National Library of Energy BETA

Sample records for database public information

  1. ARM - Public Information Materials

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    govPublicationsPublic Information Materials Publications Journal Articles Conference Documents Program Documents Technical Reports Publications Database Public Information...

  2. ARM Publications Database

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    govPublicationsPublications Database Publications Database Submit a Publication Would your publication make a good research highlight? Submit one now. Comments? Need a change to an...

  3. ARM Publications Database

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    DatabaseSearch Publications Database Search Submit a Publication Would your publication make a good research highlight? Submit one now. Comments? Need a change to an existing...

  4. ARM Publications Database

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    DatabaseSearchTips Publications Database Search Submit a Publication Would your publication make a good research highlight? Submit one now. Comments? Need a change to an existing...

  5. Freedom of Information and Privacy Act Database PIA, Idaho Operations

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Office | Department of Energy Information and Privacy Act Database PIA, Idaho Operations Office Freedom of Information and Privacy Act Database PIA, Idaho Operations Office Freedom of Information and Privacy Act Database PIA, Idaho Operations Office PDF icon Freedom of Information and Privacy Act Database PIA, Idaho Operations Office More Documents & Publications PIA - Security Clearance Work Tracking and Budget System TRAIN-PIA.pdf Occupational Medicine - Assistant PIA, Idaho National

  6. REDD+ Database | Open Energy Information

    Open Energy Info (EERE)

    change mitigation, resource conservation and positive development outcomes through sustainable forest management." References "REDD+ Database" Retrieved from "http:...

  7. Emergency Public Information

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    1997-08-21

    This volume defines elements of providing information to the public during and following emergencies. Canceled by DOE G 151.1-4.

  8. TWRS information locator database system design description

    SciTech Connect (OSTI)

    Knutson, B.J.

    1996-09-13

    This document gives an overview and description of the Tank Waste Remediation System (TWRS) Information Locator Database (ILD)system design. The TWRS ILD system is an inventory of information used in the TWRS Systems Engineering process to represent the TWRS Technical Baseline. The inventory is maintained in the form of a relational database developed in Paradox 4.5.

  9. Freedom of Information and Privacy Act Database PIA, Idaho Operations...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Information and Privacy Act Database PIA, Idaho Operations Office Freedom of Information and Privacy Act Database PIA, Idaho Operations Office Freedom of Information and Privacy ...

  10. Montana State Antiquities Database | Open Energy Information

    Open Energy Info (EERE)

    Antiquities Database Jump to: navigation, search OpenEI Reference LibraryAdd to library Web Site: Montana State Antiquities Database Abstract Database contains cultural resource...

  11. WTO Subsidy Notifications Database | Open Energy Information

    Open Energy Info (EERE)

    Dataset Website: www.globalsubsidies.orgprivatemodulesknowledgeboxexternalindex.ph WTO Subsidy Notifications Database Screenshot References: WTO Subsidy Database1...

  12. International Forest Policy Database | Open Energy Information

    Open Energy Info (EERE)

    Database Jump to: navigation, search Tool Summary LAUNCH TOOL Name: International Forest Policy Database AgencyCompany Organization: GTZ Sector: Land Focus Area: Forestry...

  13. IPCC Emission Factor Database | Open Energy Information

    Open Energy Info (EERE)

    Emission Factor Database Jump to: navigation, search Tool Summary LAUNCH TOOL Name: IPCC Emission Factor Database AgencyCompany Organization: World Meteorological Organization,...

  14. DOE's Public Database for Green Building Case Studies: Preprint

    SciTech Connect (OSTI)

    Torcellini, P. A.; Crawley, D. B.

    2003-11-01

    To help capture valuable information on''green building'' case studies, the U.S. Department of Energy has created an online database for collecting, standardizing, and disseminating information about high-performance, green projects. Type of information collected includes green features, design processes, energy performance, and comparison to other high-performance, green buildings.

  15. Databases

    Broader source: Energy.gov [DOE]

    The Fuel Cell Technologies Office is developing databases to make it easier for users to find up-to-date information on hydrogen and fuel cells.

  16. Public Information Campaigns

    Broader source: Energy.gov [DOE]

    The U.S. Department of Energy (DOE) supports states, local governments, and tribes in their efforts to carry out education campaigns targeting the general public about energy conservation. These...

  17. Montana 310 Permit Database | Open Energy Information

    Open Energy Info (EERE)

    0 Permit Database Jump to: navigation, search OpenEI Reference LibraryAdd to library Web Site: Montana 310 Permit Database Abstract Provides access to Montana's 310 permit mapping...

  18. Hydrodynamic Testing Facilities Database | Open Energy Information

    Open Energy Info (EERE)

    Hydrodynamic Testing Facilities Database (Redirected from Hydrodynamic Testing Facilities) Jump to: navigation, search Facility Operators By viewing Hydrodynamic Testing Facilities...

  19. Information Resources - Publications

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Quick Search Search By: Keyword Author Title Year GO Main Menu Home My Papers Submit Status Signatures Search Admin Log Out Contract Acknowledgment Notice In June 2014, the Department of Energy's Office of Science issued new guidance for manuscripts produced by DOE-funded laboratories. Each submitted manuscript must now contain a Notice to the Publisher and an Acknowledgment. Notice to Publisher As per the JSA contract with DOE, it is necessary to inform the publisher of the U.S. Government

  20. Hydrodynamic Testing Facilities Database | Open Energy Information

    Open Energy Info (EERE)

    Hydrodynamic Testing Facilities Database Jump to: navigation, search Facility Operators By viewing Hydrodynamic Testing Facilities in the list accompanying the map, one will be...

  1. REDD Country Activity Database | Open Energy Information

    Open Energy Info (EERE)

    in multiple languages across a broad range of areas including policies, plans, laws, statistics, activities and financing. The REDD Countries Database does not attempt to assess...

  2. Global Renewable Energy Database | Open Energy Information

    Open Energy Info (EERE)

    LAUNCH TOOL Name: Global Renewable Energy Database AgencyCompany Organization: German Aerospace Center (DLR) Sector: Energy Focus Area: Renewable Energy, Solar, Wind...

  3. Geothermal/Geochemical Database | Open Energy Information

    Open Energy Info (EERE)

    to library Chart: GeothermalGeochemical DatabaseInfo GraphicMapChart Author Nevada Bureau of Mines and Geology Published Nevada Bureau of Mines and Geology, 2012 DOI Not...

  4. TWRS information locator database system administrator`s manual

    SciTech Connect (OSTI)

    Knutson, B.J., Westinghouse Hanford

    1996-09-13

    This document is a guide for use by the Tank Waste Remediation System (TWRS) Information Locator Database (ILD) System Administrator. The TWRS ILD System is an inventory of information used in the TWRS Systems Engineering process to represent the TWRS Technical Baseline. The inventory is maintained in the form of a relational database developed in Paradox 4.5.

  5. DOE technology information management system database study report

    SciTech Connect (OSTI)

    Widing, M.A.; Blodgett, D.W.; Braun, M.D.; Jusko, M.J.; Keisler, J.M.; Love, R.J.; Robinson, G.L.

    1994-11-01

    To support the missions of the US Department of Energy (DOE) Special Technologies Program, Argonne National Laboratory is defining the requirements for an automated software system that will search electronic databases on technology. This report examines the work done and results to date. Argonne studied existing commercial and government sources of technology databases in five general areas: on-line services, patent database sources, government sources, aerospace technology sources, and general technology sources. First, it conducted a preliminary investigation of these sources to obtain information on the content, cost, frequency of updates, and other aspects of their databases. The Laboratory then performed detailed examinations of at least one source in each area. On this basis, Argonne recommended which databases should be incorporated in DOE`s Technology Information Management System.

  6. Databases | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Information Resources » Databases Databases This page contains several databases that provide comprehensive information to expand your biomass knowledge. Use the descriptions and links provided to access the database that best meets your research needs. Alternative Fuels & Advanced Vehicles Data Center (AFDC) Publications Database: There are thousands of publications in AFDC's comprehensive alternative fuels and advanced transportation database. Sponsored by the U.S. Department of Energy's

  7. Public Service Electric & Gas | Open Energy Information

    Open Energy Info (EERE)

    Electric & Gas Jump to: navigation, search Name: Public Service Electric & Gas Place: Newark, NJ Information About Partnership with NREL Partnership with NREL Yes Partnership Type...

  8. Manhattan Project: Informing the Public, August 1945

    Office of Scientific and Technical Information (OSTI)

    Informing the Public, August 1945 The Manhattan Engineer District, 1945-1946 First Steps toward International Control, 1944-1945 Search for a Policy on International Control, 1945 ...

  9. Global Databases, Office of Scientific and Technical Information, USDOE

    Office of Scientific and Technical Information (OSTI)

    Global Databases OSTI ensures global access to DOE research. OSTI brings the world's research to DOE. Multilingual WorldWideScience.org The Global Science Gateway This gateway gives citizens, researchers, and anyone interested in science the capability to search national science portals from participating nations. Patrons will get the most current information from around the world in fields such as energy, medicine, agriculture, environment, and basic sciences. IEA Energy Technology Data

  10. Databases

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Databases Databases NERSC supports the provisioning of databases to hold large scientific datasets, as part of the science gateways effort. Data-centric science often benefits from database solutions to store scientific data or metadata about data stored in more traditional file formats. Our database offereings are targeted toward large data sets and high performance. Currently we support: MySQL PostgreSQL MongoDB SciDB If you would like to discuss databases at NERSC please fill out this form

  11. SERN Policy and Regulation Database | Open Energy Information

    Open Energy Info (EERE)

    SERN Policy and Regulation Database Jump to: navigation, search Tool Summary Name: SERN Policy and Regulation Database AgencyCompany Organization: Renewable Energy and Energy...

  12. Low Carbon Society (LCS) Database | Open Energy Information

    Open Energy Info (EERE)

    (LCS) Database Jump to: navigation, search Tool Summary LAUNCH TOOL Name: Low Carbon Society (LCS) Database AgencyCompany Organization: LCS-RNet Sector: Energy, Land Focus Area:...

  13. Global Offshore Wind Farms Database | Open Energy Information

    Open Energy Info (EERE)

    Wind Farms Database Jump to: navigation, search Tool Summary LAUNCH TOOL Name: Global Offshore Wind Farms Database Focus Area: Renewable Energy Topics: Deployment Data Website:...

  14. Databases

    Broader source: Energy.gov [DOE]

    DOE has supported the development of several combined heat and power (CHP) and distributed energy databases that have proven to be "go-to" resources for end users. These resources include an...

  15. Smart Grid Request for Information and Public Comments | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Services Technology Development Smart Grid Smart Grid Request for Information and Public Comments Smart Grid Request for Information and Public Comments As part of its ...

  16. Public Informational Materials | Argonne Leadership Computing Facility

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    News & Events Web Articles In the News Upcoming Events Past Events Informational Materials Photo Galleries Public Informational Materials Annual Reports 2015 ALCF Annual Report 2015 ALCF Annual Report March 2016 PDF icon 2015 ALCF Annual Report 2014 ALCF Annual Report 2014 ALCF Annual Report March 2015 PDF icon 2014 ALCF Annual Report 2013 ALCF Annual Report ALCF 2013 Annual Report May 2014 PDF icon 2013 ALCF Annual Report 2012 ALCF Annual Report ALCF 2012 Annual Report July 2013 PDF icon

  17. Gasification Plant Databases

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Plant Databases Welcome to the U. S. Department of Energy, National Energy Technology Laboratory's Gasification Plant Databases Within these databases you will find current publicly available information on proposed projects and projects undergoing construction and initial operation within the United States and worldwide. Currently operating projects are excluded. The data have been compiled here to keep the public informed of the technologies and investments in major industrial coal

  18. Greenhouse Gas Initiative Scenario Database | Open Energy Information

    Open Energy Info (EERE)

    TOOL Name: Greenhouse Gas Initiative Scenario Database AgencyCompany Organization: Science for Global Insight Sector: Climate, Energy, Land Topics: Baseline projection, GHG...

  19. Global Bus Rapid Transit (BRT) Database | Open Energy Information

    Open Energy Info (EERE)

    URI: cleanenergysolutions.orgcontentglobal-bus-rapid-transit-brt-database Language: English Related Tools GIZ Sourcebook Module 4e: Intelligent Transport Systems...

  20. IEA-Electricity Access Database | Open Energy Information

    Open Energy Info (EERE)

    - Energy Access Resource Type: Dataset Website: www.iea.orgweoelectricity.asp Language: English IEA-Electricity Access Database Screenshot References: Electricity Access...

  1. National Carbon Sequestration Database and Geographic Information System (NatCarb)

    SciTech Connect (OSTI)

    Kenneth Nelson; Timothy Carr

    2009-03-31

    This annual and final report describes the results of the multi-year project entitled 'NATional CARBon Sequestration Database and Geographic Information System (NatCarb)' (http://www.natcarb.org). The original project assembled a consortium of five states (Indiana, Illinois, Kansas, Kentucky and Ohio) in the midcontinent of the United States (MIDCARB) to construct an online distributed Relational Database Management System (RDBMS) and Geographic Information System (GIS) covering aspects of carbon dioxide (CO{sub 2}) geologic sequestration. The NatCarb system built on the technology developed in the initial MIDCARB effort. The NatCarb project linked the GIS information of the Regional Carbon Sequestration Partnerships (RCSPs) into a coordinated regional database system consisting of datasets useful to industry, regulators and the public. The project includes access to national databases and GIS layers maintained by the NatCarb group (e.g., brine geochemistry) and publicly accessible servers (e.g., USGS, and Geography Network) into a single system where data are maintained and enhanced at the local level, but are accessed and assembled through a single Web portal to facilitate query, assembly, analysis and display. This project improves the flow of data across servers and increases the amount and quality of available digital data. The purpose of NatCarb is to provide a national view of the carbon capture and storage potential in the U.S. and Canada. The digital spatial database allows users to estimate the amount of CO{sub 2} emitted by sources (such as power plants, refineries and other fossil-fuel-consuming industries) in relation to geologic formations that can provide safe, secure storage sites over long periods of time. The NatCarb project worked to provide all stakeholders with improved online tools for the display and analysis of CO{sub 2} carbon capture and storage data through a single website portal (http://www.natcarb.org/). While the external project is ending, NatCarb will continue as an internal US Department of Energy National Energy Technology Laboratory (NETL) project with the continued cooperation of personnel at both West Virginia University and the Kansas Geological Survey. The successor project will continue to organize and enhance the information about CO{sub 2} sources and developing the technology needed to access, query, analyze, display, and distribute natural resource data critical to carbon management. Data are generated, maintained and enhanced locally at the RCSP level, or at the national level in specialized data warehouses, and assembled, accessed, and analyzed in real-time through a single geoportal. To address the broader needs of a spectrum of users form high-end technical queries to the general public, NatCarb will be moving to an improved and simplified display for the general public using readily available web tools such as Google Earth{trademark} and Google Maps{trademark}. The goal is for NatCarb to expand in terms of technology and areal coverage and remain the premier functional demonstration of distributed data-management systems that cross the boundaries between institutions and geographic areas, and forms the foundation of a functioning carbon cyber-infrastructure. NatCarb provides access to first-order information to evaluate the costs, economic potential and societal issues of CO{sub 2} capture and storage, including public perception and regulatory aspects.

  2. UN-Energy Statistics Database | Open Energy Information

    Open Energy Info (EERE)

    PV, Wind Resource Type: Dataset Website: data.un.orgExplorer.aspx?dEDATA Cost: Free Language: English UN-Energy Statistics Database Screenshot References: UN Data1 "The United...

  3. NREL-LCI Database Project | Open Energy Information

    Open Energy Info (EERE)

    and compare analysis results that are based on similar data collection and analysis methods. NREL-LCI Database Project Screenshot This article is a stub. You can help OpenEI by...

  4. NATIONAL CARBON SEQUESTRATION DATABASE AND GEOGRAPHIC INFORMATION SYSTEM (NATCARB) FORMER TITLE-MIDCONTINENT INTERACTIVE DIGITAL CARBON ATLAS AND RELATIONAL DATABASE (MIDCARB)

    SciTech Connect (OSTI)

    Timothy R. Carr

    2004-07-16

    This annual report describes progress in the third year of the three-year project entitled ''Midcontinent Interactive Digital Carbon Atlas and Relational Database (MIDCARB)''. The project assembled a consortium of five states (Indiana, Illinois, Kansas, Kentucky and Ohio) to construct an online distributed Relational Database Management System (RDBMS) and Geographic Information System (GIS) covering aspects of carbon dioxide (CO{sub 2}) geologic sequestration (http://www.midcarb.org). The system links the five states in the consortium into a coordinated regional database system consisting of datasets useful to industry, regulators and the public. The project has been extended and expanded as a ''NATional CARBon Sequestration Database and Geographic Information System (NATCARB)'' to provide national coverage across the Regional CO{sub 2} Partnerships, which currently cover 40 states (http://www.natcarb.org). Advanced distributed computing solutions link database servers across the five states and other publicly accessible servers (e.g., USGS) into a single system where data is maintained and enhanced at the local level but is accessed and assembled through a single Web portal and can be queried, assembled, analyzed and displayed. This project has improved the flow of data across servers and increased the amount and quality of available digital data. The online tools used in the project have improved in stability and speed in order to provide real-time display and analysis of CO{sub 2} sequestration data. The move away from direct database access to web access through eXtensible Markup Language (XML) has increased stability and security while decreasing management overhead. The MIDCARB viewer has been simplified to provide improved display and organization of the more than 125 layers and data tables that have been generated as part of the project. The MIDCARB project is a functional demonstration of distributed management of data systems that cross the boundaries between institutions and geographic areas. The MIDCARB system addresses CO{sub 2} sequestration and other natural resource issues from sources, sinks and transportation within a spatial database that can be queried online. Visualization of high quality and current data can assist decision makers by providing access to common sets of high quality data in a consistent manner.

  5. State Energy Efficiency Policy Database | Open Energy Information

    Open Energy Info (EERE)

    URI: cleanenergysolutions.orgcontentstate-energy-efficiency-policy-databa Language: English DeploymentPrograms: Public-Private Partnerships Regulations: "Appliance &...

  6. Property:PublicationName | Open Energy Information

    Open Energy Info (EERE)

    publications, such as journal and periodical publications Retrieved from "http:en.openei.orgwindex.php?titleProperty:PublicationName&oldid5930...

  7. Freedom of Information and Privacy Act Database PIA, Idaho Operations...

    Energy Savers [EERE]

    Office More Documents & Publications PIA - Security Clearance Work Tracking and Budget System TRAIN-PIA.pdf Occupational Medicine - Assistant PIA, Idaho National Laboratory...

  8. Oregon Public Utility Commission | Open Energy Information

    Open Energy Info (EERE)

    in bi-weekly public meetings at its headquarters in Salem, and it encourages public involvement in its decisions. The PUC also conducts public hearings on specific issues. The...

  9. Truman Public Utilities Comm | Open Energy Information

    Open Energy Info (EERE)

    Truman Public Utilities Comm Jump to: navigation, search Name: Truman Public Utilities Comm Place: Minnesota Phone Number: 507-776-7951 Website: trumanmn.usutilities Outage...

  10. Hibbing Public Utilities Comm | Open Energy Information

    Open Energy Info (EERE)

    Hibbing Public Utilities Comm Jump to: navigation, search Name: Hibbing Public Utilities Comm Place: Minnesota Website: www.hpuc.com Outage Hotline: 218-262-7720 References: EIA...

  11. Trinity Public Utilities Dist | Open Energy Information

    Open Energy Info (EERE)

    Public Utilities Dist Jump to: navigation, search Name: Trinity Public Utilities Dist Place: California Website: trinitypud.com Outage Hotline: (530) 623-5536 References: EIA Form...

  12. Keewatin Public Utilities | Open Energy Information

    Open Energy Info (EERE)

    Keewatin Public Utilities Jump to: navigation, search Name: Keewatin Public Utilities Place: Minnesota Phone Number: 218-778-6544 Website: www.keewatin.govoffice.comind Outage...

  13. Fairmont Public Utilities Comm | Open Energy Information

    Open Energy Info (EERE)

    Fairmont Public Utilities Comm Jump to: navigation, search Name: Fairmont Public Utilities Comm Place: Minnesota Phone Number: 507-235-6918 Website: fairmont.orgpublic-utilities...

  14. Brainerd Public Utilities | Open Energy Information

    Open Energy Info (EERE)

    Brainerd Public Utilities Jump to: navigation, search Name: Brainerd Public Utilities Abbreviation: BPU Address: 8027 Highland Scenic Rd Place: Brainerd, MN Zip: 56401 Phone...

  15. Shakopee Public Utilities Comm | Open Energy Information

    Open Energy Info (EERE)

    Shakopee Public Utilities Comm Jump to: navigation, search Name: Shakopee Public Utilities Comm Place: Minnesota Website: spucweb.com Outage Hotline: 952-445-1988 References: EIA...

  16. Clarksdale Public Utilities | Open Energy Information

    Open Energy Info (EERE)

    Clarksdale Public Utilities Jump to: navigation, search Name: Clarksdale Public Utilities Place: Mississippi Phone Number: (662) 627-8499 Website: www.clarksdale.com Facebook:...

  17. Aitkin Public Utilities Comm | Open Energy Information

    Open Energy Info (EERE)

    Aitkin Public Utilities Comm Jump to: navigation, search Name: Aitkin Public Utilities Comm Place: Minnesota Phone Number: 763-576-2750 Website: www.anokaelectric.govoffice3.c...

  18. Preston Public Utilities Comm | Open Energy Information

    Open Energy Info (EERE)

    Preston Public Utilities Comm Jump to: navigation, search Name: Preston Public Utilities Comm Place: Minnesota Phone Number: (507) 765-2491 Website: www.prestonmn.orgpuc1.htm...

  19. Raton Public Service Company | Open Energy Information

    Open Energy Info (EERE)

    Raton Public Service Company Jump to: navigation, search Name: Raton Public Service Company Place: New Mexico Phone Number: (575) 445-8723 Outage Hotline: (575) 445-8723...

  20. Southwestern Public Service Company | Open Energy Information

    Open Energy Info (EERE)

    Southwestern Public Service Company Place: AMARILLO, Texas Zip: 79101 Product: Xcel's regulated operating company. References: Southwestern Public Service Company1 This article...

  1. Public Order and Safety | Open Energy Information

    Open Energy Info (EERE)

    Safety Jump to: navigation, search Building Type Public Order and Safety Definition Buildings used for the preservation of law and order or public safety. Sub Categories police...

  2. Category:Buildings Publications | Open Energy Information

    Open Energy Info (EERE)

    navigation, search This category uses the form Buildings Publication. Pages in category "Buildings Publications" The following 2 pages are in this category, out of 2 total. G...

  3. CDC DOGGR Geothermal Publications | Open Energy Information

    Open Energy Info (EERE)

    PublicationsLegal Abstract The California Department of Conservation (CDC) Division of Oil, Gas, and Geothermal Resources (DOGGR) provides publications related to geothermal...

  4. Roosevelt Public Power Dist | Open Energy Information

    Open Energy Info (EERE)

    Public Power Dist Place: Nebraska Phone Number: 308-635-2424 Website: rooseveltppd.com Facebook: https:www.facebook.compagesRoosevelt-Public-Power-District1389888067908873...

  5. It's All About the Data: How the Building Performance Database is Informing

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Decisions on Energy Efficiency | Department of Energy It's All About the Data: How the Building Performance Database is Informing Decisions on Energy Efficiency It's All About the Data: How the Building Performance Database is Informing Decisions on Energy Efficiency August 25, 2015 - 3:54pm Addthis BPD's Explore Tool allows users to filter the BPD to create and save custom peer group datasets based on specific variables including building types, locations, sizes, ages, equipment,

  6. Hawley Public Utilities Comm | Open Energy Information

    Open Energy Info (EERE)

    Hawley Public Utilities Comm Jump to: navigation, search Name: Hawley Public Utilities Comm Place: Minnesota Phone Number: 218-483-3331 or 701-361-8219 or 701-361-4803 Website:...

  7. Adrian Public Utilities Comm | Open Energy Information

    Open Energy Info (EERE)

    Adrian Public Utilities Comm Jump to: navigation, search Name: Adrian Public Utilities Comm Address: 20 Maine Ave Place: Adrian, MN Zip: 56110 Phone Number: 507-483-2680 Website:...

  8. Maine Public Service Co | Open Energy Information

    Open Energy Info (EERE)

    Maine Public Service Co Jump to: navigation, search Name: Maine Public Service Co Place: Maine Phone Number: 207-973-2000 Website: www.emeramaine.com Twitter: @emerame Facebook:...

  9. Utah's Public Notice Website | Open Energy Information

    Open Energy Info (EERE)

    Not Provided DOI Not Provided Check for DOI availability: http:crossref.org Online Internet link for Utah's Public Notice Website Citation Utah.gov. Utah's Public Notice Website...

  10. Category:Public Sectors | Open Energy Information

    Open Energy Info (EERE)

    no pages or media. Retrieved from "http:en.openei.orgwindex.php?titleCategory:PublicSectors&oldid272249" Feedback Contact needs updating Image needs updating...

  11. Colorado Public Utilities Commission | Open Energy Information

    Open Energy Info (EERE)

    CBONDORA1251633139779 Retrieved from "http:en.openei.orgwindex.php?titleColoradoPublicUtilitiesCommission&oldid886925" Feedback Contact needs updating Image needs...

  12. Anadarko Public Works Auth | Open Energy Information

    Open Energy Info (EERE)

    File for 2010 - File1a" Retrieved from "http:en.openei.orgwindex.php?titleAnadarkoPublicWorksAuth&oldid880476" Feedback Contact needs updating Image needs updating...

  13. Melrose Public Utilities | Open Energy Information

    Open Energy Info (EERE)

    File for 2010 - File1a" Retrieved from "http:en.openei.orgwindex.php?titleMelrosePublicUtilities&oldid880788" Feedback Contact needs updating Image needs updating...

  14. Public Notice Applicability Table | Open Energy Information

    Open Energy Info (EERE)

    http:crossref.org Citation Retrieved from "http:en.openei.orgwindex.php?titlePublicNoticeApplicabilityTable&oldid792160" Feedback Contact needs updating Image...

  15. Idaho Public Utilities Commission | Open Energy Information

    Open Energy Info (EERE)

    Commission Jump to: navigation, search Name: Idaho Public Utilities Commission Address: P.O. Box 83720 Place: Boise, ID Zip: 83720 Website: www.puc.idaho.gov Coordinates:...

  16. Olmsted County Public Works | Open Energy Information

    Open Energy Info (EERE)

    Facebook: https:www.facebook.compagesOlmsted-County-Public-Works1536287513256862?refprofile Outage Hotline: 507-328-7070 References: EIA Form EIA-861 Final Data File for...

  17. Wisconsin Public Service Corp | Open Energy Information

    Open Energy Info (EERE)

    Wisconsin Public Service Corp Place: Wisconsin Phone Number: 800-450-7260 Website: www.wisconsinpublicservice.com Twitter: @WPSStorm Outage Hotline: 800-450-7240 Outage Map:...

  18. Nevada Public Utilities Commission | Open Energy Information

    Open Energy Info (EERE)

    Name: Nevada Public Utilities Commission Abbreviation: NPUC Address: Southern Nevada Office, 9075 West Diablo Drive, Suite 250 Place: Las Vegas, Nevada Zip: 89148 Phone Number:...

  19. Clark Public Utilities | Open Energy Information

    Open Energy Info (EERE)

    utility. The company started the Green Lights program to support the development of renewable energy resources in the Northwest. References: Clark Public Utilities1 This...

  20. Oregon Public Health Division | Open Energy Information

    Open Energy Info (EERE)

    Division Jump to: navigation, search Name: Oregon Public Health Division Address: 800 NE Oregon Street, Suite 930 Place: Portland, Oregon Zip: 97232 Phone Number: 971-673-1222...

  1. Public Health and Safety | Open Energy Information

    Open Energy Info (EERE)

    Health and Safety Jump to: navigation, search Retrieved from "http:en.openei.orgwindex.php?titlePublicHealthandSafety&oldid687683" Feedback Contact needs updating Image...

  2. Michigan Public Service Commission | Open Energy Information

    Open Energy Info (EERE)

    of the Michigan Public Service Commission is to grow Michigan's economy and enhance the quality of life of its communities by assuring safe and reliable energy,...

  3. Yarbrough Public School System | Open Energy Information

    Open Energy Info (EERE)

    Status In Service Owner Yarbrough Public School Energy Purchaser NA Location Goodwell OK Coordinates 36.87268, -101.902701 Show Map Loading map... "minzoom":false,"mappings...

  4. Southwestern Public Service Co | Open Energy Information

    Open Energy Info (EERE)

    table contains monthly sales and revenue data for Southwestern Public Service Co (New Mexico). Scroll leftright to see all of the table values. Month RES REV (THOUSAND ) RES...

  5. Hawaii Public Utilities Commission | Open Energy Information

    Open Energy Info (EERE)

    Name: Hawaii Public Utility Commission Address: 465 South King Street 103 Place: Honolulu, Hawaii Zip: 96813 Coordinates: 21.3053513, -157.85857 Show Map Loading map......

  6. Vermont Public Service Board | Open Energy Information

    Open Energy Info (EERE)

    of service, and overall financial management of Vermont's public utilities: cable television, electric, gas, telecommunications, water and large wastewater companies. Retrieved...

  7. Modernizing Public Transport Webinar | Open Energy Information

    Open Energy Info (EERE)

    EMBARQNetworkmodernizing-public-transport-webinar This webinar presents lessons learned from bus reform in Latin America and Asia. References Retrieved from...

  8. PublicGen | Open Energy Information

    Open Energy Info (EERE)

    search Name: PublicGen Place: Asheville, North Carolina Zip: NC 28815 Sector: Hydro, Hydrogen Product: Provider of pre-sales, development stage project management and technical...

