Powered by Deep Web Technologies
Note: This page contains sample records for the topic "bv dl deltak" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


1

Deltak LLC | Open Energy Information  

Open Energy Info (EERE)

Deltak LLC Deltak LLC Jump to: navigation, search Name Deltak LLC Place Minneapolis, Minnesota Zip 55441 Product Supplier of custom designed heat recovery steam generators (HRSGs) for gas turbine combined-cycle power generation and specialty boilers for waste heat recovery applications Coordinates 44.979035°, -93.264929° Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"ROADMAP","zoom":14,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"350px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":44.979035,"lon":-93.264929,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}

2

Ubbink BV | Open Energy Information  

Open Energy Info (EERE)

Ubbink BV Jump to: navigation, search Name: Ubbink BV Place: Doesburg, Netherlands Zip: 6980 AA Sector: Solar Product: Provides arange of solar integration products that it sells...

3

RGS Development BV | Open Energy Information  

Open Energy Info (EERE)

RGS Development BV Jump to: navigation, search Name: RGS Development BV Place: Netherlands Sector: Solar Product: Joint venture between the Energy Research Centre of the...

4

Scheuten Solar Holding BV | Open Energy Information  

Open Energy Info (EERE)

BV Jump to: navigation, search Name: Scheuten Solar Holding BV Place: Venlo, Netherlands Zip: 5900 Sector: Solar Product: Scheuten Solar is a globally operating, innovative and...

5

DL-36361 UC-414 I  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

DL-36361 DL-36361 UC-414 I * Discovery of the Most Distant Supernovae and the Quest for L l Gerson Goldhaber and Saul Perlmutter Lawrence Berkeley Laboratory and Center for Particle Astrophysics University of California, Berkeley, CA 94720 Silvia Gabi, Ariel Goobar, Alex Kim, Mathew Kim, and Reynald Pain Lawrence Berkeley Laboratory, University of California Berkeley, CA 94720 Carl Pennypacker and Ivan Small Lawrence Berkeley Laboratory and Space Sciences Laboratory University of California, Berkeley, CA 94720 Brian Boyle, Richard Ellis, and Richard McMahon Institute of Astronomy, Cambridge, United Kingdom and Peter Bunclarlc, Dave Carter, and Roberto Terlevich Royal Greenwich Observatory, Cambridge, United Kingdom May 1994 T h i s work w a s supported in part by the U.S. Department of Energy under Contract No. DE-AC03-76SF00098,

6

Evelop BV | Open Energy Information  

Open Energy Info (EERE)

Evelop BV Evelop BV Jump to: navigation, search Name Evelop BV Place Utrecht, Netherlands Zip 3503 RC Product Utrecht-based firm that develops sustainable energy projects in the Netherlands and abroad, especially in Western Europe, Eastern Europe and Latin America. Coordinates 52.088932°, 5.115405° Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"ROADMAP","zoom":14,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"350px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":52.088932,"lon":5.115405,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}

7

Intivation BV | Open Energy Information  

Open Energy Info (EERE)

Intivation BV Intivation BV Jump to: navigation, search Name Intivation BV Place Amsterdam, Netherlands Zip 1075 Sector Solar Product Netherlands-based manufacturer of solar-powered consumer products for electronics, notably solar handsets and chargers. Coordinates 52.37312°, 4.893195° Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"ROADMAP","zoom":14,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"350px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":52.37312,"lon":4.893195,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}

8

Innogrow BV | Open Energy Information  

Open Energy Info (EERE)

Innogrow BV Innogrow BV Jump to: navigation, search Name Innogrow BV Place Utrecht, Netherlands Zip 3503 RK Product Innogrow has developed a greenhouse product for gardening and thermal energy source. Coordinates 52.088932°, 5.115405° Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"ROADMAP","zoom":14,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"350px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":52.088932,"lon":5.115405,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}

9

SunConnex International BV | Open Energy Information  

Open Energy Info (EERE)

BV Jump to: navigation, search Name: SunConnex International BV Place: Amsterdam, Netherlands Zip: 1096 Sector: Solar Product: Dutch PV installer established in 1989; supplier...

10

Solland Solar Energy BV | Open Energy Information  

Open Energy Info (EERE)

Dutch manufacturer of crystalline silicon back-contact solar cells. References: Solland Solar Energy BV1 This article is a stub. You can help OpenEI by expanding it. Solland...

11

Dutch Space BV | Open Energy Information  

Open Energy Info (EERE)

Space BV Space BV Jump to: navigation, search Name Dutch Space BV Place Leiden, Netherlands Zip 2333 Sector Solar Product Leiden-based supplier of subsystems for the European space industry, including the production of solar arrays for spacecraft. Coordinates 52.15457°, 4.49463° Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"ROADMAP","zoom":14,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"350px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":52.15457,"lon":4.49463,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}

12

GiraMundo BV | Open Energy Information  

Open Energy Info (EERE)

GiraMundo BV GiraMundo BV Jump to: navigation, search Name GiraMundo BV Place Deventer, Netherlands Zip 7411TH Sector Solar Product GiraSolar's project development division. Coordinates 52.251034°, 6.159899° Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"ROADMAP","zoom":14,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"350px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":52.251034,"lon":6.159899,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}

13

Eurus Energy Europe BV | Open Energy Information  

Open Energy Info (EERE)

Europe BV Europe BV Jump to: navigation, search Name Eurus Energy Europe BV Place London, United Kingdom Zip SW1Y 4QT Sector Wind energy Product European arm of Japanese wind power project developer. Coordinates 51.506325°, -0.127144° Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"ROADMAP","zoom":14,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"350px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":51.506325,"lon":-0.127144,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}

14

Pillar Group BV | Open Energy Information  

Open Energy Info (EERE)

BV BV Jump to: navigation, search Name Pillar Group BV Place Kyiv, Ukraine Zip 4136 Sector Solar Product Holding company; subsidiary Silicio Solar makes monosilicon wafers through the Cz process. Coordinates 50.429447°, 30.546693° Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"ROADMAP","zoom":14,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"350px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":50.429447,"lon":30.546693,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}

15

DutchSolar BV | Open Energy Information  

Open Energy Info (EERE)

DutchSolar BV DutchSolar BV Jump to: navigation, search Name DutchSolar BV Place Deventer, Netherlands Sector Solar Product Manufactures the GiraSolar brand of PV solar modules. Coordinates 52.251034°, 6.159899° Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"ROADMAP","zoom":14,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"350px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":52.251034,"lon":6.159899,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}

16

Note on Evaluation of AWG Port Utilization Probabilities dl(1, j), j = 1, D, D -1, and  

E-Print Network [OSTI]

1 Note on Evaluation of AWG Port Utilization Probabilities dl(1, j), j = 1, D, D - 1, and dl(1, 1, D - 1 In this appendix we evaluate dl(1, j) for j = 1, D, D-1, i.e., the output port j is not a direct neighbor of sender port D, and note that the dl(1, j) are the same for these AWG ports j. We

Reisslein, Martin

17

Aggregation of n-octanoyl-dl-cysteine in aqueous solvent systems  

E-Print Network [OSTI]

indicated the predominant sites of interaction of thymine with the micellar n-octanoyl-dl-cysteine. At the lower pH ranges of 6. 0 and 7. 5 thymine primarily interacts with protons close to the sulfhydryl group of the surfactant while at the higher p... concentration Deoxyribonucleic acid n-Octanoyl-dl-cysteine Tetrahydrofuran Nuclear magnetic resonance Surfactant concentration Observed chemical shift of surfactant Micellar chemical shift of surfactant Monomeric chemical shift of surfactant Monomeric...

Shelley, Ralph Ray

2012-06-07T23:59:59.000Z

18

Applied Clay Science, 1 (1985) 89--101 89 Elsevier Science Publishers B.V., Amsterdam --Printed in The Netherlands  

E-Print Network [OSTI]

in The Netherlands KINETICS OF POTASSIUM EXCHANGE IN HETEROGENEOUS SYSTEMS D.L. SPARKS and T.H. CARSKI Department

Sparks, Donald L.

19

Resources, Conservation and Recycling, 11 (1994) 261-274 Elsevier Science B.V.  

E-Print Network [OSTI]

Resources, Conservation and Recycling, 11 (1994) 261-274 Elsevier Science B.V. 261 -~ Assessing can be re-used as a new resource material, such as soil fertilizer and conditioner, to substitute

Tiquia-Arashiro, Sonia M.

20

An introduction to BV functions in Wiener spaces M. Miranda jr, M. Novaga, D. Pallara  

E-Print Network [OSTI]

been considered by Fukushima in [32] and Fukushima-Hino in [33], where the first definition of BV- tion of finite perimeter sets in finite dimension given by Fukushima in [31], see Theorem 4 below

Novaga, Matteo

Note: This page contains sample records for the topic "bv dl deltak" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


21

Characterization of a novel gene encoding ankyrin repeat domain from Cotesia vestalis polydnavirus (CvBV)  

SciTech Connect (OSTI)

Cotesia vestalis (Haliday) is an endoparasitoid of Plutella xylostella (L.) larvae and injects a polydnavirus (CvBV) into its host during oviposition. In this report we describe the characterization of a gene (CvBV805) and its products. CvBV805 is located on the segment S8 of CvBV genome; it has a size of 909 bp and encodes a predicted protein of 125 amino acids. This protein contains an ankyrin repeat domain with a high degree of similarity with I{kappa}B-like genes. Gene transcripts were detected in extracts of the host as early as 2 h post-parasitization (p.p.) and continued to be detected through 24 h. Tissue-specific expression patterns showed that CvBV805 might be involved in early host immunosuppression. CvBV805 was detected in parasitized hosts at 12 h p.p. and in rBac-eGFP-CvBV805-infected Tn-5B1-4 cells at 72 h.p.i. by using western blots analysis. The size of the protein expressed in the host hemocytes and infected Tn-5B1-4 cells was 17 kDa and 56 kDa (including eGFP), respectively, which nearly corresponded with the predicted molecular weight (14.31 kDa) of CvBV805, suggesting that the protein did not undergo extensive post-translational modification. The protein was confirmed to be present within the nuclear region in hemocytes of the parasitized P. xylostella larvae at 48 h p.p. using confocal laser scanning microscopy.

Shi Min; Chen Yafeng; Huang Fang; Liu Pengcheng [Institute of Insect Sciences, Zhejiang University, 268 Kaixuan Road, Hangzhou 310029 (China); Zhou Xueping [Institute of Biotechnology, Zhejiang University, 268 Kaixuan Road, Hangzhou 310029 (China); Chen Xuexin [Institute of Insect Sciences, Zhejiang University, 268 Kaixuan Road, Hangzhou 310029 (China)], E-mail: xxchen@zju.edu.cn

2008-06-05T23:59:59.000Z

22

International Journal of Mass Spectrometry and Zon Processes, 80 (1987) 51-62 Elsevier Science Publishers B.V.. Amsterdam -Printed in The Netherlands  

E-Print Network [OSTI]

Publishers B.V.. Amsterdam - Printed in The Netherlands 51 VIBRATIONAL OVERLAP INTEGRALS BETWEEN THE NEUTRAL

Zare, Richard N.

23

MR-Trackable Intramyocardial Injection Catheter P.V. Karmarkar,1* D.L. Kraitchman,1  

E-Print Network [OSTI]

MR-Trackable Intramyocardial Injection Catheter P.V. Karmarkar,1* D.L. Kraitchman,1 I. Izbudak,1 L.V. Hofmann,1 L.C. Amado,2 D. Fritzges,1 R. Young,3 M. Pittenger,3 J.W.M. Bulte,1 and E. Atalar1 ventricular remodeling. MRI can be effectively used to differentiate in- farcted from healthy myocardium. MR

Atalar, Ergin

24

Kinetics of on Goethite: A Pressure Relaxation Study. P. G. GROSSL*, MJ. EICK, D.L.  

E-Print Network [OSTI]

I Kinetics of on Goethite: A Pressure Relaxation Study. P. G. GROSSL*, MJ. EICK, D.L. SPARKS, and C the adsorption/desorption of the oxyanions, chromate and arsenate, on goethite (a-FeOOH). Experimental conditions included equilibration of a 10 g L-l goethite (surface area 52 m2 g-l) suspension with initial total

Sparks, Donald L.

25

Complete genome sequence of Mesorhizobium ciceri bv. biserrulae type strain (WSM1271T)  

SciTech Connect (OSTI)

Mesorhizobium ciceri bv. biserrulae strain WSM1271T was isolated from root nodules of the pasture legume Biserrula pelecinus growing in the Mediterranean basin. Previous studies have shown this aerobic, motile, Gram negative, non-spore-forming rod preferably nodulates B. pelecinus a legume with many beneficial agronomic attributes for sustainable agriculture in Australia. We describe the genome of Mesorhizobium ciceri bv. biserrulae strain WSM1271T consisting of a 6,264,489 bp chro-mosome and a 425,539 bp plasmid that together encode 6,470 protein-coding genes and 61 RNA-only encoding genes.

