Journals Connector (OSTI)

Fig. R.66. UY. (A) Magnetic form factor. The radial ?j i? integrals, which contribute to the neutron magnetic fo...

R. Tro?

2009-01-01T23:59:59.000Z

459

LHC Magnet Program | Superconducting Magnet Division  

NLE Websites -- All DOE Office Websites (Extended Search)

Magnet Program Magnet Program The Superconducting Magnet Division is building a number of dipole magnets for the Large Hadron Collider (LHC), which is now under construction at CERN in Geneva, Switzerland. Scheduled to begin operation in 2007, this machine will collide beams of protons with the unprecedented energy of 7 TeV per beam to explore the nature of matter at its most basic level (RHIC can collide beams of protons with energies of 0.25 TeV, but is mostly used to collide heavy ions with energies of 0.1 TeV per nucleon). The magnets are being built as part of the US program, recommended by the High Energy Physics Advisory Panel (HEPAP) and approved by Congress, to contribute to the construction and, later, use of that frontier machine by the US high energy physics community. Fermi National Accelerator Laboratory (FNAL) and

460

Draft Advanced Nuclear Energy Solicitation Public Meeting Presentation...  

Office of Environmental Management (EM)

Draft Advanced Nuclear Energy Solicitation Public Meeting Presentation Draft Advanced Nuclear Energy Solicitation Public Meeting Presentation Draft Advanced Nuclear Solicitation...

Note: This page contains sample records for the topic "determination advanced magnetic" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


461

E-Print Network 3.0 - atomic absorption spectrometry-determination...  

NLE Websites -- All DOE Office Websites (Extended Search)

Search Powered by Explorit Topic List Advanced Search Sample search results for: atomic absorption spectrometry-determination Page: << < 1 2 3 4 5 > >> 1 Extended Xray...

462

E-Print Network 3.0 - atomic absorption determination Sample...  

NLE Websites -- All DOE Office Websites (Extended Search)

Search Powered by Explorit Topic List Advanced Search Sample search results for: atomic absorption determination Page: << < 1 2 3 4 5 > >> 1 Extended Xray Absorption Fine...

463

E-Print Network 3.0 - africa tanzania determinants Sample Search...  

NLE Websites -- All DOE Office Websites (Extended Search)

Search Powered by Explorit Topic List Advanced Search Sample search results for: africa tanzania determinants Page: << < 1 2 3 4 5 > >> 1 University of Virginia, Department...

464

Magnetic susceptibility in QCD  

E-Print Network (OSTI)

Magnetic susceptibility in the deconfined phase of QCD is calculated in a closed form using a recent general expression for the quark gas pressure in magnetic field. Quark selfenergies are entering the result via Polyakov line factors and ensure the total paramagnetic effect, increasing with temperature. A generalized form of magnetic susceptibility in nonzero magnetic field suitable for experimental and lattice measurements is derived, showing a good agreement with available lattice data.

V. D. Orlovsky; Yu. A. Simonov

2014-05-12T23:59:59.000Z

465

Advances in Metallic Nuclear Fuel  

Science Journals Connector (OSTI)

Metallic nuclear fuels have generated renewed interest for advanced ... operations is excellent. Ongoing irradiation tests in Argonne-Wests Idaho-based Experimental Breeder Reactor ... fast reactor (IFR) concept...

B. R. Seidel; L. C. Walters; Y. I. Chang

1987-04-01T23:59:59.000Z

466

Advanced Sensors and Instrumentation Newsletter  

Energy.gov (U.S. Department of Energy (DOE))

The Advanced Sensors and Instrumentation (ASI) newsletter will be released periodically to inform program stakeholders about new developments and achievements in the area of sensors, instrumentation and related technologies across the Office of Nuclear Energy (NE) R&D programs.

467

advanced search Economist.com  

E-Print Network (OSTI)

SEARCH advanced search » Economist.com RESEARCH TOOLS Choose a research tool... Help their movements cause? A company is paying them to do a job, so why should it not read their e-mails when

Nissenbaum, Helen

468

Advanced Policy Practice Spring 2014  

E-Print Network (OSTI)

Advanced Policy Practice Spring 2014 SW 548-001 Instructor course that focuses on the theory and evidence-based skill sets of policy analysis, development, implementation, and change. The course focuses on policy

Grissino-Mayer, Henri D.

469

Sandia National Laboratories: advanced materials  

NLE Websites -- All DOE Office Websites (Extended Search)

Renewable Energy, Solar, Systems Engineering On May 21st, the Department of Energy SunShot Initiative announced 10M for six new R&D projects that will advance innovative...

470

Nanobiocatalyst advancements and bioprocessing applications  

Science Journals Connector (OSTI)

...develop a synergistic biocatalyst-medicine device. They used a cleavable enzyme-linker...innovative discovery reported in Nature Nanotechnology [32]. The authors characterized...integrates two advanced technologies: nanotechnology and biotechnology. The perspectives...