  9. Embrittlement Database from the Radiation Safety Information Computational Center

    DOE Data Explorer [Office of Scientific and Technical Information (OSTI)]

    The Embrittlement Data Base (EDB) is a comprehensive collection of data from surveillance capsules of U.S. commercial nuclear power reactors and from experiments in material test reactors. The collected data are contained in either the Power Reactor Embrittlement Data Base (PR-EDB) or the Test Reactor Embrittlement Data Base (TR-EDB). The EDB work includes verification of the quality of the EDB, provision for user-friendly software to access and process the data, exploration and/or confirmation of embrittlement prediction models, provision for rapid investigation of regulatory issues, and provision for the technical bases for voluntary consensus standards or regulatory guides. The EDB is designed for use with a personal computer. The data are collected into "raw data files." Traceability of all data is maintained by including complete references along with the page numbers. External data verification of the PR-EDB is the responsibility of the vendors, who were responsible for the insertion and testing of the materials in the surveillance capsules. Internal verification is accomplished by checking against references and checking for inconsistencies. Examples of information contained in the EDBs are: Charpy data, tensile data, reactor type, irradiation environments, fracture toughness data, instrumented Charpy data, pressure-temperature (P-T) data, chemistry data, and material history. The TR-EDB additionally has annealing Charpy data. The current version of the PR-EDB contains the test results from 269 Charpy capsules irradiated in 101 reactors. These results include 320 plate data points, 123 forging data points, 113 standard reference materials (SRMS) or correlation monitor (CM) points, 244 weld material data points, and 220 heat-affected-zone (HAZ) material data points. Similarly, the TR-EDB contains information for 290 SRM or CM points, 342 plate data points, 165 forging data points, 378 welds, and 55 HAZ materials. [copied from http://rsicc.ornl.gov/RelatedLinks.aspx?t=edb

  10. Los Alamos Field Office Emergency Public Information | National...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Los Alamos Field Office Emergency Public Information DOE NNSA Accident Response Aerial Measuring System (AMS) Atmospheric Release Advisory Capability (ARAC) Accident Response Group ...

  11. Fukushima Daiichi Accident Study Information Portal Quality Assurance Review: Pre-Public Release

    SciTech Connect (OSTI)

    Kurt G. Vedros

    2012-01-01

    This design review compared the current product with the original intent set forth in the initial internet portal design found in the document: Fukushima Daiichi Database Design, Revision 5. The current revision of the Fukushima Daiichi Accident Study Information Portal (FDASIP) is 1.0.21. This revision is one that restricts access for each user based on roles granted by the project administrator. The public access revision is currently on the test server and will be considered in this review as well.

  12. Litchfield Public Utilities | Open Energy Information

    Open Energy Info (EERE)

    to: navigation, search Name: Litchfield Public Utilities Place: Minnesota Website: www.ci.litchfield.mn.us2184P Outage Hotline: (866) 639-6108 References: EIA Form EIA-861...

  13. Butler Public Power District | Open Energy Information

    Open Energy Info (EERE)

    Nebraska Phone Number: 402-367-3081 or 402-367-3082 Website: www.butlerppd.com Facebook: https:www.facebook.compagesButler-Public-Power-District176407425708968 Outage...

  14. Southwest Public Power Dist | Open Energy Information

    Open Energy Info (EERE)

    Public Power Dist Place: Nebraska Phone Number: (308)285-3295 Website: www.swppd.com Twitter: @SWPPD Facebook: https:www.facebook.comSWPPD Outage Hotline: (800)379-7977...

  15. Form:Buildings Publication | Open Energy Information

    Open Energy Info (EERE)

    name already exists, you will be sent to a form to edit that page. Create or edit Retrieved from "http:en.openei.orgwindex.php?titleForm:BuildingsPublication&oldid270103...

  16. Butler Public Power District | Open Energy Information

    Open Energy Info (EERE)

    Butler County Rural P P D) Jump to: navigation, search Name: Butler Public Power District Place: Nebraska Phone Number: 402-367-3081 or 402-367-3082 Website: www.butlerppd.com...

  17. California Public Utilities Act | Open Energy Information

    Open Energy Info (EERE)

    search OpenEI Reference LibraryAdd to library Legal Document- StatuteStatute: California Public Utilities ActLegal Published NA Year Signed or Took Effect 2014 Legal...

  18. Rochester Public Utilities | Open Energy Information

    Open Energy Info (EERE)

    hesterpublicutilities Outage Hotline: 5072809191 Outage Map: www.rpu.orgcontact-uspower-o References: EIA Form EIA-861 Final Data File for 2010 - File1a1 Energy Information...

  19. Information Center Complex publications and presentations, 1971-1980

    SciTech Connect (OSTI)

    Gill, A.B.; Hawthorne, S.W.

    1981-08-01

    This indexed bibliography lists publications and presentations of the Information Center Complex, Information Division, Oak Ridge National Laboratory, from 1971 through 1980. The 659 entries cover such topics as toxicology, air and water pollution, management and transportation of hazardous wastes, energy resources and conservation, and information science. Publications range in length from 1 page to 3502 pages and include topical reports, books, journal articles, fact sheets, and newsletters. Author, title, and group indexes are provided. Annual updates are planned.

  20. DOE to Hold Public Information Meetings On Proposed Permit Modification

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    December 14, 2000 - The public is invited to comment on a proposed modification to the Hazardous Waste Facility Permit for the Waste Isolation Pilot Plant (WIPP). Submittal of the proposed modification to the New Mexico Environment Department (NMED) by the U.S. Department of Energy (DOE) begins a formal review process that includes a 60-day public comment period and two separate public information meetings next month. In its request, DOE proposes to modify requirements for Drum Age Criteria

  1. DOE to Hold Public Information Meetings On Proposed Permit Modification

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    July 26, 2000 - The public is invited to comment on a proposed modification to the Hazardous Waste Facility Permit for the Waste Isolation Pilot Plant (WIPP). Submittal of the proposed modification to the New Mexico Environment Department (NMED) by the U.S. Department of Energy (DOE) begins a formal review process that includes a 60-day public comment period and two separate public information meetings. In its request, DOE proposes to increase the aboveground storage capacity at WIPP by 25

  2. DOE to Hold Public Information Meetings On Proposed Permit Modification

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Meeting On Proposed Permit Modification CARLSBAD, N.M., January 31, 2001 - The public is invited to comment on a proposed modification to the Hazardous Waste Facility Permit for the Waste Isolation Pilot Plant (WIPP). Submittal of the proposed modification to the New Mexico Environment Department (NMED) by the U.S. Department of Energy (DOE) begins a formal review process that includes a 60-day public comment period and a public information meeting. In its request, DOE proposes alternative

  3. DOE to Hold Public Information Meetings on Permit Modifications

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Meetings On Permit Modifications CARLSBAD, N.M., May 8, 2001 - The public is invited to comment on two proposed modifications to the Hazardous Waste Facility Permit for the Waste Isolation Pilot Plant (WIPP). Submittal of the proposed modifications to the New Mexico Environment Department (NMED) by the U.S. Department of Energy (DOE) begins a formal review process that includes a 60-day public comment period and two separate public information meetings. The proposed modifications would support

  4. DOE to Hold Public Information Meetings on Requested Permit Modifications

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Requested Permit Modifications CARLSBAD, N.M., March 15, 2001 -- The public is invited to comment on requested modifications to the Hazardous Waste Facility Permit for the Waste Isolation Pilot Plant (WIPP). Submittal of the proposed modification request to the New Mexico Environment Department (NMED) by the U.S. Department of Energy (DOE) begins a formal review process that includes a 60-day public comment period and public information meetings. In its submittal, DOE requests five permit

  5. Creating a Public Web Database about High Performance (Green) Buildings: Preprint

    SciTech Connect (OSTI)

    Crawley, D. B.; Torcellini, P.; Malin, N.

    2003-06-01

    Preprint of conference paper about the DOEs High Performance Buildings Database to be presented at the ASHRAE Conference in Scotland in September 2003.

  6. Database application for input and review of information on analytical measurements

    SciTech Connect (OSTI)

    Narayanan, U.I.; Spaletto, M.I.; Baran, D.T.; Stiffin, A.V.; Dallmann, E.

    1995-03-01

    An Analytical Measurements Information Database Application was developed to give an overall view of the criteria involved in the selection of an analytical measurement technique. This specific database application was developed for the measurement of elemental concentration of uranium. It includes information on many components of each measurement technique and allows easy comparison of different techniques. The integrated data information for the methods contained in this program include the specific technique, expected precision and bias, materials applicability, interferences, analysis time, reagents needed, training time, instrumentation required and its associated costs, and resulting process streams. Process stream information may be used to determine the method of preference based on pollution prevention opportunities. Use of this information also serves as an up-front indication of the types of waste generated when different analytical methods are implemented. Most sites, through pollution prevention programs and departmental mandates, are required to generate annual waste forecasts. The use of the process stream information greatly reduces the difficulty of predicting waste generation rates for different analytical methods, while the accuracy of such predictions is substantially increased.

  7. The challenge of information access

    SciTech Connect (OSTI)

    Travers, L.A.

    1990-12-31

    Traditional methods of risk communication may not work for large quantities of information. Federal databases are being created to meet the public`s right-to-know.

  8. WINDExchange: Publications

    Wind Powering America (EERE)

    Information Resources Printable Version Bookmark and Share Publications Webinars Podcasts Economic Development Studies Wind Turbine Ordinances Awards Publications This page lists all of the publications referenced on the WINDExchange initiative's website. Search the WINDExchange Database Choose a Subject Category All Agricultural Public Power Schools Small Wind Economic Development Policy Start Search Clear Search Filtered by: Publication Date State Program Area Title 4/28/2016 U.S. Wind

  9. Nucleic Acid Database: a Repository of Three-Dimensional Information about Nucleic Acids

    DOE Data Explorer [Office of Scientific and Technical Information (OSTI)]

    Berman, H. M.; Olson, W. K.; Beveridge, D. L.; Westbrook, J.; Gelbin, A.; Demeny, T.; Hsieh, S. H.; Srinivasan, A. R.; Schneider, B.

    The Nucleic Acid Database (NDB) provides 3-D structural information about nucleic acids. It is a relational database designed to facilitate the easy search for nucleic acid structures using any of the stored primary or derived structural features. Reports can then be created describing any properties of the selected structures and structures may be viewed in several different formats, including the mmCIF format, the NDB Atlas format, the NDB coordinate format, or the PDB coordinate format. Browsing structure images created directly from coordinates in the repository can also be done. More than 7000 structures have been released as of May 2014. This website also includes a number of specialized tools and interfaces. The NDB Project is funded by the National Institutes of Health and has been funded by the National Science Foundation and the Department of Energy in the past.

  10. Nucleic Acid Database: a Repository of Three-Dimensional Information about Nucleic Acids

    DOE Data Explorer [Office of Scientific and Technical Information (OSTI)]

    Berman, H. M.; Olson, W. K.; Beveridge, D. L.; Westbrook, J.; Gelbin, A.; Demeny, T.; Hsieh, S. H.; Srinivasan, A. R.; Schneider, B.

    The Nucleic Acid Database (NDB) provides 3-D structural information about nucleic acids.  It is a relational database designed to facilitate the easy search for nucleic acid structures using any of the stored primary or derived structural features. Reports can then be created describing any properties of the selected structures and structures may be viewed in several different formats, including the mmCIF format, the NDB Atlas format, the NDB coordinate format, or the PDB coordinate format. Browsing structure images created directly from coordinates in the repository can also be done. More than 7000 structures have been released as of May 2014. This website also includes a number of specialized tools and interfaces. The NDB Project is funded by the National Institutes of Health and has been funded by the National Science Foundation and the Department of Energy in the past.

  11. NREL: Renewable Resource Data Center - Geothermal Resource Publications

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Publications For a list of Geothermal publications, go to Geothermal Technologies Publication page. For a list of legacy Geothermal publications, check out Geothermal Technologies Legacy Collection. NREL Publications Database For a comprehensive list of other NREL geothermal resource publications, explore NREL's Publications Database. When searching the database, search on "geothermal resources". Printable Version RReDC Home Biomass Resource Information Geothermal Resource Information

  12. Information flow in the DAMA Project beyond database managers: Information flow managers

    SciTech Connect (OSTI)

    Russell, L.; Wolfson, O.; Yu, C.

    1996-03-01

    To meet the demands of commercial data traffic on the information highway, a new look at managing data is necessary. One projected activity, sharing of point-of-sale information, is being considered in the Demand Activated Manufacturing Project of the American Textile Partnership project. A scenario is examined in which 100,000 retail outlets communicate over a period of days. They provide the latest estimate of demand for sewn products across a chain of 26,000 suppliers through the use of bill-of-materials explosions at four levels of detail. A new paradign the information flow manager, is developed to handle this situation, including the case where members of the supply chain fail to communicate and go out of business. Techniques for approximation are introduced to keep estimates of demand as current as possible.

  13. Buildings Database

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Energy Efficiency & Renewable Energy EERE Home | Programs & Offices | Consumer Information Buildings Database Welcome Guest Log In | Register | Contact Us Home About All Projects...

  14. Scientific and Technical Information Publications FAQs | The Ames

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Laboratory Scientific and Technical Information Publications FAQs What is an Accepted Manuscript? It is a version of the article that has been accepted for publication by a publisher includes changes made by the author during the peer-review process. This is called the final peer-reviewed accepted manuscript. It includes the same content as the published article in the journal but does not include the publisher's form or format. Why do I have to submit my Final Accepted Manuscript? In

  15. Public information circular for shipments of irradiated reactor fuel

    SciTech Connect (OSTI)

    1996-07-01

    This circular provides information on shipment of spent fuel subject to regulation by US NRC. It provides a brief description of spent fuel shipment safety and safeguards requirement of general interest, a summary of data for 1979-1995 highway and railway shipments, and a listing, by State, of recent highway and railway shipment routes. The enclosed route information reflects specific NRC approvals that have been granted in response to requests for shipments of spent fuel. This publication does not constitute authority for carriers or other persons to use the routes described to ship spent fuel, other categories of nuclear waste, or other materials.

  16. Marine and Hydrokinetic (MHK) Databases and Systems Fact Sheet | Department

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    of Energy (MHK) Databases and Systems Fact Sheet Marine and Hydrokinetic (MHK) Databases and Systems Fact Sheet The following online information resources are designed to provide the public access to information pertaining to MHK technologies, projects, and research. PDF icon Marine and Hydrokinetic (MHK) Databases and Systems Fact Sheet More Documents & Publications Before the Subcommittee on Water and Power - Senate Committee on Energy and Natural Resourses Categorizing and Evaluating

  17. ARTI Refrigerant Database

    SciTech Connect (OSTI)

    Calm, J.M.

    1992-04-30

    The Refrigerant Database consolidates and facilitates access to information to assist industry in developing equipment using alternative refrigerants. The underlying purpose is to accelerate phase out of chemical compounds of environmental concern. The database provides bibliographic citations and abstracts for publications that may be useful in research and design of air- conditioning and refrigeration equipment. The complete documents are not included, though some may be added at a later date. The database identifies sources of specific information on R-32, R-123, R-124, R- 125, R-134a, R-141b, R142b, R-143a, R-152a, R-290 (propane), R-717 (ammonia), ethers, and others as well as azeotropic and zeotropic blends of these fluids. It addresses polyalkylene glycol (PAG), ester, and other lubricants. It also references documents addressing compatibility of refrigerants and lubricants with metals, plastics, elastomers, motor insulation, and other materials used in refrigerant circuits.

  18. OpenEI:Projects/Public Resources | Open Energy Information

    Open Energy Info (EERE)

    By Entity By County By Planning Area Completed:TAW California Energy Commission oil and gas Weekly Database for Refinery Production and Output http:energyalmanac.ca.gov...

  19. Invitation for Public Comment to Inform the Design of a Consent...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Invitation for Public Comment to Inform the Design of a Consent-Based Siting Process Invitation for Public Comment to Inform the Design of a Consent-Based Siting Process As part of ...

  20. Public Utility Commission of Texas | Open Energy Information

    Open Energy Info (EERE)

    Public Utility Commission of Texas Name: Public Utility Commission of Texas Address: 1701 N. Congress Avenue Place: Austin, Texas Zip: 78701 Year Founded: 1975 Website:...

  1. Utah Division of Public Utilities | Open Energy Information

    Open Energy Info (EERE)

    Salt Lake City, Utah. The Division of Public Utilities, makes recommendations to the Utah Public Service Commission for rate-making purposes, applications, hearings and other...

  2. Arizona Public Service Company APS | Open Energy Information

    Open Energy Info (EERE)

    Public Service Company APS Jump to: navigation, search Name: Arizona Public Service Company (APS) Place: Phoenix, Arizona Zip: 85004 Product: Generates, transmits and distributes...

  3. New Mexico Public Regulation Commission | Open Energy Information

    Open Energy Info (EERE)

    Public Regulation Commission Name: New Mexico Public Regulation Commission Address: 33 Plaza La Prensa Place: Santa Fe, New Mexico Zip: 87507 Website: www.nmprc.state.nm.us...

  4. The UNEP-SEFI Public Finance Alliance | Open Energy Information

    Open Energy Info (EERE)

    platform for managers of public and publicly backed funds dedicated to building sustainable energy markets AgencyCompany Organization United Nations Environment...

  5. ARM Publications Database

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    ... Sites: ARM Instruments: Data Products: AMF - Black Forest, ... (PYE) AMF - Shouxian, China (HFE) AMF - Steamboat ... (ASSIST) Automatic Weather Station (MAWS) ...

  6. databases | netl.doe.gov

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    The database is available in Microsoft Access 2002 format. Download 6.35 MB COA Database Heavy Oil Database: 2004. The Heavy Oil Database contains information on over 500 ...

  7. Vermont Public Service Board Rule | Open Energy Information

    Open Energy Info (EERE)

    Public Service Board Rule Jump to: navigation, search OpenEI Reference LibraryAdd to library Legal Document- RegulationRegulation: Vermont Public Service Board RuleLegal Abstract...

  8. ARS 40 - Public Utilities and Carriers | Open Energy Information

    Open Energy Info (EERE)

    StatuteStatute: ARS 40 - Public Utilities and CarriersLegal Abstract This title sets forth the statutes for public utilities and carriers in Arizona. Published NA Year Signed...

  9. M S R Public Power Agency | Open Energy Information

    Open Energy Info (EERE)

    R Public Power Agency Jump to: navigation, search Name: M-S-R Public Power Agency Place: Modesto, California Sector: Wind energy Product: Modesto, California-based joint powers...

  10. Method and system for normalizing biometric variations to authenticate users from a public database and that ensures individual biometric data privacy

    DOE Patents [OSTI]

    Strait, Robert S.; Pearson, Peter K.; Sengupta, Sailes K.

    2000-01-01

    A password system comprises a set of codewords spaced apart from one another by a Hamming distance (HD) that exceeds twice the variability that can be projected for a series of biometric measurements for a particular individual and that is less than the HD that can be encountered between two individuals. To enroll an individual, a biometric measurement is taken and exclusive-ORed with a random codeword to produce a "reference value." To verify the individual later, a biometric measurement is taken and exclusive-ORed with the reference value to reproduce the original random codeword or its approximation. If the reproduced value is not a codeword, the nearest codeword to it is found, and the bits that were corrected to produce the codeword to it is found, and the bits that were corrected to produce the codeword are also toggled in the biometric measurement taken and the codeword generated during enrollment. The correction scheme can be implemented by any conventional error correction code such as Reed-Muller code R(m,n). In the implementation using a hand geometry device an R(2,5) code has been used in this invention. Such codeword and biometric measurement can then be used to see if the individual is an authorized user. Conventional Diffie-Hellman public key encryption schemes and hashing procedures can then be used to secure the communications lines carrying the biometric information and to secure the database of authorized users.

  11. Benchmarking Database - JCAP

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    ©bobpaz.com0121.JPG Benchmarking Database Research Why Solar Fuels Goals & Objectives Thrust 1 Thrust 2 Thrust 3 Thrust 4 Publications Research Highlights Videos Innovations User Facilities Expert Team Benchmarking Database Device Simulation Tool XPS Spectral Database Research Introduction Why Solar Fuels? Goals & Objectives Thrusts Thrust 1 Thrust 2 Thrust 3 Thrust 4 Library Publications Research Highlights Videos Resources User Facilities Expert Team Benchmarking Database Device

  12. Federal Awardee Performance and Integrity Information System (FAPIIS) – Public Access

    Broader source: Energy.gov [DOE]

    On April 15, 2011, the public side of the Federal Awardee Performance and Integrity Information System (FAPIIS) website was launched. This means that information posted to FAPIIS on and after this date, with the exception of past performance reviews, will be accessible by the public. Public access to information posted to FAPIIS prior to April 15, 2011, will be subject to the Freedom of Information Act (FOIA) process. (See paragraph (b)(3) of 52.209-9, Updates of Publicly Available Information Regarding Responsibility Matters (JAN 2011)).

  13. Publications

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Publications JLF Science Publications JLF Facility-related Publications JLF Highlights

  14. ARTI refrigerant database

    SciTech Connect (OSTI)

    Calm, J.M.

    1998-08-01

    The Refrigerant Database is an information system on alternative refrigerants, associated lubricants, and their use in air conditioning and refrigeration. It consolidates and facilitates access to property, compatibility, environmental, safety, application and other information. It provides corresponding information on older refrigerants, to assist manufactures and those using alternative refrigerants, to make comparisons and determine differences. The underlying purpose is to accelerate phase out of chemical compounds of environmental concern. The database provides bibliographic citations and abstracts for publications that may be useful in research and design of air-conditioning and refrigeration equipment. The complete documents are not included, though some may be added at a later date. The database identifies sources of specific information on many refrigerants including propane, ammonia, water, carbon dioxide, propylene, ethers, and others as well as azeotropic and zeotropic blends of these fluids. It addresses lubricants including alkylbenzene, polyalkylene glycol, polyolester, and other synthetics as well as mineral oils. It also references documents addressing compatibility of refrigerants and lubricants with metals, plastics, elastomers, motor insulation, and other materials used in refrigerant circuits. Incomplete citations or abstracts are provided for some documents. They are included to accelerate availability of the information and will be completed or replaced in future updates.

  15. ARTI refrigerant database

    SciTech Connect (OSTI)

    Calm, J.M.

    1997-02-01

    The Refrigerant Database is an information system on alternative refrigerants, associated lubricants, and their use in air conditioning and refrigeration. It consolidates and facilitates access to property, compatibility, environmental, safety, application and other information. It provides corresponding information on older refrigerants, to assist manufacturers and those using alterative refrigerants, to make comparisons and determine differences. The underlying purpose is to accelerate phase out of chemical compounds of environmental concern. The database provides bibliographic citations and abstracts for publications that may be useful in research and design of air-conditioning and refrigeration equipment. The complete documents are not included, though some may be added at a later date. The database identifies sources of specific information on various refrigerants. It addresses lubricants including alkylbenzene, polyalkylene glycol, polyolester, and other synthetics as well as mineral oils. It also references documents addressing compatibility of refrigerants and lubricants with metals, plastics, elastomers, motor insulation, and other materials used in refrigerant circuits. Incomplete citations or abstracts are provided for some documents. They are included to accelerate availability of the information and will be completed or replaced in future updates.

  16. Texas - PUC - Public Utility Regulatory Act | Open Energy Information

    Open Energy Info (EERE)

    Act (2011). Retrieved from "http:en.openei.orgwindex.php?titleTexas-PUC-PublicUtilityRegulatoryAct&oldid800942" Feedback Contact needs updating Image needs...

  17. Idaho IS 61 Public Utility Regulation | Open Energy Information

    Open Energy Info (EERE)

    Regulation (2013). Retrieved from "http:en.openei.orgwindex.php?titleIdahoIS61PublicUtilityRegulation&oldid722586" Feedback Contact needs updating Image needs...

  18. Public Utilities Commission of Nevada | Open Energy Information

    Open Energy Info (EERE)

    Craig McDonnell 775.684.6149 Retrieved from "http:en.openei.orgwindex.php?titlePublicUtilitiesCommissionofNevada&oldid886985" Feedback Contact needs updating...

  19. Title 33 CFR 327 Public Hearings | Open Energy Information

    Open Energy Info (EERE)

    Hearings (2014). Retrieved from "http:en.openei.orgwindex.php?titleTitle33CFR327PublicHearings&oldid890311" Feedback Contact needs updating Image needs updating...

  20. Auburn Board of Public Works | Open Energy Information

    Open Energy Info (EERE)

    2010 - File1a" Retrieved from "http:en.openei.orgwindex.php?titleAuburnBoardofPublicWorks&oldid879873" Feedback Contact needs updating Image needs updating...

  1. Public Utility Regulatory Act - Texas | Open Energy Information

    Open Energy Info (EERE)

    http:crossref.org Citation Retrieved from "http:en.openei.orgwindex.php?titlePublicUtilityRegulatoryAct-Texas&oldid792167" Feedback Contact needs updating...

  2. Public Power & Utility, Inc. (Pennsylvania) | Open Energy Information

    Open Energy Info (EERE)

    Data File for 2010 - File22010" Retrieved from "http:en.openei.orgwindex.php?titlePublicPower%26Utility,Inc.(Pennsylvania)&oldid882382" Feedback Contact needs...

  3. Public Service Commission of Wisconsin | Open Energy Information

    Open Energy Info (EERE)

    Commission of Wisconsin Jump to: navigation, search Name: Public Service Commission of Wisconsin Address: 610 North Whitney Way Place: Madison, Wisconsin Zip: 53707-7854 Phone...

  4. Public Service Enterprise Group PSEG | Open Energy Information

    Open Energy Info (EERE)

    Enterprise Group PSEG Jump to: navigation, search Name: Public Service Enterprise Group (PSEG) Place: Newark, New Jersey Zip: 7102 Sector: Services Product: New Jersey-based...

  5. Public Service Elec & Gas Co | Open Energy Information

    Open Energy Info (EERE)

    Elec & Gas Co (Redirected from PSEG) Jump to: navigation, search Name: Public Service Elec & Gas Co Abbreviation: PSEG Place: New Jersey Year Founded: 1903 Phone Number:...

  6. Utah Public Lands Policy Coordination Office | Open Energy Information

    Open Energy Info (EERE)

    Lands Policy Coordination Office Jump to: navigation, search Name: Governor's Public Lands Policy Coordination Office Address: 5110 State Office Building Place: Salt Lake City,...

  7. Energy Standards for Public Buildings | Open Energy Information

    Open Energy Info (EERE)

    Comprehensive MeasuresWhole Building CHPCogeneration Yes Life-Cycle Analysis and Energy Efficiency in State Buildings (Missouri) Energy Standards for Public Buildings Missouri...

  8. Vermont Department of Public Service | Open Energy Information

    Open Energy Info (EERE)

    navigation, search Name: Vermont Department of Public Service Address: 112 State Street Third Floor Place: Montpelier, Vermont Country: United States Zip: 05620-2601 Phone...

  9. 2011 APTA Public Transportation Fact Book | Open Energy Information

    Open Energy Info (EERE)

    Area: Transportation Resource Type: Publications Website: www.apta.comresourcesstatisticsDocumentsFactBookAPTA2011FactBo Country: United States Cost: Free Northern...

  10. Vermont Public Pwr Supply Auth | Open Energy Information

    Open Energy Info (EERE)

    Website: www.vppsa.com Facebook: https:www.facebook.compagesVermont-Public-Power-Supply-Authority Outage Hotline: 802-244-7678 Outage Map: vtoutages.com...

  11. Grand Rapids Public Util Comm | Open Energy Information

    Open Energy Info (EERE)

    https:www.facebook.compagesGrand-Rapids-Public-Utilities108782819203449?skwall Outage Hotline: 218-326-4806 References: EIA Form EIA-861 Final Data File for 2010 -...

  12. RAPID/Best Practices/Public Involvement | Open Energy Information

    Open Energy Info (EERE)

    - use a broad range of communication tools, including public meetings, a project website, social media accounts, press releases, advertisements in local newspapers and...

  13. Property:Relevant Technical Publications | Open Energy Information

    Open Energy Info (EERE)

    Technical Publications" Showing 11 pages using this property. M MHK TechnologiesDeep Water Pipelines + http:journals.tdl.orgicceindex.phpiccearticleviewFile44034084...

  14. Oregon Water Rights Public Notice Webpage | Open Energy Information

    Open Energy Info (EERE)

    Jump to: navigation, search OpenEI Reference LibraryAdd to library Web Site: Oregon Water Rights Public Notice Webpage Abstract Provides access to Oregon Water Resources...

  15. Resources for global risk assessment: The International Toxicity Estimates for Risk (ITER) and Risk Information Exchange (RiskIE) databases

    SciTech Connect (OSTI)

    Wullenweber, Andrea Kroner, Oliver; Kohrman, Melissa; Maier, Andrew; Dourson, Michael; Rak, Andrew; Wexler, Philip; Tomljanovic, Chuck

    2008-11-15

    The rate of chemical synthesis and use has outpaced the development of risk values and the resolution of risk assessment methodology questions. In addition, available risk values derived by different organizations may vary due to scientific judgments, mission of the organization, or use of more recently published data. Further, each organization derives values for a unique chemical list so it can be challenging to locate data on a given chemical. Two Internet resources are available to address these issues. First, the International Toxicity Estimates for Risk (ITER) database ( (www.tera.org/iter)) provides chronic human health risk assessment data from a variety of organizations worldwide in a side-by-side format, explains differences in risk values derived by different organizations, and links directly to each organization's website for more detailed information. It is also the only database that includes risk information from independent parties whose risk values have undergone independent peer review. Second, the Risk Information Exchange (RiskIE) is a database of in progress chemical risk assessment work, and includes non-chemical information related to human health risk assessment, such as training modules, white papers and risk documents. RiskIE is available at (http://www.allianceforrisk.org/RiskIE.htm), and will join ITER on National Library of Medicine's TOXNET ( (http://toxnet.nlm.nih.gov/)). Together, ITER and RiskIE provide risk assessors essential tools for easily identifying and comparing available risk data, for sharing in progress assessments, and for enhancing interaction among risk assessment groups to decrease duplication of effort and to harmonize risk assessment procedures across organizations.

  16. Public Service Enterprise Group (PSE&G) | Open Energy Information

    Open Energy Info (EERE)

    Group (PSE&G) Jump to: navigation, search Name: Public Service Enterprise Group (PSE&G) Address: 80 Park Plaza Place: Newark, New Jersey Zip: 07102 Region: Northeast - NY NJ CT PA...

  17. Public Utility District No 1 | Open Energy Information

    Open Energy Info (EERE)

    Data File for 2010 - File1a" Retrieved from "http:en.openei.orgwindex.php?titlePublicUtilityDistrictNo1&oldid883990" Feedback Contact needs updating Image needs...

  18. TNRC 33 - Management of Coastal Public Land | Open Energy Information

    Open Energy Info (EERE)

    33 - Management of Coastal Public Land Jump to: navigation, search OpenEI Reference LibraryAdd to library Legal Document- RegulationRegulation: TNRC 33 - Management of Coastal...