Nandesena, Kemanthi [Murdoch University, Perth, Australia] [Murdoch University, Perth, Australia; Yates, Ron [Murdoch University, Perth, Australia] [Murdoch University, Perth, Australia; Tiwari, Ravi [Murdoch University, Perth, Australia] [Murdoch University, Perth, Australia; O'Hara, Graham [Murdoch University, Perth, Australia] [Murdoch University, Perth, Australia; Howieson, John [Murdoch University, Perth, Australia] [Murdoch University, Perth, Australia; Ninawi, Mohamed [Murdoch University, Perth, Australia] [Murdoch University, Perth, Australia; Chertkov, Olga [Los Alamos National Laboratory (LANL)] [Los Alamos National Laboratory (LANL); Detter, J. Chris [U.S. Department of Energy, Joint Genome Institute] [U.S. Department of Energy, Joint Genome Institute; Tapia, Roxanne [Los Alamos National Laboratory (LANL)] [Los Alamos National Laboratory (LANL); Han, Cliff [Los Alamos National Laboratory (LANL)] [Los Alamos National Laboratory (LANL); Woyke, Tanja [U.S. Department of Energy, Joint Genome Institute] [U.S. Department of Energy, Joint Genome Institute; Pitluck, Sam [U.S. Department of Energy, Joint Genome Institute] [U.S. Department of Energy, Joint Genome Institute; Nolan, Matt [U.S. Department of Energy, Joint Genome Institute] [U.S. Department of Energy, Joint Genome Institute; Land, Miriam L [ORNL] [ORNL; Liolios, Konstantinos [U.S. Department of Energy, Joint Genome Institute] [U.S. Department of Energy, Joint Genome Institute; Pati, Amrita [U.S. Department of Energy, Joint Genome Institute] [U.S. Department of Energy, Joint Genome Institute; Copeland, A [U.S. Department of Energy, Joint Genome Institute] [U.S. Department of Energy, Joint Genome Institute; Kyrpides, Nikos C [U.S. Department of Energy, Joint Genome Institute] [U.S. Department of Energy, Joint Genome Institute; Ivanova, N [U.S. Department of Energy, Joint Genome Institute] [U.S. Department of Energy, Joint Genome Institute; Goodwin, Lynne A. [Los Alamos National Laboratory (LANL)] [Los Alamos National Laboratory (LANL); Meenakshi, Uma [Murdoch University, Perth, Australia] [Murdoch University, Perth, Australia; Reeve, Wayne [Murdoch University, Perth, Australia] [Murdoch University, Perth, Australia

2013-01-01T23:59:59.000Z

26

bv2epr: A Tool for Polynomially Translating Quantifier-free Bit-Vector Formulas into EPR  

E-Print Network [OSTI]

bv2epr: A Tool for Polynomially Translating Quantifier-free Bit-Vector Formulas into EPR Gergely Logic (EPR). This allows us to solve QF BV problems using EPR solvers and avoids the exponential growth benchmarks for EPR solvers. 1 Introduction Bit-precise reasoning over bit-vector logics is important for many

Biere, Armin

27

Chemical Geology, 112 ( 1994 ) 91-104 91 Elsevier Science B.V., Amsterdam  

E-Print Network [OSTI]

August 1987 from eight stations along the longitudinal salinity gradient of the Beaulieu River Estuary the effectof salinity, agitation, biological activity, addition of a carbon source and degree of water of changing salinity on phos- 0009-2541/94/$07.00 © 1994 Elsevier Science B.V. All rights reserved. SSDI 0009

Canberra, University of

28

Landscape Ecology vol. 10 no. 4 pp 229-237 (1995) SPB Academic Publishing bv, Amsterdam  

E-Print Network [OSTI]

Landscape Ecology vol. 10 no. 4 pp 229-237 (1995) SPB Academic Publishing bv, Amsterdam Culture and changing landscape structure Joan Iverson Nassauer Department of Landscape Architecture, University, landscape ecology Abstract Culture changes landscapes and culture is embodied by landscapes. Both aspects

Nassauer, Joan Iverson

29

Journal of Wind Engineering and Industrial Aerodynamics, 24 (1986) 215--225 215 Elsevier Science Publishers B.V., Amsterdam --Printed in The Netherlands  

E-Print Network [OSTI]

Publishers B.V., Amsterdam -- Printed in The Netherlands MULTIPLE ACTUATOR-DISC THEORY FOR WIND TURBINES B

McCalley, James D.

30

u.s. Dl1PARUIFNT OF ENERGY EERE PROJECT MAN AGEMENT CENTER NEPA DETERMINATION  

Broader source: Energy.gov (indexed) [DOE]

Dl1PARUIFNT OF ENERGY Dl1PARUIFNT OF ENERGY EERE PROJECT MAN AGEMENT CENTER NEPA DETERMINATION Page I of2 STATE: TX RECIPIENT:E1 Paso, TX PROJECT PV Solar Demonstration Project ARRA-EECBG-City of EI Paso, TX TITLE: Funding Opportunity Announcement Number Procurement Instrument Number NEPA Control Number CID Number DE-FOA-OOOOO13 DE-EEOOOO964 GFQ-0000964-OO3 G0964 Based on my review orlhe information concerning the proposed action, as NEPA Compliance Officer (authoriJ'£d under DOE Order 451.IA), I have made the rollowing determination: ex, EA, EIS APPENDIX AND NUMBER: Description: 85.16 Solar photovoltalc systems The installation, modification, operation, and removal of commercially available solar pholovoltaic systems located on a building or other structure (such as rooftop, parking lot or facility, and mounted to

31

Voltage Dependent Carrier Collection in CdTe Solar Cells D.L. Btzner1  

E-Print Network [OSTI]

Voltage Dependent Carrier Collection in CdTe Solar Cells D.L. Bätzner1 , Guido Agostinelli2 , A to 1000nm, i.e. the band edge region of CdTe. Region I is further divided in a `blue' part between 300 nm III is as well subdivided in region IIIa from about 800 nm to the band gap of CdTe (~850 nm

Romeo, Alessandro

32

Tss4U BV formerly Holecsol R S Renewable Energy Systems and Shell Solar  

Open Energy Info (EERE)

Tss4U BV formerly Holecsol R S Renewable Energy Systems and Shell Solar Tss4U BV formerly Holecsol R S Renewable Energy Systems and Shell Solar Energy Jump to: navigation, search Name Tss4U BV (formerly Holecsol, R&S Renewable Energy Systems and Shell Solar Energy) Place Veldhoven, Netherlands Zip 5503 Sector Solar, Wind energy Product Provides small solar and wind for offgrid applications, notably power for oil rigs. Coordinates 51.421746°, 5.404554° Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"ROADMAP","zoom":14,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"350px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":51.421746,"lon":5.404554,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}

33

U.S. Dl1PARl'MENT OF ENERGY EERE PROJECT MAN AG EMENT CENTER  

Broader source: Energy.gov (indexed) [DOE]

r-.u..~ r-.u..~ , U.S. Dl1PARl'MENT OF ENERGY EERE PROJECT MAN AG EMENT CENTER NEPA DEl'ElU.,nNAl'ION RECIPIENT:WA Dept. of Commerce PROJECT TITLE: Washington State Ferries Biodiesel Project· Phase II Page 1 of3 STATE: WA Funding Opportunity Announcement Number ProcuR'mentlnstrument Number NEPA Control Number em Number DE-FOA-OOOOO52 EEOOOO139 GF0-0000139-039 EE139 Based on my review orlhe Information concerning the propostd action, as NEPA Compliance Officer (authorized under DOE Order 45I.1A), I have made tbe rollowing determination: ex, EA, EIS APPENDIX AND NUMBER: Description: B5.22 Alternative fuel vehicle fueling stations The installation, modification, operation, and removal of alternative fuel vehicle fueling stations (such as for compressed

34

ANALYTICAL DATA SHEET ANALYTICAL DEPT. - HEALTH Al\rD SAFETY DlVlSlON  

Office of Legacy Management (LM)

em IVIL, u-3 em IVIL, u-3 1' 1L, I -' I ANALYTICAL DATA SHEET ANALYTICAL DEPT. - HEALTH Al\rD SAFETY DlVlSlON 1956 1. H.# fL22 Industrial Hygiene or Medical Dept. Sample Nor& 3 Date Collected- 5117 by --Route to CES CES r Location IQJKER-PEMJNS Co- Type of Sample-waternalyzed for F Alpha Remarks -&I GG -- u - Beta Samples of water discharged to river during Steam clean- No, Ra ing of equipment. Oil PH Be Th Sample No. Hour Sample Description (RT Please analyze for gm/U/gal. BP-1 P- RO-Kneader BP-2 K- N-Kneader BP-3 Omera Feeder - __-- .___ -- i ___- ------I - 1 I . ----.--- - ------ .-___ _- I I - 3" - 1 ' : i ' Nt! w-d Analytical Chemistry Section: - Date Received 5-21-56 bY %b. Date Reported 5-2 Z-56 by&b. Method of Analysis Fluorimeter

35

EERE PROJECT MANAGEMENT CDITER Nl!PA Dl!Tl!Rl\llNATION  

Broader source: Energy.gov (indexed) [DOE]

... ... ~ . u.s DEPAR lENT OFl!NERG' EERE PROJECT MANAGEMENT CDITER Nl!PA Dl!Tl!Rl\llNATION Page 1 of2 RECIPIENT:Stanford University STATE: CA PROJECf TITLE: In·Situ X·Ray Analysis of Rapid Thermal Processing for Thin·FiI Solar Cells: Closing the Gap between Production and Laboratory Efficiency Funding Opportunity Announcement Number DE·FOA-0000654 Procurement Instrument Number DE·EE0005951 NEPA Control Number em Number GFQ-0005951·001 G05951 Based on my review of the information concerning the proposed action, as NEPA Compliance Officer (authorized under DOE Order 4SI.IA), I have made the following determination: CX, EA, EIS APP~:NDIX AND NUMBER: Description: A9 Information gathering, analysis, and dissemination 81.31 Installation or

36

Dl!PARThlENT OF ENERGY EERE PROJECT \1A~AGEMENT CENTER  

Broader source: Energy.gov (indexed) [DOE]

~"'-'~' ~"'-'~' u.s. Dl!PARThlENT OF ENERGY EERE PROJECT \1A~AGEMENT CENTER NEPA DETEIU.llNATION Page 1 of2 REel PIENT:County of Somerset STATE: NJ PROJECT TITl.E : Somerset County Renewable Energy Initiative Funding Opportunity Announcement Number Procurement Instrument Number NEPA Control Number CID Number DE-EEOOO3199 GFOOOO3199-001 G03199 BaSC'd on my review o!tbe information concerning the proposed action, as NEPA Compliance Officrr (authorized under DOE Order 451.1A), I have made the following detenninatioo: ex, EA, [IS APPENDIX AND NUMBER: Description: 85.16 Solar photovoltaic systems The installation, modification , operation, and removal of commercially available solar photoyoltaic systems located on a building or other structure (such as rooftop. parking lot Of facility

37

Rvision par r-ensembles de bases de connaissances en DL-LiteR S. Benferhat1  

E-Print Network [OSTI]

2 E. Würbel3 1 Université d'Artois - Nord de France, CRIL-CNRS UMR 8188. 2 Université d- vision" for revising DL-Lite knowledge bases. Such stra- tegy of revision is based on inconsistency

Paris-Sud XI, Université de

38

Posizione Matricola Corso di Laurea Magistrale Sede isc. Sede alt. Voto laurea Data nascita 1 782252 A-ARCHITETTURA MI BV 110 07/05/1989  

E-Print Network [OSTI]

782252 A-ARCHITETTURA MI BV 110 07/05/1989 2 766298 A-PIANIFICAZIONE URBANA E POLITICHE TERRITORIALI MI BV 110 20/04/1989 3 770229 A-PIANIFICAZIONE URBANA E POLITICHE TERRITORIALI MI 110 27/06/1988 4 767317 A-ARCHITETTURA MI 110 13/06/1988 5 765987 A-PIANIFICAZIONE URBANA E POLITICHE TERRITORIALI MI 110

39

Earth and Planetary Science Letters, 116(1993) 1-8 1 Elsevier Science Publishers B.V., Amsterdam  

E-Print Network [OSTI]

Earth and Planetary Science Letters, 116(1993) 1-8 1 Elsevier Science Publishers B.V., Amsterdam as the axialbody rotation. An observed magnetic superchron seems to end when a new hotspot migration cycle,rotating and magnetized mantles, in which the characteristic surface tracers are believed to reflect the patterns