2015-01-01T23:59:59.000Z

471

February 2000 Advanced Technology Program  

E-Print Network (OSTI)

OF COMMERCE Economic Assessment Office Technology Administration Advanced Technology Program National .................................................................................................6 V. IIH Focused Program Project Selection Process information infrastructure in healthcare. A discussion of the ATP "white paper" process4 notes differences

472

Recent Advances in Petroleum Microbiology  

Science Journals Connector (OSTI)

American Society for Microbiology ARTICLE REVIEWS Recent Advances in Petroleum Microbiology Jonathan D. Van Hamme...177: 2615-2621. 218 Gilbert, S. C., J. Morton...desulfurization pathway. Microbiology 144: 2545-2553. 219...

Jonathan D. Van Hamme; Ajay Singh; Owen P. Ward

2003-12-01T23:59:59.000Z

473

Advanced Process Management and Implementation  

E-Print Network (OSTI)

Advanced Process Management is a method to achieve optimum process performance during the life cycle of a plant through proper design, effective automation, and adequate operator decision support. Developing a quality process model is an effective...

Robinson, J.

474

SCANNING THE TECHNOLOGY Scanning Advanced  

E-Print Network (OSTI)

state of refinement. This has been made possible by advancements in a wide spec- trum of scientific economy, lower emissions and improved safety. The availability of computers on board the vehicle

475

Advanced Supply System Validation Workshop  

Energy.gov (U.S. Department of Energy (DOE))

The Bioenergy Technologies Office (BETO) is hosting the Advanced Supply System Validation Workshop on February 3-4, 2015, in Golden, Colorado. The purpose of the workshop is to bring together a...

476

20 th International Sacramento Peak Summer Workshop Advanced Solar Polarimetry -Theory, Observation, and Instrumentation  

E-Print Network (OSTI)

in the Quiet Sun Alexei A. Pevtsov National Solar Observatory/Sacramento Peak, PO Box 62, Sunspot, New Mexico20 th International Sacramento Peak Summer Workshop Advanced Solar Polarimetry - Theory in the solar activity on all spatial scales. It is believed that the strong magnetic #12;eld (active regions

Pevtsov, Alexei A.

477

Magnetism Theory Group / POSTECH Magnetism Theory Group / POSTECH  

E-Print Network (OSTI)

Magnetism Theory Group / POSTECH #12;Magnetism Theory Group / POSTECH #12;Magnetism Theory Group / POSTECH #12;Magnetism Theory Group / POSTECH #12;Magnetism Theory Group / POSTECH J.H . Park et al. #12;'s of FeinCsm e tal The chargeandorbitalordering geom etryin YB a C o 2 O 5 S. K. Kwon etal .Magnetism Theory

Min, Byung Il

478

Building Technologies Office: Advanced Energy Retrofit Guides  

NLE Websites -- All DOE Office Websites (Extended Search)

Energy Energy Retrofit Guides to someone by E-mail Share Building Technologies Office: Advanced Energy Retrofit Guides on Facebook Tweet about Building Technologies Office: Advanced Energy Retrofit Guides on Twitter Bookmark Building Technologies Office: Advanced Energy Retrofit Guides on Google Bookmark Building Technologies Office: Advanced Energy Retrofit Guides on Delicious Rank Building Technologies Office: Advanced Energy Retrofit Guides on Digg Find More places to share Building Technologies Office: Advanced Energy Retrofit Guides on AddThis.com... About Take Action to Save Energy Activities 179d Tax Calculator Advanced Energy Design Guides Advanced Energy Retrofit Guides Building Energy Data Exchange Specification Buildings Performance Database Data Centers Energy Asset Score

479

Sandia National Laboratories: Advanced Materials Laboratory  

NLE Websites -- All DOE Office Websites (Extended Search)

Advanced Materials Laboratory Sandia Researchers Win CSP:ELEMENTS Funding Award On June 4, 2014, in Advanced Materials Laboratory, Concentrating Solar Power, Energy, Energy...

480

Vehicle Technologies Office: 2008 Advanced Vehicle Technology...  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

8 Advanced Vehicle Technology Analysis and Evaluation Activities and Heavy Vehicle Systems Optimization Program Annual Progress Report Vehicle Technologies Office: 2008 Advanced...

Note: This page contains sample records for the topic "determination advanced magnetic" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


481

Advanced Hybrid Water Heater using Electrochemical Compressor...  

Energy Savers (EERE)

Advanced Hybrid Water Heater using Electrochemical Compressor Advanced Hybrid Water Heater using Electrochemical Compressor Xergy is using its Electro Chemical Compression (ECC)...

482

Polymer Electrolytes for Advanced Lithium Batteries | Department...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Advanced Lithium Batteries Polymer Electrolytes for Advanced Lithium Batteries 2009 DOE Hydrogen Program and Vehicle Technologies Program Annual Merit Review and Peer Evaluation...