  19. Public Service Elec & Gas Co | Open Energy Information

    Open Energy Info (EERE)

    Elec & Gas Co Jump to: navigation, search Name: Public Service Elec & Gas Co Abbreviation: PSEG Place: New Jersey Year Founded: 1903 Phone Number: 1-800-436-7734 Website:...

  20. New Ulm Public Utilities Comm | Open Energy Information

    Open Energy Info (EERE)

    New Ulm Public Utilities Comm Place: Minnesota Phone Number: (507) 359-8264 Website: www.ci.new-ulm.mn.usindex.asp Facebook: https:www.facebook.compagesCity-of-New-UlmNew-Ulm-...

  1. Property:Buildings/PublicationName | Open Energy Information

    Open Energy Info (EERE)

    Jump to: navigation, search This is a property of type String. Pages using the property "BuildingsPublicationName" Showing 2 pages using this property. G General Merchandise 50%...

  2. Property:Buildings/PublicationURL | Open Energy Information

    Open Energy Info (EERE)

    Jump to: navigation, search This is a property of type URL. Pages using the property "BuildingsPublicationURL" Showing 2 pages using this property. G General Merchandise 50%...

  3. Property:Buildings/PublicationType | Open Energy Information

    Open Energy Info (EERE)

    Jump to: navigation, search This is a property of type String. Pages using the property "BuildingsPublicationType" Showing 2 pages using this property. G General Merchandise 50%...

  4. Property:Buildings/PublicationYear | Open Energy Information

    Open Energy Info (EERE)

    Jump to: navigation, search This is a property of type Date. Pages using the property "BuildingsPublicationYear" Showing 2 pages using this property. G General Merchandise 50%...

  5. DOE Launches Public Website for Energy Technology Information...

    Energy Savers [EERE]

    DOE has unveiled Open Energy Information, an open-source Web platform that will make DOE ... Information Bridge to Energy (VIBE), which serves up Web gadgets that display energy data. ...

  6. Public Comments on the Request for Information on Rapid Response...

    Office of Environmental Management (EM)

    Notice seeking information on questions related to permitting of transmission lines. ... wide array of processes and procedural requirements in order to obtain all necessary ...

  7. Publications

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Los Alamos Reports Los Alamos Reports Unless identified as SRD (Secret Restricted Data), these reports are available to the public from the National Technical Information Service, Springfield, VA. Contact Institute Director Charles Farrar (505) 663-5330 Email UCSD EI Director Michael Todd (858) 534-5951 Professional Staff Assistant Ellie Vigil (505) 667-2818 Email Administrative Assistant Rebecca Duran (505) 665-8899 Email Los Alamos Reports E. Figueiredo, G. Park, J. Figueiras, C. R. Farrar,

  8. ARTI Refrigerant Database

    SciTech Connect (OSTI)

    Cain, J.M.

    1993-04-30

    The Refrigerant Database consolidates and facilitates access to information to assist industry in developing equipment using alternative refrigerants. The underlying purpose is to accelerate phase out of chemical compounds of environmental concern. The database provides bibliographic citations and abstracts for publications that may be useful in research and design of air-conditioning and refrigeration equipment. The complete documents are not included. The database identifies sources of specific information on R-32, R-123, R-124, R-125, R-134, R-134a, R-141b, R-142b, R-143a, R-152a, R-245ca, R-290 (propane), R-717 (ammonia), ethers, and others as well as azeotropic and zeotropic blends of these fluids. It addresses lubricants including alkylbenzene, polyalkylene glycol, ester, and other synthetics as well as mineral oils. It also references documents addressing compatibility of refrigerants and lubricants with metals, plastics, elastomers, motor insulation, and other materials used in refrigerant circuits. Incomplete citations or abstracts are provided for some documents to accelerate availability of the information and will be completed or replaced in future updates.

  9. Carbon Capture and Storage Database (CCS) from DOE's National Energy Technology Laboratory (NETL)

    DOE Data Explorer [Office of Scientific and Technical Information (OSTI)]

    NETL's Carbon Capture and Storage (CCS) Database includes active, proposed, canceled, and terminated CCS projects worldwide. Information in the database regarding technologies being developed for capture, evaluation of sites for carbon dioxide (CO2) storage, estimation of project costs, and anticipated dates of completion is sourced from publically available information. The CCS Database provides the public with information regarding efforts by various industries, public groups, and governments towards development and eventual deployment of CCS technology. The database contains more than 260 CCS projects worldwide in more than 30 countries across 6 continents. Access to the database requires use of Google Earth, as the NETL CCS database is a layer in Google Earth. Or, users can download a copy of the database in MS-Excel directly from the NETL website.

  10. ARTI Refrigerant Database

    SciTech Connect (OSTI)

    Calm, J.M.

    1992-11-09

    The database provides bibliographic citations and abstracts for publications that may be useful in research and design of air- conditioning and refrigeration equipment. The database identifies sources of specific information on R-32, R-123, R-124, R-125, R-134, R-134a, R-141b, R-142b, R-143a, R-152a, R-245ca, R-290 (propane), R- 717 (ammonia), ethers, and others as well as azeotropic and zeotropic and zeotropic blends of these fluids. It addresses lubricants including alkylbenzene, polyalkylene glycol, ester, and other synthetics as well as mineral oils. It also references documents on compatibility of refrigerants and lubricants with metals, plastics, elastomers, motor insulation, and other materials used in refrigerant circuits. A computerized version is available that includes retrieval software.

  11. Building Performance Database

    Broader source: Energy.gov [DOE]

    The Building Performance Database (BPD) unlocks the power of building data by providing access to the largest publicly-available dataset of information about the physical and operational characteristics of real buildings. The BPD enables users to perform statistical analysis on an anonymous dataset of hundreds of thousands of commercial and residential buildings from across the country. Users can examine specific building types and geographic areas, compare performance trends among similar buildings, identify and prioritize cost-saving energy efficiency improvements, and assess the range of likely savings from these improvements.

  12. Database for Regional Geology, Phase 1- A Tool for informing Regional

    Energy Savers [EERE]

    Energy Data-Driven Mailing Helps Heat Up Untapped Seattle Market Data-Driven Mailing Helps Heat Up Untapped Seattle Market Abridged transcript of an interview with Community Power Works Project Manager Ruth Bell and Program/System Analyst Vince Schueler of the Washington State University Energy Program. PDF icon Seattle Focus Series More Documents & Publications The Better Buildings Neighborhood View -- January 2013 howtodesignandmarketenergyefficiencyprogramstospecificneighborhoods.doc

  13. Assembly and comparison of available solar hot water system reliability databases and information.

    SciTech Connect (OSTI)

    Menicucci, David F.

    2009-05-01

    Solar hot water (SHW) systems have been installed commercially for over 30 years, yet few quantitative details are known about their reliability. This report describes a comprehensive analysis of all of the known major previous research and data regarding the reliability of SHW systems and components. Some important conclusions emerged. First, based on a detailed inspection of ten-year-old systems in Florida, about half of active systems can be expected to fail within a ten-year period. Second, valves were identified as the probable cause of a majority of active SHW failures. Third, passive integral and thermosiphon SHW systems have much lower failure rates than active ones, probably due to their simple design that employs few mechanical parts. Fourth, it is probable that the existing data about reliability do not reveal the full extent of fielded system failures because most of the data were based on trouble calls. Often an SHW system owner is not aware of a failure because the backup system silently continues to produce hot water. Thus, a repair event may not be generated in a timely manner, if at all. This final report for the project provides all of the pertinent details about this study, including the source of the data, the techniques to assure their quality before analysis, the organization of the data into perhaps the most comprehensive reliability database in existence, a detailed statistical analysis, and a list of recommendations for additional critical work. Important recommendations include the inclusion of an alarm on SHW systems to identify a failed system, the need for a scientifically designed study to collect high-quality reliability data that will lead to design improvements and lower costs, and accelerated testing of components that are identified as highly problematic.

  14. GOLD: The Genomes Online Database

    DOE Data Explorer [Office of Scientific and Technical Information (OSTI)]

    Kyrpides, Nikos; Liolios, Dinos; Chen, Amy; Tavernarakis, Nektarios; Hugenholtz, Philip; Markowitz, Victor; Bernal, Alex

    Since its inception in 1997, GOLD has continuously monitored genome sequencing projects worldwide and has provided the community with a unique centralized resource that integrates diverse information related to Archaea, Bacteria, Eukaryotic and more recently Metagenomic sequencing projects. As of September 2007, GOLD recorded 639 completed genome projects. These projects have their complete sequence deposited into the public archival sequence databases such as GenBank EMBL,and DDBJ. From the total of 639 complete and published genome projects as of 9/2007, 527 were bacterial, 47 were archaeal and 65 were eukaryotic. In addition to the complete projects, there were 2158 ongoing sequencing projects. 1328 of those were bacterial, 59 archaeal and 771 eukaryotic projects. Two types of metadata are provided by GOLD: (i) project metadata and (ii) organism/environment metadata. GOLD CARD pages for every project are available from the link of every GOLD_STAMP ID. The information in every one of these pages is organized into three tables: (a) Organism information, (b) Genome project information and (c) External links. [The Genomes On Line Database (GOLD) in 2007: Status of genomic and metagenomic projects and their associated metadata, Konstantinos Liolios, Konstantinos Mavromatis, Nektarios Tavernarakis and Nikos C. Kyrpides, Nucleic Acids Research Advance Access published online on November 2, 2007, Nucleic Acids Research, doi:10.1093/nar/gkm884]

    The basic tables in the GOLD database that can be browsed or searched include the following information:

    • Gold Stamp ID
    • Organism name
    • Domain
    • Links to information sources
    • Size and link to a map, when available
    • Chromosome number, Plas number, and GC content
    • A link for downloading the actual genome data
    • Institution that did the sequencing
    • Funding source
    • Database where information resides
    • Publication status and information

    (Specialized Interface)

  15. Emergency Public Information | Y-12 National Security Complex

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Administration Response / Training Emergency Operations Training Academy Rotating image showing pictures of Classroom, Online and Hands on trainings The Office of Emergency Operations, NA-40-The Emergency Operations Training Academy (EOTA) EOTA provides training and education to enhance the readiness of personnel in the radiological-nuclear emergency operations community. For more information or to contact us, visit the EOTA website at: http://eota.energy.gov/ Vision The Emergency Operations

  16. Smart Grid Request for Information and Public Comments

    Broader source: Energy.gov [DOE]

    As part of its ongoing effort regarding the formation of smart grid policy, the Department of Energy issued a Request for Information in September of 2010 on the topic of Addressing Policy and Logistical Challenges to Smart Grid Implementation. The purpose was to solicit comments from interested stakeholders on policy and logistical challenges that confront smart grid implementation, and recommendations on how to best overcome those challenges.

  17. Smart Grid Request for Information and Public Comments

    Broader source: Energy.gov [DOE]

    As part of its ongoing effort regarding the formation of smart grid policy, the Department of Energy issued a Request for Information in September of 2010 on the topic of “Addressing Policy and Logistical Challenges to Smart Grid Implementation.” The purpose was to solicit comments from interested stakeholders on policy and logistical challenges that confront smart grid implementation, and recommendations on how to best overcome those challenges.

  18. SMART GRID Request for Information And Public Comments

    Broader source: Energy.gov [DOE]

    As part of its ongoing effort regarding the formation of smart grid policy, the Department of Energy issued a Request for Information in September of 2010 on the topic of “Addressing Policy and Logistical Challenges to Smart Grid Implementation.” The purpose was to solicit comments from interested stakeholders on policy and logistical challenges that confront smart grid implementation, and recommendations on how to best overcome those challenges.

  19. DOE Makes Public Detailed Information on the BP Oil Spill | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Public Detailed Information on the BP Oil Spill DOE Makes Public Detailed Information on the BP Oil Spill June 8, 2010 - 12:00am Addthis WASHINGTON - As part of the Obama Administration's ongoing commitment to transparency surrounding the response to the BP oil spill, U.S. Energy Secretary Steven Chu announced today that Department is providing online access to schematics, pressure tests, diagnostic results and other data about the malfunctioning blowout preventer. Secretary Chu

  20. Lessons Learned Database

    Broader source: Energy.gov [DOE]

    The DOE Corporate Lessons Learned Database provides a central clearinghouse that allows ready access to and communication about collected information on a timely, unimpeded basis by all DOE...

  1. Find Articles/Databases

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Geology Looking for data? Chemical Data and Structures: SciFinder information CRC Handbook of Chemistry and Physics Protein Data Bank Cambridge Structural Database (and ...

  2. National Residential Efficiency Measures Database

    DOE Data Explorer [Office of Scientific and Technical Information (OSTI)]

    The National Residential Efficiency Measures Database is a publicly available, centralized resource of residential building retrofit measures and costs for the U.S. building industry. With support from the U.S. Department of Energy, NREL developed this tool to help users determine the most cost-effective retrofit measures for improving energy efficiency of existing homes. Software developers who require residential retrofit performance and cost data for applications that evaluate residential efficiency measures are the primary audience for this database. In addition, home performance contractors and manufacturers of residential materials and equipment may find this information useful. The database offers the following types of retrofit measures: 1) Appliances, 2) Domestic Hot Water, 3) Enclosure, 4) Heating, Ventilating, and Air Conditioning (HVAC), 5) Lighting, 6) Miscellaneous.

  3. Buildings Performance Database Overview | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Buildings Performance Database Overview Buildings Performance Database Overview Buildings Performance Database Overview, from the U.S. Department of Energy's Office of Energy Efficiency and Renewable Energy. PDF icon bpd_overview_2014.pdf More Documents & Publications Buildings Performance Database (BPD) - 2014 BTO Peer Review Buildings Performance Database - 2013 BTO Peer Review Data Preparation Process for the Buildings Performance Database

  4. Publications

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    PADSTE » ADTSC » Publications Publications The Theory, Simulation, and Computation Science Highlight publications are available online. Contact Communications Email Covers from research highlight publications Covers from the print version of past Theory, Simulation, and Computation science highlights. All Theory, Simulation, and Computation technical papers, journal articles, and publications other than Science Highlights are available in the Research Library Catalog. Science Highlights 2013

  5. Publications

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    work. Today at Berkeley Lab: : The daily newsletter for our employees and collaborators. Publications.lbl.gov: : Over 75,000 of our laboratory's scientific publications,...

  6. The BABAR Database: Challenges, Trends and Projections (Technical Report) |

    Office of Scientific and Technical Information (OSTI)

    SciTech Connect The BABAR Database: Challenges, Trends and Projections Citation Details In-Document Search Title: The BABAR Database: Challenges, Trends and Projections × You are accessing a document from the Department of Energy's (DOE) SciTech Connect. This site is a product of DOE's Office of Scientific and Technical Information (OSTI) and is provided as a public service. Visit OSTI to utilize additional information resources in energy science and technology. A paper copy of this

  7. Databases | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Databases Databases CORPORATE REPORTING AND SAFETY PERFORMANCE ANALYSIS chart The Office of Environment, Health, Safety and Security (EHSS) manages corporate reporting databases and provides analysis of DOE-wide performance in protecting the public, the workers and the environment while performing the missions of DOE. EHSS manages a number of viable safety indicators applicable to most DOE contractor operations that provide Departmental leadership, line management, and stakeholders with timely

  8. Publications

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Publications Engineering Institute Publications Publications are organized by topic. Contact Institute Director Charles Farrar (505) 663-5330 Email UCSD EI Director Michael Todd (858) 534-5951 Professional Staff Assistant Ellie Vigil (505) 667-2818 Email Administrative Assistant Rebecca Duran (505) 665-8899 Email Model Verification and Validation Sensor and Sensing Technologies Structural Health Monitoring Earthquake Engineering and Structural Dynamics Damage Prognosis Other Publications Book

  9. 2010 Worldwide Gasification Database

    DOE Data Explorer [Office of Scientific and Technical Information (OSTI)]

    The 2010 Worldwide Gasification Database describes the current world gasification industry and identifies near-term planned capacity additions. The database lists gasification projects and includes information (e.g., plant location, number and type of gasifiers, syngas capacity, feedstock, and products). The database reveals that the worldwide gasification capacity has continued to grow for the past several decades and is now at 70,817 megawatts thermal (MWth) of syngas output at 144 operating plants with a total of 412 gasifiers.

  10. Cambridge Structural Database

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Cambridge Structural Database Cambridge Structural Database LANL researchers can access WebCSD from offsite via Remote Access. Question? 667-5809 Email Cambridge Structural Database (CSD) includes bibliographic, chemical, and crystallographic information for organic molecules and metal-organic compounds. The crystal structure data comes from the open literature or direct deposits by researchers. The CSD System incorporations a suite of flexible search and analysis tools. The Research Library

  11. Publications

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Publications /newsroom/_assets/images/newsroom-icon.jpg Publications Los Alamos publications demonstrate the Lab's enduring commitment to researching and applying the best science, engineering and technology in order to meet the challenges facing our country and society in the 21st century. NSS april 2016 1663 NEW ISSUE Nss: April 2016 Welcome to this issue The Hurt-Locker School Explosive Results Questing for the Holy Grail of High Explosives Learning from (Near) Disaster A Safer Liftoff Shake,

  12. Publications

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Publications Publications Official releases of Richard P. Feynman Center for Innovation publications General Inquiries Richard P. Feynman Center for Innovation (505) 665-9090 Email All years denote Fiscal Years. Progress Report FY14 FCI Progress Report 2014 (pdf) 2013 (pdf) 2011-2012 (pdf) 2009-2010 (pdf) 2007-2008 (pdf) 2005-2006 (pdf) 2004 (pdf) outSTANDING innOVATION Awards After 2011, the outSTANDING innOVATION Awards booklet and Progress Report were combined into a single publication. FY11

  13. Buildings Performance Database

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    * Enable public access to general statistical information about buildings, without ... of real buildings. * The BPD enables statistical analysis without revealing information ...

  14. Publications

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    GCPCC's collaboration and publication policy Beamline acknowledgement Publication List Please contact us when you have a publication resulting from work done at the GCPCC PX beamline. Miller MD, Phillips GN Jr., White MA, Fox RO, Craft BC III The development of the GCPCC Protein Crystallography Beamline at CAMD. Application of Accelerators in Research and Industry -- Sixteenth Int'l Conf., J.L. Duggan and I.L. Morgan eds., 734-737 (2001). {PDF} Qiu C, Tarrant MK, Choi SH, Sathyamurthy A, Bose R,

  15. WMC Database Evaluation. Case Study Report

    SciTech Connect (OSTI)

    Palounek, Andrea P. T

    2015-10-29

    The WMC Database is ultimately envisioned to hold a collection of experimental data, design information, and information from computational models. This project was a first attempt at using the Database to access experimental data and extract information from it. This evaluation shows that the Database concept is sound and robust, and that the Database, once fully populated, should remain eminently usable for future researchers.

  16. Database for Regional Geology, Phase 1: A Tool for Informing Regional Evaluations of Alternative Geologic Media and Decision Making

    SciTech Connect (OSTI)

    Perry, Frank Vinton; Kelley, Richard E.; Birdsell, Suzanne M.; Lugo, Alexander Bryan; Dobson, Patrick; Houseworth, James

    2014-11-12

    Reported is progress in the following areas: Phase 1 and 2 websites for the regional geology GIS database; terrane maps of crystalline basement rocks; inventory of shale formations in the US; and rock properties and in-situ conditions for shale estimated from sonic velocity measurements.

  17. Publications

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Book Chapters and Other Publications Book Chapters and Other Publications Contact Institute Director Charles Farrar (505) 663-5330 Email UCSD EI Director Michael Todd (858) 534-5951 Professional Staff Assistant Ellie Vigil (505) 667-2818 Email Administrative Assistant Rebecca Duran (505) 665-8899 Email Book Chapters C. J. Stull, F. M. Hemez and C. R. Farrar, "On Assessing the Robustness of Structural Health Monitoring Technologies," Topics in Model Validation and Uncertainty

  18. Publications

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Model Verification and Validation Model Verification and Validation Publications Publications are organized by topic. Contact Institute Director Charles Farrar (505) 663-5330 Email UCSD EI Director Michael Todd (858) 534-5951 Professional Staff Assistant Jutta Kayser (505) 663-5649 Email Administrative Assistant Stacy Baker (505) 663-5233 Email Decision-Making for Science-Based Predictive Modeling Atamturktur, H.S., Egeberg, M.C., Hemez, F.M., Stevens, G.N., "Defining Coverage of an

  19. Publications

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Structural Health Monitoring Structural Health Monitoring Publications Publications are organized by topic. Contact Institute Director Charles Farrar (505) 663-5330 Email UCSD EI Director Michael Todd (858) 534-5951 Professional Staff Assistant Ellie Vigil (505) 667-2818 Email Administrative Assistant Rebecca Duran (505) 665-8899 Email Structural Health Monitoring is the process of implementing a damage detection strategy for aerospace, civil and mechanical engineering infrastructure is referred

  20. Publications | NISAC

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Publications Publications Photo courtesy of ©iStockphoto.com/Samohin Photo courtesy of ©iStockphoto.com/Samohin The EERE Publication and Product Library will allow you to find publications and products provided by the DOE's Office of Energy Efficiency and Renewable Energy specifically for our constituents. This database will allow you to do the following: Search for publications and products Download or view publications online Request a copy to be mailed to you. Visit the EERE Publication

  1. ARTI Refrigerant Database

    SciTech Connect (OSTI)

    Calm, J.M.

    1994-05-27

    The Refrigerant Database consolidates and facilitates access to information to assist industry in developing equipment using alternative refrigerants. The underlying purpose is to accelerate phase out of chemical compounds of environmental concern.

  2. Life Cycle Inventory Database

    Broader source: Energy.gov [DOE]

    The U.S. Life Cycle Inventory (LCI) Database serves as a central repository for information about the total energy and resource impacts of developing and using various commercial building materials...

  3. DOE Research and Development Accomplishments Database Browse

    Office of Scientific and Technical Information (OSTI)

    Database Browse Sorted by: Most Recently Added Sort List By: -------------------- Most Recently Added Title Author Publication Date Some links on this page may take you to non-federal websites. Their policies may differ from this site. Website Policies/Important Links U.S. Department of Energy Office of Scientific and Technical Information National Library of Energy BETA science.gov WorldWideScience.org U.S. Deparment of Energy Office of Science

  4. Publications

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Publications - Sandia Energy Energy Search Icon Sandia Home Locations Contact Us Employee Locator Energy & Climate Secure & Sustainable Energy Future Stationary Power Energy Conversion Efficiency Solar Energy Wind Energy Water Power Supercritical CO2 Geothermal Natural Gas Safety, Security & Resilience of the Energy Infrastructure Energy Storage Nuclear Power & Engineering Grid Modernization Battery Testing Nuclear Fuel Cycle Defense Waste Management Programs Advanced Nuclear

  5. Publications

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Damage Prognosis Publications-Damage Prognosis Journal articles for the topic Damage Prognosis. Contact Institute Director Charles Farrar (505) 663-5330 Email UCSD EI Director Michael Todd (858) 534-5951 Professional Staff Assistant Ellie Vigil (505) 667-2818 Email Administrative Assistant Rebecca Duran (505) 665-8899 Email Journal articles Gabbatto, M., Conte, J, Kosmatka, J. Farrar, C. R., "Reliability-Based Framework for Fatigue Damage Prognosis of Composite Aircraft Structures,"

  6. Publications

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Earthquake Engineering and Structural Dynamics Earthquake Engineering and Structural Dynamics Publications Journal articles are organized by date. Contact Institute Director Charles Farrar (505) 663-5330 Email UCSD EI Director Michael Todd (858) 534-5951 Professional Staff Assistant Ellie Vigil (505) 667-2818 Email Administrative Assistant Rebecca Duran (505) 665-8899 Email Journal articles D. Mascarenas, D. Macknelly, J. Mullins, H. Wiest and G. Park, "Dynamic characterization of satellite

  7. Publications

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Sensors and Sensing Technologies Sensors and Sensing Technologies Publications Journal articles on Sensors and Sensing Technologies Contact Institute Director Charles Farrar (505) 663-5330 Email UCSD EI Director Michael Todd (858) 534-5951 Professional Staff Assistant Ellie Vigil (505) 667-2818 Email Administrative Assistant Rebecca Duran (505) 665-8899 Email Journal Articles Stull, C.J., Taylor, S. G., Wren, J., Mascarenas, D.L., Farrar, C. R., "Real-Time Condition Assessment of the Raptor

  8. Publications

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Directed Organization of Functional Materials at Inorganic-Macromolecular Interfaces Recent Publications R. Tunuguntla, M. Bangar, K. Kim, P. Stroeve, C.M. Ajo-Franklin, A. Noy, "Lipid Bilayer Composition can Influence the Orientation of Proteorhodopsin in Artificial Membranes", Biophys. J., accepted (2013) A. Noy "Kinetic model of gas transport in carbon nanotube channels", The Journal of Physical Chemistry C 117, 7656 (2013) A. Noy, R.W. Friddle "Practical single

  9. Database Search

    National Nuclear Security Administration (NNSA)

    ... mountain ranges, faults that have both normal and strike slip. Dip Database Search http:gldims.cr.usgs.govwebappscfusionsitesqfaultqfwebdisp.cfm?... 1 of 1 3292010 6:23

  10. Database Search

    National Nuclear Security Administration (NNSA)

    ... fault were found, so its displacement sense is uncertain. Dip Database Search http:gldims.cr.usgs.govwebappscfusionSitesqfaultqfwebdisp.cfm?... 1 of 1 1292010 2:54

  11. Energy Citations Database (ECD) - About

    Office of Scientific and Technical Information (OSTI)

    About ECD The Energy Citations Database (1943 - Present) was developed by the U.S. Department of Energy (DOE) Office of Scientific and Technical Information (OSTI) to improve...

  12. Energy Citations Database (ECD) - Widget

    Office of Scientific and Technical Information (OSTI)

    Energy Citations Database Widget You can access key features from the Department of Energy's Office of Scientific and Technical Information (DOEOSTI) by downloading the Energy...

  13. Hanford Site's Data Packages in the Administrative Record (AR) and Public Information Repository (PIR)

    DOE Data Explorer [Office of Scientific and Technical Information (OSTI)]

    In 1989, the Department of Energy joined with the Washington State Department of Ecology and the U.S. Environmental Protection Agency in signing the Hanford Federal Facility Agreement and Consent Order more commonly known as the Tri-Party Agreement (TPA). The TPA outlines legally enforceable milestones for Hanford cleanup over the next several decades. The AR is the body of documents and information that is considered or relied upon to arrive at a final decision for remedial action or hazardous waste management. An AR is established for each operable unit (OU); treatment, storage, or disposal unit (TSD); or Expedited Response Action (ERA) group and will contain all documents having information considered in arriving at a Record of Decision or permit. Documents become part of the AR after they have been designated as an AR by the TPA or after EPA, DOE, or other official parties have identified a document or set of documents for inclusion. Furthermore, AR documents are to be kept in a Public Information Repository (PIR).Thousands of data packages that support the AR documents are available to the public in the Hanford PIR.

  14. Public information circular for shipments of irradiated reactor fuel. Revision 9

    SciTech Connect (OSTI)

    Not Available

    1993-03-01

    This circular has been prepared to provide information on the shipment of irradiated reactor fuel (spent fuel) subject to regulation by the Nuclear Regulatory Commission (NRC), and to meet the requirements of Public Law 96--295. The report provides a brief description of NRC authority for certain aspects of transporting spent fuel. It provides descriptive statistics on spent fuel shipments regulated by the NRC from 1979 to 1992. It also lists detailed highway and railway segments used within each state from October 1, 1987 through December 31, 1992.

  15. Publications

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Fundamental Mechanisms of Transient States in Materials Quantified by DTEM Recent Publications N.D. Browning, M.A. Bonds, G.H. Campbell, J.E. Evans, T. LaGrange, K.L. Jungjohann, D.J. Masiel, J. McKeown, S. Mehraen, B.W. Reed, M. Santala, "Recent Developments in Dynamic Transmission Electron Microscopy," Current Opinion in Solid State and Materials Science, 16 [1] 23 - 30 (2012). Thomas LaGrange, Bryan W. Reed, Melissa Santala, Joseph McKeown, Andreas Kulovits, Jörg M. K. Wiezorek,

  16. Standard Energy Efficiency Database Platform - 2013 BTO Peer...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Database Platform - 2013 BTO Peer Review Standard Energy Efficiency Database Platform - 2013 BTO Peer Review PDF icon commlbldgs09prindle040313.pdf More Documents & Publications ...

  17. National Residential Efficiency Measures Database Aimed at Reducing Risk for Residential Retrofit Industry (Fact Sheet)

    SciTech Connect (OSTI)

    Not Available

    2012-01-01

    This technical highlight describes NREL research to develop a publicly available database of energy retrofit measures containing performance characteristics and cost estimates for nearly 3,000 measures. Researchers at the U.S. Department of Energy (DOE) National Renewable Energy Laboratory (NREL) have developed the National Residential Efficiency Measures Database, a public database that characterizes the performance and costs of common residential energy efficiency measures. The data are available for use in software programs that evaluate cost-effective retrofit measures to improve the energy efficiency of residential buildings. The database provides a single, consistent source of current data for DOE and private-sector energy audit and simulation software tools and the retrofit industry. The database will reduce risk for residential retrofit industry stakeholders by providing a central, publicly vetted source of up-to-date information.

  18. Catalog of databases and reports

    SciTech Connect (OSTI)

    Burtis, M.D.

    1997-04-01

    This catalog provides information about the many reports and materials made available by the US Department of Energy`s (DOE`s) Global Change Research Program (GCRP) and the Carbon Dioxide Information Analysis Center (CDIAC). The catalog is divided into nine sections plus the author and title indexes: Section A--US Department of Energy Global Change Research Program Research Plans and Summaries; Section B--US Department of Energy Global Change Research Program Technical Reports; Section C--US Department of Energy Atmospheric Radiation Measurement (ARM) Program Reports; Section D--Other US Department of Energy Reports; Section E--CDIAC Reports; Section F--CDIAC Numeric Data and Computer Model Distribution; Section G--Other Databases Distributed by CDIAC; Section H--US Department of Agriculture Reports on Response of Vegetation to Carbon Dioxide; and Section I--Other Publications.