Fridlind, Ann

40

Landscape Ecology vol. 6 no. 3 pp 147-159 (1992) SPB Academic Publishing bv, The Hague  

E-Print Network [OSTI]

Landscape Ecology vol. 6 no. 3 pp 147-159 (1992) SPB Academic Publishing bv, The Hague Landscape, Rheinsprung 9, CH-4051,Basel, Switzerland Keywords: landscape, metapopulation, reproductive systems, life history traits, non-equilibrium Abstract Distribution of genetic diversity in a landscape depends on both

Note: This page contains sample records for the topic "bv dl deltak" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


41

ANALYTICAL DATA SHEET ANALYTICAL DEPT. - HEALTH AhD SAFETY DlVlSlDN  

Office of Legacy Management (LM)

ANALYTICAL DEPT. - HEALTH AhD SAFETY DlVlSlDN I -. . Industrial Hygiene or Medical Dept. 1956 I. H.# 984 Sample Nos. l2 Date Collected- o/2g by&- Route to J" Location SSi4.X CUiTn! CXJitP. Type of Sample&-dust Analyzed for F Alpha x Remarks P~UXC~JGIi.' ON. 14lCI11~ U Beta - IIoll0Wi.n~ slucs - NO, Ra Oil PH Be Th Sample No. 7573p Hour Sample Description 1355 CZ Orxxator sets slul: into place, closes shield over machine S starts &ill. oil coolant flows through hollow drill ____ 3 is rebounded back through an openiq covers 1 cor.lp N9 8775 Analytical Chemistry Section: Date Received 7-2-66 by hb Date Reported 74X& bY IIR Method of Analysis Alpha sdntillation cam 2 % ' CJly Counting Data: BKGD .27 c/min GE0 4o% /min 1 I c- d/ill/M 3

42

DEPXRTMEKT OF ENV]RO~:MENTAL F'ROTECTION DlVklOh OF  

Office of Legacy Management (LM)

. * . * @.+<, .-- v 7, -e -5 u i' ;. - - : ,.:,, 4-.1M-4. a". : ' - l-1 &dp d 3-m 3jPr5Py DEPXRTMEKT OF ENV]RO~:MENTAL F'ROTECTION DlVklOh OF ~NVIR0N~Eh~A.L OUR' tiIn - . BUREAU OF R&DllmcN t=ROTE~lOH ' 1 ,_ jBD 5cOTCH ROAD. ~R~%~obi. fd. 1. 08628 .' - ._ -_ _ . . : S=_srterrjer 27, 1977 - ,. _ :.- ,_..I \ L . x=- a-. JEC): f' eust C--l L-9 ,c:c- -*r 2ze E&f&y _3=iz=Et=g cr;i\' ==Siq ' ---res"LE;, c2iiIps - de- ~-z7~~to3, Bew --d Jersey DE540 3ez' -- . w- Tecsk: i 25, 1577, A&=!= --t' -jD,r= of

43

DEPARTMENT OF ENERGY EERE PROJECT MANAGEMENT CENTER N1!PA Dl!1'ElU.llNATION  

Broader source: Energy.gov (indexed) [DOE]

N1!PA Dl!1'ElU.llNATION N1!PA Dl!1'ElU.llNATION RECIPIENT:City of Perth Amboy PROJECT TITLE : Municipal Complex Solar Power Project Page 1 of2 STATE: NJ Funding Opportunity Announl::ement Number Procurement Instrument Number NEPA Control Number elD Number Congressionally Directed Project DE· EEOOO3172 GF0-0003172..Q01 EE3172 Based on my review of the information concerning the proposed action, as N[PA Compliance Officer (authoro.ed under DOE Order451.1A),1 have made tbe following determination: ex, EA, EIS APPENDIX AND NUMBER: Description: 8 5.1 Adions to oonserve energy, demonstrate potential energy conservation, and promote energy-efficiency that do not increase the indoor concentratIOns of potentially harmful substances. These actions may involve financial and technical

44

Recrystallization in CdTe/CdS A. Romeo, D.L. Batzner, H. Zogg, A.N. Tiwari*  

E-Print Network [OSTI]

Recrystallization in CdTe/CdS A. Romeo, D.L. Ba?tzner, H. Zogg, A.N. Tiwari* Thin Film Physics with HVE and CBD grown CdS window layers. q 2000 Elsevier Science S.A. All rights reserved. Keywords: Cd and to different deposition techniques of the window layer. Chemi- cal bath deposition (CBD) grown CdS is preferred

Romeo, Alessandro

45

U.S. DEPARTIl1ENT OF ENERGY EERE PROJECT MANAGEMENT CENTER NEPA Dl!TFR1ITNATION  

Broader source: Energy.gov (indexed) [DOE]

ENT OF ENERGY ENT OF ENERGY EERE PROJECT MANAGEMENT CENTER NEPA Dl!TFR1ITNATION RECIPIENT:Colorado School of Mines Page 1 on STATE: CO PROJECT TITLE: Time-lapse Joint Inversion of GEOphysical Data and its Application to Geothermal Prospecting GEODE Funding Opportunity Announcement Number DOE DE-FOA-OOOO522 Procurement Instrument Number OE-EEOOO5513 NEPA Control Number em Number GFO-o005513-Q01 0 Based on my review ofthe information concerning the proposed action, as NEPA Compliance Officer (authorized under DOE Order 451.IA), 1 have made the following determination: ex, EA, EIS APPENDIX AND NUMBER: Description: A9 1nformation ga thering, a nalysis, a nd d issem ination Information gathering (including, but not limited to, literature surveys, inventories, site visils, and audits), data analysis

46

PMC·Fr.. U.S. Dl?PARThIENT OFFNFRGY EERE PROJECT MANAGEMENT CE~TER  

Broader source: Energy.gov (indexed) [DOE]

Fr.. Fr.. U.S. Dl?PARThIENT OFFNFRGY EERE PROJECT MANAGEMENT CE~TER Nl!PA DF=llNATION RECIPIENT:Oregon Stale University-NNMREC PROJECT TITLE : Pacific Marine Energy Center FY2012 Funding Page 1 of3 STATE: OR Funding Opportunity Announcement Number Procurement Instrument Number NEPA Control Number CID Number G098030 DE-FG36-08GOI8179 GFO-GOI8179-004 G018179 Based on my review of the information concerning the proposed action, as NEPA Compliance Officer (authorized under DOE Order 451. 1A), I have made the following determination: ex, EA, EIS APPENDIX AND NUMBER: Description: A9 Inform ation gathering, analys is, and disseminatlon A1 1 Technical advice and assistance to organizations Information gathering (including, but not limited to, literature surveys, inventories, site visits, and

47

RECIPIENT:QDOE U.S. Dl1PARTlIIENT OF ENERGY EERE PROJECT MANAGEMENT CENTER  

Broader source: Energy.gov (indexed) [DOE]

QDOE QDOE U.S. Dl1PARTlIIENT OF ENERGY EERE PROJECT MANAGEMENT CENTER Nl!PA DETERMINATION Page 1 of2 STATE: OR PROJECT TITL.E : SEP ARRA - Deployment of Innovative Energy Efficiency and Renewable Energy - Agriculture - Dufur & HanncrCantrell Funding Opportunity Announcement Number Pro<:uremeniinstruml.'nt Number NEPA Control Number elD Number OE-FOA-OOOOOS2 EEOOOO140 GF0-0000140-001 EE140 Based on my review of the Information concerning the proposed action, as NEPA Compliance Officer (authorized under DOE Order 4SUA), I have made the following determination: ex, EA, EIS APPENDIX AND NUMBER: De~cription: 85.1 Actions to conserve energy. demonstrate potential energy oonservalion, and promote energy-efficiency that do not increase the indoor concentrations o

48

DEPARThIENT OF ENERGY EERE PROJECT MANAGEMENT CENTER NEPA Dl!1'FIt1.fiNATION  

Broader source: Energy.gov (indexed) [DOE]

DEPARThIENT OF ENERGY DEPARThIENT OF ENERGY EERE PROJECT MANAGEMENT CENTER NEPA Dl!1'FIt1.fiNATION RECIPIENT:Biomass Energy Resource Center PROJECf TITLE: Biomass Energy Resource Center - Core and Program Support Page 1 of2 STATE: VT Funding Opportunity Annoum:emenl Number Procu~ment Instrument Number NEPA Control Number CID Number COP DE-FG36-06G086103,AOO4 GFO-G086103-003 0 Based on my review oflhl' information concerning the proposed action, as NEPA Compliance Officer (aulhoru.ed under DOE Order 451.1A), I bne made the following determination: ex, EA, EIS APPF..NDIX AND NUMBER: Description: A9 Information gathering (including, but not limited 10, literature surveys, inventories, audits), data analysis (including computer modeling), document preparation (such as conceptual design or feasibility studies, analytical energy supply and

49

Cryogenic friction behavior of PTFE based solid lubricant composites N.L. McCook, D.L. Burris, P.L. Dickrell and W.G. Sawyer*  

E-Print Network [OSTI]

Cryogenic friction behavior of PTFE based solid lubricant composites N.L. McCook, D.L. Burris, P life [4,5], ability to operate from cryogenic temperature (4 K) to 500 K, and their relative that operate at cryogenic temperatures, there is a paucity of data available for friction coeffi- cients

Sawyer, Wallace

50

The feedback phase instability in the HBT-EP tokamak D.L. Nadle, C. Cates, H. Dahi, M.E. Mauel,  

E-Print Network [OSTI]

The feedback phase instability in the HBT-EP tokamak D.L. Nadle, C. Cates, H. Dahi, M.E. Mauel, D of a performance limiting feedback phase instability in the HBT-EP toka- mak are reported. The phase instability instability limits feedback performance in HBT-EP by decreasing the feedback loop's phase accuracy as gain

Mauel, Michael E.

51

Kinetics of Adsorption of Selenate and Selonite at the Goethite/Water InterfAce. p.e. ZHANG* and D.L. SPARKS.  

E-Print Network [OSTI]

Kinetics of Adsorption of Selenate and Selonite at the Goethite/Water InterfAce. p.e. ZHANG* and D.L. SPARKS. Univ. of Delaware. Mechanisms and kinetics of SeO, and Se~ at the goethite/water interface were

Sparks, Donald L.

52

Journal of Wind Engineering and Industrial Aerodynamics, 30 (1988) 233-241 233 Elsevier Science Publishers B.V., Amsterdam --Printed in The Netherlands  

E-Print Network [OSTI]

Journal of Wind Engineering and Industrial Aerodynamics, 30 (1988) 233-241 233 Elsevier Science Publishers B.V., Amsterdam -- Printed in The Netherlands EFFECT OF PARAMETRIC UNCERTAINTIES ON WIND EXCITED the influence of parametric uncertainties on the wind excited response of structures. Based on the available

Kareem, Ahsan

53

Thin Solid Films 440 (2003) 1118 0040-6090/03/$ -see front matter 2003 Elsevier Science B.V. All rights reserved.  