483

Advanced Natural Gas Reciprocating Engines (ARES) - Presentation...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Advanced Natural Gas Reciprocating Engines (ARES) - Presentation by Caterpillar, Inc., June 2011 Advanced Natural Gas Reciprocating Engines (ARES) - Presentation by Caterpillar,...

484

Advanced Natural Gas Reciprocating Engines (ARES) - Presentation...  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

Cummins, Inc., June 2011 Advanced Natural Gas Reciprocating Engines (ARES) - Presentation by Cummins, Inc., June 2011 Presentation on Advanced Natural Gas Reciprocating Engines...

485

Advanced Natural Gas Reciprocating Engines (ARES) - Presentation...  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

Dresser Waukesha, June 2011 Advanced Natural Gas Reciprocating Engines (ARES) - Presentation by Dresser Waukesha, June 2011 Presentation on Advanced Natural Gas Reciprocating...

486

Optimization of Advanced Diesel Engine Combustion Strategies...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Optimization of Advanced Diesel Engine Combustion Strategies Optimization of Advanced Diesel Engine Combustion Strategies 2010 DOE Vehicle Technologies and Hydrogen Programs Annual...

487

Vehicle Technologies Office: 2012 Advanced Power Electronics...  

Energy Savers (EERE)

2 Advanced Power Electronics and Electric Motors R&D Annual Progress Report Vehicle Technologies Office: 2012 Advanced Power Electronics and Electric Motors R&D Annual Progress...

488

Advanced Electric Drive Vehicle Education Program | Department...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Advanced Electric Drive Vehicle Education Program Advanced Electric Drive Vehicle Education Program 2010 DOE Vehicle Technologies and Hydrogen Programs Annual Merit Review and Peer...

489

Advanced Electric Drive Vehicles ? A Comprehensive Education...  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

D.C. tiarravt034ferdowsi2010o.pdf More Documents & Publications Advanced Electric Drive Vehicles A Comprehensive Education, Training, and Outreach Program Advanced...

490

Advanced Electric Drive Vehicles ? A Comprehensive Education...  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

Meeting arravt034tiferdowsi2012o.pdf More Documents & Publications Advanced Electric Drive Vehicles A Comprehensive Education, Training, and Outreach Program Advanced...

491

Advanced Electric Drive Vehicles ? A Comprehensive Education...  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

Evaluation arravt034tiferdowsi2011p.pdf More Documents & Publications Advanced Electric Drive Vehicles A Comprehensive Education, Training, and Outreach Program Advanced...

492

Advanced Electric Drive Vehicles | Department of Energy  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

D.C. tiarravt039schwendeman2010o.pdf More Documents & Publications Advanced Electric Drive Vehicles Advanced Electric Drive Vehicles Energy & Manufacturing Workforce...

493

Advancing Transportation Through Vehicle Electrification - PHEV...  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

Meeting arravt067vssbazzi2012o.pdf More Documents & Publications Advancing Transportation Through Vehicle Electrification - PHEV Advancing Plug In Hybrid Technology and...

494

The Ohio Advanced Transportation Partnership (OATP) | Department...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

The Ohio Advanced Transportation Partnership (OATP) The Ohio Advanced Transportation Partnership (OATP) 2012 DOE Hydrogen and Fuel Cells Program and Vehicle Technologies Program...

495

Funding Opportunity Webinar - Advancing Solutions To Improve...  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

Funding Opportunity Webinar - Advancing Solutions To Improve the Energy Efficiency of US Commercial Buildings Funding Opportunity Webinar - Advancing Solutions To Improve the...

496

Advanced Manufacturing Initiative Improves Turbine Blade Productivity...  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

Advanced Manufacturing Initiative Improves Turbine Blade Productivity Advanced Manufacturing Initiative Improves Turbine Blade Productivity May 20, 2011 - 2:56pm Addthis This is an...

497

Request for Information (RFI): Advanced Manufacturing Office...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Advanced Manufacturing Office (AMO) Software Tools Request for Information (RFI): Advanced Manufacturing Office (AMO) Software Tools July 25, 2014 - 1:00pm Addthis Funding: This...

498

Current trends in the Advanced Bioindustry  

Energy.gov (U.S. Department of Energy (DOE))

Afternoon Plenary Session: Current Trends in the Advanced Bioindustry State of TechnologyMichael McAdams, President, Advanced Biofuels Association

499

Tribal Renewable Energy Advanced Course: Project Development...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Development and Financing Essentials Tribal Renewable Energy Advanced Course: Project Development and Financing Essentials Watch the DOE Office of Indian Energy advanced course...

500

Advanced Vehicle Testing Activity (AVTA) ? PHEV Evaluations...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Advanced Vehicle Testing Activity (AVTA) PHEV Evaluations and Data Collection Advanced Vehicle Testing Activity (AVTA) PHEV Evaluations and Data Collection Presentation from...