  19. Buildings Performance Database Overview

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Overview Buildings.energy.gov/BPD BuildingsPerformanceDatabase@ee.doe.gov 2 * The BPD statistically analyzes trends in the energy performance and physical & operational characteristics of real commercial and residential buildings. The Buildings Performance Database 3 Design Principles * The BPD contains actual data on existing buildings - not modeled data or anecdotal evidence. * The BPD enables statistical analysis without revealing information about individual buildings. * The BPD cleanses

  20. XPS Spectral Database - JCAP

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Information XML Services Science Search Tools | DOE Collections | Journal Sources | Library Tools Home | U.S. Federal Agencies | Global Databases | Customized Resources XML data services are currently available from several OSTI collections. The XML Services Manual covers the following products: DOE PagesBeta XML Data Services Manual [674-KB PDF] DOE R&D Accomplishments XML Data Services Manual [157-KB PDF] DOepatents database XML Data Services Manual [1089-KB PDF] Geothermal

  1. Electric and Magnetic Fields Research and Public Information Dissemination Program annual report for fiscal year 1996

    SciTech Connect (OSTI)

    NONE

    1997-06-01

    The Electric and Magnetic Fields (EMF) Research and Public Information Dissemination (RAPID) Program was authorized by the Energy Policy Act of 1992 as a near-term effort to expand and accelerate the research needed to address the EMF issue. As required by this legislation, the EMF Interagency Committee, the National EMF Advisory Committee (NEMFAC), and the National Academy of Sciences (NAS) are providing valued input and advice for the direction of this program. With this input and advice, the Department of Energy (DOE) and the National Institute of Environmental Health Sciences (NIEHS) have developed and are implementing five-year program plans. Multi-year health effects research projects and related EMF measurement and exposure assessment projects are underway using funds appropriated in fiscal years 1994, 1995, and 1996 together with voluntary non-Federal contributions. The results of these research projects, along with the results of other EMF research, will be used as input to the hazard evaluation effort, which is the focus of the EMF RAPID Program. A coordinated interagency program is underway to communicate needed information on the EMF issue in a clear manner to the public and other decision makers.

  2. Tracking the Reliability of the U.S. Electric Power System: An Assessment of Publicly Available Information Reported to State Public Utility Commissions

    SciTech Connect (OSTI)

    LaCommare, Kristina H.; Eto, Joseph H.

    2008-10-10

    Large blackouts, such as the August 14-15, 2003 blackout in the northeasternUnited States and Canada, focus attention on the importance of reliable electric service. As public and private efforts are undertaken to improve reliability and prevent power interruptions, it is appropriate to assess their effectiveness. Measures of reliability, such as the frequency and duration of power interruptions, have been reported by electric utilities to state public utility commissions for many years. This study examines current state and utility practices for collecting and reporting electricity reliability information and discusses challenges that arise in assessing reliability because of differences among these practices. The study is based primarily on reliability information for 2006 reported by 123 utilities to 37 state public utility commissions.

  3. Database Help

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    other services. What databases does LinkSeeker appear in? Primo, Web of Knowledge, ProQuest, PubMed, MathSciNet, and the classic Library Catalog When I click the LinkSeeker...

  4. Information Resources | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Information Resources Information Resources Many resources are available from AMO to help manufacturers improve energy efficiency. Access our free online publications, databases, program highlights, webcasts, workshop results, and energy analysis. 2014_all_manufacturing_energy_carbon_footprint_Page_1.png Publications Search the AMO Publication and Product Library by technology area, category, or key word. Highlights Read about projects that lead to new technologies, improve existing

  5. ISSUANCE 2015-07-17: Energy Conservation Program: Energy Conservation Standards for Room Air Conditioners; Request for Information, Extension of the Public Comment Period

    Broader source: Energy.gov [DOE]

    Energy Conservation Program: Energy Conservation Standards for Room Air Conditioners; Request for Information, Extension of the Public Comment Period

  6. Hazard Analysis Database Report

    SciTech Connect (OSTI)

    GAULT, G.W.

    1999-10-13

    The Hazard Analysis Database was developed in conjunction with the hazard analysis activities conducted in accordance with DOE-STD-3009-94, Preparation Guide for US Department of Energy Nonreactor Nuclear Facility Safety Analysis Reports, for the Tank Waste Remediation System (TWRS) Final Safety Analysis Report (FSAR). The FSAR is part of the approved TWRS Authorization Basis (AB). This document describes, identifies, and defines the contents and structure of the TWRS FSAR Hazard Analysis Database and documents the configuration control changes made to the database. The TWRS Hazard Analysis Database contains the collection of information generated during the initial hazard evaluations and the subsequent hazard and accident analysis activities. The database supports the preparation of Chapters 3,4, and 5 of the TWRS FSAR and the USQ process and consists of two major, interrelated data sets: (1) Hazard Evaluation Database--Data from the results of the hazard evaluations; and (2) Hazard Topography Database--Data from the system familiarization and hazard identification.

  7. Construction of file database management

    SciTech Connect (OSTI)

    MERRILL,KYLE J.

    2000-03-01

    This work created a database for tracking data analysis files from multiple lab techniques and equipment stored on a central file server. Experimental details appropriate for each file type are pulled from the file header and stored in a searchable database. The database also stores specific location and self-directory structure for each data file. Queries can be run on the database according to file type, sample type or other experimental parameters. The database was constructed in Microsoft Access and Visual Basic was used for extraction of information from the file header.

  8. ARTI refrigerant database

    SciTech Connect (OSTI)

    Calm, J.M.

    1999-01-01

    The Refrigerant Database is an information system on alternative refrigerants, associated lubricants, and their use in air conditioning and refrigeration. It consolidates and facilities access to property, compatibility, environmental, safety, application and other information. It provides corresponding information on older refrigerants, to assist manufacturers and those using alternative refrigerants, to make comparisons and determine differences. The underlying purpose is to accelerate phase out of chemical compounds of environmental concern.

  9. ARTI refrigerant database

    SciTech Connect (OSTI)

    Calm, J.M.

    1996-11-15

    The Refrigerant Database is an information system on alternative refrigerants, associated lubricants, and their use in air conditioning and refrigeration. It consolidates and facilitates access to property, compatibility, environmental, safety, application and other information. It provides corresponding information on older refrigerants, to assist manufacturers and those using alternative refrigerants, to make comparisons and determine differences. The underlying purpose is to accelerate phase out of chemical compounds of environmental concern.

  10. ARTI refrigerant database

    SciTech Connect (OSTI)

    Calm, J.M.

    1996-07-01

    The Refrigerant Database is an information system on alternative refrigerants, associated lubricants, and their use in air conditioning and refrigeration. It consolidates and facilitates access to property, compatibility, environmental, safety, application and other information. It provides corresponding information on older refrigerants, to assist manufacturers and those using alternative refrigerants, to make comparisons and determine differences. The underlying purpose is to accelerate phase out of chemical compounds of environmental concern.

  11. Electric and magnetic fields research and public information dissemination program. Progress report

    SciTech Connect (OSTI)

    1995-12-01

    The Electric and Magnetic Fields (EMF) Research and Public Information Dissemination (RAPID) Program was authorized by the Energy Policy Act of 1992 (enacted October 24, 1992) to determine whether or not exposure to EMF produced by the generation, transmission, and use of electric energy affects human health. Two Federal agencies, the Department of Energy (DOE) and the National Institute of Environmental Health Sciences (NIEHS), have primary responsibility for the program, but other Federal agencies are key participants as well. This program requires that Federal appropriations be matched by contributions from non-Federal sources. The authorized level of funding for the program was $65 million over a 5-year period (fiscal years 1993-1997 inclusive). For EMF RAPID to be a fully funded program, $32.5 million over 5 years will have to be appropriated by Congress and matched by non-Federal contributions.

  12. The Genomes On Line Database (GOLD) in 2007: status of genomic and metagenomic projects and their associated metadata

    SciTech Connect (OSTI)

    Fenner, Marsha W; Liolios, Konstantinos; Mavromatis, Konstantinos; Tavernarakis, Nektarios; Kyrpides, Nikos C.

    2007-12-31

    The Genomes On Line Database (GOLD) is a comprehensive resource of information for genome and metagenome projects world-wide. GOLD provides access to complete and ongoing projects and their associated metadata through pre-computed lists and a search page. The database currently incorporates information for more than 2900 sequencing projects, of which 639 have been completed and the data deposited in the public databases. GOLD is constantly expanding to provide metadata information related to the project and the organism and is compliant with the Minimum Information about a Genome Sequence (MIGS) specifications.

  13. Sandia National Laboratories: News: Search Sandia Publications

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Publications Annual Report Environmental Reports Fact Sheets Labs Accomplishments Lab News Partnerships Annual Report Research Magazine HPC Annual Reports Search Sandia Publications Strategic Plan News Search Sandia Publications Search | Advanced Search Examples - simple search: wind turbine, wildcard: wind* , exact match: "wind turbine", multiple: wind AND turbine, wind OR turbine Title Author Document ID Subject Published From Published To Database Conference Information

  14. High Performance Buildings Database

    DOE Data Explorer [Office of Scientific and Technical Information (OSTI)]

    The High Performance Buildings Database is a shared resource for the building industry, a unique central repository of in-depth information and data on high-performance, green building projects across the United States and abroad. The database includes information on the energy use, environmental performance, design process, finances, and other aspects of each project. Members of the design and construction teams are listed, as are sources for additional information. In total, up to twelve screens of detailed information are provided for each project profile. Projects range in size from small single-family homes or tenant fit-outs within buildings to large commercial and institutional buildings and even entire campuses. The database is a data repository as well. A series of Web-based data-entry templates allows anyone to enter information about a building project into the database. Once a project has been submitted, each of the partner organizations can review the entry and choose whether or not to publish that particular project on its own Web site.

  15. A brief introduction on training and public information of building energy codes in the U.S.

    SciTech Connect (OSTI)

    Shui, Bin

    2010-12-01

    This report is associated with the project of Implementation of Building Energy Codes in China (55793). The report aims to give Chinese audience a brief introduction on training and public information activities of building energy codes in the U.S. The report contains four sections: Section One is about the development history and implementation of building energy codes in the U.S. Section Two is about the organizations of training and public information activities, mainly focused on ASHRAE, ICC, federal and state government. Policy implication, which is Section Three, addresses the role of federal government and on-line training and public information activities in promoting training and public information (the current China training system lacks strong support of central government and on-line training activities). Conclusions are made in Section Four. This report will be uploaded to an upcoming Chinese website which is devoted to provide first-time free on-line training and public information of building energy codes in China.

  16. Related Publications

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Skip navigation links Financial Information Financial Public Processes Asset Management Cost Verification Process Rate Cases BP-18 Rate Case Related Publications Meetings...

  17. Crude Oil Analysis Database

    DOE Data Explorer [Office of Scientific and Technical Information (OSTI)]

    Shay, Johanna Y.

    The composition and physical properties of crude oil vary widely from one reservoir to another within an oil field, as well as from one field or region to another. Although all oils consist of hydrocarbons and their derivatives, the proportions of various types of compounds differ greatly. This makes some oils more suitable than others for specific refining processes and uses. To take advantage of this diversity, one needs access to information in a large database of crude oil analyses. The Crude Oil Analysis Database (COADB) currently satisfies this need by offering 9,056 crude oil analyses. Of these, 8,500 are United States domestic oils. The database contains results of analysis of the general properties and chemical composition, as well as the field, formation, and geographic location of the crude oil sample. [Taken from the Introduction to COAMDATA_DESC.pdf, part of the zipped software and database file at http://www.netl.doe.gov/technologies/oil-gas/Software/database.html] Save the zipped file to your PC. When opened, it will contain PDF documents and a large Excel spreadsheet. It will also contain the database in Microsoft Access 2002.

  18. Benefits of an International Database for UF6 Cylinders

    SciTech Connect (OSTI)

    Babcock, R A; Whitaker, J M; Murphy, J; Oakberg, J

    2008-06-30

    A reasonable expectation regarding the nuclear energy renaissance is that the location of fuel cycle nuclear materials throughout the world will be known. We ask--would an international system for uranium hexafluoride (UF{sub 6}) cylinders provide the effective assurances expected for international fuel supply and of the international fuel centers? This paper introduces the question and discusses the potential benefits of tracking UF{sub 6} cylinders through the development of an international database. The nonproliferation benefits of an international database for UF{sub 6} cylinders being used in the fuel cycle include an enhanced capability to reconcile nuclear material imports and exports. Currently, import and export declarations only require the reporting of total 'rolled up' quantities of nuclear materials contained in all items--not the quantities of materials in individual items like individual UF{sub 6} cylinders. The database could provide supplier countries with more assurance on the location of the UF{sub 6} cylinders they export. Additionally, a comprehensive database on all declared cylinders would be a valuable resource in detecting and recognizing undeclared cylinders. The database could potentially be administered by the IAEA and be accessible to authorized countries around the world. During the nuclear renaissance, the general public, as well as the participants will expect transparency and quality information about movement of nuclear fuel cycle nuclear materials. We will discuss the potential benefits of such a database for the suppliers, inspectorates, and general public.

  19. NMS 62-3 New Mexico Public Utility Act | Open Energy Information

    Open Energy Info (EERE)

    62-3 New Mexico Public Utility Act Jump to: navigation, search OpenEI Reference LibraryAdd to library Legal Document- StatuteStatute: NMS 62-3 New Mexico Public Utility ActLegal...

  20. Utah UC 54-2-1, Public Utilities Definitions | Open Energy Information

    Open Energy Info (EERE)

    2-1, Public Utilities Definitions Jump to: navigation, search OpenEI Reference LibraryAdd to library Legal Document- RegulationRegulation: Utah UC 54-2-1, Public Utilities...

  1. Title 43 CFR 1610.2 Public Participation | Open Energy Information

    Open Energy Info (EERE)

    2 Public Participation Jump to: navigation, search OpenEI Reference LibraryAdd to library Legal Document- Federal RegulationFederal Regulation: Title 43 CFR 1610.2 Public...

  2. C.R.S. 40-1-103 - Public Utility Defined | Open Energy Information

    Open Energy Info (EERE)

    navigation, search OpenEI Reference LibraryAdd to library Legal Document- StatuteStatute: C.R.S. 40-1-103 - Public Utility DefinedLegal Abstract This statute defines "public...

  3. Transfer of Physical and Hydraulic Properties Databases to the Hanford Environmental Information System - PNNL Remediation Decision Support Project, Task 1, Activity 6

    SciTech Connect (OSTI)

    Rockhold, Mark L.; Middleton, Lisa A.

    2009-03-31

    This report documents the requirements for transferring physical and hydraulic property data compiled by PNNL into the Hanford Environmental Information System (HEIS). The Remediation Decision Support (RDS) Project is managed by Pacific Northwest National Laboratory (PNNL) to support Hanford Site waste management and remedial action decisions by the U.S. Department of Energy and one of their current site contractors - CH2M-Hill Plateau Remediation Company (CHPRC). The objective of Task 1, Activity 6 of the RDS project is to compile all available physical and hydraulic property data for sediments from the Hanford Site, to port these data into the Hanford Environmental Information System (HEIS), and to make the data web-accessible to anyone on the Hanford Local Area Network via the so-called Virtual Library.1 These physical and hydraulic property data are used to estimate parameters for analytical and numerical flow and transport models that are used for site risk assessments and evaluation of remedial action alternatives. In past years efforts were made by RDS project staff to compile all available physical and hydraulic property data for Hanford sediments and to transfer these data into SoilVision{reg_sign}, a commercial geotechnical software package designed for storing, analyzing, and manipulating soils data. Although SoilVision{reg_sign} has proven to be useful, its access and use restrictions have been recognized as a limitation to the effective use of the physical and hydraulic property databases by the broader group of potential users involved in Hanford waste site issues. In order to make these data more widely available and useable, a decision was made to port them to HEIS and to make them web-accessible via a Virtual Library module. In FY08 the original objectives of this activity on the RDS project were to: (1) ensure traceability and defensibility of all physical and hydraulic property data currently residing in the SoilVision{reg_sign} database maintained by PNNL, (2) transfer the physical and hydraulic property data from the Microsoft Access database files used by SoilVision{reg_sign} into HEIS, which is currently being maintained by CHRPC, (3) develop a Virtual Library module for accessing these data from HEIS, and (4) write a User's Manual for the Virtual Library module. The intent of these activities is to make the available physical and hydraulic property data more readily accessible and useable by technical staff and operable unit managers involved in waste site assessments and remedial action decisions for Hanford. In FY08 communications were established between PNNL and staff from Fluor-Hanford Co. (who formerly managed HEIS) to outline the design of a Virtual Library module that could be used to access the physical and hydraulic property data that are to be transferred into HEIS. Data dictionaries used by SoilVision{reg_sign} were also provided to Fluor-Hanford personnel (who are now with CHPRC). During ongoing work to ensure traceability and defensibility of all physical and hydraulic property data that currently reside in the SoilVision{reg_sign} database, it was recognized that further work would be required in this effort before the data were actually ported into HEIS. Therefore work on the Virtual Library module development and an accompanying User's Guide was deferred until an unspecified later date. In FY09 efforts have continued to verify the traceability and defensibility of the physical and hydraulic property datasets that are currently being maintained by PNNL. Although this is a work in progress, several of these datasets should be ready for transfer to HEIS in the very near future. This document outlines a plan for the migration of these datasets into HEIS.

  4. National Spill Test Technology Database

    DOE Data Explorer [Office of Scientific and Technical Information (OSTI)]

    Sheesley, David [Western Research Institute

    Western Research Institute established, and ACRC continues to maintain, the National Spill Technology database to provide support to the Liquified Gaseous Fuels Spill Test Facility (now called the National HAZMAT Spill Center) as directed by Congress in Section 118(n) of the Superfund Amendments and Reauthorization Act of 1986 (SARA). The Albany County Research Corporation (ACRC) was established to make publicly funded data developed from research projects available to benefit public safety. The founders since 1987 have been investigating the behavior of toxic chemicals that are deliberately or accidentally spilled, educating emergency response organizations, and maintaining funding to conduct the research at the DOEs HAZMAT Spill Center (HSC) located on the Nevada Test Site. ACRC also supports DOE in collaborative research and development efforts mandated by Congress in the Clean Air Act Amendments. The data files are results of spill tests conducted at various times by the Silicones Environmental Health and Safety Council (SEHSC) and DOE, ANSUL, Dow Chemical, the Center for Chemical Process Safety (CCPS) and DOE, Lawrence Livermore National Laboratory (LLNL), OSHA, and DOT; DuPont, and the Western Research Institute (WRI), Desert Research Institute (DRI), and EPA. Each test data page contains one executable file for each test in the test series as well as a file named DOC.EXE that contains information documenting the test series. These executable files are actually self-extracting zip files that, when executed, create one or more comma separated value (CSV) text files containing the actual test data or other test information.

  5. National Spill Test Technology Database

    DOE Data Explorer [Office of Scientific and Technical Information (OSTI)]

    Sheesley, David [Western Research Institute

    Western Research Institute established, and ACRC continues to maintain, the National Spill Technology database to provide support to the Liquified Gaseous Fuels Spill Test Facility (now called the National HAZMAT Spill Center) as directed by Congress in Section 118(n) of the Superfund Amendments and Reauthorization Act of 1986 (SARA). The Albany County Research Corporation (ACRC) was established to make publicly funded data developed from research projects available to benefit public safety. The founders since 1987 have been investigating the behavior of toxic chemicals that are deliberately or accidentally spilled, educating emergency response organizations, and maintaining funding to conduct the research at the DOEÆs HAZMAT Spill Center (HSC) located on the Nevada Test Site. ACRC also supports DOE in collaborative research and development efforts mandated by Congress in the Clean Air Act Amendments. The data files are results of spill tests conducted at various times by the Silicones Environmental Health and Safety Council (SEHSC) and DOE, ANSUL, Dow Chemical, the Center for Chemical Process Safety (CCPS) and DOE, Lawrence Livermore National Laboratory (LLNL), OSHA, and DOT; DuPont, and the Western Research Institute (WRI), Desert Research Institute (DRI), and EPA. Each test data page contains one executable file for each test in the test series as well as a file named DOC.EXE that contains information documenting the test series. These executable files are actually self-extracting zip files that, when executed, create one or more comma separated value (CSV) text files containing the actual test data or other test information.

  6. CREW Database

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Database - Sandia Energy Energy Search Icon Sandia Home Locations Contact Us Employee Locator Energy & Climate Secure & Sustainable Energy Future Stationary Power Energy Conversion Efficiency Solar Energy Wind Energy Water Power Supercritical CO2 Geothermal Natural Gas Safety, Security & Resilience of the Energy Infrastructure Energy Storage Nuclear Power & Engineering Grid Modernization Battery Testing Nuclear Fuel Cycle Defense Waste Management Programs Advanced Nuclear Energy

  7. 3D Covalent Organic Framework Materials database (Dataset) | SciTech

    Office of Scientific and Technical Information (OSTI)

    Connect Dataset: 3D Covalent Organic Framework Materials database Citation Details In-Document Search Title: 3D Covalent Organic Framework Materials database Authors: Haranczyk, Maciej [1] + Show Author Affiliations Lawrence Berkeley National Laboratory Publication Date: 2014-09-11 OSTI Identifier: 1155071 Report Number(s): 1 DOE Contract Number: AC02-05CH11231 Resource Type: Dataset Data Type: Numeric Data Resource Relation: Related Information: R.L. Martin et al Journal of Physical

  8. Organizing the Extremely Large LSST Database forReal-Time Astronomical

    Office of Scientific and Technical Information (OSTI)

    Processing (Conference) | SciTech Connect Organizing the Extremely Large LSST Database forReal-Time Astronomical Processing Citation Details In-Document Search Title: Organizing the Extremely Large LSST Database forReal-Time Astronomical Processing × You are accessing a document from the Department of Energy's (DOE) SciTech Connect. This site is a product of DOE's Office of Scientific and Technical Information (OSTI) and is provided as a public service. Visit OSTI to utilize additional

  9. PNNL: Publication Details

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Details Sorry, we cannot locate that Publication. Please try the Publications Database for other PNNL Publications. Powered By ERICA, PNNL's publication metadatabase Publications Search Publications Science as Art Calendar Magazines and Newsletters Pacific Northwest Technology Today DOE Pulse Additional Resources PNNL Technical Library PNNL Photo Library PNNL Brochure Library Related Links Hanford Technical Library

  10. Geothermal NEPA Database on OpenEI (Poster)

    SciTech Connect (OSTI)

    Young, K. R.; Levine, A.

    2014-09-01

    The National Renewable Energy Laboratory (NREL) developed the Geothermal National Environmental Policy Act (NEPA) Database as a platform for government agencies and industry to access and maintain information related to geothermal NEPA documents. The data were collected to inform analyses of NEPA timelines, and the collected data were made publically available via this tool in case others might find the data useful. NREL staff and contractors collected documents from agency websites, during visits to the two busiest Bureau of Land Management (BLM) field offices for geothermal development, and through email and phone call requests from other BLM field offices. They then entered the information into the database, hosted by Open Energy Information (http://en.openei.org/wiki/RAPID/NEPA). The long-term success of the project will depend on the willingness of federal agencies, industry, and others to populate the database with NEPA and related documents, and to use the data for their own analyses. As the information and capabilities of the database expand, developers and agencies can save time on new NEPA reports by accessing a single location to research related activities, their potential impacts, and previously proposed and imposed mitigation measures. NREL used a wiki platform to allow industry and agencies to maintain the content in the future so that it continues to provide relevant and accurate information to users.

  11. Database specification for the Worldwide Port System (WPS) Regional Integrated Cargo Database (ICDB)

    SciTech Connect (OSTI)

    Faby, E.Z.; Fluker, J.; Hancock, B.R.; Grubb, J.W.; Russell, D.L.; Loftis, J.P.; Shipe, P.C.; Truett, L.F.

    1994-03-01

    This Database Specification for the Worldwide Port System (WPS) Regional Integrated Cargo Database (ICDB) describes the database organization and storage allocation, provides the detailed data model of the logical and physical designs, and provides information for the construction of parts of the database such as tables, data elements, and associated dictionaries and diagrams.

  12. RCW - 79.36 - Easements Over Public Lands | Open Energy Information

    Open Energy Info (EERE)

    Retrieved from "http:en.openei.orgwindex.php?titleRCW-79.36-EasementsOverPublicLands&oldid790126" Feedback Contact needs updating Image needs updating...

  13. National Residential Efficiency Measures Database

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    National Residential Efficiency Measures Database Development Document, v3.0 Final Draft, June 2012 National Renewable Energy Laboratory 15013 Denver West Parkway Golden, Colorado i Executive Summary The National Residential Efficiency Measures Database is a publicly available, centralized resource of residential building retrofit measures and costs for the U.S. building industry. With support from the U.S. Department of Energy, NREL developed this tool to help users determine the most

  14. Bioenergy Technologies Office: Publications

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Advanced Search Browse by Topic Mail Requests Help Key Publications Newsletter Biomass Basics Multimedia Webinars Databases Analytical Tools Glossary Student & Educator Resources...

  15. H.R.S. 269 - Public Utilities Commission | Open Energy Information

    Open Energy Info (EERE)

    search OpenEI Reference LibraryAdd to library Legal Document- StatuteStatute: H.R.S. 269 - Public Utilities CommissionLegal Abstract This section of the Hawaii Revised...

  16. Building America Webinar: National Residential Efficiency Measures Database

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Unveiled | Department of Energy National Residential Efficiency Measures Database Unveiled Building America Webinar: National Residential Efficiency Measures Database Unveiled This webinar presented an overview of this database of residential building retrofit measures and associated estimated costs, and progress to date. File webinar_residential_efficiencydb_20110118.wmv More Documents & Publications National Residential Efficiency Measures Database Webinar Slides Building America

  17. Wyoming Interagency Spatial Database & Online Management | Open...

    Open Energy Info (EERE)

    Western Governors' Association, WY Game and Fish Department, WY Geographic Information Science Center (WyGISC), WY Natural Diversity Database, The Nature Conservancy, WY Department...

  18. Lessons Learned Database | Department of Energy

    Broader source: Energy.gov (indexed) [DOE]

    DOE Corporate Lessons Learned Database provides a central clearinghouse that allows ready access to and communication about collected information on a timely, unimpeded basis by...

  19. Database of State Incentives for Renewables & Efficiency

    Broader source: Energy.gov [DOE]

    The Database of State Incentives for Renewables & Efficiency (DSIRE) is the most comprehensive source of information on incentives and policies that support renewables and energy efficiency in...

  20. Public Access to Federal Awardee Performance and Integrity Information System (FAPIIS) – FAR Clause 52.209-8 Class Deviation

    Broader source: Energy.gov [DOE]

    Attached is a class deviation executed by the Senior Procurement Executives of NNSA and DOE. It allows a deviation to Federal Acquisition Regulation (FAR) clause 52.209-8, Updates of Information Regarding Responsibility Matters (DEVIATION) (OCT 2010). Given the requirements of Public Law 111-212, it is necessary to deviate from use of the current clause. Contracting Officers shall begin using the revised clause in new solicitations and contracts as prescribed at FAR 9.104-7(c).

  1. Status Report on Transfer of Physical and Hydraulic Properties Databases to the Hanford Environmental Information System - PNNL Remediation Decision Support Project, Task 1, Activity 6

    SciTech Connect (OSTI)

    Rockhold, Mark L.; Middleton, Lisa A.; Cantrell, Kirk J.

    2009-06-30

    This document provides a status report on efforts to transfer physical and hydraulic property data from PNNL to CHPRC for incorporation into HEIS. The Remediation Decision Support (RDS) Project is managed by Pacific Northwest National Laboratory (PNNL) to support Hanford Site waste management and remedial action decisions by the U.S. Department of Energy and their contractors. The objective of Task 1, Activity 6 of the RDS project is to compile all available physical and hydraulic property data for sediments from the Hanford Site, to port these data into the Hanford Environmental Information System (HEIS), and to make the data web-accessible to anyone on the Hanford Local Area Network via the so-called Virtual Library. These physical and hydraulic property data are used to estimate parameters for analytical and numerical flow and transport models that are used for site risk assessments and evaluation of remedial action alternatives. In past years efforts were made by RDS project staff to compile all available physical and hydraulic property data for Hanford sediments and to transfer these data into SoilVision{reg_sign}, a commercial geotechnical software package designed for storing, analyzing, and manipulating soils data. Although SoilVision{reg_sign} has proven to be useful, its access and use restrictions have been recognized as a limitation to the effective use of the physical and hydraulic property databases by the broader group of potential users involved in Hanford waste site issues. In order to make these data more widely available and useable, a decision was made to port them to HEIS and to make them web-accessible via a Virtual Library module. In FY08 the original objectives of this activity on the RDS project were to: (1) ensure traceability and defensibility of all physical and hydraulic property data currently residing in the SoilVision{reg_sign} database maintained by PNNL, (2) transfer the physical and hydraulic property data from the Microsoft Access database files used by SoilVision{reg_sign} into HEIS, which is currently being maintained by CH2M-Hill Plateau Remediation Company (CHRPC), (3) develop a Virtual Library module for accessing these data from HEIS, and (4) write a User's Manual for the Virtual Library module. The intent of these activities is to make the available physical and hydraulic property data more readily accessible and useable by technical staff and operable unit managers involved in waste site assessments and remedial action decisions for Hanford. In FY08 communications were established between PNNL and staff from Fluor-Hanford Co. (who formerly managed HEIS) to outline the design of a Virtual Library module that could be used to access the physical and hydraulic property data that are to be transferred into HEIS. Data dictionaries used by SoilVision{reg_sign} were also provided to Fluor-Hanford personnel who are now with CHPRC. During ongoing work to ensure traceability and defensibility of all physical and hydraulic property data that currently reside in the SoilVision{reg_sign} database, it was recognized that further work would be required in this effort before the data were actually ported into HEIS. Therefore work on the Virtual Library module development and an accompanying User's Guide was deferred until an unspecified later date. In FY09 efforts have continued to verify the traceability and defensibility of the physical and hydraulic property datasets that are currently being maintained by PNNL. Although this is a work in progress, several of these datasets are now ready for transfer to CHRPC for inclusion in HEIS. The actual loading of data into HEIS is performed by CHPRC staff, so after the data are transferred from PNNL to CHPRC, it will be the responsibility of CHPRC to ensure that these data are loaded and made accessible. This document provides a status report on efforts to transfer physical and hydraulic property data from PNNL to CHPRC for incorporation into HEIS.