E-Print Network [OSTI]

interest as anode candidates in lithium-ion batteries. 2003 Elsevier Science B.V. All rights reserved these methods, new high temperature superconductors, magnetoresistors, phosphors and fuel cell catalysts have-ion batteries. The methodology is simple, robust, and allows for linear, constant or other desired functional

Hewitt, Kevin

54

Palaeogeography, Palaeoclimatology, Palaeoecology(Globaland Planetary Change Section), 90 (1991) 33-39 33 Elsevier Science Publishers B.V., Amsterdam  

E-Print Network [OSTI]

satellite datasets being col- lected by the operational weather satellite system (Schiffer and Rossow, 1985- 39 33 Elsevier Science Publishers B.V., Amsterdam Condensed Paper Use of operational satellite data. Use of operational satellite data for study of clouds and radiation in climate. Palaeogeogr

Fridlind, Ann

55

DEVELOPMENT OF HIGH EFFICIENCY FLEXIBLE CdTe SOLAR CELLS A.Romeo, M. Arnold, D.L. Btzner, H. Zogg and A.N. Tiwari*  

E-Print Network [OSTI]

to the solar panel that can be adapted to any kind of shape and is easy to deploy in space. In the last yearsDEVELOPMENT OF HIGH EFFICIENCY FLEXIBLE CdTe SOLAR CELLS A.Romeo, M. Arnold, D.L. Bätzner, H. Zogg Telephone: +44-1509-227031 E-mail: a.n.tiwari@lboro.ac.uk ABSTRACT: Polycrystalline thin film solar cells

Romeo, Alessandro

56

Posizione Matricola Corso di Laurea Magistrale Sede isc. Sede alt. Voto laurea Data nascita 1 765363 I-INGEGNERIA NUCLEARE MI BV 110 05/07/1988  

E-Print Network [OSTI]

765363 I-INGEGNERIA NUCLEARE MI BV 110 05/07/1988 2 766599 I-INGEGNERIA NUCLEARE MI 110 21/03/1988 3 764813 I-INGEGNERIA ELETTRICA MI 110 29/04/1987 4 765411 I-INGEGNERIA CHIMICA MI 110 23/05/1988 5 781546 NANOTECHNOLOGY MI 110 19/08/1989 6 778979 NANOTECHNOLOGY MI 110 21/05/1990 7 764495 I-INGEGNERIA NUCLEARE MI 110

57

U.S. DI!PARThlENT OF ENERGY EERE PROJECT MANAGEMENT CENTER Nl!PA Dl1TImfiNATION  

Broader source: Energy.gov (indexed) [DOE]

PARThlENT OF ENERGY PARThlENT OF ENERGY EERE PROJECT MANAGEMENT CENTER Nl!PA Dl1TImfiNATION RECIPIENT: BeIi Geospace, Inc Page 1 of2 STATE: TX PROJECT TITLE: Geothermal Technology Advancement for Rapid Development of Resources in the U.S. Funding OpportunUy Announcement Number Procurement Instrument Number NEPA Control Number em Number DE·FQA'()()()()S22 OE-EEOOO5515 GF0-0005515-001 G05515 Bued on my review oftbe information concerning the proposro action, as NEPA Compliance Officer (authorized under DOE Ordtr 4SI.IA), I have made the following determination: ex, EA, EIS APPENDIX AND NUMBER: Description : A9 Information gathering, analysis, and dissemination Information gathering (induding, but not limited to, literature surveys, inventories, site visits. and audits), data analysis

58

173. NICKEL SORPTION KINETICS ON THE CLAY FRACTION OF A SOIL. D.R. Roberts and D.L. Sparks, Department of Plant and Soil Sciences, University of Delaware, Newark,  

E-Print Network [OSTI]

173. NICKEL SORPTION KINETICS ON THE CLAY FRACTION OF A SOIL. D.R. Roberts and D.L. Sparks the fate of heavy metal contaminants in the soil environment. Past studies of heavy metal sorption kinetics. This study exannines Ni(II) sorption and desorption kinetics on the clay fraction (

Sparks, Donald L.

59

A. Kusiak, Data Mining and Decision Making, in B.V. Dasarathy (Ed.), Proceedings of the SPIE Conference on Data Mining and Knowledge Discovery: Theory, Tools, and Technology IV, Vol. 4730, SPIE, Orlando, FL, April 2002, pp. 155-165.  

E-Print Network [OSTI]

A. Kusiak, Data Mining and Decision Making, in B.V. Dasarathy (Ed.), Proceedings of the SPIE Conference on Data Mining and Knowledge Discovery: Theory, Tools, and Technology IV, Vol. 4730, SPIE, Orlando, FL, April 2002, pp. 155-165. Data Mining and Decision Making Andrew Kusiak Department of Mechanical

Kusiak, Andrew

60

Get The BV Toolbar Make BV My HomePage  

E-Print Network [OSTI]

BLACK VOICES Search All News & Entertainment Stories Main News Entertainment Life & Style Blogs Daily of President Bush. Corporate responsibility is integrated into a company's business through self leak. In fact, the company acknowledges that a permanent solution for containment of the oil

Note: This page contains sample records for the topic "bv dl deltak" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


61

Mann, C.P., Stix, J., Vallance, J.W., and Richer, M., 2004, Subaqueous intracaldera volcanism, Ilopango Caldera, El Salvador, Central America, in Rose, W.I., Bommer, J.J., Lpez, D.L., Carr, M.J., and Major, J.J., eds., Natural hazards in El Salvador: Boul  

E-Print Network [OSTI]

, Ilopango Caldera, El Salvador, Central America, in Rose, W.I., Bommer, J.J., López, D.L., Carr, M.J., and Major, J.J., eds., Natural hazards in El Salvador: Boulder, Colorado, Geological Society of America of America Special Paper 375 2004 Subaqueous intracaldera volcanism, Ilopango Caldera, El Salvador, Central

Long, Bernard

62

Microsoft Word - mitchell-dl.doc  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Characterizing Particle Size, Water Path and Photon Characterizing Particle Size, Water Path and Photon Tunneling in Ice and Water Clouds David L. Mitchell Atmospheric Sciences Division Desert Research Institute Reno, Nevada Robert P. d'Entremont Satellite Meteorology Group Atmospheric and Environmental Research, Inc. Lexington, Massachusetts Abstract Global information of ice water path (IWP) in ice clouds is urgently needed for testing of global climate models (GCMs) and other applications, but satellite retrievals of IWP are still in the developing stages, and tend to have large uncertainties (e.g. factor of 3 or more). Results of a new retrieval method are presented here that may have relatively low uncertainties, using several thermal-radiance channels. Recent research indicates that ice-cloud radiative properties depend on more than effective diameter

63

CM200DL-Final.doc  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

CM200 CM200 Core Status: new users must complete 2 trouble free training sessions and pass the drivers test to work independently during Core sessions. Flex Status: core users must complete 5 trouble free sessions to work during Flex sessions. To reserve a CM200 session, go to www/ncem.lbl.gov, click on "Microscope Scheduling", use proposal number and password to log in. You may only sign up for one Core session at a time. To cancel a session, email your request to the technical staff in charge of the microscope. CORE LICENSE TEST Safety  Understand emergency shut down procedure  Know emergency contact numbers  Know where LN protective equipment is  Find updated operating instruction and notice (?) Instrument Preparation  Check V7 closed and SSC on and in cooling

64

TEAM0.5DL.doc  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

0.5 0.5 Core Status: new users must complete 2 training sessions and pass a sample exchange exam to work independently during Core sessions (regular work hours). Flex Status: core users must complete 5 Core sessions and pass a driving test to work during Flex sessions (evening and weekend hours). All TEAM 0.5 scheduling must be coordinated through Peter Ercius at Percius@lbl.gov. You may be assigned only two sessions per month. CORE LICENSE Safety  Understand emergency shut-down procedure  Demonstrate handling of the column valves  Point out where emergency contact numbers are posted  Know how to contact NCEM staff for support Instrument preparation  Show how to check basic vacuum functionality and target pressure values  (Gun: 1, Liner: 18-20 and Octagon: < 10)

65

Internships at VSTEP BV Background VSTEP  

E-Print Network [OSTI]

, the effect of the current on the ship's manoeuvring characteristics needs to be implemented. 5. A damage (www.quest3d.com) and C++. Background Ship Simulator 2006 One of VSTEP's more recent products is a PC game called Ship Simulator 2006 (www.shipsim.com), in store in many countries since June 2006

Vuik, Kees

66

dlCC Opt: Optimization Software for Renewable Energy Projects...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

indicators of project opportunities. Many existing programs require the user to enter the size (kW) of the renewable energy system in order to start calculations. However,...

67

DL-940 1/08 Animal Health Diagnostic Center  

E-Print Network [OSTI]

These are instructions for collecting specimens for Campylobacter fetus culture fluorescent antibody and Tritrichomonas with protective sheath 5. Sterile rubber bulb (return to lab for credit to your account) Needed but not supplied by the AHDC 6. Syringe (3cc) and needle Procedures 1. Attach rubber bulb to collection catheter 2

Keinan, Alon

68

SSC-DL Version 1.0 SIRTF Science Center  

E-Print Network [OSTI]

-SED 6741 Code walk-through fixes/updates to "LoadIrsaPtgMetaData" perl subroutine. 6735 New module-masked pixels are NaN'd in final mips24 BCD products.. 6710 Update GenSBPHFsForCampaign.pl following comments from code walk-thru.. 6679 Update w_po

Masci, Frank

69

18 Modeling high-performance HBTs D.L. Pulfrey  

E-Print Network [OSTI]

an acceptable base resistance. A short base width leads directly to an improved cut-off frequency, fT , which, when coupled with the lower base resistance, leads to an improved oscillation frequency, fmax. These consideration is also given to the incorporation of the compact model for JC into a large-signal equivalent

Pulfrey, David L.

70

Bayesian Video Dejittering By BV Image Model Jianhong Shen  

E-Print Network [OSTI]

settings. For instance, due to electromagnetic interference in the environment (especially intentional

71

Bayesian Video Dejittering By BV Image Model Jianhong Shen  

E-Print Network [OSTI]

storage me- dia, or by electromagnetic interference in wireless video transmission. The goal of intrinsic, and applicable in more general settings. For instance, due to electromagnetic interference in the environment

Soatto, Stefano

72

Bayesian Video Dejittering By BV Image Model Jianhong Shen  

E-Print Network [OSTI]

to electromagnetic interference in the environment (especially intentional interfering as in battle fields), wireless

73

Wear 260 (2006) 915918 Technical note  

E-Print Network [OSTI]

-1648/$ ­ see front matter © 2005 Published by Elsevier B.V. doi:10.1016/j.wear.2005.06.009 #12;916 D.L. BurrisWear 260 (2006) 915­918 Technical note Improved wear resistance in alumina-PTFE nanocomposites nanocomposites showed up to 600? improvements in wear resistance over unfilled PTFE with the addition of Al2O3

Sawyer, Wallace

74

Identification of the membrane association of BV/ODV E26 and the domains in BV/ODV E26 responsible for nuclear trafficking to intranuclear microvesicles  

E-Print Network [OSTI]

part of the 26 kDa population is a membrane bound form interacting with an integral membrane protein in the ER and likely functions as an INM sorting factor. The 26 kDa membrane bond form is also found in the inner nuclear membrane, intra-nuclear...

Burks, Jared K.

2007-04-25T23:59:59.000Z

75

u.s. Dl!PARThIENT OF ENERGY EERE PROJECT MANAGEMENT CENTER NEPA DETERMINATION  

Broader source: Energy.gov (indexed) [DOE]

PARThIENT OF ENERGY PARThIENT OF ENERGY EERE PROJECT MANAGEMENT CENTER NEPA DETERMINATION Page 1 of2 RECIPIENT: University of Oregon STATE: OR PROJECT TITLE: Vapor Transport Deposition for Thin Film III-V Photovoltaics fo'unding Opportunity Announcement Number Procurement Instrument Number NEPA Control Number CID Number DE-FOA..()()()()654 DE-EEOOO5957 GF0-0005957·0Q1 Based on my review of the information concerning the proposed action, as NI<:PA Compliance Officer (authorized under DOE Order 451.1A), I have made the following determination : ex, EA, EIS APPENDIX AND NUMBER: Description: A9 Information gathering, analysis, and dissemination Information gathering (including, but not limited to, literature surveys, inventories, site visits, and audits). data analysis (including, but not limited to, computer modeling), document preparation

76

u.s. Dl!PAR1'M:ENT OF ENERGY EERE PROJECT MANAGEMENT CENTER  

Broader source: Energy.gov (indexed) [DOE]

PAR1'M:ENT OF ENERGY PAR1'M:ENT OF ENERGY EERE PROJECT MANAGEMENT CENTER NEPA DETERlIIINATION RECIPIENT :University of California San Diego PROJECT TITL.E: San Diego Center for Algae Biotechnology Page 1 of2 STATE: CA Funding Opportunity Announcement Number Procurement Instnlment Number NEPA Control Number em Number EEOOO3142 GF0-10-582 EE3142 Based on my review ortbe information concerning the proposed action, as NEPA Compliance Officer (authorukd under DOE Order 451.1A), I have made the following determination: ex, EA, EIS APPENDIX AND NUMBER: Description: 83.6 Siting . construction (or modification), operation, and deoommissioning of facilities for indoor bench-scale research projects and conventional laboratory operations (for example. preparation of chemical standards and sample analYSIS):

77

u.s. Dl!PARTMENT OF ENERGY EERE PROJECT MANAGEMENT CENTER Nl!PA DETERMINATION  

Broader source: Energy.gov (indexed) [DOE]

PARTMENT OF ENERGY PARTMENT OF ENERGY EERE PROJECT MANAGEMENT CENTER Nl!PA DETERMINATION RECIPIENT:WA Dept of Commerce Page 1 of3 STATE: WA PROJECT TITLE: SEP ARRA · WSU Anaerobic Digester - Nutrient Recovery Technology - Vander Haak Dairy Funding Opportunity Announcement Number Procurement Instrument Number NEPA Control Number CID Number EEOOOO139 GF0-0000139-040 0 Based on my review of the Information concerning the proposed action, as NEPA Compliance Officer (authorized under DOE Order 4S1.1A), I have made tbe following determination: ex, EA, EIS APPENDIX AND NUMBER: Description: A9 Information gathering, analysis, and dissemination Information gathering (including, but not limited to, literature surveys, inventories, site visils, and audits), data analysis (including

78

Data Compression and Harmonic Analysis D.L. Donoho, M. Vetterli,  

E-Print Network [OSTI]

, Littlewood­Paley theory, Sampling Theorem. ``Like the vague sighings of a wind at even, That wakes perhaps less familiar to the Information Theory community, growing out of the field of harmonic analysis analysis in this century. Typically, the problems and achievements of this field have involved goals

Donoho, David

79

Data Compression and Harmonic Analysis D.L. Donoho, M. Vetterli,  

E-Print Network [OSTI]

, Littlewood-Paley theory, Sampling Theorem. "Like the vague sighings of a wind at even, That wakes perhaps less familiar to the Information Theory community, growing out of the field of harmonic analysis analysis in this century. Typically, the problems and achievements of this field have involved goals

Donoho, David

80

TFI: RTEfuST, T{ ftd rDl-.I: 91.1.1.41493997  

E-Print Network [OSTI]

, windows, ventilators and partitions with extruded built up standard tubular sections/ appropriate Z for glazing I paneling, C.p. Oiass / stainless steel screws, all complete as per archjtectural drawings in aluminum doors, windows shutters and partition frames with C.p. brass / stainless steel screws etc

Bandyopadhyay, Antar

Note: This page contains sample records for the topic "bv dl deltak" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


81

TRIAC: A code for track measurements using image analysis tools D.L. Patiris a  

E-Print Network [OSTI]

.G. Ioannides a,* a Nuclear Physics Laboratory, Department of Physics, University of Ioannina, 451 10 Ioannina State Nuclear Track Detectors CR39. The program using image analysis tools counts the number of tracks for dosimetry proposes and classifies the tracks according to their radii for the spectrometry of alpha

Blekas, Konstantinos

82

A. E. K.Ris Ris-M-Dl^ Title and author(s)  

E-Print Network [OSTI]

Mechanics to Prer.oure Vocicel Reliability Analysis ty P.E. Becher and Arne Pedersen pages + tables -f- 16 OF STATISTICAL LINEAR ELASTIC FRACTURE MECHANICS TO PRESSURE VESSEL RELIABILITY ANALYSIS P.E. BECHER, A. PEDERSEN sampling. Copies to Library Reactor 100 50 Abstract to Available on request from the Library of the Danish

83

The foundational inequalities of D.L. Burkholder and some of their ...  

E-Print Network [OSTI]

Aug 3, 2011 ... multipliers obtained by projections (conditional expectations) of trans- formations of ...... of conformally invariant energy functionals and regularity of solutions to the generalized .... The Poisson process ??(t) of intensity ? arises from (0,0, ??1), where ?1 is the Dirac ...... other techniques, in the near future.

2011-08-03T23:59:59.000Z

84

Measurement of the B -> Dl nu branching fractions and form factor  

E-Print Network [OSTI]

J. Lee, 19 H. Schwarthoff, 19 A. Wolf, 19 M.M. Zoeller, 19 S.J. Richichi, 20 H. Severini, 20 P. Skubic, 20 A. Undrus, 20 M. Bishai, 21 S. Chen, 21 J. Fast, 21 J.W. Hinson, 21 N. Menon, 21 D.H. Miller, 21 E.I. Shibata, 21 I.P.J. Shipsey, 21 S. Glenn... efficiency and the smearing in ?w. The fraction of D 0 , 2 ?n decays in each w bin that is recon- structed is 17% to 21% and the average ?w resolution is 0.026, about one-half the bin width. The small statistical uncertainty in e ij is represented by s 2 e ij...

Ammar, Raymond G.; Baringer, Philip S.; Bean, Alice; Besson, David Zeke; Coppage, Don; Darling, C.; Davis, Robin E. P.; Kotov, S.; Kravchenko, I.; Kwak, Nowhan; Zhou, L.

1999-05-01T23:59:59.000Z

85

Transitional Cell Hyperplasia in the Bladders of Dogs Fed dl-Tryptophan  

Science Journals Connector (OSTI)

...these experiments add further fuel to the concept that tryptophan...available at a more resonable price, and a feeding experiment designed...REFERENCES 1. Brown, R. R., Price, J. M., Friedell, G. H...T., Brown, R. R., and Price, J. M. Incidence of Mouse...

J. L. Radomski; E. M. Glass; and William B. Deichmann

1971-11-01T23:59:59.000Z

86

Matematik Dnyas>, 2003 K>fl Tbitak Bilim dl (1979) sahibi, k>rk do-  

E-Print Network [OSTI]

> ayn> üniversiteden 1953'te ald>. 1960'da Ege ?niversitesi T>p Fakültesi'nde "yabanc> ma- tematik ve- l>flt>. Ege ?niversitesi'nde doçent (1965) ve profe- sör (1967) oldu. 1969-76 y>llar> aras>nda OD>rma Merke- zi'nde, 1995-97'de Gebze'de, Elektronik ve Krip- toloji Araflt>rma Merkezi'nde görev ald>. 1997

Sertöz, Ali Sinan

87

ISSN:1575-6807 D.L.: GC-1317-1999  

E-Print Network [OSTI]

Universitario de Ciencias y Tecnologías Cibernéticas Universidad de Las Palmas de Gran Canaria Campus de Tafira) Universidad de Las Palmas de Gran Canaria (ULPGC) Las Palmas de Gran Canaria December 4-6, 2003 Organized Editorial Commite in alphabetic order · Alvarez Luis (Universidad de Las Palmas de Gran Canaria) · Baumela

Granada, Universidad de

88

DOE/SC-ARM-13-003 ARM Lead Mentor Selection Process DL Sisterson  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

of the instrument system in a timely manner. * Use the Data Quality Problem Report (DQPR) process to alert the Site Scientist Team and Site Operations Team to problems with the...

89

Desalination, 48 (1983) l-16 Elsevier Science Publishers B.V., Amsterdam -Printed in The Netherlands  

E-Print Network [OSTI]

, S.B. McCRAY AND J.W. McCUTCHAN Chemical, Nuclear and Thermal Engineering Department, University instability, gas injection must be carried out continuous- ly. A six hour pre-injection period was required

Zachariah, Michael R.

90

Distribution of a Population of Rhizobium leguminosarum bv. trifolii among Different Size Classes of Soil Aggregates  

Science Journals Connector (OSTI)

...from 5 to 77 times greater than the populations...corresponding aggregate size classes of the fallow and...to 2.0-mm size class of the legume treatment...contained a significantly greater density of AR18 than the size classes of 0.25, 0.25...

Ieda C. Mendes; Peter J. Bottomley

1998-03-01T23:59:59.000Z

91

Scientia Horticulturae, 54 (1993) 255-265 255 Elsevier Science Publishers B.V., Amsterdam  

E-Print Network [OSTI]

-week old, in vitro grown yam plantletswere transferred to pots and treated in vivo with end-of- day (EOD and Skoog basal medium and exposed in vitro to EOD R or FR light. EOD FR light increased internode number and dry weight per plant only in the in vivo evaluation. EOD FR light enhancementsof internode

Decoteau, Dennis R.

92

WELL-POSEDNESS IN BV t AND CONVERGENCE OF A DIFFERENCE SCHEME FOR CONTINUOUS SEDIMENTATION  

E-Print Network [OSTI]

as well as in wastewater treatment plants. Mathematical models are urgently needed for the design-1516, USA. E-mail:jtowers@cts.com, URL: www.miracosta.cc.ca.us/home/jtowers/. 1 #12; 2 B  URGER, KARLSEN

93

A study of the back contacts on CdTe/CdS solar cells D.L. Batznera  

E-Print Network [OSTI]

Institute of Technology, Zu?rich, Technoparkstr. 1, 8005 Zu?rich, Switzerland b ANTEC GmbH, Industriestrasse 2-4, 65779 Kelkheim, Germany Abstract Conventional back contacts on CdTe/CdS solar cells layer thickness and stability issues have been studied. Different etchants not only clean the Cd

Romeo, Alessandro

94

Frank Masci (1)MIPS D/L Review (S6), August 7, 2001 Optical Distortion and its Representation  

E-Print Network [OSTI]

-imaged focal planes. l Distortion is significant. Code-V optical ray trace models: 4.7% (24µm), 7.9% (70µm No re-gridding is done to make the BCD and correct for distortion. Instead, the distortion

Masci, Frank

95

Tectonophysics, 154 (1988) 125-136 Elsevier Science Publishers B.V., Amsterdam -Printed in The Netherlands  

E-Print Network [OSTI]

in The Netherlands 125 The brittle-ductile transition in a deformation-mechanism map for halite FREDERICK M. CHESTER. The brittle-ductile transition in a deformation-mechanism map for halite. Tectonophysics, 154: 125-mechanism map for halite is presented, based on shear experiments at room temperature (22OC) over the range

Chester, Frederick M.

96

Serological and Ecological Characteristics of a Nodule-Dominant Serotype from an Indigenous Soil Population of Rhizobium leguminosarum bv. trifolii  

Science Journals Connector (OSTI)

...2 Medford (bean) 67 0.6 0.9 Klamath Falls (alfalfa) 20 0.8 4.1 Soil under...AR23, and AS27. In contrast to the fall rhizosphere response, host-serotype...M. Means. 1963. Serological groups of Rhizobium japonicum recovered...

Kamtin Leung; Kathryn Yap; Narjes Dashti; Peter J. Bottomley

1994-02-01T23:59:59.000Z

97

Bulk chemicals from biomass Jacco van Haveren, Agrotechnology and Food Innovations B.V., Wageningen, The Netherlands  

E-Print Network [OSTI]

41 Review Bulk chemicals from biomass Jacco van Haveren, Agrotechnology and Food Innovations B production, and available biomass conversion technologies, biomass-based routes are expected to make and -caprolactam. Technologies involving direct isolation of aromatic building blocks from biomass

Grossmann, Ignacio E.

98

Deep-Sea Research I (2004) 51(11) p.15171528. c 2004 Elsevier B.V. All rights reserved.  

E-Print Network [OSTI]

. The solubility of neon, nitrogen and argon in distilled water and seawater Roberta C. Hamme Scripps Institution, nitrogen and argon in distilled water and seawater, over a temperature range of 1­30 oC. Water those of Weiss (1971b, 1970) by 1% or more. 1 Introduction The dependence of gas solubility

Hamme, Roberta C.

99

Journal of Chromatography, 480 (1989) 421-43 I Elsevier Science Publishers B.V., Amsterdam -Printed in The Netherlands  

E-Print Network [OSTI]

have been described2*3. a Permanent address: Departamento de Ingenieria Quimica (ETSEIB), Universidad

Zare, Richard N.

100

EIT Foundation C/o ERBS BV, Burgemeester Oudlaan 50, Room H-7-25, 3062 PA Rotterdam -The Netherlands  

E-Print Network [OSTI]

-standard diffusion processes � Translate the corresponding process into exchange and information handling procedures � INTERNSHIP PROPOSAL Internship title: Non-standard diffusive transport (applied to complex information functions (PDFs) in a variety of natural and technological systems. However, little is known concerning

Boucherie, Richard J.

Note: This page contains sample records for the topic "bv dl deltak" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


101

Tecionop~ysics, 102 (1984) 53-84 Elsevier Science Publishers B.V., Amsterdam -Printed in The Netherlands  

E-Print Network [OSTI]

half of the Palau-Kyushu Ridge. In the second episode, the Izu-Mariana Trench retreated eastward. The 48 Ma ages of the northern part of the Palau-Kyushu Ridge and of Chichi-Jima of the Bonin Islands. From this and the subp~alle~sm in trend between the northern part of the Palau-Kyushu Ridge

Seno, Tetsuzo

102

Carbohydmte Research, 162 (1987) 145-152 Elsevier Science Publishers B.V., Amsterdam -Printed in The Netherlands  

E-Print Network [OSTI]

Pharmaceutical Industries Ltd. (Israel) Received January 16th, 1986; accepted for publication, November 3rd, 1986-O-tin derivatives 7 were efficiently hydro- lysed on silica gel either by reaction with absorbed water that the derivatives 7 can be obtained from the tin oxide questions the contention'Oa that esters R'COOR" react

Keinan, Ehud

103

Scientia Horticulturae, 34 (1988) 169-175 169 Elsevier Science Publishers B.V., Amsterdam --Printed in The Netherlands  

E-Print Network [OSTI]

-- Printed in The Netherlands Plastic Mulch Color Effects on Reflected Light and Tomato Plant Growth D.R. DECOTEAU', M.J. KASPERBAUER2,D.D. DANIELS' and P.G. HUNT 2 'Department of Horticulture, Clemson University.D. and Hunt, P.G., 1988. Plastic mulch color ef- fects on reflected light and tomato plant growth. Scientia

Decoteau, Dennis R.