  2. Rice Glycosyltransferase (GT) Phylogenomic Database

    DOE Data Explorer [Office of Scientific and Technical Information (OSTI)]

    Ronald, Pamela

    The Ronald Laboratory staff at the University of California-Davis has a primary research focus on the genes of the rice plant. They study the role that genetics plays in the way rice plants respond to their environment. They created the Rice GT Database in order to integrate functional genomic information for putative rice Glycosyltransferases (GTs). This database contains information on nearly 800 putative rice GTs (gene models) identified by sequence similarity searches based on the Carbohydrate Active enZymes (CAZy) database. The Rice GT Database provides a platform to display user-selected functional genomic data on a phylogenetic tree. This includes sequence information, mutant line information, expression data, etc. An interactive chromosomal map shows the position of all rice GTs, and links to rice annotation databases are included. The format is intended to "facilitate the comparison of closely related GTs within different families, as well as perform global comparisons between sets of related families." [From http://ricephylogenomics.ucdavis.edu/cellwalls/gt/genInfo.shtml] See also the primary paper discussing this work: Peijian Cao, Laura E. Bartley, Ki-Hong Jung and Pamela C. Ronalda. Construction of a Rice Glycosyltransferase Phylogenomic Database and Identification of Rice-Diverged Glycosyltransferases. Molecular Plant, 2008, 1(5): 858-877.

  3. Public Comments on the Request for Information on Rapid Response Teams for Transmission (April 2012)

    Broader source: Energy.gov [DOE]

    On February 27, 2012, the Department issued a Federal Register Notice seeking information on questions related to permitting of transmission lines. Infrastructure projects — such as high voltage,...

  4. Summary of Carbon Storage Project Public Information Meeting and Open House, Hawesville, Kentucky, October 28, 2010

    SciTech Connect (OSTI)

    David Harris; David Williams; J. Richard Bowersox; Hannes Leetaru

    2012-06-01

    The Kentucky Geological Survey (KGS) completed a second phase of carbon dioxide (CO{sub 2}) injection and seismic imaging in the Knox Group, a Cambrian‐Ordovician dolomite and sandstone sequence in September 2010. This work completed 2 years of activity at the KGS No. 1 Marvin Blan well in Hancock County, Kentucky. The well was drilled in 2009 by a consortium of State and industry partners (Kentucky Consortium for Carbon Storage). An initial phase of CO{sub 2} injection occurred immediately after completion of the well in 2009. The second phase of injection and seismic work was completed in September 2010 as part of a U.S. DOE–funded project, after which the Blan well was plugged and abandoned. Following completion of research at the Blan well, a final public meeting and open house was held in Hancock County on October 28, 2010. This meeting followed one public meeting held prior to drilling of the well, and two on‐site visits during drilling (one for news media, and one for school teachers). The goal of the final public meeting was to present the results of the project to the public, answer questions, and address any concerns. Despite diligent efforts to publicize the final meeting, it was poorly attended by the general public. Several local county officials and members of the news media attended, but only one person from the general public showed up. We attribute the lack of interest in the results of the project to several factors. First, the project went as planned, with no problems or incidents that affected the local residents. The fact that KGS fulfilled the promises it made at the beginning of the project satisfied residents, and they felt no need to attend the meeting. Second, Hancock County is largely rural, and the technical details of carbon sequestration were not of interest to many people. The county officials attending were an exception; they clearly realized the importance of the project in future economic development for the county.

  5. Marine and Hydrokinetic Technology Database

    DOE Data Explorer [Office of Scientific and Technical Information (OSTI)]

    DOE’s Marine and Hydrokinetic Technology Database provides up-to-date information on marine and hydrokinetic renewable energy, both in the U.S. and around the world. The database includes wave, tidal, current, and ocean thermal energy, and contains information on the various energy conversion technologies, companies active in the field, and development of projects in the water. Depending on the needs of the user, the database can present a snapshot of projects in a given region, assess the progress of a certain technology type, or provide a comprehensive view of the entire marine and hydrokinetic energy industry. Results are displayed as a list of technologies, companies, or projects. Data can be filtered by a number of criteria, including country/region, technology type, generation capacity, and technology or project stage. The database was updated in 2009 to include ocean thermal energy technologies, companies, and projects.

  6. Marine and Hydrokinetic Technology Database

    DOE Data Explorer [Office of Scientific and Technical Information (OSTI)]

    DOEs Marine and Hydrokinetic Technology Database provides up-to-date information on marine and hydrokinetic renewable energy, both in the U.S. and around the world. The database includes wave, tidal, current, and ocean thermal energy, and contains information on the various energy conversion technologies, companies active in the field, and development of projects in the water. Depending on the needs of the user, the database can present a snapshot of projects in a given region, assess the progress of a certain technology type, or provide a comprehensive view of the entire marine and hydrokinetic energy industry. Results are displayed as a list of technologies, companies, or projects. Data can be filtered by a number of criteria, including country/region, technology type, generation capacity, and technology or project stage. The database was updated in 2009 to include ocean thermal energy technologies, companies, and projects.

  7. Publications | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Publications Publications Photo courtesy of ©iStockphoto.com/Samohin Photo courtesy of ©iStockphoto.com/Samohin The EERE Publication and Product Library will allow you to find publications and products provided by the DOE's Office of Energy Efficiency and Renewable Energy specifically for our constituents. This database will allow you to do the following: Search for publications and products Download or view publications online Request a copy to be mailed to you. Visit the EERE Publication

  8. ORISE: Human Subjects Research Database

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Human Subjects Research Database Section 10, Part 745 of the Code of Federal Regulations and U.S. Department of Energy (DOE) Orders 443.1 and 481.1 require the maintenance of information on all research projects that involve human subjects and that are funded by DOE, conducted in DOE facilities, performed by DOE personnel or involve DOE or contract personnel. The Oak Ridge Institute for Science and Education (ORISE) maintains the Human Subjects Research Database (HSRD) for the Office of

  9. Fuel Cell Technical Publications | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Information Resources Technical Publications Fuel Cell Technical Publications Fuel Cell Technical Publications Technical information about fuel cells published in technical ...

  10. Coastal resources management guidelines. Coastal Management Publication No. 2. Renewable Resources Information Series

    SciTech Connect (OSTI)

    Snedaker, S.C.; Getter, C.D.

    1985-01-01

    The guidebook is one in a series of publications being produced for the Agency for International Development (AID) by the National Park Service (NPS). Its purpose is to provide expert guidance in planning and management for sustainable coastal development and for the conservation of coastal resources. In addition to the book the coastal series includes a casebook with eight case studies, a report on institutional arrangements for coastal resource management, and a condensed design aids booklet.

  11. Security of databases

    SciTech Connect (OSTI)

    Yeh, Y.S.

    1985-01-01

    In this thesis, the security of databases using cryptographic methods is considered. An algebra for encrypted relational databases is considered and examined. Other database cryptosystems are presented, namely multilevel secure databases including three different approaches; multikey multilevel, cumulative key multilevel, and permutational multilevel secure databases. Finally, entity-relationship encryption is examined.

  12. Summary of Information Presented at an NRC-Sponsored Low-Power Shutdown Public Workshop, April 27, 1999, Rockville, Maryland

    SciTech Connect (OSTI)

    Wheeler, Timothy A.; Whitehead, Donnie W.; Lois, Erasmia

    1999-07-01

    This report summarizes a public workshop that was held on April 27, 1999, in Rockville, Maryland. The workshop was conducted as part of the US Nuclear Regulatory Commission's (NRC) efforts to further develop its understanding of the risks associated with low power and shutdown operations at US nuclear power plants. A sufficient understanding of such risks is required to support decision-making for risk-informed regulation, in particular Regulatory Guide 1.174, and the development of a consensus standard. During the workshop the NRC staff discussed and requested feedback from the public (including representatives of the nuclear industry, state governments, consultants, private industry, and the media) on the risk associated with low-power and shutdown operations.

  13. Designing a Multi-Petabyte Database for LSST (Conference) | SciTech Connect

    Office of Scientific and Technical Information (OSTI)

    Designing a Multi-Petabyte Database for LSST Citation Details In-Document Search Title: Designing a Multi-Petabyte Database for LSST × You are accessing a document from the Department of Energy's (DOE) SciTech Connect. This site is a product of DOE's Office of Scientific and Technical Information (OSTI) and is provided as a public service. Visit OSTI to utilize additional information resources in energy science and technology. A paper copy of this document is also available for sale to the

  14. Office of Information Resources

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Freedom of Information and Privacy Act Database Bureau: DOE-ID Project Unique ID: Date: May 8,2008 A. CONTACT INFORMATION 1. Who is the person completing this document? Nicole Brooks Title: FOIA/PA Officer Organization: DOE-ID Public Affairs Office Address: 1955 N. Fremont Ave, MS 1203 Idaho Falls, Idaho 83415 2. Who is the system owner? Nicole Brooks, FOIA/PA Officer U.S. DOE, Idaho Operations Office DOE-ID Public Affairs Office Address: 1955 N. Fremont Ave, MS 1203 Idaho Falls, Idaho 834 15 3.

  15. Jefferson Lab Public Affairs

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Web Design Photography Video Portfolio print version Public Affairs Links Home Journalists' Newsroom Media Photographic Archives What is Jefferson Lab? Community Outreach Public Affairs Children watch demonstrations of JLab equipment Take Our Children to Work Day Community Outreach JLab Event Calendar Schedule a Tour Speaker's Bureau Special Events K-12 Education Program Higher Education Programs JLab Public Newsroom JPIX Image Gallery Scientific Publications Database

  16. Session title: Distributed and intelligent databases

    SciTech Connect (OSTI)

    Argos, P.; Mewes, H.W.; Frishman, D.

    1996-12-31

    This session focuses on the recent advances in the delivery of information to the biological community concerning genome sequencing and related information. New approaches include interconnecting existing databases, knowledge-based expert systems, interface languages and multiserver management.

  17. About the Building Performance Database

    Broader source: Energy.gov [DOE]

    Recent technology, market and policy drivers - smart meters, energy performance disclosure laws, etc. - are resulting in a rapid increase in generation of data about buildings and their energy performance. But this data is still hard to access, and analyze because it is being housed in many decentralized and often proprietary databases. The DOE Building Performance Database (BPD) aims to bridge this gap by compiling and cleansing a large dataset required to assess the likely performance of energy efficiency retrofit measures and services. By making the data available anonymously and in aggregate, the BPD enables the public to gain value from the data while addressing the privacy needs of contributors.

  18. Information Science & Technology Institute Los Alamos National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Information Resources Information Resources Many resources are available from AMO to help manufacturers improve energy efficiency. Access our free online publications, databases, program highlights, webcasts, workshop results, and energy analysis. 2014_all_manufacturing_energy_carbon_footprint_Page_1.png Publications Search the AMO Publication and Product Library by technology area, category, or key word. Highlights Read about projects that lead to new technologies, improve existing

  19. About EIA - Policies - U.S. Energy Information Administration (EIA)

    Gasoline and Diesel Fuel Update (EIA)

    About EIA Copyrights and Reuse Public domain and use of EIA content U.S. government publications are in the public domain and are not subject to copyright protection. You may use and/or distribute any of our data, files, databases, reports, graphs, charts, and other information products that are on our website or that you receive through our email distribution service. However, if you use or reproduce any of our information products, you should use an acknowledgment, which includes the

  20. Midcontinent Interactive Digital Carbon Atlas and Relational Database (MIDCARB)

    SciTech Connect (OSTI)

    Timothy R. Carr; Scott W. White

    2002-06-01

    This annual report describes progress of the project entitled ''Midcontinent Interactive Digital Carbon Atlas and Relational Database (MIDCARB)''. This project, funded by the Department of Energy, is a cooperative project that assembles a consortium of five states (Indiana, Illinois, Kansas, Kentucky and Ohio) to construct an online distributed Relational Database Management System (RDBMS) and Geographic Information System (GIS) covering aspects of carbon dioxide geologic sequestration (http://www.midcarb.org). The system links the five states in the consortium into a coordinated regional database system consisting of datasets useful to industry, regulators and the public. The project is working to provide advanced distributed computing solutions to link database servers across the five states into a single system where data is maintained at the local level but is accessed through a single Web portal and can be queried, assembled, analyzed and displayed. Each individual state has strengths in data gathering, data manipulation and data display, including GIS mapping, custom application development, web development, and database design. Sharing of expertise provides the critical mass of technical expertise to improve CO{sub 2} databases and data access in all states. This project improves the flow of data across servers in the five states and increases the amount and quality of available digital data. The MIDCARB project is developing improved online tools to provide real-time display and analyze CO{sub 2} sequestration data. The system links together data from sources, sinks and transportation within a spatial database that can be queried online. Visualization of high quality and current data can assist decision makers by providing access to common sets of high quality data in a consistent manner.

  1. HANFORD NUCLEAR CRITICALITY SAFETY PROGRAM DATABASE

    SciTech Connect (OSTI)

    TOFFER, H.

    2005-05-02

    The Hanford Database is a useful information retrieval tool for a criticality safety practitioner. The database contains nuclear criticality literature screened for parameter studies. The entries, characterized with a value index, are segregated into 16 major and six minor categories. A majority of the screened entries have abstracts and a limited number are connected to the Office of Scientific and Technology Information (OSTI) database of full-size documents. Simple and complex searches of the data can be accomplished very rapidly and the end-product of the searches could be a full-size document. The paper contains a description of the database, user instructions, and a number of examples.

  2. Ordering Information

    Gasoline and Diesel Fuel Update (EIA)

    coal industry Natural gas trade (Table 4.3) Ordering Information This publication and other Energy Information Administration (EIA) publications may be purchased from the...

  3. RCRA information on hazardous wastes for publicly owned treatment works. Technical report

    SciTech Connect (OSTI)

    Not Available

    1985-09-01

    The guidance manual provides guidance to municipal personnel in understanding hazardous waste requirements of the Resource Conservation and Recovery Act (RCRA) and the implications of these RCRA requirements for the wastewater treatment plant operated by your municipality, for your local pretreatment program, and for local industries served by the treatment plant. The primary purpose of the manual is the RCRA notification requirement specified in the General Pretreatment Regulations. The manual focuses on Subtitle C requirements. (Subtitle C is directly applicable to industries since this program regulates generators, transporters, and disposers of hazardous waste). The manual also provides a general understanding of how federal RCRA requirements for hazardous waste affect industrial users. The manual also will be helpful in complying with any applicable federal requirements incumbent upon your POTW under Subtitle C of RCRA. The appendices contain lists of hazardous wastes regulated by federal requirements; selected EPA-approved forms for hazardous waste facilities to use; RCRA information brochure which briefly outlines the Act's impact on industries that generate or transport hazardous wastes; and EPA pamphlets summarizing information for generators of small quantities of hazardous waste.

  4. FOIA Update: The Freedom of Information Act, 5 U.S.C. sect. 552, As Amended By Public Law No. 104-

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    and Privacy Act Freedom of Information Act (link) FOIA Update: The Freedom of Information Act, 5 U.S.C. sect. 552, As Amended By Public Law No. 104- 231, 110 Stat. 3048 | OIP | Department of Justice DOE Savannah River Operations Office To make an Electronic FOIA (E-FOIA) request, please provide the information below. Failure to enter accurate and complete information may render your FOIA request impossible to fulfill. Requests submitted under the Privacy Act must be signed and, therefore, cannot

  5. DOE Science Showcase - Rare Earth Metal Research from DOE Databases |

    Office of Scientific and Technical Information (OSTI)

    OSTI, US Dept of Energy, Office of Scientific and Technical Information Rare Earth Metal Research from DOE Databases Information Bridge Energy Citations Database Highlighted documents of Rare Earth Metal research in DOE databases Information Bridge - Corrosion-resistant metal surfaces DOE R&D Project Summaries - Structural and magnetic studies on heavy rare earth metals at high pressures using designer diamonds Energy Citations Database - Intermultiplet transitions in rare-earth metals

  6. Overview of selected molecular biological databases

    SciTech Connect (OSTI)

    Rayl, K.D.; Gaasterland, T.

    1994-11-01

    This paper presents an overview of the purpose, content, and design of a subset of the currently available biological databases, with an emphasis on protein databases. Databases included in this summary are 3D-ALI, Berlin RNA databank, Blocks, DSSP, EMBL Nucleotide Database, EMP, ENZYME, FSSP, GDB, GenBank, HSSP, LiMB, PDB, PIR, PKCDD, ProSite, and SWISS-PROT. The goal is to provide a starting point for researchers who wish to take advantage of the myriad available databases. Rather than providing a complete explanation of each database, we present its content and form by explaining the details of typical entries. Pointers to more complete ``user guides`` are included, along with general information on where to search for a new database.

  7. UNIRIB: Publications

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    UNIRIB Publications The University Radioactive Ion Beam (UNIRIB) consortium contributes to numerous scholarly publications and presents research at a variety of international conferences. The following links provide bibliographical information about each article UNIRIB and its staff have published in recent years. 2013 bibliography 2012 bibliography 2011 bibliography 2010 bibliography 2009 bibliography 2008 bibliography 2007 bibliography 2006 bibliography Publications

  8. NREL: National Residential Efficiency Measures Database - Application

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Developer Tools Application Developer Tools Here you will find tools intended to help software application developers access the data in the National Residential Efficiency Measures Database. This database of retrofit measures and associated costs can be used by software applications that evaluate residential efficiency measures. Read more about the database and information about the cost data. Developer Tools Change log-View a list of changes to the National Residential Efficiency Measures

  9. Nevada National Security Site Cleanup Information Is Just a Click Away with Computer Map, Database- New Interactive Map Makes NNSS Data More Accessible to the Public

    Broader source: Energy.gov [DOE]

    LAS VEGAS, NV – For decades, the Nevada Site Office (NSO) has been investigating, characterizing, identifying, and performing corrective actions in areas contaminated by historical nuclear research...

  10. CEBAF Large Acceptance Spectrometer (CLAS) Physics Database

    DOE Data Explorer [Office of Scientific and Technical Information (OSTI)]

    A username and password are required to access and search the entire database. However, the Overview page provides links to detailed data pages for each of the experiments available for public access. There are many experiments with data that the public can freely access.

  11. NREL: National Residential Efficiency Measures Database - About the

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Database About the Database Here you will find more information about the purpose, audience, and uses for the National Residential Efficiency Measures Database. Purpose NREL developed this database on behalf of the U.S. Department of Energy. The purpose of this project is to provide a national unified database of residential building retrofit measures and associated costs. These data are accessible to software programs that evaluate most cost-effective retrofit measures to improve the energy

  12. NREL: Hydrogen and Fuel Cells Research - Publications

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Publications NREL researchers document their findings in technical reports, conference papers, journal articles, and fact sheets. The following online resources provide publications about hydrogen and fuel cell R&D. NREL Publications Database The NREL publications database offers a wide variety of documents related to hydrogen and fuel cell technologies. Search the database or find publications according to these popular keywords: Fuel cell electric vehicles | fuel cell backup power | fuel

  13. Energy science and technology database (on the internet). Online data

    SciTech Connect (OSTI)

    1997-12-01

    The Energy Science and Technology Database (EDB) is a multidisciplinary file containing worldwide references to basic and applied scientific and technical research literature. The information is collected for use by government managers, researchers at the national laboratories, and other research efforts sponsored by the U.S. Department of Energy, and the results of this research are transferred to the public. Abstracts are included for records from 1976 to the present. The EDB also contains the Nuclear Science Abstracts which is a comprehensive abstract and index collection to the international nuclear science and technology literature for the period 1948 through 1976. Included are scientific and technical reports of the U.S. Atomic Energy Commission, U.S. Energy Research and Development Administration and its contractors, other agencies, universities, and industrial and research organizations. Approximately 25% of the records in the file contain abstracts. Nuclear Science Abstracts contains over 900,000 bibliographic records. The entire Energy Science and Technology Database contains over 3 million bibliographic records. This database is now available for searching through the GOV. Research-Center (GRC) service. GRC is a single online web-based search service to well known Government databases. Featuring powerful search and retrieval software, GRC is an important research tool. The GRC web site is at http://grc.ntis.gov.

  14. DOE Global Energy Storage Database

    DOE Data Explorer [Office of Scientific and Technical Information (OSTI)]

    The DOE International Energy Storage Database has more than 400 documented energy storage projects from 34 countries around the world. The database provides free, up-to-date information on grid-connected energy storage projects and relevant state and federal policies. More than 50 energy storage technologies are represented worldwide, including multiple battery technologies, compressed air energy storage, flywheels, gravel energy storage, hydrogen energy storage, pumped hydroelectric, superconducting magnetic energy storage, and thermal energy storage. The policy section of the database shows 18 federal and state policies addressing grid-connected energy storage, from rules and regulations to tariffs and other financial incentives. It is funded through DOEs Sandia National Laboratories, and has been operating since January 2012.

  15. DOE Global Energy Storage Database

    DOE Data Explorer [Office of Scientific and Technical Information (OSTI)]

    The DOE International Energy Storage Database has more than 400 documented energy storage projects from 34 countries around the world. The database provides free, up-to-date information on grid-connected energy storage projects and relevant state and federal policies. More than 50 energy storage technologies are represented worldwide, including multiple battery technologies, compressed air energy storage, flywheels, gravel energy storage, hydrogen energy storage, pumped hydroelectric, superconducting magnetic energy storage, and thermal energy storage. The policy section of the database shows 18 federal and state policies addressing grid-connected energy storage, from rules and regulations to tariffs and other financial incentives. It is funded through DOE’s Sandia National Laboratories, and has been operating since January 2012.

  16. Network II Database

    Energy Science and Technology Software Center (OSTI)

    1994-11-07

    The Oak Ridge National Laboratory (ORNL) Rail and Barge Network II Database is a representation of the rail and barge system of the United States. The network is derived from the Federal Rail Administration (FRA) rail database.

  17. Pathogen Research Databases

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Pathogen Databases Pathogen Research Databases A new research frontier awaits! Our door is open and we thrive on mutually beneficial partnerships, collaborations that drive innovations and new technologies. HIV Databases The HIV and HCV databases contain data on viral genetic sequences, immunological epitopes, drug resistance-associated mutations, and vaccine trials. The websites also gives access to a large number of tools that can be used to analyze these data. These projects are funded by the

  18. Open Energy Information Systems - 2013 Peer Review | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    - 2013 Peer Review Open Energy Information Systems - 2013 Peer Review Emerging Technologies Project for the 2013 Building Technologies Office's Program Peer Review PDF icon emrgtech04_granderson_040213.pdf More Documents & Publications Open Energy Information Systems (OpenEIS) - 2014 Peer Review Buildings Performance Database - 2013 BTO Peer Review Energy Management Systems Package for Small Commercial Buildings

  19. Nuclear Concrete Materials Database Phase I Development

    SciTech Connect (OSTI)

    Ren, Weiju; Naus, Dan J

    2012-05-01

    The FY 2011 accomplishments in Phase I development of the Nuclear Concrete Materials Database to support the Light Water Reactor Sustainability Program are summarized. The database has been developed using the ORNL materials database infrastructure established for the Gen IV Materials Handbook to achieve cost reduction and development efficiency. In this Phase I development, the database has been successfully designed and constructed to manage documents in the Portable Document Format generated from the Structural Materials Handbook that contains nuclear concrete materials data and related information. The completion of the Phase I database has established a solid foundation for Phase II development, in which a digital database will be designed and constructed to manage nuclear concrete materials data in various digitized formats to facilitate electronic and mathematical processing for analysis, modeling, and design applications.

  20. Tools for Public Information

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Energy Tools for Discovery Offer Potential Hope for Huntington's Tools for Discovery Offer Potential Hope for Huntington's May 25, 2011 - 3:24pm Addthis Flora Meilleur prepares protein solutions for structural investigation with neutrons. | Courtesy of ORNL Flickr / Jason Richards Flora Meilleur prepares protein solutions for structural investigation with neutrons. | Courtesy of ORNL Flickr / Jason Richards Charles Rousseaux Charles Rousseaux Senior Communications Specialist (detailee) What

  1. Reservation Emergency Public Information

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    CNS, llc for the National Nuclear Security Administration (NNSA) Production Office. Y-12 is responsible for maintaining the safety, security and effectiveness of the U.S. nuclear weapons stockpile. Weapons component production, surveillance, dismantlement and storage are four distinct facets of this mission. Production includes the manufacture of new components, which oftentimes are combined with recycled components into subassemblies. This process, referred to as refurbishment, extends the

  2. Reservation Emergency Public Information

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    B&W Y-12 LLC for the National Nuclear Security Administration (NNSA) Production Office. Y-12 is responsible for maintaining the safety, security and effectiveness of the U.S. nuclear weapons stockpile. Weapons component production, surveillance, dismantlement and storage are four distinct facets of this mission. Production includes the manufacture of new components, which oftentimes are combined with recycled components into subassemblies. This process, referred to as refurbishment, extends

  3. Tools for Public Information

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    including Intellus, an online tool that provides transparency and accessibility to the environmental monitoring data from in and around Los Alamos National Laboratory. August 1,...

  4. Property:Tool Users | Open Energy Information

    Open Energy Info (EERE)

    "Tool Users" Showing 1 page using this property. N National Residential Efficiency Measures Database + The National Residential Efficiency Measures Database is a publicly...

  5. Deep Sky Astronomical Image Database

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Deep Sky Astronomical Image Database Deep Sky Astronomical Image Database Key Challenges: Develop, store, analyze, and make available an astronomical image database of...

  6. Public Outreach committee meeting

    Broader source: Energy.gov [DOE]

    The ORSSAB Public Outreach Committee meeting is open to the public. The conference call information will be provided as the meeting approaches.

  7. NREL: Energy Storage - Publications

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Publications Explore NREL's most recent and popular publications. A complete collection of NREL's transportation and energy storage publications can be found in the NREL Publications Database. Papers, Presentations, and Posters Fact sheets Papers, Presentations, and Posters 2016 | 2015 | 2014 | 2013 | 2012 | 2011 | 2010 | 2009 | 2008 | 2007 | 2006 | 2005 | 2004 | 2003 | 2002 | 2001 | 2000 | 1999 | 1998 | 1997 | 1996 | 1995 | 1994 2016 NREL Multiphysics Modeling Tools and ISC Device for Designing

  8. PDS: A Performance Database Server

    DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

    Berry, Michael W.; Dongarra, Jack J.; Larose, Brian H.; Letsche, Todd A.

    1994-01-01

    The process of gathering, archiving, and distributing computer benchmark data is a cumbersome task usually performed by computer users and vendors with little coordination. Most important, there is no publicly available central depository of performance data for all ranges of machines from personal computers to supercomputers. We present an Internet-accessible performance database server (PDS) that can be used to extract current benchmark data and literature. As an extension to the X-Windows-based user interface (Xnetlib) to the Netlib archival system, PDS provides an on-line catalog of public domain computer benchmarks such as the LINPACK benchmark, Perfect benchmarks, and the NAS parallelmore » benchmarks. PDS does not reformat or present the benchmark data in any way that conflicts with the original methodology of any particular benchmark; it is thereby devoid of any subjective interpretations of machine performance. We believe that all branches (research laboratories, academia, and industry) of the general computing community can use this facility to archive performance metrics and make them readily available to the public. PDS can provide a more manageable approach to the development and support of a large dynamic database of published performance metrics.« less

  9. Development of an Integrated Natural Barrier Database System for Site Evaluation of a Deep Geologic Repository in Korea - 13527

    SciTech Connect (OSTI)

    Jung, Haeryong; Lee, Eunyong; Jeong, YiYeong; Lee, Jeong-Hwan

    2013-07-01

    Korea Radioactive-waste Management Corporation (KRMC) established in 2009 has started a new project to collect information on long-term stability of deep geological environments on the Korean Peninsula. The information has been built up in the integrated natural barrier database system available on web (www.deepgeodisposal.kr). The database system also includes socially and economically important information, such as land use, mining area, natural conservation area, population density, and industrial complex, because some of this information is used as exclusionary criteria during the site selection process for a deep geological repository for safe and secure containment and isolation of spent nuclear fuel and other long-lived radioactive waste in Korea. Although the official site selection process has not been started yet in Korea, current integrated natural barrier database system and socio-economic database is believed that the database system will be effectively utilized to narrow down the number of sites where future investigation is most promising in the site selection process for a deep geological repository and to enhance public acceptance by providing readily-available relevant scientific information on deep geological environments in Korea. (authors)

  10. SWNVF: database contents

    National Nuclear Security Administration (NNSA)

    Nevada Test Site (NTS). The database complies with protocols of Structured Query Language (SQL), allowing construction of relationships among these data, from...

  11. Lessons Learned From Developing Reactor Pressure Vessel Steel Embrittlement Database

    SciTech Connect (OSTI)

    Wang, Jy-An John

    2010-08-01

    Materials behaviors caused by neutron irradiation under fission and/or fusion environments can be little understood without practical examination. Easily accessible material information system with large material database using effective computers is necessary for design of nuclear materials and analyses or simulations of the phenomena. The developed Embrittlement Data Base (EDB) at ORNL is this comprehensive collection of data. EDB database contains power reactor pressure vessel surveillance data, the material test reactor data, foreign reactor data (through bilateral agreements authorized by NRC), and the fracture toughness data. The lessons learned from building EDB program and the associated database management activity regarding Material Database Design Methodology, Architecture and the Embedded QA Protocol are described in this report. The development of IAEA International Database on Reactor Pressure Vessel Materials (IDRPVM) and the comparison of EDB database and IAEA IDRPVM database are provided in the report. The recommended database QA protocol and database infrastructure are also stated in the report.