104

0011-9164/09/$ See front matter 2008 Elsevier B.V. All rights reserved Desalination 239 (2009) 1021  

E-Print Network [OSTI]

, the diluted DS is treated in a reverse osmosis (RO) unit; the by-product is a reconcentrated DS for reuse. For potable reuse (e.g., indirect reuse through aquifer recharge), advanced treat- ment [e.g., reverse osmosis) 10­21 The forward osmosis membrane bioreactor: A low fouling alternative to MBR processes Andrea

105

Marine Chemistry, 20 (1987) 299-312 299 Elsevier Science Publishers B.V., Amsterdam --Printed in The Netherlands  

E-Print Network [OSTI]

in The Netherlands A FIELD COMPARISON OF TWO METHODS FOR THE DETERMINATION OF COPPER COMPLEXATION: BACTERIAL BIOASSAY

Morel, François M. M.

106

Tectonophysics, 104 (1984) 299-313 Elsevier Science Publishers B.V., Amsterdam -Printed in The Netherlands  

E-Print Network [OSTI]

in The Netherlands 299 SURFACE MORPHOLOGY ON CROSS-FOLD JOINTS OF THE APPALACHIAN PLATEAU, NEW YORK AND PENNSYLVANIA

Engelder, Terry

107

Analytica Chimica Acta, 162 (1984) 263--274 Elsevier Science Publishers B.V., Amsterdam --Printed in The Netherlands  

E-Print Network [OSTI]

in The Netherlands LIGAND EXCHANGE AND FLUORESCENCE QUENCHING STUDIES OF THE FULVIC ACID-IRON INTERACTION Effects

Morel, François M. M.

108

Tectonophysics, 119 (1985) 67-88 Elsevier Science Publishers B.V.. Amsterdam -Printed in The Netherlands  

E-Print Network [OSTI]

in The Netherlands 67 THE ROLE OF SALT IN FOLD-AND-THRUST BELTS DAN M. DAVIS and TERRY ENGELDER Lamont -Doherty

Engelder, Terry

109

Journul of Chromatogruphy, 480 (1989) 95-110 Elsevier Science Publishers B.V., Amsterdam -Printed in The Netherlands  

E-Print Network [OSTI]

in The Netherlands CHROM. 21 811 ANALYSIS OF FACTORS CAUSING PEAK BROADENING IN CAPILLARY ZONE ELECTROPHORESIS

Zare, Richard N.

110

Earth and Planetary Science Letters, 119 (1993) 71-83 71 Elsevier Science Publishers B.V., Amsterdam  

E-Print Network [OSTI]

.M. Christie, J.J. Dieu, P. Enos, E. Erba, J. Fenner, J.S. Gee, J.A. Haggerty, MJ. Head, P.R.N. Hobbs, H. Ito

Fisher, Andrew

111

Epoxy, ZnO, and PTFE nanocomposite: friction and wear optimization N.L. McCook, B. Boesl, D.L. Burris and W.G. Sawyer*  

E-Print Network [OSTI]

Epoxy, ZnO, and PTFE nanocomposite: friction and wear optimization N.L. McCook, B. Boesl, D and increase the wear resistance of epoxy, nanoparticles of zinc oxide and polytetrafluoro- ethylene (PTFE procedure in order to find a volume percent for optimized wear resistance and friction coefficient

Sawyer, Wallace

112

de la pression de l'air (entre zero et 75 millimtres), et restent les mmes quc les surfaces dl'S ballons soient noircies ou non, ce qui  

E-Print Network [OSTI]

galvamscher Combinationen durch die Wärme (Changements qu'eprouve la force électromotrice des combinaisons

Boyer, Edmond

113

Effects of d,l-2-Difluoromethylornithine and Indomethacin on Mammary Tumor Promotion in Rats Fed High n-3 and/or n-6 Fat Diets  

Science Journals Connector (OSTI)

...522:5 n-3OthersCorn oil"11.22.125.059...respectively. The menhaden oil was provided by Dr. Tony...Chemical Co., St. Louis, Missouri. Corn oil was purchased from Seaway...were killed using CO: gas. A complete necropsy examination...

Soad H. Abou-El-Ela; Keith W. Prasse; Robert L. Farrell; Richard W. Carroll; Adelbert E. Wade; and Opal R. Bunce

1989-03-15T23:59:59.000Z

114

Journal of Molecular Structure (Theochem), 163 (1988) 207-237 Elsevier Science Publishers B.V., Amsterdam -Printed in The Netherlands  

E-Print Network [OSTI]

energy is 56 kcal mol-*, which is 16 kcal mole1 weaker than the Si-Si single bond in disilane! The origin to that of disilane, 3, H&Si-SiHJ (iv) and the correct description of planar 1;i.e., should the bonding be viewed

Goddard III, William A.

115

Hearing Resea&t, 52 (1991) 113-132 0 1991 Elsevier Science publishers B.V. 0378-5955/91/$03.50  

E-Print Network [OSTI]

a band-pass (54%) or bimodal (24%) AMF-rate histogram. At an AMF of 36 Hz, which is equal to the pulse Physics and Biophysics, University of Nijmegen, The NetherIan& (Received 16 April 1990; accepted 22 repetition rate of the mating call, 70% of the units possessed an asymmetrical ITD-rate histogram, whereas

van Stokkum, Ivo

116

Surface and Coatings Technology 171 (2003) 4650 0257-8972/03/$ -see front matter 2003 Elsevier Science B.V. All rights reserved.  

E-Print Network [OSTI]

amorphous silicon carbide (a-SiC:H) and crystalline silicon carbide (c-SiC) with different compositions were deposited on Si(1 0 0) substrates by both RF plasma enhanced chemical vapor deposition and thermal metal-PECVD; Thermal MOCVD 1. Introduction Hydrogenated amorphous silicon carbide (a-SiC:H) films are widely used

Boo, Jin-Hyo

117

Small molecules activators of the Nrf2-HO-1 antioxidant axis modulate heme metabolism and inflammation in BV2 microglia cells  

E-Print Network [OSTI]

1 Small molecules activators of the Nrf2-HO-1 antioxidant axis modulate heme metabolism, 16163 Genova, Italy d Department of Clinical and Molecular Biomedicine, Section of Pharmacology-associated protein-1; INF- , interferon- ISL, isoliquiritigenin; LPS, lipopolysaccharide; Nrf2, HF-E2 p45-related

Boyer, Edmond

118

Journal o[WindEngineering and IndustrialAerodynamics,36 (1990)589-599 589 Elsevier Science Publishers B.V., Amsterdam --Printed in The Netherlands  

E-Print Network [OSTI]

by the distortion of the wind field, the flow separation, the vortex formation, and wake development. The pressure is the approach wind field complex, but the vortical flow patterns generated around a structure are complicated findings. The fluctuating pressure field on the side and leeward faces is greatly influenced by the wake

Kareem, Ahsan

119

Procedia Earth and Planetary Science 7 (2013) 863 866 1878-5220 2013 The Authors. Published by Elsevier B.V.  

E-Print Network [OSTI]

gas exploration and hydraulic fracturing on the quality of water resources in the United States Avner and production strategies such as horizontal drilling and hydraulic fracturing have significantly improved gas and hydraulic fracturing technologies have dramatically changed the energy landscape in the U

Jackson, Robert B.

120

The Science of the Total Environment 311 (2003) 151176 0048-9697/03/$ -see front matter 2003 Elsevier Science B.V. All rights reserved.  

E-Print Network [OSTI]

for Coastal Research, GKSS Research Centre, 21502 Geesthacht, Germanya Norwegian Institute for Air Research *Corresponding author. Tel.: q49 4152 87 1831; fax: q49 4152 87 2832. E-mail address: storch@gkss.de (H. von

Costa-Cabral, Mariza

Note: This page contains sample records for the topic "bv dl deltak" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


121

Surface and Coatings Technology 174175 (2003) 839844 0257-8972/03/$ -see front matter 2003 Elsevier Science B.V. All rights reserved.  

E-Print Network [OSTI]

using an atmospheric pressure plasma jet and their surface characteristics M.C. Kim , S.H. Yang *, J an atmospheric-pressure plasma jet generated by nitrogen and oxygen gases under the atmospheric pressure at room of different metal- surfaces by atmospheric plasma jet treated under the condition of nearly atmospheric

Boo, Jin-Hyo

122

Biochimica et Biophysica Acta, 1142(1993) 115-122 115 1993.Elsevier Science Publishers B.V. All rights reserved 0005-2728/93/$06.00  

E-Print Network [OSTI]

photosynthetic rate is decreased as a result of exposure of oxygen- evolving organisms to light intensities; Electron transport; Chlorophyll fluorescence; Photosystem I; Reaction center II; (L. gibba) Intact Lemna requires either the pres- ence of oxygen [9,10] or extremely reducing conditions [11

Allen, John F.

123

Thin Solid Films 430 (2003) 125129 0040-6090/03/$ -see front matter 2003 Elsevier Science B.V. All rights reserved.  

E-Print Network [OSTI]

for a-Si:H solar cell fabrication. In addition to photovoltaic applications, a-Si:H is also used of amorphous silicon (a-Si:H)-based photovoltaic devices, it is important to deposit high- quality a progress has been made in hydrogenated amorphous silicon (a-Si:H)-based thin film photovoltaic devices

Deng, Xunming

124

Thin Solid Films 434 (2003) 5561 0040-6090/03/$ -see front matter 2003 Elsevier Science B.V. All rights reserved.  

E-Print Network [OSTI]

, including nuclear spectroscopy w4x, dosimetry w5x, oil-well logging w6x and computed tomography w7x

Cao, Guozhong

125

Biochimica et Biophysica Acta, 1162(1993)47-53 47 1992Elsevier Science Publishers B.V. All rights reserved 0167-4838/92/$06.00  

E-Print Network [OSTI]

and presence of calcium and phospholipids Giovanna Zolese a, Ileana Giambanco c, Giovanna Curatola a, Gelsomina-hand' calcium-binding domain (site I). A con- ventional CaZ+-binding site, 28 residues long, is present in the C sites has been predicted in a study of carp parval- bumin [3]. It has an helix-loop-helix conformation

Gilbert, Pupa Gelsomina De Stasio

126

Earth and Planetary Science Letters, 73 (1985) 231-243 231 Elsevier Science Publishers B.V., Amsterdam -Printed in The Netherlands  

E-Print Network [OSTI]

-latitude waters, thermal insulation due to sea-ice cover, salt rejection during freezing of seawater, and salinity reflect higher preformed nutrients (due to bottom-water formation under sea and/or shelf ice

Kurapov, Alexander

127

Surface and Coatings Technology 179 (2004) 124134 0257-8972/04/$ -see front matter 2003 Elsevier B.V. All rights reserved.  

E-Print Network [OSTI]

of Mechanical and Production Engineering, Nanyang Technological University, Singapore 639798, Singaporeb) and energy dispersive X-ray analysis on substrates plated for a very short interval of time. The early stage with the coating, it then spread onto eutectic a and primary a-phase. The coating produced with the optimised bath

Zhou, Wei

128

Symbiotic Characteristics of Rhizobium leguminosarum bv. trifolii Isolates Which Represent Major and Minor Nodule-Occupying Chromosomal Types of Field-Grown Subclover (Trifolium subterraneum L.)  

Science Journals Connector (OSTI)

...assemblies were transferred to a greenhouse and arranged in a randomized...Leonard jar assemblies under greenhouse conditions. A ninefold...for his generous loan of greenhouse facilities with high-intensity lighting. REFERENCES 1. Almendras...

K. Leung; F. N. Wanjage; P. J. Bottomley

1994-02-01T23:59:59.000Z

129

Thin Solid Films 431432 (2003) 301306 0040-6090/03/$ -see front matter 2003 Elsevier Science B.V. All rights reserved.  

E-Print Network [OSTI]

Laboratory, 1617 Cole Boulevard, Golden, CO 80401, USAd Institute of Energy Conversion, University of Electrical Engineering, The Ohio State University, Columbus, OH 43210, USAc National Renewable Energy-containing layer, which could be responsible for the surface carrier type inversion, a near-surface region

Rockett, Angus

130

The Science of the Total Environment 296 (2002) 139151 0048-9697/02/$ -see front matter 2002 Elsevier Science B.V. All rights reserved.  

E-Print Network [OSTI]

, and films and books extol their wonders. In the oceans, fishery is dramatically declining (FAO, 1999 ecosystems and coral reefs, biotopes of highest species richness and biological diversity (Suchanek, 1994 of the industrial and technological revolutions in the con- sumer-oriented society, man has b

Stone, Lewi

131

Dynamics of Atmospheres and Oceans, 7 (1983) 189-219 189 Elsevier Science Publishers B.V., Amsterdam -Printed in The Netherlands  

E-Print Network [OSTI]

.V., Amsterdam - Printed in The Netherlands EIKONAL DESCRIPTION OF INTERNAL WAVE INTERACTIONS: A NON

132

The Science of the Total Environment 309 (2003) 173185 0048-9697/03/$ -see front matter 2003 Elsevier Science B.V. All rights reserved.  

E-Print Network [OSTI]

arsenate (CCA) in wood mulch Timothy G. Townsend * , Helena Solo-Gabriele , Thabet Tolaymat , Kristin of yard trash and waste wood. When wood recovered from construction and demolition (C&D) debris is used as mulch, it sometimes contains chromated copper arsenate (CCA)-treated wood. The presence of CCA

Florida, University of

133

A Novel Assay to Assess Primary Human Cancer Infectibility by Replication-Selective Oncolytic Adenoviruses  

Science Journals Connector (OSTI)

...dl922-947) and replication-defective (dl312) adenoviruses...adenovirus receptor (CAR) and tissue viability...dl922-947) and replication-defective (dl312) adenoviruses...adenovirus receptor (CAR) and tissue viability...predicted, the replication-defective adenovirus dl312 was...

Yaohe Wang; Stephen Thorne; Joseph Hannock; Jennelle Francis; Tina Au; Tony Reid; Nick Lemoine; David Kirn; and Gunnel Halldn

2005-01-01T23:59:59.000Z

134

spe438-20 page 1 Garrison, N.J., Busby, C.J., Gans, P.B., Putirka, K., and Wagner, D.L., 2008, A mantle plume beneath California? The mid-Miocene Lovejoy flood basalt, northern  

E-Print Network [OSTI]

-Miocene Lovejoy flood basalt, northern California Noah J. Garrison Cathy J. Busby Phillip B. Gans Department the eastern Snake River Plain toward the Yellowstone caldera (Armstrong et al., 1975; Rodgers et al., 1990

Busby, Cathy

135

174. THE EFFECTS OF RESIDENCE TIME ON THE RETENTION OF ARSENATE BY GOETHITE. S.E. O'Reilly and D.L. Sparks, Department of Plant and Soil Sciences, University  

E-Print Network [OSTI]

174. THE EFFECTS OF RESIDENCE TIME ON THE RETENTION OF ARSENATE BY GOETHITE. S.E. O'Reilly and D on goethite. Batch sorption and desorption studies were conducted at pH 6 for periods up to 2 months. Arsenate sorption increased slowly with time. As residence time between arsenate and goethite increased

Sparks, Donald L.

136

E-Print Network 3.0 - arthrobacter sp 32c Sample Search Results  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

DL149 GGS dilution 1 Actino Arthrobacter DL150 GGS dilution 1 Actino Subtercola Source: Colorado at Boulder, University of - Alpine Microbial Observatory Collection:...

137

Dilute Acid Hydrolysis of Oligomers in Hydrothermal Pretreatment Hydrolyzate into Monomers with High Yields  

E-Print Network [OSTI]

Klass DL. 1998. Biomass for renewable energy, fuels, andNational Renewable Energy Laboratory.2003, Biomass feedstockKlass DL. 1998. Biomass for Renewable Energy, Fuels and

Tsai, Yueh-Du

2012-01-01T23:59:59.000Z

138

53T. Schlichter and L. Montes (eds.), Forests in Development: A Vital Balance, DOI 10.1007/978-94-007-2576-8_5, Springer Science+Business Media B.V. 2012  

E-Print Network [OSTI]

, mediator between atmospheric water inputs and the actual water services that humans receive and value, generate changes on water services. Here we revise the mechanisms, impacts, and challenges of these effects to infiltration and surface water routing shifts). In sloped terrains global stream flow measurements in paired

Nacional de San Luis, Universidad

139

Biochimtca et Biophyszva Acta. IlllO( 1992}I-bl ] 19q2 Elsevier Science Publishers B.V. All rights reserved O) ~-272~;/92/$ J5.0n  

E-Print Network [OSTI]

..~phaeroide~) Photosystcm I1 of oxygen-evolving organisms exhibits a bicarbonatc-revcrsiblc ff~rmatc effect on clcctron through the quinone electron accep- ters of Photosygtem 1I (PS 11) in oxygen-evolving organ- isms of the glutamate ligand to the iron atom in bacterial reaction centers? X. Wang a, j. Cao a, p. Mar6ti ", H

Govindjee

140

Physics Procedia 34 (2012) 70 79 1875-3892 2012 Published by Elsevier B.V. Selection and/or peer review under responsibility of the Organising Committee of the CSP 2012  

E-Print Network [OSTI]

/or peer review under responsibility of the Organising Committee of the CSP 2012 Conference. doi:10.1016/j

Berthier, Ludovic

Note: This page contains sample records for the topic "bv dl deltak" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


142

141A. Le Pichon et al. (eds.), Infrasound Monitoring for Atmospheric Studies, DOI 10.1007/978-1-4020-9508-5, Springer Science+Business Media B.V. 2010  

E-Print Network [OSTI]

tool during the early proliferation of nuclear weapon technologies after WWII when nuclear tests were, and nuclear testing generally went underground. Interest in infrasound as a moni- toring tool waned as interest in global seismology increased. In 1996, the Comprehensive Nuclear-Test-Ban Treaty (CTBT) opened

Vernon, Frank

143

4 Planning January 2007 100 MilliBv A r d i u r C. N e l s o n . ! A K P . a n d K o b e i t E.  

E-Print Network [OSTI]

between now and 2040, while Germany, Italy, and Japan will lose population. Only India--with a current suspect that the housing preferences of older, childless households will he different from those of other households. Second, household types are becoming more diverse, ln 1970, just after the population reached 200

Handy, Susan L.

144

Local and synoptic mechanisms causing Southern Californias Santa Ana winds  

E-Print Network [OSTI]

DL (1994) Global physical climatology. Academic Press, Sancisely the month when the climatology of temperature favors

Hughes, Mimi; Hall, Alex

2010-01-01T23:59:59.000Z

145

Feature selection in robust clustering based on Laplace mixture Aurelien Cord *, Christophe Ambroise, Jean-Pierre Cocquerez  

E-Print Network [OSTI]

Elsevier B.V. All rights reserved. Keywords: Clustering; Feature selection; Laplace distribution; Kruskal­Wallis

Cord, Aurélien

146

International Journal of Networking and Computing www.ijnc.org ISSN 2185-2839 (print) ISSN 2185-2847 (online)  

E-Print Network [OSTI]

In this paper, we consider the problem of decontaminating a network from a black virus (BV) using a team of mobile system agents. The BV is a harmful process which, like the extensively studied black hole (BH which is static by definition, a BV moves, spreading to all the neighbouring sites, thus increasing its

Flocchini, Paola

147

Electro-Magnetic Dipole Properties of The Even-Even {sup 160}Gd Nucleus in The Spectroscopic Region  

SciTech Connect (OSTI)

In this study result of calculations using rotational, translational and Galilean invariant quasiparticle random-phase approximation is presented for the low lying dipole excitations in the even-even {sup 60}Gd nucleus. To make detail structure analysis for electric and magnetic dipole states, calculations carried out for both {delta}K = 1 and {delta}K = 0 branches. The analysis shows that almost all transitions with {delta}K = 1 are magnetic character in 2.4 divide 4 MeV energy interval. However, the calculations indicate the presence of a few prominent negative parity K{sup {pi}} = 1 states in the investigated energy interval, one of them with rather high E1 strength B(E1) = 7.1{center_dot}10{sup -3} e{sup 2} fm{sup 2} at energy 3.2 MeV. Calculated M1 dipole strength of the scissors mode K{sup {pi}} = 1{sup +} excitations clustered in two groups around 2.7 and 3.3 MeV. A similar situation arises for the experimentally obtained states two bumps around {omega}{sub i} = 2.7 MeV and {omega}{sub i} = 3.3 MeV. It has been shown that main part of spin-1 states, observed at energy 2.4 divide 4 MeV in {sup 160}Gd may be attributed to have M1 character and may be interpreted as main fragments of the scissors mode. However, it is apparent that the experimental data exceeds the calculation results for the summed B(M1) by a factor of 1.13 for M1 transitions.

Ertugral, Filiz; Kuliev, Ali [Sakarya University, Department of Physics, 54100, Sakarya (Turkey); Guliyev, Ekber [National Academy of Sciences, Institute of Physics, Baku (Azerbaijan)

2008-11-11T23:59:59.000Z

148

A validation study of existing neutronics tools against ZPPR-21 and ZPPR-15 critical experiments.  

SciTech Connect (OSTI)

A study was performed to validate the existing tools for fast reactor neutronics analysis against previous critical experiments. The six benchmark problems for the ZPPR-21 critical experiments phases A through F specified in the Handbook of Evaluated Criticality Safety Benchmark Experiments were analyzed. Analysis was also performed for three loading configurations of the ZPPR-15 Phase A experiments. As-built core models were developed in XYZ geometries using the reactor loading records and drawer master information. Detailed Monte Carlo and deterministic transport calculations were performed, along with various modeling sensitivity analyses. The Monte Carlo simulations were carried out with the VIM code with continuous energy cross sections based on the ENDF/B-V.2 data. For deterministic calculations, region-dependent 230-group cross sections were generated using the ETOE-2/MC-2/SDX code system, again based on the ENDF/B-V.2 data. Plate heterogeneity effects were taken into account by SDX unit cell calculations. Core calculations were performed with the TWODANT discrete ordinate code for the ZPPR-21 benchmarks, and with the DIF3D nodal transport option for the ZPPR-15 experiments. For all six ZPPR-21 configurations where the Pu-239 concentration varies from 0 to 49 w/o and the U-235 concentration accordingly varies from 62 to 0 w/o, the core multiplication factor determined with a 230-group TWODANT calculation agreed with the VIM Monte Carlo solution within 0.20 %{Delta}k, and there was no indication of any systematic bias. The quality of principal cross sections generated with the MC-2 code was comparable to that of VIM cross sections. The overall reactivity effect due to the errors in the 230-group principal cross sections was estimated to be less than 0.05 %{Delta}k. The statistics of the differences between calculated values and specified benchmark experimental values showed similar bias (from -0.28 %{Delta}k to 0.33 %{Delta}k) for MC{sup 2}-2/TWODANT and VIM. This result suggests that the criticality prediction accuracy of MC{sup 2}-2/TWODANT is comparable to VIM. Investigation of group collapsing methods showed that direct generation of broad-group cross sections from MC{sup 2}-2 calculations was not adequate for analysis of ZPPR-21 assemblies. Scalar flux weighting for all cross sections, including anisotropic cross sections, was not sufficiently accurate, either. The use of higher flux moments for anisotropic scattering cross section collapsing reproduced the fine-group results with broad-group calculations. The ZPPR-15 analyses, starting from detailed as-built plate geometries, showed that the plate heterogeneity effect was as large as 1.3 %{Delta}k. Through a series of sensitivity studies, a procedure to generate effective cross sections was developed based on one-dimensional SDX unit cell calculations. With this procedure to account for the plate heterogeneity effect, the core multiplication factor determined with a 230-group DIF3D nodal transport calculation agreed with the VIM Monte Carlo solution within 0.12 %{Delta}k. It was however observed that the calculated values consistently underestimated the criticality by 0.32 %{Delta}k to 0.43 %{Delta}k. The sodium void worths determined from VIM Monte Carlo and DIF3D nodal transport calculations were also very close to each other, but both predictions overestimated the measured void worth by {approx}0.1 %{Delta}k, which amounted to {approx}40% of the measured value. Further investigation is needed to identify the reason for this discrepancy between calculated and measured sodium void worths. In summary, for all nine core configurations of ZPPR-21 and ZPPR-15 analyzed in this study, the deterministic transport solutions showed good agreement with Monte Carlo results. These results indicate that the existing deterministic methods for multigroup cross section generation and core calculation are adequate to use in the initial design stage of Advanced Burner Reactors, for which the startup fuel is expected to be conventional plutonium fuel. However, further verifica

Yang, W.S.; Kim, S.J. (Nuclear Engineering Division)

2007-09-30T23:59:59.000Z

149

Fructose impairs glucose-induced hepatic triglyceride synthesis  

E-Print Network [OSTI]

The area under the curve (AOC) (Mean SD) for each of theand area under the curve (AOC, mg/dl min) for glucosea. BL b. IPGT blood glucose AOC mg/dl x min c. 120 min Serum

Huang, Danshan; Dhawan, Tania; Young, Stephen; Yong, William H; Boros, Laszlo G; Heaney, Anthony P

2011-01-01T23:59:59.000Z

150

Macronutrient and energy content of breast milk of mothers delivering prematurely  

Science Journals Connector (OSTI)

The protein, lactose, fat and energy contents of the fore-milk of mother with ... weeks of lactation, the mean (SD) energy (Kcal/dl), protein (g/dl) ... days, there was a decline in protein content while fat, la...