  12. MTBreg: The Database of Conditionally Regulated Proteins in Mycobacterium Tuberculosis

    DOE Data Explorer [Office of Scientific and Technical Information (OSTI)]

    Kaufman, Markus; Pal, Debnath; Eisenberg, David

    Proteins up- and down- regulated in Mycobacterium tuberculosis grown under conditions mimicking infection are included in this database. It also includes information on proteins that are regulated by selected transcription factors or other regulatory proteins. The literature data provided here is complimentary to the databases provided by Michael Strong that include recent TB computational functional linkages and the Prolinks Database by Peter Bowers. The experimental condition, the experimental dataset and a literature reference will be displayed, including links to the computationally linked proteins in the Prolinks Database and the entry in the Mycobacterium tuberculosis Structural Genomics Database.[Copied from information at http://www.doe-mbi.ucla.edu/Services/MTBreg/

  13. Frequently Asked Questions About the Building Performance Database |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy Commercial Buildings » Analysis Tools » Building Performance Database » Frequently Asked Questions About the Building Performance Database Frequently Asked Questions About the Building Performance Database On this page you will find answers to frequently asked questions pertaining to the DOE Buildings Performance Database (BPD). General What is the purpose of the BPD? What building energy performance data is included in the BPD? Access Information How can I access the

  14. Industrial Assistance and Projects Databases | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Industrial Assistance and Projects Databases Industrial Assistance and Projects Databases AMO's databases provide information on energy assessments and recommendations, results and paybacks, and lessons learned by manufacturers who implement projects to save energy. Also review case studies from manufacturers. Combined Heat and Power (CHP) Project Profiles Database Arrow DOE's CHP Technical Assistance Partnerships (CHP TAPs) have compiled a select number of CHP project profiles. The documents

  15. Selected Publications

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    impact / selected publications

  16. BioImaging Database

    Energy Science and Technology Software Center (OSTI)

    2006-10-25

    The Biolmaging Database (BID) is a relational database developed to store the data and meta-data for the 3D gene expression in early Drosophila embryo development on a cellular level. The schema was written to be used with the MySQL DBMS but with minor modifications can be used on any SQL compliant relational DBMS.

  17. ARM - People Contact Information

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    govPeople DirectoryReports ARM People Database Reports Email List Owner Information Email List Membership Information (password required) CategoryProgram List Membership...

  18. Hanford Site technical baseline database. Revision 1

    SciTech Connect (OSTI)

    Porter, P.E.

    1995-01-27

    This report lists the Hanford specific files (Table 1) that make up the Hanford Site Technical Baseline Database. Table 2 includes the delta files that delineate the differences between this revision and revision 0 of the Hanford Site Technical Baseline Database. This information is being managed and maintained on the Hanford RDD-100 System, which uses the capabilities of RDD-100, a systems engineering software system of Ascent Logic Corporation (ALC). This revision of the Hanford Site Technical Baseline Database uses RDD-100 version 3.0.2.2 (see Table 3). Directories reflect those controlled by the Hanford RDD-100 System Administrator. Table 4 provides information regarding the platform. A cassette tape containing the Hanford Site Technical Baseline Database is available.

  19. Diffusion Databases for ICME | Department of Energy

    Broader source: Energy.gov (indexed) [DOE]

    1 DOE Hydrogen and Fuel Cells Program, and Vehicle Technologies Program Annual Merit Review and Peer Evaluation PDF icon lm036_warren_2011_o.pdf More Documents & Publications Diffusion Databases for Mg-ICME Vehicle Technologies Office: 2010 Lightweight Materials R&D Annual Progress Report Low-Cost Direct Bonded Aluminum (DBA) Substrates

  20. NREL: National Residential Efficiency Measures Database Home Page

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    The National Residential Efficiency Measures Database is a publicly available, centralized resource of residential building retrofit measures and costs for the U.S. building industry. With support from the U.S. Department of Energy, NREL developed this tool to help users determine the most cost-effective retrofit measures for improving energy efficiency of existing homes. Learn more about the database. By accessing the database, the user agrees to the terms and conditions of use. View Data Now

  1. NREL: Geothermal Technologies - Publications

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Publications NREL's geothermal team develops publications, including technical reports and conference papers, about geothermal resource assessments, market and policy analysis, and geothermal research and development (R&D) activities. In addition to the selected documents available below, you can find resources on the U.S. Department of Energy (DOE) Geothermal Technologies Office website or search the NREL Publications Database. Learn more about how research at NREL is accelerating

  2. DOE Science Showcase - Neutron Science Research from DOE Databases | OSTI,

    Office of Scientific and Technical Information (OSTI)

    US Dept of Energy, Office of Scientific and Technical Information DOE Science Showcase - Neutron Science Research from DOE Databases Additional neutron science research in DOE Databases Information Bridge Neutron scattering research was pioneered in 1946 by ORNL's Clifford G. Shull, winner of 1994 Nobel Prize in Physics. Access Shull's early research records in Energy Citations Database. Neutron scattering research was pioneered in 1946 by ORNL's Clifford G. Shull, winner of 1994 Nobel Prize

  3. Fact Sheet: Energy Storage Database (October 2012) | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Database (October 2012) Fact Sheet: Energy Storage Database (October 2012) DOE and Sandia National Laboratories are developing a database of energy storage projects and policies that will present current information about energy storage projects worldwide and U.S. energy storage policy in an easy-to-use and intuitive format. Users will be able to search by region, technology, service territory, benefit stream, and other project or policy statistics. For more information about how OE performs

  4. Rate Information

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    links Financial Information Financial Public Processes Asset Management Cost Verification Process Rate Cases Rate Information Current Power Rates Current Transmission Rates...

  5. Requirements Management Database

    Energy Science and Technology Software Center (OSTI)

    2009-08-13

    This application is a simplified and customized version of the RBA and CTS databases to capture federal, site, and facility requirements, link to actions that must be performed to maintain compliance with their contractual and other requirements.

  6. National Solar Radiation Database 1991-2010 Update: User's Manual

    SciTech Connect (OSTI)

    Wilcox, S. M.

    2012-08-01

    This user's manual provides information on the updated 1991-2010 National Solar Radiation Database. Included are data format descriptions, data sources, production processes, and information about data uncertainty.

  7. Marine and Hydrokinetic (MHK) Databases and Systems

    SciTech Connect (OSTI)

    2015-01-01

    The online information resources included in this fact sheet were developed with support from the U.S. Department of Energy, and are designed to provide the public access to information pertaining to MHK technologies, projects, and research.

  8. Ceramic Technology Project database: September 1990 summary report

    SciTech Connect (OSTI)

    Keyes, B.L.P.

    1992-06-01

    Data generated within the Ceramic Technology Project (CTP) represent a valuable resource for both research and industry. The CTP database was created to provide easy access to this information in electronic and hardcopy forms by using a computerized database and by issuing periodic hardcopy reports on the database contents. This report is the sixth in a series of semiannual database summaries and covers recent additions to the database, including joined brazed specimen test data. It covers 1 SiC, 34 SiN, 10 whisker-reinforced SiN, 2 zirconia-toughened aluminas, 8 zirconias, and 34 joints.

  9. DIP: The Database of Interacting Proteins

    DOE Data Explorer [Office of Scientific and Technical Information (OSTI)]

    The DIP Database catalogs experimentally determined interactions between proteins. It combines information from a variety of sources to create a single, consistent set of protein-protein interactions. By interaction, the DIP Database creators mean that two amino acid chains were experimentally identified to bind to each other. The database lists such pairs to aid those studying a particular protein-protein interaction but also those investigating entire regulatory and signaling pathways as well as those studying the organisation and complexity of the protein interaction network at the cellular level. The data stored within the DIP database were curated, both, manually by expert curators and also automatically using computational approaches that utilize the knowledge about the protein-protein interaction networks extracted from the most reliable, core subset of the DIP data. It is a relational database that can be searched by protein, sequence, motif, article information, and pathBLAST. The website also serves as an access point to a number of projects related to DIP, such as LiveDIP, The Database of Ligand-Receptor Partners (DLRP) and JDIP. Users have free and open access to DIP after login. [Taken from the DIP Guide and the DIP website] (Specialized Interface) (Registration Required)

  10. OpenEI Community - Database

    Open Energy Info (EERE)

    Announcing New Utility Rate Database and API Features http:en.openei.orgcommunityblogannouncing-new-utility-rate-database-and-api-features

    NREL, in collaboration with...

  11. Database Performance Monitoring for the Photovoltaic Systems

    SciTech Connect (OSTI)

    Klise, Katherine A.

    2015-10-01

    The Database Performance Monitoring (DPM) software (copyright in processes) is being developed at Sandia National Laboratories to perform quality control analysis on time series data. The software loads time indexed databases (currently csv format), performs a series of quality control tests defined by the user, and creates reports which include summary statistics, tables, and graphics. DPM can be setup to run on an automated schedule defined by the user. For example, the software can be run once per day to analyze data collected on the previous day. HTML formatted reports can be sent via email or hosted on a website. To compare performance of several databases, summary statistics and graphics can be gathered in a dashboard view which links to detailed reporting information for each database. The software can be customized for specific applications.

  12. Transport NAMA Database | Open Energy Information

    Open Energy Info (EERE)

    Website: www.transport-namadatabase.orgindex.phpMainPage Transport Toolkit Region(s): Latin America & Caribbean, Africa & Middle East, Europe, Asia Related Tools Climate...

  13. Transparent Cost Database | Open Energy Information

    Open Energy Info (EERE)

    Biomass Combustion, - Biomass Gasification, - Biomass Pyrolysis, - Landfill Gas, Fuels & Efficiency, Geothermal, Ground Source Heat Pumps, Hydrogen, Solar, - Concentrating Solar...

  14. Utility Rate Database | Open Energy Information

    Open Energy Info (EERE)

    Islands Norway Oman Pakistan Palau Palestinian Territories Panama Papua New Guinea Paraguay Peru Philippines Pitcairn Islands Poland Portugal Puerto Rico Qatar Romania Russia...

  15. High Performance Buildings Database | Open Energy Information

    Open Energy Info (EERE)

    >Owner: Miller Brothers Construction Inc.

  16. NAMA Database Wiki | Open Energy Information

    Open Energy Info (EERE)

    is to share these activities so that countries and other participants are able to learn from these experiences and gain insights into how mitigation activities can be...

  17. Coal Power Plant Database | Open Energy Information

    Open Energy Info (EERE)

    needs updating Image needs updating Reference needed Missing content Broken link Other Additional Comments Cancel Submit Categories: Datasets Articles with outstanding TODO tasks...

  18. Nama Database Wiki | Open Energy Information

    Open Energy Info (EERE)

    Topics: Finance, Low emission development planning, -NAMA Resource Type: Guidemanual, Lessons learnedbest practices, Training materials User Interface: Website ComplexityEase...

  19. National Solar Radiation Database | Open Energy Information

    Open Energy Info (EERE)

    Program Website4 Program Website5 References http:www.nrel.govnewspress2007516.html http:rredc.nrel.govsolarpubsNSRDBbackground.html http:...

  20. Enhancing the DNA Patent Database

    SciTech Connect (OSTI)

    Walters, LeRoy B.

    2008-02-18

    Final Report on Award No. DE-FG0201ER63171 Principal Investigator: LeRoy B. Walters February 18, 2008 This project successfully completed its goal of surveying and reporting on the DNA patenting and licensing policies at 30 major U.S. academic institutions. The report of survey results was published in the January 2006 issue of Nature Biotechnology under the title The Licensing of DNA Patents by US Academic Institutions: An Empirical Survey. Lori Pressman was the lead author on this feature article. A PDF reprint of the article will be submitted to our Program Officer under separate cover. The project team has continued to update the DNA Patent Database on a weekly basis since the conclusion of the project. The database can be accessed at dnapatents.georgetown.edu. This database provides a valuable research tool for academic researchers, policymakers, and citizens. A report entitled Reaping the Benefits of Genomic and Proteomic Research: Intellectual Property Rights, Innovation, and Public Health was published in 2006 by the Committee on Intellectual Property Rights in Genomic and Protein Research and Innovation, Board on Science, Technology, and Economic Policy at the National Academies. The report was edited by Stephen A. Merrill and Anne-Marie Mazza. This report employed and then adapted the methodology developed by our research project and quoted our findings at several points. (The full report can be viewed online at the following URL: http://www.nap.edu/openbook.php?record_id=11487&page=R1). My colleagues and I are grateful for the research support of the ELSI program at the U.S. Department of Energy.

  1. National Residential Efficiency Measures Database Aimed at Reducing Risk for Residential Retrofit Industry

    SciTech Connect (OSTI)

    David Roberts

    2012-01-01

    This technical highlight describes NREL research to develop a publicly available database of energy retrofit measures containing performance characteristics and cost estimates for nearly 3,000 measures.

  2. The Genomes On Line Database (GOLD) in 2009: status of genomic and metagenomic projects and their associated metadata

    SciTech Connect (OSTI)

    Liolios, Konstantinos; Chen, Amy; Mavromatis, Konstantinos; Tavernarakis, Nektarios; Hugenholtz, Phil; Markowitz, Victor; Kyrpides, Nikos C.

    2009-09-01

    The Genomes On Line Database (GOLD) is a comprehensive resource for centralized monitoring of genome and metagenome projects worldwide. Both complete and ongoing projects, along with their associated metadata, can be accessed in GOLD through precomputed tables and a search page. As of September 2009, GOLD contains information for more than 5800 sequencing projects, of which 1100 have been completed and their sequence data deposited in a public repository. GOLD continues to expand, moving toward the goal of providing the most comprehensive repository of metadata information related to the projects and their organisms/environments in accordance with the Minimum Information about a (Meta)Genome Sequence (MIGS/MIMS) specification.

  3. Sandia Wind Turbine Loads Database

    DOE Data Explorer [Office of Scientific and Technical Information (OSTI)]

    The Sandia Wind Turbine Loads Database is divided into six files, each corresponding to approximately 16 years of simulation. The files are text files with data in columnar format. The 424MB zipped file containing six data files can be downloaded by the public. The files simulate 10-minute maximum loads for the NREL 5MW wind turbine. The details of the loads simulations can be found in the paper: Decades of Wind Turbine Loads Simulations, M. Barone, J. Paquette, B. Resor, and L. Manuel, AIAA2012-1288 (3.69MB PDF). Note that the site-average wind speed is 10 m/s (class I-B), not the 8.5 m/s reported in the paper.

  4. Sandia Wind Turbine Loads Database

    DOE Data Explorer [Office of Scientific and Technical Information (OSTI)]

    The Sandia Wind Turbine Loads Database is divided into six files, each corresponding to approximately 16 years of simulation. The files are text files with data in columnar format. The 424MB zipped file containing six data files can be downloaded by the public. The files simulate 10-minute maximum loads for the NREL 5MW wind turbine. The details of the loads simulations can be found in the paper: “Decades of Wind Turbine Loads Simulations”, M. Barone, J. Paquette, B. Resor, and L. Manuel, AIAA2012-1288 (3.69MB PDF). Note that the site-average wind speed is 10 m/s (class I-B), not the 8.5 m/s reported in the paper.

  5. EIA publications directory, 1992

    SciTech Connect (OSTI)

    Not Available

    1993-06-24

    This directory contains abstracts and ordering information for EIA publications. The abstracts are arranged by broad subject category such as coal, petroleum, natural gas, and electric power. A comprehensive subject index, a title index, and a report number index are included. Each entry gives the title, report number, publication frequency, date, number of pages, and ordering information. Publication began with the 1979 edition.

  6. Redis database administration tool

    Energy Science and Technology Software Center (OSTI)

    2013-02-13

    MyRedis is a product of the Lorenz subproject under the ASC Scirntific Data Management effort. MyRedis is a web based utility designed to allow easy administration of instances of Redis databases. It can be usedd to view and manipulate data as well as run commands directly against a variety of different Redis hosts.

  7. BPO crude oil analysis data base user`s guide: Methods, publications, computer access correlations, uses, availability

    SciTech Connect (OSTI)

    Sellers, C.; Fox, B.; Paulz, J.

    1996-03-01

    The Department of Energy (DOE) has one of the largest and most complete collections of information on crude oil composition that is available to the public. The computer program that manages this database of crude oil analyses has recently been rewritten to allow easier access to this information. This report describes how the new system can be accessed and how the information contained in the Crude Oil Analysis Data Bank can be obtained.

  8. D3 website database | Department of Energy

    Broader source: Energy.gov (indexed) [DOE]

    2009 DOE Hydrogen Program and Vehicle Technologies Program Annual Merit Review and Peer Evaluation Meeting, May 18-22, 2009 -- Washington D.C. PDF icon vssp_19_keller.pdf More Documents & Publications Advanced Vehicle Benchmarking of HEVs and PHEVs Argonne Facilitation of PHEV Standard Testing Procedure (SAE J1711) AVTA: 2012 Toyota Prius PHEV Downloadable Dynamometer Database Reports

  9. ARTI Refrigerant Database. [Quarterly progress report, 1 July 1993--30 September 1993

    SciTech Connect (OSTI)

    Calm, J.M.

    1993-11-28

    The Refrigerant Database consolidates and facilitates access to information to assist industry in developing equipment using alternative refrigerants. The underlying purpose is to accelerate phase out of chemical compounds of environmental concern. The database provides bibliographic citations and abstracts for publications that may be useful in research and design of air-conditioning and refrigeration equipment. The complete documents are not included, though some may be added at a later date. The database identifies sources of specific information on R-32, R-123, R-124, R-125, R-134, R134a, R-141b, R-142b, R-143a, R-152a, R-227ea, R-245ca, R-290 (propane), R-717 (ammonia), ethers, and others as well as azeotropic and zeotropic blends of these fluids. It addresses lubricants including alkylbenzene, polyalkylene glycol, polyol ester, and other synthetics as well as mineral oils. It also references documents addressing compatibility of refrigerants and lubricants with metals, plastics, elastomers, motor insulation, and other materials used in refrigerant circuits. Incomplete citations or abstracts are provided for some documents. They are included to accelerate availability of the information and will be completed or replaced in future updates.

  10. System maintenance verification and validation plan for the TWRS controlled baseline database system

    SciTech Connect (OSTI)

    Spencer, S.G.

    1998-09-23

    TWRS Controlled Baseline Database, formally known as the Performance Measurement Control System, is used to track and monitor TWRS project management baseline information. This document contains the verification and validation approach for system documentation changes within the database system.

  11. MHK Materials Database

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Materials Database - Sandia Energy Energy Search Icon Sandia Home Locations Contact Us Employee Locator Energy & Climate Secure & Sustainable Energy Future Stationary Power Energy Conversion Efficiency Solar Energy Wind Energy Water Power Supercritical CO2 Geothermal Natural Gas Safety, Security & Resilience of the Energy Infrastructure Energy Storage Nuclear Power & Engineering Grid Modernization Battery Testing Nuclear Fuel Cycle Defense Waste Management Programs Advanced

  12. NREL Publications Win Awards

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Publications Win Awards For more information contact: e:mail: Public Affairs Golden, Colo., April 17, 1998 — Six publications written at the U.S. Department of Energy's National Renewable Energy Laboratory earned international awards from the Society for Technical Communications (STC). The awards were part of STC's International Technical Publications Competition. Fifteen publications (including the six international winners) also won awards in STC's Rocky Mountain Chapter's annual

  13. What Can We Learn from Hydrogen Safety Event Databases? | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy What Can We Learn from Hydrogen Safety Event Databases? What Can We Learn from Hydrogen Safety Event Databases? Download presentation slides from the DOE Fuel Cell Technologies Office webinar "What Can We Learn from Hydrogen Safety Event Databases?" held on September 10, 2013. PDF icon What Can We Learn from Hydrogen Safety Event Databases? Webinar Slides More Documents & Publications Hydrogen Safety Knowledge Tools H2 Safety Snapshot, Vol. 1, Issue 1, April 2009

  14. Public Outreach Fact Sheet

    Office of Energy Efficiency and Renewable Energy (EERE)

    This fact sheet provides information about the U.S. Department of Energy Office of Legacy Management public outreach principles and approaches.

  15. NREL: National Residential Efficiency Measures Database - Change Log

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    History Change Log History Here you can view a list of changes to the National Residential Efficiency Measures Database. Version Date Description v3.0.0 3/21/13 Public Release v2.0.0 11/1/10 Public Release v1.0.0 2/26/10 Public Release v1.0.0Beta 2/18/10 DOE Lab Review

  16. Hydrogen Storage Materials Database Demonstration

    Broader source: Energy.gov [DOE]

    Presentation slides from the Fuel Cell Technologies Office webinar "Hydrogen Storage Materials Database Demonstration" held December 13, 2011.

  17. NREL Updates Solar Radiation Database - News Releases | NREL

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Solar Radiation Database, a web-based technical report that provides critical information about solar and meteorological data for 1,454 locations in the U.S. and its territories. ...

  18. Regional Geology: GIS Database for Alternative Host Rocks and...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    The objective of this work is to develop a spatial database that integrates both geologic data for alternative host-rock formations and information that has been historically used ...

  19. OSTI, US Dept of Energy, Office of Scientific and Technical Information |

    Office of Scientific and Technical Information (OSTI)

    Speeding access to science information from DOE and Beyond Products and Content Topic SciTech Connect, Primary Repository for DOE Scientific and Technical Information, Turns Two by Catherine Pepmiller 02 Apr, 2015 in Products and Content As Spring 2015 rolls around, it's time to mark a momentous occasion in the history of SciTech Connect: it's turning TWO! SciTech Connect is a publicly available database of bibliographic citations for energy-related scientific and technical information

  20. OSTI, US Dept of Energy, Office of Scientific and Technical Information |

    Office of Scientific and Technical Information (OSTI)

    Speeding access to science information from DOE and Beyond Connect, Primary Repository for DOE Scientific and Technical Information, Turns Two by Catherine Pepmiller on Thu, Apr 2, 2015 As Spring 2015 rolls around, it's time to mark a momentous occasion in the history of SciTech Connect: it's turning TWO! SciTech Connect is a publicly available database of bibliographic citations for energy-related scientific and technical information (STI), including technical reports, journal articles,

  1. Buildings Performance Database (BPD) - 2014 BTO Peer Review | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy (BPD) - 2014 BTO Peer Review Buildings Performance Database (BPD) - 2014 BTO Peer Review Project Objective The overall goal of the Buildings Performance Database (BPD) is to provide public access to high-quality building characteristics and energy consumption data to incentivize, analyze, and validate energy efficiency investments. The project's objectives for this year are to: (1) significantly increase data acquisition, mapping, and cleansing, including an enhanced process for

  2. Indian Renewable Energy and Energy Efficiency Policy Database (Fact Sheet)

    SciTech Connect (OSTI)

    Bushe, S.

    2013-09-01

    This fact sheet provides an overview of the Indian Renewable Energy and Energy Efficiency Policy Database (IREEED) developed in collaboration by the United States Department of Energy and India's Ministry of New and Renewable Energy. IREEED provides succinct summaries of India's central and state government policies and incentives related to renewable energy and energy efficiency. The online, public database was developed under the U.S.- India Energy Dialogue and the Clean Energy Solution Center.

  3. DOE Science Showcase - Carbon Capture research in DOE Databases | OSTI,

    Office of Scientific and Technical Information (OSTI)

    US Dept of Energy, Office of Scientific and Technical Information DOE Science Showcase - Carbon Capture research in DOE Databases Information Bridge : Natural materials for carbon capture. ... Realistic costs of carbon capture ... Technology and international climate policy Energy Citations Database : What Can China Do? China's Best Alternative Outcome for Energy Efficiency and CO2 Emissions ... Effects of warming on the structure and function of a boreal black spruce forest ...

  4. Mining Bug Databases for Unidentified Software Vulnerabilities

    SciTech Connect (OSTI)

    Dumidu Wijayasekara; Milos Manic; Jason Wright; Miles McQueen

    2012-06-01

    Identifying software vulnerabilities is becoming more important as critical and sensitive systems increasingly rely on complex software systems. It has been suggested in previous work that some bugs are only identified as vulnerabilities long after the bug has been made public. These vulnerabilities are known as hidden impact vulnerabilities. This paper discusses the feasibility and necessity to mine common publicly available bug databases for vulnerabilities that are yet to be identified. We present bug database analysis of two well known and frequently used software packages, namely Linux kernel and MySQL. It is shown that for both Linux and MySQL, a significant portion of vulnerabilities that were discovered for the time period from January 2006 to April 2011 were hidden impact vulnerabilities. It is also shown that the percentage of hidden impact vulnerabilities has increased in the last two years, for both software packages. We then propose an improved hidden impact vulnerability identification methodology based on text mining bug databases, and conclude by discussing a few potential problems faced by such a classifier.

  5. APS Recent Publications | For the week ending 01.03.2016

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    list of entries in the APS Publications Database does not include abstracts, invited talks, awards, magazine articles, or patents. For complete lists, search the APS Publications...

  6. A snapshot in time - the new TRUplanner database

    SciTech Connect (OSTI)

    Estill, Wesley Gordon; Crawford, Beverly; Van Soest, Greg

    2010-01-01

    A new database was developed to augment transuranic (TRU) waste inventory information already captured within the Comprehensive Inventory Database (CID). This new database, known as the TRUplanner, includes information focused on site capability for TRU waste certification and availability to ship to either the Waste Isolation Pilot Plant (WIPP) or Idaho National Laboratory for final characterization and certification before coming to WIPP. Waste stream specific data is imported from the CID to the TRUplanner, and additional data is collected and entered as a result of interviews and site visits. This data is continuously updated as sites are visited.

  7. EIA Publications Directory 1993

    SciTech Connect (OSTI)

    Not Available

    1994-07-18

    This directory contains abstracts and ordering information for EIA publications released in the above time period. The abstracts are arranged by broad subject category such as coal, petroleum, natural gas, and electric power. A comprehensive subject index, a title index, and a report number index are included. Each entry gives the title, report number, publication frequency, date, number of pages, and ordering information.

  8. Coal Distribution Database, 2006

    U.S. Energy Information Administration (EIA) Indexed Site

    Report - Annual provides detailed information on domestic coal distribution by origin state, destination state, consumer category, and method of transportation. Also provided is...

  9. Ribosomal Database Project II

    DOE Data Explorer [Office of Scientific and Technical Information (OSTI)]

    The Ribosomal Database Project (RDP) provides ribosome related data and services to the scientific community, including online data analysis and aligned and annotated Bacterial small-subunit 16S rRNA sequences. As of March 2008, RDP Release 10 is available and currently (August 2009) contains 1,074,075 aligned 16S rRNA sequences. Data that can be downloaded include zipped GenBank and FASTA alignment files, a histogram (in Excel) of the number of RDP sequences spanning each base position, data in the Functional Gene Pipeline Repository, and various user submitted data. The RDP-II website also provides numerous analysis tools.[From the RDP-II home page at http://rdp.cme.msu.edu/index.jsp

  10. Second-Tier Database for Ecosystem Focus, 2000-2001 Annual Report.

    SciTech Connect (OSTI)

    Van Holmes, Chris; Muongchanh, Christine; Anderson, James J.

    2001-11-01

    The Second-Tier Database for Ecosystem Focus (Contract 00004124) provides direct and timely public access to Columbia Basin environmental, operational, fishery and riverine data resources for federal, state, public and private entities. The Second-Tier Database known as Data Access in Realtime (DART) does not duplicate services provided by other government entities in the region. Rather, it integrates public data for effective access, consideration and application.

  11. National Residential Efficiency Measures Database Webinar Slides...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    National Residential Efficiency Measures Database Webinar Slides National Residential Efficiency Measures Database Webinar Slides Presentation slides for the Building Technologies ...

  12. OSTI, US Dept of Energy, Office of Scientific and Technical Information |

    Office of Scientific and Technical Information (OSTI)

    Speeding access to science information from DOE and Beyond hearing Topic DOE Releases Manhattan District History and Oppenheimer Personnel Hearing Transcript via OSTI-Hosted OpenNet by Rita Hohenbrink 09 Oct, 2014 in The Department of Energy (DOE) recently completed two significant declassification efforts and has made the newly released documents publicly available on the OpenNet database, which DOE launched 20 years ago to improve public access to declassified documents. The website is

  13. OSTI, US Dept of Energy, Office of Scientific and Technical Information |

    Office of Scientific and Technical Information (OSTI)

    Speeding access to science information from DOE and Beyond security Topic DOE Releases Manhattan District History and Oppenheimer Personnel Hearing Transcript via OSTI-Hosted OpenNet by Rita Hohenbrink 09 Oct, 2014 in The Department of Energy (DOE) recently completed two significant declassification efforts and has made the newly released documents publicly available on the OpenNet database, which DOE launched 20 years ago to improve public access to declassified documents. The website is

  14. OSTI, US Dept of Energy, Office of Scientific and Technical Information |

    Office of Scientific and Technical Information (OSTI)

    Speeding access to science information from DOE and Beyond OpenNet Topic DOE Releases Manhattan District History and Oppenheimer Personnel Hearing Transcript via OSTI-Hosted OpenNet by Rita Hohenbrink 09 Oct, 2014 in The Department of Energy (DOE) recently completed two significant declassification efforts and has made the newly released documents publicly available on the OpenNet database, which DOE launched 20 years ago to improve public access to declassified documents. The website is

  15. OSTI, US Dept of Energy, Office of Scientific and Technical Information |

    Office of Scientific and Technical Information (OSTI)

    Speeding access to science information from DOE and Beyond Releases Manhattan District History and Oppenheimer Personnel Hearing Transcript via OSTI-Hosted OpenNet by Rita Hohenbrink on Thu, Oct 9, 2014 The Department of Energy (DOE) recently completed two significant declassification efforts and has made the newly released documents publicly available on the OpenNet database, which DOE launched 20 years ago to improve public access to declassified documents. The website is supported by the

  16. Public Assembly | Open Energy Information

    Open Energy Info (EERE)

    whether in private or non-private meeting halls. Sub Categories social or meeting (e.g. community center, lodge, meeting hall, convention center, senior center); recreation...

  17. Database | OpenEI Community

    Open Energy Info (EERE)

    State University, with funding from the Department of Energy Sunshot Program, has enhanced the U.S. Utility Rate Database with the following new features: Kyoung's picture...

  18. 09-Databases-Wahid.pptx

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Wahid Bhimji (wbhimji@lbl.gov) https:www.nersc.govusersdata- analyticsdata-management Databases and IO --- 1 --- Systems Services Tools Capabilities Transfer Processing...

  19. Sandia Wind Turbine Loads Database

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Wind Turbine Loads Database - Sandia Energy Energy Search Icon Sandia Home Locations ... Stationary Power Energy Conversion Efficiency Solar Energy Wind Energy Water Power ...

  20. Energy Citations Database (ECD) - Architecture

    Office of Scientific and Technical Information (OSTI)

    Search Architecture - What Is under the hood? The Energy Citations Database makes searchable over two million bibliographic citations for energy and energy related STI from the...

  1. PUBLIC SUBMISSION

    Energy Savers [EERE]

    ANDREW%20J.%20FERLIC_cover_DRAFT-0002.html[2/3/2012 12:37:00 PM] PUBLIC SUBMISSION As of: February 03, 2012 Received: December 29, 2011 Status: Pending_Post Tracking No. 80f8ad44 Comments Due: January 20, 2012 Submission Type: Web Docket: DOE-HQ-2012-0004 U.S. Department of Energy Audit Guidance: For-Profit Recipients Comment On: DOE-HQ-2012-0004-0001 Audit Guidance: For-Profit Recipients Document: DOE-HQ-2012-0004-DRAFT-0002 Comment on FR Doc # 2011-32622 Submitter Information Name: ANDREW J.

  2. PUBLIC SUBMISSION

    Energy Savers [EERE]

    6.html[2/3/2012 12:44:00 PM] PUBLIC SUBMISSION As of: February 03, 2012 Received: January 19, 2012 Status: Pending_Post Tracking No. 80f9b24f Comments Due: January 20, 2012 Submission Type: Web Docket: DOE-HQ-2012-0004 U.S. Department of Energy Audit Guidance: For-Profit Recipients Comment On: DOE-HQ-2012-0004-0001 Audit Guidance: For-Profit Recipients Document: DOE-HQ-2012-0004-DRAFT-0006 Comment on FR Doc # 2011-32622 Submitter Information Name: Eric Russell Address: 836 Thurber Drive West Apt

  3. Hanford Site technical baseline database

    SciTech Connect (OSTI)

    Porter, P.E., Westinghouse Hanford

    1996-05-10

    This document includes a cassette tape that contains the Hanford specific files that make up the Hanford Site Technical Baseline Database as of May 10, 1996. The cassette tape also includes the delta files that delineate the differences between this revision and revision 3 (April 10, 1996) of the Hanford Site Technical Baseline Database.

  4. Wind turbine reliability database update.

    SciTech Connect (OSTI)

    Peters, Valerie A.; Hill, Roger Ray; Stinebaugh, Jennifer A.; Veers, Paul S.

    2009-03-01

    This report documents the status of the Sandia National Laboratories' Wind Plant Reliability Database. Included in this report are updates on the form and contents of the Database, which stems from a fivestep process of data partnerships, data definition and transfer, data formatting and normalization, analysis, and reporting. Selected observations are also reported.

  5. Data Preparation Process for the Buildings Performance Database

    SciTech Connect (OSTI)

    Walter, Travis; Dunn, Laurel; Mercado, Andrea; Brown, Richard E.; Mathew, Paul

    2014-06-30

    The Buildings Performance Database (BPD) includes empirically measured data from a variety of data sources with varying degrees of data quality and data availability. The purpose of the data preparation process is to maintain data quality within the database and to ensure that all database entries have sufficient data for meaningful analysis and for the database API. Data preparation is a systematic process of mapping data into the Building Energy Data Exchange Specification (BEDES), cleansing data using a set of criteria and rules of thumb, and deriving values such as energy totals and dominant asset types. The data preparation process takes the most amount of effort and time therefore most of the cleansing process has been automated. The process also needs to adapt as more data is contributed to the BPD and as building technologies over time. The data preparation process is an essential step between data contributed by providers and data published to the public in the BPD.

  6. A+M Collisional Databases in ALADDIN Format

    DOE Data Explorer [Office of Scientific and Technical Information (OSTI)]

    ALADDIN (A Labelled Atomic Data Interface) is a database system developed in order to provide a standard and flexible format and interface for the exchange and management of atomic, molecular and plasma-material interaction data of interest to fusion research. As part of the Atomic and Molecular Data Information System (AMDIS), introduced by the IAEA Atomic and Molecular Data Unit, the ALADDIN interface is available on-line. Twelve databases from DOE and IAEA sources are available from the CFADC website under the heading A+M Collisional Databases.

  7. A snapshot in time - the new TRUplanner database - 10400

    SciTech Connect (OSTI)

    Estill, Wes; Crawford, Beverly A; Van Soest, Gregory D

    2009-01-01

    A new database was developed to augment transuranic (TRU) waste inventory information already captured within the Comprehensive Inventory Database (CID). This new database, known as the TRUplanner, includes information focused on site capability for TRU waste certification and availability to ship to either the Waste Isolation Pilot Plant (WIPP) or Idaho National Laboratory for final characterization and certification before coming to WIPP. Waste stream specific data is imported from the CID to the TRUplanner, and additional data is collected and entered as a result of interviews and site visits. This data is continuously updated as sites are visited. TRU waste information such as facility, equipment, and container information for waste streams, has been captured within the TRUplanner, and supports the Department of Energy, Carlsbad Field Office (CBFO) decision making and strategic planning activities. This infonnation is delivered via three built-in TRUplanner reports that are provided to CBFO management, Acceptable Knowledge (AK) Experts and the TRU Waste Inventory Team.

  8. GOTTCHA Database, Version 1

    Energy Science and Technology Software Center (OSTI)

    2015-08-03

    One major challenge in the field of shotgun metagenomics is the accurate identification of the organisms present within the community, based on classification of short sequence reads. Though microbial community profiling methods have emerged to attempt to rapidly classify the millions of reads output from contemporary sequencers, the combination of incomplete databases, similarity among otherwise divergent genomes, and the large volumes of sequencing data required for metagenome sequencing has led to unacceptably high false discoverymore » rates (FDR). Here we present the application of a novel, gene-independent and signature-based metagenomic taxonomic profiling tool with significantly smaller FDR, which is also capable of classifying never-before seen genomes into the appropriate parent taxa.The algorithm is based upon three primary computational phases: (I) genomic decomposition into bit vectors, (II) bit vector intersections to identify shared regions, and (III) bit vector subtractions to remove shared regions and reveal unique, signature regions.In the Decomposition phase, genomic data is first masked to highlight only the valid (non-ambiguous) regions and then decomposed into overlapping 24-mers. The k-mers are sorted along with their start positions, de-replicated, and then prefixed, to minimize data duplication. The prefixes are indexed and an identical data structure is created for the start positions to mimic that of the k-mer data structure.During the Intersection phase -- which is the most computationally intensive phase -- as an all-vs-all comparison is made, the number of comparisons is first reduced by four methods: (a) Prefix restriction, (b) Overlap detection, (c) Overlap restriction, and (d) Result recording. In Prefix restriction, only k-mers of the same prefix are compared. Within that group, potential overlap of k-mer suffixes that would result in a non-empty set intersection are screened for. If such an overlap exists, the region which intersects is first reduced by performing a binary search of the boundary suffixes of the smaller set into the larger set, which defines the limits of the zipper-based intersection process. Rather than recording the actual k-mers of the intersection, another data structure of identical "shape" is created which consists of only bit vectors so that only a 1 or 0 will be stored in the location of the k-mer suffix that was found in the intersection. This reduces the amount of data generated and stored considerably.During the Subtraction phase, relevant intersection bitmasks are first unionized together to form a single bitmask which is then applied over the original genome to reveal only those regions of the genome that are unique. These regions are then exported to disk in FASTA format and used in the application of determining the constituents of an unknown metagenomic community.The DATABASE provided is the result of the algorithm described.« less

  9. Rocky Mountain Basins Produced Water Database

    DOE Data Explorer [Office of Scientific and Technical Information (OSTI)]

    Historical records for produced water data were collected from multiple sources, including Amoco, British Petroleum, Anadarko Petroleum Corporation, United States Geological Survey (USGS), Wyoming Oil and Gas Commission (WOGC), Denver Earth Resources Library (DERL), Bill Barrett Corporation, Stone Energy, and other operators. In addition, 86 new samples were collected during the summers of 2003 and 2004 from the following areas: Waltman-Cave Gulch, Pinedale, Tablerock and Wild Rose. Samples were tested for standard seven component "Stiff analyses", and strontium and oxygen isotopes. 16,035 analyses were winnowed to 8028 unique records for 3276 wells after a data screening process was completed. [Copied from the Readme document in the zipped file available at http://www.netl.doe.gov/technologies/oil-gas/Software/database.html] Save the Zipped file to your PC. When opened, it will contain four versions of the database: ACCESS, EXCEL, DBF, and CSV formats. The information consists of detailed water analyses from basins in the Rocky Mountain region.

  10. Diffusion Databases for Mg-ICME | Department of Energy

    Broader source: Energy.gov (indexed) [DOE]

    2 DOE Hydrogen and Fuel Cells Program and Vehicle Technologies Program Annual Merit Review and Peer Evaluation Meeting PDF icon lm036_kulkarni_2012_o.pdf More Documents & Publications Diffusion Databases for ICME Vehicle Technologies Office: 2010 Lightweight Materials R&D Annual Progress Report Low-Cost Magnesium Sheet Production using the Twin Roll Casting Process and Asymmetric Rolling

  11. NREL: National Residential Efficiency Measures Database - Retrofit Measures

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Submit Questions/Comments Retrofit Measures This page provides the types for all retrofit measures available in the National Residential Efficiency Measures Database. Select a component type below to see the retrofit measure data. For more information, read about the database, learn about the cost data, and see the glossary. Airflow Air Leakage Mechanical Ventilation Ceilings/Roofs Finished Roof Radiant Barrier Roof Material Unfinished Attic Foundation/Floors Crawlspace Slab Unfinished Basement

  12. Sandia National Laboratories: News: Publications

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Publications Annual Report Environmental Reports Fact Sheets Labs Accomplishments Lab News Partnerships Annual Report Research Magazine HPC Annual Reports Search Sandia Publications Strategic Plan News Publications Reports authored by Sandia National Laboratories can be obtained through the following sources: Office of Scientific & Technical Information (OSTI): Provides access to Department of Energy research and development reports. National Technical Information Service (NTIS): Official

  13. IRENA Global Atlas | Open Energy Information

    Open Energy Info (EERE)

    this information can make it easier to take this first step. Renewable energy databases mainly focus on specific aspects, such as physical information on insulation or wind...

  14. National Geothermal Database

    Energy Science and Technology Software Center (OSTI)

    2014-04-30

    THE NGDS IS A USER-FRIENDLY, WEB-BASED APPLICATION TO SUPPORT FINDING, VISUALIZING, MAPPING, AND ACQUISITION OF DATA BY END-USERS. THIS APPLICATION ALLOWS USERS TO DISCOVER AND ACCESS RESOURCES MADE AVAILABLE ACROSS ALL NGDS NODES, AND TO SEARCH FOR DATA ACROSS THE SYSTEM BASED ON TOPIC, LOCATION, AND OR OTHER CRITERIA. STANDARDIZED METADATA DESCRIBING EACH DATASET PROVIDES THE USER WITH THE INFORMATION NECESSARY TO DETERMINE THE UTILITY OF THAT DATASET FOR THEIR PURPOSES. GEOGRAPHIC DATASETS CAN BEmore » VISUALIZED THROUGH A MAP INTERFACE THAT ALLOWS USERS TO INSPECT THE DETAILS OF INDIVIDUAL DATA POINTS (E.G. WELLS, TEMPERATURE MEASUREMENTS, ETC.) FROM PROPERLY FORMATTED DATASETS. IN ADDITION TO VISUALIZATION WITHIN THE APPLICATION, THE INTERFACE PROVIDES THE INFORMATION NECESSARY FOR USERS TO ACCESS THE DATA FROM OTHER APPLICATIONS.« less

  15. Final report. Geothermal Energy Program: Information dissemination, public outreach, and technical analysis activities. April 1, 1999 to December 31, 2001. USDOE Grant No. DE-FG01-99-EE35098

    SciTech Connect (OSTI)

    Lund, John W.

    2002-03-22

    This is the final report of the accomplishments of the geothermal energy program: information dissemination, public outreach, and technical analysis activities by the project team consisting of the Geo-Heat Center, Geothermal Resources Council, Geothermal Education Office, Geothermal Energy Association, and the Washington State University Energy Program.

  16. Catalog of databases and reports

    SciTech Connect (OSTI)

    Burtis, M.D.

    1996-04-01

    This document provides information about the many reports and other materials made available by the US Department of Energy`s (DOE`s) Global Change Research Program (GCRP). It is divided into nine sections plus author and title indexes: Section A -- US Department of Energy Global Change Research Program research plans and summaries; Section B -- US Department of Energy Global Change Research Program technical reports; Section C -- US Department of energy Atmospheric Radiation Measurement (ARM) program reports; Section D -- Other US Department of Energy reports; Section E -- CDIAC reports; Section F -- CDIAC numeric data and computer model distribution; Section G -- other data sets distributed by CDIAC; Section H -- USDA reports on response of vegetation to carbon dioxide; Section I -- other publications.

  17. Technical Publications | Department of Energy

    Energy Savers [EERE]

    System Technical Publications by System Technical Publications are available for Steam, Process Heating, Compressed Air, Motor, Pump, Fan, and Plant Wide. These publications include Sourcebooks, Handbooks, Market Assessments, and other technical documents. Technical publications are also available for Combined Heat & Power. Sourcebooks give the detailed technical information necessary for comprehensive understanding of energy system components, including how to analyze facility needs,

  18. The renewable electric plant information system

    SciTech Connect (OSTI)

    Sinclair, K.

    1995-12-01

    This report explains the procedures used for creating the Renewable Electric Plant Information System (REPiS) database, describes the database fields, and summarizes the data. The REPiS database contains comprehensive information on grid-connected renewable electric generation plants in the United States. Originally designed in 1987 and updated in 1990, the database includes information through 1994. The report also illustrates ways of using the data for analysis is and describes how researchers validated the data.

  19. ORISE: Human Subjects Research Database

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Human Subjects Research Database Section 10, Part 745 of the Code of Federal Regulations and U.S. Department of Energy (DOE) Orders 443.1 and 481.1 require the maintenance of...

  20. Energy Citations Database (ECD) - Comments

    Office of Scientific and Technical Information (OSTI)

    Contact Us If you have a question about Energy Citations Database, we recommend you check frequently asked questions. If your question still has not been answered or if you wish to...

  1. WIPP - Public Reading Facilities

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Public Reading Facilities/Electronic Reading Facilities The Freedom of Information Act (FOIA) and Electronic FOIA (E-FOIA) require that various specific types of records, as well as various other records, be maintained in public reading facilities. Before you submit a FOIA request, we recommend you contact or visit the appropriate public reading facility to determine if the records you are seeking have already been released. The U.S. Department of Energy (DOE), as well as other related DOE

  2. Mound publications for 1991

    SciTech Connect (OSTI)

    Nowka, Stephen L.

    1992-05-01

    This document is a compilation of all Mound formal technical publications and oral presentations for calendar year 1991. It is intended to serve as an aid to personnel in obtaining or referring to specific publications by giving the proper complete reference for each information item published during the year. Some items, such as proceedings publications, may have issue dates or periods of coverage prior to 1991; however, they were formally published during 1991.

  3. Jefferson Lab Public Affairs

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Electronic Media print version Public Affairs Links Home Journalists' Newsroom Media Photographic Archives What is Jefferson Lab? Community Outreach Public Affairs Director's Office - Media The Public Affairs Office is prepared to aid media representatives in preparing for JLab stories and photo sessions. We can also help reporters find expert sources for science and technology-based stories. Media kits, provided upon request, offer a wealth of JLab information including fact sheets, photos,

  4. Modifications for Public Comment - Hanford Site

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    MP-14 WIDS Information Hanford Site Waste Management Units Report Hanford Public Involvement Plan Administrative Record (AR) Related Links Modifications for Public Comment...

  5. Oregon Public Utility Commission | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Smart Grid Request for Information (RFI). PDF icon Oregon Public Utility Commission More Documents & Publications ... Edison Electric Institute (EEI) Regulatory Burden ...

  6. Some stuff about the document data-base

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Docdb Primer The entry page url of our DocDB is microboone-docdb.fnal.gov. Public or Private Access The data-base has a basic upper level of defining its documents. Documents are either public which means anyone on the web can see them, or documents are private which means only people logging in to our DocDB with a username and password can see them. The selection for public access, or for private access, is made on the entry page shown in Figure 1. In addition, there are different levels of

  7. Public Meetings

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Public Meetings Individual Permit: Public Meetings Subscribe to receive notifications for semiannual Individual Permit for Storm Water public meetings. Contact Environmental Communication & Public Involvement P.O. Box 1663 MS M996 Los Alamos, NM 87545 (505) 667-0216 Email Public meeting notifications LANL will email a draft agenda at least one week before the meeting and will consider suggestions from the public for changes or additions to the agenda. Upcoming Meetings 2016 Meeting Archives

  8. CNEEC - Publications

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    CNEEC archival journal publications CNEEC maintains two lists of publications, one devoted to research solely supported by funding from the CNEEC EFRC and another containing...

  9. FEDIX: The on-line database retrieval service of government information for colleges, universities, and other organizations. User`s guide, Version 4.0/Release 2.1

    SciTech Connect (OSTI)

    Not Available

    1992-12-31

    FEDIX is an on-line information service that links the higher education community and the federal government to facilitate research, education, and services. The system provides accurate, timely federal agency information to colleges, universities, and other research organizations. There are no registration fees or access charges. Participating agencies include DOE, FAA, NASA, ONR, AFOSR, NSF, NSA, DOE, DOEd, HUD, and AID. This guide is intended to help users access and utilize FEDIX.

  10. Nuclear Energy Infrastructure Database Description and User’s Manual

    SciTech Connect (OSTI)

    Heidrich, Brenden

    2015-11-01

    In 2014, the Deputy Assistant Secretary for Science and Technology Innovation initiated the Nuclear Energy (NE)–Infrastructure Management Project by tasking the Nuclear Science User Facilities, formerly the Advanced Test Reactor National Scientific User Facility, to create a searchable and interactive database of all pertinent NE-supported and -related infrastructure. This database, known as the Nuclear Energy Infrastructure Database (NEID), is used for analyses to establish needs, redundancies, efficiencies, distributions, etc., to best understand the utility of NE’s infrastructure and inform the content of infrastructure calls. The Nuclear Science User Facilities developed the database by utilizing data and policy direction from a variety of reports from the U.S. Department of Energy, the National Research Council, the International Atomic Energy Agency, and various other federal and civilian resources. The NEID currently contains data on 802 research and development instruments housed in 377 facilities at 84 institutions in the United States and abroad. The effort to maintain and expand the database is ongoing. Detailed information on many facilities must be gathered from associated institutions and added to complete the database. The data must be validated and kept current to capture facility and instrumentation status as well as to cover new acquisitions and retirements. This document provides a short tutorial on the navigation of the NEID web portal at NSUF-Infrastructure.INL.gov.

  11. Biomass Feedstock Composition and Property Database () | Data...

    Office of Scientific and Technical Information (OSTI)

    Biomass Feedstock Composition and Property Database Title: Biomass Feedstock Composition and Property Database The Office of Energy Efficiency and Renewable Energy's Biomass ...

  12. Materials Databases Infrastructure Constructed by First Principles Calculations: A Review

    SciTech Connect (OSTI)

    Lin, Lianshan

    2015-10-13

    The First Principles calculations, especially the calculation based on High-Throughput Density Functional Theory, have been widely accepted as the major tools in atom scale materials design. The emerging super computers, along with the powerful First Principles calculations, have accumulated hundreds of thousands of crystal and compound records. The exponential growing of computational materials information urges the development of the materials databases, which not only provide unlimited storage for the daily increasing data, but still keep the efficiency in data storage, management, query, presentation and manipulation. This review covers the most cutting edge materials databases in materials design, and their hot applications such as in fuel cells. By comparing the advantages and drawbacks of these high-throughput First Principles materials databases, the optimized computational framework can be identified to fit the needs of fuel cell applications. The further development of high-throughput DFT materials database, which in essence accelerates the materials innovation, is discussed in the summary as well.

  13. Databases for rRNA gene profiling of microbial communities

    DOE Patents [OSTI]

    Ashby, Matthew

    2013-07-02

    The present invention relates to methods for performing surveys of the genetic diversity of a population. The invention also relates to methods for performing genetic analyses of a population. The invention further relates to methods for the creation of databases comprising the survey information and the databases created by these methods. The invention also relates to methods for analyzing the information to correlate the presence of nucleic acid markers with desired parameters in a sample. These methods have application in the fields of geochemical exploration, agriculture, bioremediation, environmental analysis, clinical microbiology, forensic science and medicine.

  14. Nuclear Energy Infrastructure Database Fitness and Suitability Review

    SciTech Connect (OSTI)

    Heidrich, Brenden

    2015-03-01

    In 2014, the Deputy Assistant Secretary for Science and Technology Innovation (NE-4) initiated the Nuclear Energy-Infrastructure Management Project by tasking the Nuclear Science User Facilities (NSUF) to create a searchable and interactive database of all pertinent NE supported or related infrastructure. This database will be used for analyses to establish needs, redundancies, efficiencies, distributions, etc. in order to best understand the utility of NE’s infrastructure and inform the content of the infrastructure calls. The NSUF developed the database by utilizing data and policy direction from a wide variety of reports from the Department of Energy, the National Research Council, the International Atomic Energy Agency and various other federal and civilian resources. The NEID contains data on 802 R&D instruments housed in 377 facilities at 84 institutions in the US and abroad. A Database Review Panel (DRP) was formed to review and provide advice on the development, implementation and utilization of the NEID. The panel is comprised of five members with expertise in nuclear energy-associated research. It was intended that they represent the major constituencies associated with nuclear energy research: academia, industry, research reactor, national laboratory, and Department of Energy program management. The Nuclear Energy Infrastructure Database Review Panel concludes that the NSUF has succeeded in creating a capability and infrastructure database that identifies and documents the major nuclear energy research and development capabilities across the DOE complex. The effort to maintain and expand the database will be ongoing. Detailed information on many facilities must be gathered from associated institutions added to complete the database. The data must be validated and kept current to capture facility and instrumentation status as well as to cover new acquisitions and retirements.

  15. Public Affairs Department

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Public Access Policy and Communications Public Access Policy and Communications 7/24/14 Department of Energy Public Access Plan DOE Public Access Plan 2/22/13 White House Office of Science and Technology Policy Memorandum Increasing Access to the Results of Federally Funded Scientific Research DOE Scientific and Technical Information Program (STIP) News Releases 8/4/14 DOE News Release U.S. Department of Energy Increases Access to Results of DOE-Funded Scientific Research Blogs 4/20/15 OSTIblog

  16. PylotDB - A Database Management, Graphing, and Analysis Tool Written in Python

    SciTech Connect (OSTI)

    2012-01-04

    PylotDB, written completely in Python, provides a user interface (UI) with which to interact with, analyze, graph data from, and manage open source databases such as MySQL. The UI mitigates the user having to know in-depth knowledge of the database application programming interface (API). PylotDB allows the user to generate various kinds of plots from user-selected data; generate statistical information on text as well as numerical fields; backup and restore databases; compare database tables across different databases as well as across different servers; extract information from any field to create new fields; generate, edit, and delete databases, tables, and fields; generate or read into a table CSV data; and similar operations. Since much of the database information is brought under control of the Python computer language, PylotDB is not intended for huge databases for which MySQL and Oracle, for example, are better suited. PylotDB is better suited for smaller databases that might be typically needed in a small research group situation. PylotDB can also be used as a learning tool for database applications in general.

  17. PylotDB - A Database Management, Graphing, and Analysis Tool Written in Python

    Energy Science and Technology Software Center (OSTI)

    2012-01-04

    PylotDB, written completely in Python, provides a user interface (UI) with which to interact with, analyze, graph data from, and manage open source databases such as MySQL. The UI mitigates the user having to know in-depth knowledge of the database application programming interface (API). PylotDB allows the user to generate various kinds of plots from user-selected data; generate statistical information on text as well as numerical fields; backup and restore databases; compare database tables acrossmore » different databases as well as across different servers; extract information from any field to create new fields; generate, edit, and delete databases, tables, and fields; generate or read into a table CSV data; and similar operations. Since much of the database information is brought under control of the Python computer language, PylotDB is not intended for huge databases for which MySQL and Oracle, for example, are better suited. PylotDB is better suited for smaller databases that might be typically needed in a small research group situation. PylotDB can also be used as a learning tool for database applications in general.« less

  18. WIPP - Joint Information Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    The Joint Information Center is located at 4021 National Parks Highway in Carlsbad, N.M. Joint Information Center In the unlikely event of an emergency, the WIPP Joint Information Center (JIC) serves as a central control point to coordinate multi-agency efforts to issue timely and accurate information to the public, news media and project employees. Emergency contact information: The public If the JIC is activated, members of the general public, including family members, may call (575) 234-7380

  19. ARM Publications

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Thu, 12 May 2016 17:38:19 +0000 http://www.arm.gov en Publication Notice: 15 New References Available Thu, 12 May 2016 17:38:19 +0000 Publications http://www.arm.gov/publications?date=20160512#20160512 <strong>Lead Author(s)</strong> Mather J | Comstock J | Sivaraman C | Voyles J | Kleissl J [...] Publication Notice: 52 New References Available Wed, 11 May 2016 22:41:55 +0000 Publications http://www.arm.gov/publications?date=20160511#20160511

  20. View discovery in OLAP databases through statistical combinatorial optimization

    SciTech Connect (OSTI)

    Hengartner, Nick W; Burke, John; Critchlow, Terence; Joslyn, Cliff; Hogan, Emilie

    2009-01-01

    OnLine Analytical Processing (OLAP) is a relational database technology providing users with rapid access to summary, aggregated views of a single large database, and is widely recognized for knowledge representation and discovery in high-dimensional relational databases. OLAP technologies provide intuitive and graphical access to the massively complex set of possible summary views available in large relational (SQL) structured data repositories. The capability of OLAP database software systems to handle data complexity comes at a high price for analysts, presenting them a combinatorially vast space of views of a relational database. We respond to the need to deploy technologies sufficient to allow users to guide themselves to areas of local structure by casting the space of 'views' of an OLAP database as a combinatorial object of all projections and subsets, and 'view discovery' as an search process over that lattice. We equip the view lattice with statistical information theoretical measures sufficient to support a combinatorial optimization process. We outline 'hop-chaining' as a particular view discovery algorithm over this object, wherein users are guided across a permutation of the dimensions by searching for successive two-dimensional views, pushing seen dimensions into an increasingly large background filter in a 'spiraling' search process. We illustrate this work in the context of data cubes recording summary statistics for radiation portal monitors at US ports.

  1. Public Activities

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Bird Watching Effective January 24, 2005 There are several great bird watching spots in the public areas on Fermilab's site. Driving is restricted to the roads within the public...

  2. Public Activities

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    passes. Roadways that are off limits to visiting members of the public will be posted with signs, and motorists will be given site maps to guide them to the public areas....

  3. Ceramic Technology Project database: March 1990 summary report

    SciTech Connect (OSTI)

    Keyes, B.L.P.

    1992-07-01

    This report is the fifth in a series of semiannual data summary reports on information being stored in the Ceramic Technology Project (CTP) database. The overall system status as of March 31, 1990, is summarized, and the latest additions of ceramic mechanical properties data are given for zirconia, silicon carbide, and silicon nitride ceramic mechanical properties data, including some properties on brazed specimens.

  4. Smart Grid Information Clearinghouse (SGIC)

    SciTech Connect (OSTI)

    Rahman, Saifur

    2014-08-31

    Since the Energy Independence and Security Act of 2007 was enacted, there has been a large number of websites that discusses smart grid and relevant information, including those from government, academia, industry, private sector and regulatory. These websites collect information independently. Therefore, smart grid information was quite scattered and dispersed. The objective of this work was to develop, populate, manage and maintain the public Smart Grid Information Clearinghouse (SGIC) web portal. The information in the SGIC website is comprehensive that includes smart grid information, research & development, demonstration projects, technical standards, costs & benefit analyses, business cases, legislation, policy & regulation, and other information on lesson learned and best practices. The content in the SGIC website is logically grouped to allow easily browse, search and sort. In addition to providing the browse and search feature, the SGIC web portal also allow users to share their smart grid information with others though our online content submission platform. The Clearinghouse web portal, therefore, serves as the first stop shop for smart grid information that collects smart grid information in a non-bias, non-promotional manner and can provide a missing link from information sources to end users and better serve users’ needs. The web portal is available at www.sgiclearinghouse.org. This report summarizes the work performed during the course of the project (September 2009 – August 2014). Section 2.0 lists SGIC Advisory Committee and User Group members. Section 3.0 discusses SGIC information architecture and web-based database application functionalities. Section 4.0 summarizes SGIC features and functionalities, including its search, browse and sort capabilities, web portal social networking, online content submission platform and security measures implemented. Section 5.0 discusses SGIC web portal contents, including smart grid 101, smart grid projects, deployment experience (i.e., use cases, lessons learned, cost-benefit analyses and business cases), in-depth information (i.e., standards, technology, cyber security, legislation, education and training and demand response), as well as international information. Section 6.0 summarizes SGIC statistics from the launch of the portal on July 07, 2010 to August 31, 2014. Section 7.0 summarizes publicly available information as a result of this work.

  5. MIT Plasma Science & Fusion Center: researchpublications

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Research Program Information Publications & News Meetings & Seminars Contact Information Physics Research Fusion Technology & Engineering Plasma Technology Waves & Beams Useful...

  6. MIT Plasma Science & Fusion Center: research, alcator, publications...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Research Program Information Publications & News Meetings & Seminars Contact Information Physics Research High-Energy- Density Physics Waves & Beams Technology & Engineering...

  7. A database for The Geysers geothermal field

    SciTech Connect (OSTI)

    Bodvarsson, G.S.; Cox, B.L.; Fuller, P.; Ripperda, M.; Tulinius, H.; Witherspoon, P.A.; Goldstein, N.; Flexser, S.; Pruess, K. ); Truesdell, A. )

    1989-09-01

    In Fiscal Year 1985-1986 the Earth Sciences Division of Lawrence Berkeley Laboratory (LBL) began a multi-year project for SLC to organize and analyze the field data from The Geysers. In the first year, most of the work concentrated on the development of a comprehensive database for The Geysers, and conventional reservoir engineering analysis of the data. Essentially, all non-proprietary data for wells at The Geysers have been incorporated into the database, as well as proprietary data from wells located on State leases. In following years, a more detailed analysis of The Geysers data has been carried out. This report is a summary of the non- proprietary work performed in FY 1985--1986. It describes various aspects of the database and also includes: review sections on Field Development, Geology, Geophysics, Geochemistry and Reservoir Engineering. It should be emphasized that these background chapters were written in 1986, and therefore only summarize the information available at that time. The appendices contain individual plots of wellhead pressures, degree of superheat, steam flow rates, cumulative mass flows, injection rates and cumulative injection through 1988 for approximately 250 wells. All of the data contained in this report are non-proprietary, from State and non-State leases. The production/injection and heat flow data from the wells were obtained from the California State Division of Oil and gas (DOG) (courtesy of Dick Thomas). Most of the other data were obtained from SLC files in Sacramento (courtesy of Charles Priddy), or DOG files in Santa Rosa (courtesy of Ken Stelling). 159 refs., 23 figs., 3 tabs.

  8. Energy Information Administration - new releases. Volume 3

    SciTech Connect (OSTI)

    1996-11-01

    This publication presents information compiled by the Energy Information Administration (EIA) on fuels, energy related topics, and the dissemination of other EIA publications.

  9. Energy information sheets

    SciTech Connect (OSTI)

    Not Available

    1993-12-02

    The National Energy Information Center (NEIC), as part of its mission, provides energy information and referral assistance to Federal, State, and local governments, the academic community, business and industrial organizations, and the general public. Written for the general public, the EIA publication Energy Information Sheets was developed to provide information on various aspects of fuel production, prices, consumption and capability. The information contained herein pertains to energy data as of December 1991. Additional information on related subject matter can be found in other EIA publications as referenced at the end of each sheet.

  10. DEPARTMENT OF ENERGY SOLICITS PUBLIC INPUT TO INFORM DEVELOPMENT OF A PREFERRED ALTERNATIVE FOR DISPOSAL OF GREATER-THAN-CLASS C WASTE

    Broader source: Energy.gov [DOE]

    During the months of April and May, 2011 the Department of Energy’s Office of Environmental Management will be holding nine public hearings on the Draft Environmental Impact Statement (EIS) for the Disposal of Greater-Than-Class C (GTCC) Low-Level Radioactive Waste and GTCC-Like Waste. Hearings will be held at the each of the sites being considered for disposal of GTCC wastes and in Washington, DC.

  11. ORISE: Public Health Communication

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Communication Public Health Communication The Oak Ridge Institute for Science and Education (ORISE) assists government agencies and organizations in addressing public health challenges by developing evidence-based communication programs and social marketing initiatives that resonate with target populations. Because approximately half of American adults do not understand basic health information, ORISE develops the types of messages that will attract attention and motivate people to address their

  12. NREL: National Residential Efficiency Measures Database - Data Dictionary

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Dictionary This page features the data dictionary for the National Residential Efficiency Measures Database, which supplies users with information about the database organization such as table structure, field names, and data element type and length. tblAction Column name Data type Length Description ActionID int 4 Primary key for actions sName varchar 255 Action name idComponentTypeID int 4 The component type to which this action may be applied (foreign key) idActionTypeID int 4 The action type

  13. NREL: National Residential Efficiency Measures Database - Data Use

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Disclaimer Agreement Before accessing the data from the National Residential Efficiency Measures Database, users must read and accept this agreement ("Agreement"). Database version: v3.0.0. See the Change Log for information about the version. This data and software ("Data") is provided by the National Renewable Energy Laboratory ("NREL"), which is operated by the Alliance for Sustainable Energy, LLC ("ALLIANCE") for the U.S. Department Of Energy

  14. Evaluating parallel relational databases for medical data analysis.

    SciTech Connect (OSTI)

    Rintoul, Mark Daniel; Wilson, Andrew T.

    2012-03-01

    Hospitals have always generated and consumed large amounts of data concerning patients, treatment and outcomes. As computers and networks have permeated the hospital environment it has become feasible to collect and organize all of this data. This raises naturally the question of how to deal with the resulting mountain of information. In this report we detail a proof-of-concept test using two commercially available parallel database systems to analyze a set of real, de-identified medical records. We examine database scalability as data sizes increase as well as responsiveness under load from multiple users.

  15. RNAcentral: an international database of ncRNA sequences

    DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

    Williams, Kelly Porter

    2014-10-28

    The field of non-coding RNA biology has been hampered by the lack of availability of a comprehensive, up-to-date collection of accessioned RNA sequences. Here we present the first release of RNAcentral, a database that collates and integrates information from an international consortium of established RNA sequence databases. The initial release contains over 8.1 million sequences, including representatives of all major functional classes. A web portal (http://rnacentral.org) provides free access to data, search functionality, cross-references, source code and an integrated genome browser for selected species.

  16. New research, publications and videos

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    New research, publications and videos Alumni Link: Opportunities, News and Resources for Former Employees Latest Issue:September 2015 all issues All Issues » submit New research, publications and videos Other information of interest September 1, 2015 New research, publications and videos New research, publications and videos Contact Linda Anderman Email News stories Medical and biofuel advances possible with new gene regulation tool Recent work by Los Alamos National Laboratory experimental and

  17. Energy information sheets

    SciTech Connect (OSTI)

    1995-07-01

    The National Energy Information Center (NEIC), as part of its mission, provides energy information and referral assistance to Federal, State, and local governments, the academic community, business and industrial organizations, and the public. The Energy Information Sheets was developed to provide general information on various aspects of fuel production, prices, consumption, and capability. Additional information on related subject matter can be found in other Energy Information Administration (EIA) publications as referenced at the end of each sheet.

  18. Environmental remediation and waste management information systems

    SciTech Connect (OSTI)

    Harrington, M.W.; Harlan, C.P.

    1993-12-31

    The purpose of this paper is to document a few of the many environmental information systems that currently exist worldwide. The paper is not meant to be a comprehensive list; merely a discussion of a few of the more technical environmental database systems that are available. Regulatory databases such as US Environmental Protection Agency`s (EPA`s) RODS (Records of Decision System) database [EPA, 1993] and cost databases such as EPA`s CORA (Cost of Remedial Action) database [EPA, 1993] are not included in this paper. Section 2 describes several US Department of Energy (DOE) Environmental Restoration and Waste Management (EM) information systems and databases. Section 3 discusses several US EPA information systems on waste sites and technologies. Section 4 summarizes a few of the European Community environmental information systems, networks, and clearinghouses. And finally, Section 5 provides a brief overview of Geographical Information Systems. Section 6 contains the references, and the Appendices contain supporting information.

  19. Final Report- National Database of Utility Rates and Rate Structure

    Broader source: Energy.gov [DOE]

    One of the key informational barriers for consumers, installers, regulators and policymakers, is the proper comparison cost of utility-supplied electricity that will be replaced with a Photovoltaic (PV) system. Oftentimes, these comparisons are made with national or statewide averages which results in inaccurate comparisons and conclusions. Illinois State University seeks to meet the need for accurate information about electricity costs and rate structure by building a national database of utility rates and rate structures. The database will build upon the excellent framework that was developed by the OpenEI.org initiative and extend it in several important ways. First, the data will be populated and monitored by a team of trained regulatory economists. Second, the database will be more comprehensive because it will be populated with data from newer competitive retail suppliers for states that have restructured their electricity markets to allow such suppliers. Third, the University and its Institute for Regulatory Policy Studies will maintain the database and ensure that it contains the most recent rate information.

  20. Sandia Wind Turbine Loads Database

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Wind Turbine Loads Database - Sandia Energy Energy Search Icon Sandia Home Locations Contact Us Employee Locator Energy & Climate Secure & Sustainable Energy Future Stationary Power Energy Conversion Efficiency Solar Energy Wind Energy Water Power Supercritical CO2 Geothermal Natural Gas Safety, Security & Resilience of the Energy Infrastructure Energy Storage Nuclear Power & Engineering Grid Modernization Battery Testing Nuclear Fuel Cycle Defense Waste Management Programs

  1. Tunisia-REEEP Energy Activities | Open Energy Information

    Open Energy Info (EERE)

    in clean energy in the Mediterranean Private-Public Partnership Mezzanine Fund Renewable Energies Cooperation Certificates (RECC) References "REEEP project database"...

  2. Software design for a database driven system for accelerator magnet measurements

    SciTech Connect (OSTI)

    Brown, B.C.; Bleadon, M.E.; Glass, H.D.; Glosson, R.; Hanft, R.W.; Harding, D.J.; Mazur, P.O.; Pachnik, J.E.; Sim, J.W.; Trombly-Freytag, K.; Walbridge, D.G.

    1991-05-01

    Measurements of more than 1000 new magnets are needed for the Main Injector Project at Fermilab. In order to achieve efficiency and accuracy in measurements, we chose a database driven design for control of the measurement system. We will use a relational database to describe the measurement subjects and equipment. A logbook system defined in the database will provide for prescription of measurements to be carried out, description of measurements as they are carried out, and a comment database for less structured information. The operator interface will be built on X-windows. This paper will describe our system design. 2 refs.

  3. PNNL: Publications

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Search Welcome to the Pacific Northwest National Laboratory publications page. You can use this page to find citations to materials published since 1998 by PNNL staff or by external researchers using PNNL facilities. The latter are denoted by a logo preceding the citation. Full text copies of many PNNL formal reports are available from this page either as PDF or HTML files. Search Tips Help Select Search Criteria Publication Types All Publications Journal Article Formal Report Conference Paper

  4. Publication Policy

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Publication Policy Publication of work performed at JLF JLF encourages dissemination of results of experiments performed at the Facility. Vehicles for the publication may include: Journal articles Conference proceedings articles Books or book chapters Technical reports Dissertations Published patents Published abstracts Invited or contributed talks Popular articles Press reports The decision whether to publish and in what form(s) is the responsibility of the Principal Investigator and/or the

  5. Water Power Information Resources | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Water Power Information Resources Water Power Information Resources How Hydropower Works How Hydropower Works See a detailed view of the inside of a hydropower energy generation system. Read more Marine and Hydrokinetic Technology Database on OpenEI Marine and Hydrokinetic Technology Database on OpenEI The DOE Marine and Hydrokinetic Technology Database provides up-to-date information on marine and hydrokinetic renewable energy. Read more The following resources about water power technologies

  6. Public Participation

    Broader source: Energy.gov [DOE]

    Maintaining an open dialog with the public is central to the mission of the Environmental Management Los Alamos Field Office (EM-LA).

  7. EC Publications

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    ElectricalSimulationsofSeriesandParallelPVArc-Faults(Presentation)admin2016-04-14T2... All Publications Placeholder Download Filename 39thPVSCElectricalSimulationsofSeriesa...

  8. GDB - Human Genome Database final report

    SciTech Connect (OSTI)

    Talbot, C. Conover, Jr.

    2002-01-08

    This is the DOE final report for the GDB, Human Genome Database, project at the Johns Hopkins University.

  9. National Residential Efficiency Measures Database Webinar Slides

    Broader source: Energy.gov [DOE]

    Presentation slides for the Building Technologies Program Webinar on the National Residential Efficiency Measures Database on January 18, 2011.

  10. Multimedia-Modeling Environmental Database Editor

    Energy Science and Technology Software Center (OSTI)

    1996-05-09

    MMEDE is a software tool designed by Battelle, PNL to support the maintenance of an environmental risk computation database.

  11. Gateway:International/About | Open Energy Information

    Open Energy Info (EERE)

    information on renewable energy and energy efficiency analysis tools and models, databases, assessment methodologies, and other similar technical resources and emphasizes user...

  12. Montana Cultural Records Webpage | Open Energy Information

    Open Energy Info (EERE)

    LibraryAdd to library Web Site: Montana Cultural Records Webpage Abstract Provides access to the Montana Antiquities Database and provides information about the structure and...

  13. EC Publications

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    PVROM Database Initiative: 2014 Progress Reportadmin2016-04-18T20:58:24+00:00 Popular Downloads Solar Energy Grid Integration Systems: Final Report of the Florida Solar Energy Center Team (10514 downloads) Modeling System Losses in PVsyst (8992 downloads) Numerical Manufacturing And Design Tool (NuMAD v2.0) for Wind Turbine Blades: User's Guide (7143 downloads) Solar Energy Grid Integration Systems (SEGIS) Proactive Intelligent Advances for Photovoltaic Systems (6205 downloads) Improved Test

  14. Regional Geology: GIS Database for Alternative Host Rocks and Potential Siting Guidelines

    Broader source: Energy.gov [DOE]

    The objective of this work is to develop a spatial database that integrates both geologic data for alternative host-rock formations and information that has been historically used for siting...

  15. Energy Information Directory 1996

    SciTech Connect (OSTI)

    1997-01-01

    This directory lists most government offices and trade associations that are involved in energy matters. It does not include DOE offices which do not deal with the public or public information.

  16. Energy Citations Database (ECD) - Availability

    Office of Scientific and Technical Information (OSTI)

    vente des publications des Communautes Europeenes 37, rue Glesener-Luxembourg. FD U.S. Fish and Wildlife Service, 18th and C Streets, N.W., Mail Stop 1111, Arlington Square Bldg.,...

  17. U.S. Life Cycle Inventory Database Roadmap (Brochure) | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Life Cycle Inventory Database Roadmap (Brochure) U.S. Life Cycle Inventory Database Roadmap (Brochure) Life cycle inventory data are the primary inputs for conducting life cycle assessment studies. Studies based on high-quality data that are consistent, accurate, and relevant allow for robust, defensible, and meaningful results. PDF icon 45153.pdf More Documents & Publications Life-Cycle Assessment of Energy and Environmental Impacts of LED Lighting Products Vehicle Technologies

  18. Frontier: High Performance Database Access Using Standard Web Components in a Scalable Multi-Tier Architecture

    SciTech Connect (OSTI)

    Kosyakov, S.; Kowalkowski, J.; Litvintsev, D.; Lueking, L.; Paterno, M.; White, S.P.; Autio, Lauri; Blumenfeld, B.; Maksimovic, P.; Mathis, M.; /Johns Hopkins U.

    2004-09-01

    A high performance system has been assembled using standard web components to deliver database information to a large number of broadly distributed clients. The CDF Experiment at Fermilab is establishing processing centers around the world imposing a high demand on their database repository. For delivering read-only data, such as calibrations, trigger information, and run conditions data, we have abstracted the interface that clients use to retrieve data objects. A middle tier is deployed that translates client requests into database specific queries and returns the data to the client as XML datagrams. The database connection management, request translation, and data encoding are accomplished in servlets running under Tomcat. Squid Proxy caching layers are deployed near the Tomcat servers, as well as close to the clients, to significantly reduce the load on the database and provide a scalable deployment model. Details the system's construction and use are presented, including its architecture, design, interfaces, administration, performance measurements, and deployment plan.

  19. DOE Science Showcase - Biofuels in the databases | OSTI, US Dept of

    Office of Scientific and Technical Information (OSTI)

    Energy, Office of Scientific and Technical Information DOE Science Showcase - Biofuels in the databases The new ScienceCinema provides access points where the term biofuels is spoken in DOE multimedia presentations. DOE Green Energy renewable energy portal offers biofuels related research. Science Accelerator returns results for biofuels from DOE resources with just one query: DOE Data Explorer DOE Information Bridge Energy Citations Database Federal R&D Project Summaries Biofuels in the

  20. Human Subjects Research Database (HSRD) | U.S. DOE Office of Science (SC)

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Human Subjects Research Database (HSRD) Human Subjects Protection Program (HSPP) HSPP Home About Institutional Review Boards (IRBs) Education and Resources CITI Courses DOE Resources Informed Consent Special Research Categories Community IRB Member Resources Other Resources Human Subjects Research Database (HSRD) IRB7 Regulations and Requirements Glossary Abbreviations Contact BER Home Contact Information Human Subjects Protection Program U.S. Department of Energy SC-23/Germantown Building 1000

  1. Smart Grid Research from DOE Databases | OSTI, US Dept of Energy, Office of

    Office of Scientific and Technical Information (OSTI)

    Scientific and Technical Information Smart Grid Research from DOE Databases Information Bridge Energy Citations Database DOE Green Energy DOE R&D Project Summaries Science.gov About Smart Grid Secretary Chu Announces Two Million Smart Grid Meters Installed Nationwide, August 31, 2010 DOE Office of Electricity Delivery & Energy Reliability The NETL Smart Grid Implementation Strategy The Smart Grid: An Introduction

  2. Deep Sky Astronomical Image Database Project at NERSC

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Deep Sky Astronomical Image Database Deep Sky Astronomical Image Database Key Challenges: Develop, store, analyze, and make available an astronomical image database of...

  3. EM Soil and Groundwater Database Reports | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    EM Soil and Groundwater Database Reports EM Soil and Groundwater Database Reports Brookhaven National Laboratory - HFBR Tritium Groundwater Database Report - Brookhaven National ...

  4. Renewable Energy and Defense Geospatial Database | Open Energy...

    Open Energy Info (EERE)

    Database Jump to: navigation, search OpenEI Reference LibraryAdd to library Web Site: Renewable Energy and Defense Geospatial Database Abstract This database provides GIS data...

  5. Risk assessment and toxicology databases for health effects assessment

    SciTech Connect (OSTI)

    Lu, P.Y.; Wassom, J.S.

    1990-12-31

    Scientific and technological developments bring unprecedented stress to our environment. Society has to predict the results of potential health risks from technologically based actions that may have serious, far-reaching consequences. The potential for error in making such predictions or assessment is great and multiplies with the increasing size and complexity of the problem being studied. Because of this, the availability and use of reliable data is the key to any successful forecasting effort. Scientific research and development generate new data and information. Much of the scientific data being produced daily is stored in computers for subsequent analysis. This situation provides both an invaluable resource and an enormous challenge. With large amounts of government funds being devoted to health and environmental research programs and with maintenance of our living environment at stake, we must make maximum use of the resulting data to forecast and avert catastrophic effects. Along with the readily available. The most efficient means of obtaining the data necessary for assessing the health effects of chemicals is to utilize applications include the toxicology databases and information files developed at ORNL. To make most efficient use of the data/information that has already been prepared, attention and resources should be directed toward projects that meticulously evaluate the available data/information and create specialized peer-reviewed value-added databases. Such projects include the National Library of Medicine`s Hazardous Substances Data Bank, and the U.S. Air Force Installation Restoration Toxicology Guide. These and similar value-added toxicology databases were developed at ORNL and are being maintained and updated. These databases and supporting information files, as well as some data evaluation techniques are discussed in this paper with special focus on how they are used to assess potential health effects of environmental agents. 19 refs., 5 tabs.

  6. User`s Guide: Database of literature pertaining to the unsaturated zone and surface water-ground water interactions at the Idaho National Engineering Laboratory

    SciTech Connect (OSTI)

    Hall, L.F.

    1993-05-01

    Since its beginnings in 1949, hydrogeologic investigations at the Idaho National Engineering Laboratory (INEL) have resulted in an extensive collection of technical publications providing information concerning ground water hydraulics and contaminant transport within the unsaturated zone. Funding has been provided by the Department of Energy through the Department of Energy Idaho Field Office in a grant to compile an INEL-wide summary of unsaturated zone studies based on a literature search. University of Idaho researchers are conducting a review of technical documents produced at or pertaining to the INEL, which present or discuss processes in the unsaturated zone and surface water-ground water interactions. Results of this review are being compiled as an electronic database. Fields are available in this database for document title and associated identification number, author, source, abstract, and summary of information (including types of data and parameters). AskSam{reg_sign}, a text-based database system, was chosen. WordPerfect 5.1{copyright} is being used as a text-editor to input data records into askSam.

  7. Vehicle Technologies Office: Information Resources

    Broader source: Energy.gov [DOE]

    From here you can access additional information on advanced transportation technologies; view programmatic publications and technical information; learn the basics of hybrid vehicle technology;...

  8. Information Resources | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Information Resources Information Resources Information Resources Photo of NREL employee Michael Deru using a desktop computer. The Geothermal Technologies Office is a source of current, relevant information about enhanced geothermal systems (EGS) technologies and other geothermal technologies and applications. On these pages you'll find helpful publications, software, and websites for the geothermal community and stakeholders. Geothermal information resources: Publications Technical Roadmaps

  9. Public Library.

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    and Groves statues. 8 Attend a Gordon's concert. 9 Put together a team for the mud volleyball tournament. 10 Hear authors speak or attend a gallery opening at Mesa Public...

  10. Public Activities

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Art Gallery The Art Gallery in Wilson Hall is only open to the public before and after Arts, Lectures and Film Series events. The Gallery is closed to unescorted visitors at all...

  11. Defining a new information exchange

    Energy Science and Technology Software Center (OSTI)

    2013-08-01

    This wiki page provides the public with all specifications needed to create a new information exchange (content model package).

  12. Legal Energy Information System (SIEL) Database | Open Energy...

    Open Energy Info (EERE)

    Panama, Mexico, Argentina, Bolivia, Brazil, Chile, Colombia, Ecuador, Guyana, Paraguay, Peru, Suriname, Uruguay, Venezuela, Barbados, Cuba, Grenada, Haiti, Jamaica,...

  13. IEA Policies and Measures Database | Open Energy Information

    Open Energy Info (EERE)

    Energy Agency Sector: Energy Focus Area: Renewable Energy, Energy Efficiency, Climate Change Topics: Policiesdeployment programs, Background analysis Resource Type: Dataset...

  14. Database for Regional Geology, Phase 1- A Tool for informing...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    and 3) rock properties and in-situ conditions for shale estimated from sonic velocity measurements, and 4) other aspects important to potential future site evaluation exercises. ...

  15. Marine and Hydrokinetic Technology Database | Open Energy Information

    Open Energy Info (EERE)

    prod-http-80-800498448.us-east-1.elb.amazonaws.comwimagesdd2Red-marker.png","group":"","inlineLabel":"","visitedicon":"","text":"

  16. APFED-Good Practice Database | Open Energy Information

    Open Energy Info (EERE)

    Land Use, Water Conservation Topics: Policiesdeployment programs Resource Type: Dataset, Lessons learnedbest practices User Interface: Website Website: www.apfed.netkidatabase...

  17. Confidential Business Information

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    It is DOE's policy that all comments may be included in the public docket, without change and as received, including any personal information provided in the comments (except ...

  18. Information Exchange management site

    Energy Science and Technology Software Center (OSTI)

    2012-08-01

    Django site used to manage the approved information exchanges (content models) after creation and public comment at https://github.com/usgin-models.

  19. Annotated checklist and database for vascular plants of the Jemez Mountains

    SciTech Connect (OSTI)

    Foxx, T. S.; Pierce, L.; Tierney, G. D.; Hansen, L. A.

    1998-03-01

    Studies done in the last 40 years have provided information to construct a checklist of the Jemez Mountains. The present database and checklist builds on the basic list compiled by Teralene Foxx and Gail Tierney in the early 1980s. The checklist is annotated with taxonomic information, geographic and biological information, economic uses, wildlife cover, revegetation potential, and ethnographic uses. There are nearly 1000 species that have been noted for the Jemez Mountains. This list is cross-referenced with the US Department of Agriculture Natural Resource Conservation Service PLANTS database species names and acronyms. All information will soon be available on a Web Page.

  20. COMMENTS OF THE MICHIGAN PUBLIC SERVICE COMMISSION STAFF TO REQUEST...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    COMMENTS OF THE MICHIGAN PUBLIC SERVICE COMMISSION STAFF TO REQUEST FOR INFORMATION REGARDING SMART GRID POLICY COMMENTS OF THE MICHIGAN PUBLIC SERVICE COMMISSION STAFF TO REQUEST ...

  1. Third-Party Financing and Power Purchase Agreements for Public...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Information Resources Third-Party Financing and Power Purchase Agreements for Public Sector PV Projects Third-Party Financing and Power Purchase Agreements for Public Sector PV ...

  2. NREL: State and Local Governments - State and Local Publications

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    State and Local Publications Subscribe to E-mail Updates NREL publishes technical reports, fact sheets, presentations, and brochures aimed at state and local government audiences. Several recent state and local publications are listed below, starting with the most current. You can also search the NREL Publications Database for additional resources. Featured Publication A new report presents a first-of-its kind analysis of residential and small commercial photovoltaic interconnection process time

  3. Fuel Cell Technologies Office Information Resources | Department...

    Energy Savers [EERE]

    Information Resources Fuel Cell Technologies Office Information Resources Learn about hydrogen and fuel cells, find publications and technical information, view and download...

  4. Paducah Site Public Tour | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Paducah Site Public Tour Paducah Site Public Tour June 25, 2016 8:00AM to 12:00PM CDT Contact For more information, visit: http:www.ffspaducah.comtours

  5. Paducah Site Public Tour | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Site Public Tour Paducah Site Public Tour May 21, 2016 8:00AM to 12:00PM CDT Contact For more information, visit: http:www.ffspaducah.comtours.

  6. Biological & Environmental Research Abstracts Database

    Office of Scientific and Technical Information (OSTI)

    Welcome to the Biological and Environmental Research Abstracts Database The U.S. Department of Energy's Office of Biological and Environmental Research (BER) conducts research in the areas of Climate and Environmental Sciences and Biological Systems Science. This database contains abstracts of research projects supported by the program. Work was performed at DOE Laboratories as well as at nearly 300 universities and other research institutions. This is a historical database that includes the

  7. Technology Transitions Facilities Database | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Technology Transitions Facilities Database Technology Transitions Facilities Database Type* Laboratory Name Facilities DataBase The DOE National Laboratories maintain cutting-edge experimental and computational capabilities that can provide unique opportunities for partners from the commercial sector to develop and test new technologies. The data base below lists DOE facilities and can be searched by the Laboratory at which the facility is located and by the type of R&D facility (TYPE) it

  8. Distributed Generation Operational Reliability and Availability Database,

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Final Report, January 2004 | Department of Energy Reliability and Availability Database, Final Report, January 2004 Distributed Generation Operational Reliability and Availability Database, Final Report, January 2004 This final report documents the results of an 18-month project entitled, "Distributed Generation Market Transformation Tools: Distributed Generation Reliability and Availability Database," sponsored by Oak Ridge National Laboratory (ORNL), Energy Solutions Center

  9. Using non-local databases for the environmental assessment of industrial activities: The case of Latin America

    SciTech Connect (OSTI)

    Osses de Eicker, Margarita; Hischier, Roland; Hurni, Hans; Zah, Rainer

    2010-04-15

    Nine non-local databases were evaluated with respect to their suitability for the environmental assessment of industrial activities in Latin America. Three assessment methods were considered, namely Life Cycle Assessment (LCA), Environmental Impact Assessment (EIA) and air emission inventories. The analysis focused on data availability in the databases and the applicability of their international data to Latin American industry. The study showed that the European EMEP/EEA Guidebook and the U.S. EPA AP-42 database are the most suitable ones for air emission inventories, whereas the LCI database Ecoinvent is the most suitable one for LCA and EIA. Due to the data coverage in the databases, air emission inventories are easier to develop than LCA or EIA, which require more comprehensive information. One strategy to overcome the limitations of non-local databases for Latin American industry is the combination of validated data from international databases with newly developed local datasets.

  10. Visitor Information

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Information Visitor Information The Museum is open to the public every day except Thanksgiving, Christmas, and New Year's. Contact Us thumbnail of Bradbury Science Museum 505 667-4444 Email Museum Hours Open every day except Thanksgiving, Christmas, and New Year's. Tuesday-Saturday: 10 am-5 pm Sunday & Monday: 1-5 pm FREE ADMISSION Download our brochure for more information (pdf) Weather conditions Call ahead during snow storms: (505) 667-6622 or (877) 723-4101. We follow Los Alamos National

  11. Buildings Performance Database Recommended Data Fields | Department...

    Broader source: Energy.gov (indexed) [DOE]

    Buildings Performance Database Recommended Data Fields, from the U.S. Department of Energy's Office of Energy Efficiency and Renewable Energy. BPD Priority List.pdf More Documents...

  12. Tank waste remediation systems technical baseline database

    SciTech Connect (OSTI)

    Porter, P.E.

    1996-10-16

    This document includes a cassette tape that contains Hanford generated data for the Tank Waste Remediation Systems Technical Baseline Database as of October 09, 1996.

  13. TWRS technical baseline database manager definition document

    SciTech Connect (OSTI)

    Acree, C.D.

    1997-08-13

    This document serves as a guide for using the TWRS Technical Baseline Database Management Systems Engineering (SE) support tool in performing SE activities for the Tank Waste Remediation System (TWRS). This document will provide a consistent interpretation of the relationships between the TWRS Technical Baseline Database Management software and the present TWRS SE practices. The Database Manager currently utilized is the RDD-1000 System manufactured by the Ascent Logic Corporation. In other documents, the term RDD-1000 may be used interchangeably with TWRS Technical Baseline Database Manager.

  14. Basic energy properties of electrolytic solutions database. ...

    Office of Scientific and Technical Information (OSTI)

    Basic energy properties of electrolytic solutions database. Viscosity, thermal conductivity, density, enthalpy Citation Details In-Document Search Title: Basic energy properties ...

  15. Bechtel Environmental Integrated Database Management System

    Energy Science and Technology Software Center (OSTI)

    1995-04-11

    Bechtel Environmental Integrated Data Management System (BEIDMS1.4) is an Oracle based relational database that stores data related to all aspects of environmental data collection.

  16. National Residential Efficiency Measures Database - Building...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    National Residential Efficiency Measures Database - Building America Top Innovation Image of a man insulating the ceiling of a home. Robust cost data for energy-efficiency measures ...

  17. Environment/Health/Safety (EHS): Databases

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    and to write evaluation reports) HMS - Hazard Management System Laser Management System Lessons Learned Best Practices REMS - Radiation Exposure Monitoring System SJHA Database...

  18. Buildings Performance Database Recommended Data Fields

    Broader source: Energy.gov [DOE]

    Buildings Performance Database Recommended Data Fields, from the U.S. Department of Energy's Office of Energy Efficiency and Renewable Energy.

  19. Materials Databases Infrastructure Constructed by First Principles Calculations: A Review

    DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

    Lin, Lianshan

    2015-10-13

    The First Principles calculations, especially the calculation based on High-Throughput Density Functional Theory, have been widely accepted as the major tools in atom scale materials design. The emerging super computers, along with the powerful First Principles calculations, have accumulated hundreds of thousands of crystal and compound records. The exponential growing of computational materials information urges the development of the materials databases, which not only provide unlimited storage for the daily increasing data, but still keep the efficiency in data storage, management, query, presentation and manipulation. This review covers the most cutting edge materials databases in materials design, and their hotmore » applications such as in fuel cells. By comparing the advantages and drawbacks of these high-throughput First Principles materials databases, the optimized computational framework can be identified to fit the needs of fuel cell applications. The further development of high-throughput DFT materials database, which in essence accelerates the materials innovation, is discussed in the summary as well.« less

  20. DOE - NNSA/NFO -- Public Reading Facility

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Public Reading Facility NNSA/NFO Language Options U.S. DOE/NNSA - Nevada Field Office Public Reading Facility Photograph of the Public Reading Facility The U.S. Department of Energy, National Nuclear Security Administration Nevada Field Office maintains information relating to this nation's nuclear testing program, the Nevada National Security Site, environmental monitoring and restoration, and waste management. Much of this information is already publicly available through use of the Nuclear