Vinod K. Paul; Meharban Singh; L. M. Srivastava

151

A mesostate-space model for EEG and MEG Jean Daunizeau and Karl J. Friston  

E-Print Network [OSTI]

-determination of DL inverse solutions (Grova et al., 2006). More recently, models of the coupling between active brain

Daunizeau, Jean

152

E-Print Network 3.0 - anchored carbon fiber Sample Search Results  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

; Activated carbon; Carbon fibers; D. Electrical (electronic) properties Electromagnetic interference (EMI... ) shielding is increas- ... Source: Chung, Deborah D.L. -...

153

3. Vorticity 3.1. Definition and interpretation of vorticity  

E-Print Network [OSTI]

2 u · dl = 0 if inviscid. (3.6) Eq.(3.6) is Kelvin's Circulation Theorem: for inviscid, uniform.5), we get dC dt = C - p + gz + 2 u · dl . Again the (...) · dl term integrates out, leaving dC dt = C

Read, Peter L.

154

New determination of the D0->K-pi+pi0 and D0->K-pi+pi+pi- coherence factors and average strong-phase differences  

E-Print Network [OSTI]

Measurements of the coherence factors (R_Kpipi0 and R_K3pi) and the average strong-phase differences (delta^Kpipi0_D and delta^K3pi_D) for the decays D0-> K-pi+pi0 and D0->K-pi+pi+pi- are presented. These parameters are important inputs to the determination of the unitarity triangle angle gamma in B+/- -> DK+/- decays, where D designates a D0 or D0bar meson decaying to a common final state. The measurements are made using quantum correlated DDbar decays collected by the CLEO-c experiment at the psi(3770) resonance, and augment a previously published analysis by the inclusion of new events in which the signal decay is tagged by the mode D-> K0Spi+pi-. The measurements also benefit from improved knowledge of external inputs, namely the D0D0bar mixing parameters, r_D^Kpi and several D-meson branching fractions. The measured values are R_Kpipi0 = 0.82 +- 0.07, delta_D^Kpipi0 = (164+20-14) deg., R_K3pi = 0.32+0.20-0.28 and delta^K3pi_D = (225+21_-78) deg. Consideration is given to how these measurements can be improved further by using the larger quantum-correlated data set collected by BESIII.

J. Libby; S. Malde; A. Powell; G. Wilkinson; D. M. Asner; G. Bonvicini; T. Gershon; P. Naik; T. K. Pedlar; J. Rademacker; S. Ricciardi; C. Thomas

2014-01-09T23:59:59.000Z

155

Albany, OR * Anchorage, AK * Morgantown...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Company The University of Alabama - Birmingham Shell International Exploration and Production B.V. PROJECT DURATION Start Date End Date 8112010 3312014 COST Total Project...

156

Books Received  

Science Journals Connector (OSTI)

... . Mrs. .Sro.res.bv Routledge. Pn. xxi4- Ar-4. (London:. Sifton, Praed, and Co., Ltd.)- yi's.fid. net. ...

1919-11-20T23:59:59.000Z

157

A supercoarsening multigrid method for poroelasticity in 3D coupled ...  

E-Print Network [OSTI]

Jun 14, 2012 ... Springer Science+Busincss Media B.V. 2012. Abstract The ..... practical observations of Wheeler and Smith [50] made on subsurface flow...

2012-06-14T23:59:59.000Z

158

Constraints on the flux of Ultra-High Energy neutrinos from WSRT observations  

E-Print Network [OSTI]

Versneller Instituut, University of Groningen, 9747AA, Groningen, The Netherlands 4 ASML Netherlands BV,Institute, University of Groningen, 9747 AA, Groningen, The

Scholten, O.

2010-01-01T23:59:59.000Z

159

E-Print Network 3.0 - alloy fe 2605sa1 Sample Search Results  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Elsevier B.V. All rights ... Source: Zheng, Yufeng - Department of Advanced Materials and Nanotechnology, Peking University Collection: Materials Science ; Biology and Medicine 3...

160

Theoretical Computer Science 299 (2003) 775783 www.elsevier.com/locate/tcs  

E-Print Network [OSTI]

Science B.V. All rights reserved. PII: S0304-3975(02)00778-8 #12;776 P. Garc?a et al. / Theoretical

València, Universitat Politècnica de

Note: This page contains sample records for the topic "bv dl deltak" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


161

Estimate of Cost-Effective Potential for Minimum Efficiency Performance Standards in 13 Major World Economies Energy Savings, Environmental and Financial Impacts  

E-Print Network [OSTI]

Initiative, IEA Electric Motor Systems Workshop, Paris. BV,Electric Motors ..X X X X X X X X X X X Electric Motors AC = air conditioning;

Letschert, Virginie E.

2013-01-01T23:59:59.000Z

162

E-Print Network 3.0 - amphipoda gammaridea hyalidae Sample Search...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

D 2004 Elsevier B.V. All rights reserved. Keywords: Amphipoda; Maritrema Source: Poulin, Robert - Department of Zoology, University of Otago Collection: Biology and Medicine...

163

(This is a sample cover image for this issue. The actual cover is not yet available at this time.) This article appeared in a journal published by Elsevier. The attached  

E-Print Network [OSTI]

Elsevier B.V. All rights reserved. 1. Introduction Roads have varied ecological impacts on the adjacent, roadside maintenance, and vehicle emis- sions (Forman, 2000; Lee e

Neher, Deborah A.

164

E-Print Network 3.0 - ant camponotus anderseni Sample Search...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Warren Booth Elsa Youngsteadt Coby Schal Edward L. Vargo... +Business Media B.V. 2008 Abstract Camponotus femoratus is an abundant and behaviorally dominant ant...

165

E-Print Network 3.0 - antioxidant activity oxidative Sample Search...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Quantification of antioxidant activity in brain tissue homogenates using the total equivalent... Elsevier Science B.V. All rights reserved. Keywords: Antioxidant;...

166

E-Print Network 3.0 - andresen maria jos Sample Search Results  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

of ageing and the onset of leaf senescence Jos Schippers 12;2 The studies... , The Netherlands. Cover design: Jos Schippers Printed: Gildeprint Drukkerijen BV, Enschede, The...

167

NNN06, Sept. 21, 2006 Seattle, Washington  

E-Print Network [OSTI]

on neutrinoless double beta decay of 130 Te. r 2003 Elsevier B.V. All rights reserved. PACS: 23.40.B; 11.30.F

Washington at Seattle, University of - Department of Physics, Electroweak Interaction Research Group

168

Remarkable effect of bromide ion upon two-dimensional faradaic phase transition of dibenzyl viologen on an HOPG electrode surface: Emergence of two-step transition  

Science Journals Connector (OSTI)

Abstract We found that dibenzyl viologen (dBV) on an HOPG electrode undergoes a two-step first order faradaic phase transition at high concentrations of bromide ion (Br?). Results of voltammetric and electroreflectance measurements were used to describe the mechanism of the two-step transition processes. When [Br?]>180mM, the transition step at less negative potential was ascribed to a phase transition between a gas-like adsorption layer of dBV dication (dBV2+) and a mesophase of dBV radical cation (dBV+). Most likely, the mesophase is a two-dimensional (2D) ordered phase composed of co-adsorbed dBV+ and Br? where both are in direct contact with the HOPG surface. The transition step at more negative potential was ascribed to a phase transition between the dBV+ Br? mesophase and a 2D condensed phase of dBV+. In the condensed phase being denser than the mesophase, dBV+ molecules are ?-stacked due to face-to-face interaction between bipyridinium radical cations. This transition step involves also a reduction process of dBV2+ to dBV+ followed by its incorporation into the condensed phase. The two-step transition was not observed in \\{KCl\\} solution of any concentration, either in \\{KBr\\} solution of [Br?]transition but single-step one. The nature of the transition, especially in the [Br?] range from 75 to 180mM, was closely analyzed.

Tomohiro Higashi; Takamasa Sagara

2013-01-01T23:59:59.000Z

169

Design of a PSi header processor for the X.25 packet level protocol  

E-Print Network [OSTI]

processor data for Begin CP of the Receive DL Data. 4. 14. Connection processor data for Call Connected HP of the Receive DL Data. 4. 15. Connection processor data for Close CP of the Receive DL Data.... Connection processor data for Call Request HP . . . ? 4. 20. Connection processor data for Call Accepted HP . . . 4. 21. Connection processordataforClear Request HP . . . 52 53 53 4. 22. Connection processor data for Detach CP 2 . . . . . 54 5. 1...

Yu, Tsai-Fa

2012-06-07T23:59:59.000Z

170

Wear 258 (2005) 17871793 Finite element analysis and experiments of metal/metal  

E-Print Network [OSTI]

of this simulation. © 2004 Published by Elsevier B.V. Keywords: Wear modeling; Finite element analysis 1 Published by Elsevier B.V. doi:10.1016/j.wear.2004.12.014 #12;1788 N.H. Kim et al. / Wear 258 (2005) 1787Wear 258 (2005) 1787­1793 Finite element analysis and experiments of metal/metal wear

Sawyer, Wallace

171

Wear 262 (2007) 220224 Short communication  

E-Print Network [OSTI]

Published by Elsevier B.V. Keywords: Solid lubricants; Nanocomposites; Friction; Wear; PTFE; Nanoparticles are compression molded in a 0043-1648/$ ­ see front matter © 2006 Published by Elsevier B.V. doi:10.1016/j.wearWear 262 (2007) 220­224 Short communication Tribological behavior of PEEK components

Sawyer, Wallace

172

Hydrogeological aspects of fault zones on various scales in the Roer Valley Rift System  

E-Print Network [OSTI]

at the location of the fault zone. Finally, on a regional scale, hydraulic head patterns around the lignite mining to regional groundwater flow patterns. D 2003 Elsevier Science B.V. All rights reserved. Keywords: Faults B.V. All rights reserved. doi:10.1016/S0375-6742(03)00031-1 * Corresponding author. Fax: +31

Bense, Victor

173

Physica A 259 (1998) 19 Growth properties of Eden model  

E-Print Network [OSTI]

changes to hold a self-similar surface. c 1998 Elsevier Science B.V. All rights reserved. 1. Introduction Elsevier Science B.V. All rights reserved. PII: S 0378-4371(98)00119-8 #12;2 S. Miyazima et al. / Physica which is found in experiments of sedimentary sandstones [16,17], lignite coals [18], colloidal silicate

Stanley, H. Eugene

174

Downstream Processing of Recombinant Proteins from Transgenic Plant Systems: Phenolic Compounds Removal from Monoclonal Antibody Expressing Lemna minor and Purification of Recombinant Bovine Lysozyme from Sugarcane  

E-Print Network [OSTI]

of the extraction condition, at least 47% of the starting BvLz was lost during the membrane processing. None of the evaluated extraction conditions caused a substantial recovery of BvLz in the concentrate. Alternative purification options for the IEX+HIC process...

Barros, Georgia

2012-07-16T23:59:59.000Z

175

E-Print Network 3.0 - american erionite-associated mesothelioma...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Chernyavsky AI, Jolkovsky DL, Pinkerton KE, Grando SA. A Summary: and Liu H. Incomplete birth certificates: a risk marker for infant mortality. American Journal of Public......

176

Nonprice incentives and energy conservation.  

E-Print Network [OSTI]

individual choices about energy efficiency. Proc. Natl.4. Costa DL, Kahn ME (2013) Energy conservation nudges andInformation strategies and energy conservation behavior: a

Asensio, OI; Delmas, MA

2015-01-01T23:59:59.000Z

177

ENVIRONMENTAL REVIEW FOR CATEGORICAL EXCLUSION DETERMINATION  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

RoclDl'ainage Maintenance Montrose County, Colorado A. Brief Description of Proposal: Western...

178

E-Print Network 3.0 - allowing direct observation Sample Search...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Observation Software Systems DASEL Technical Report 200707DL01 Summary: , this simple logic could be encoded directly into either the observer construction or event response...

179

E-Print Network 3.0 - acid-induced stress resistance Sample Search...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

stress sensing, as described by the fractional change in resistance per unit... for the resistance away from the ... Source: Chung, Deborah D.L. - Department of Mechanical and...

180

E-Print Network 3.0 - absolute negative resistance Sample Search...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

31 March 1999 Abstract Apparent negative electrical resistance... .33 MPa), the apparent resistance was either positive or ... Source: Chung, Deborah D.L. - Department of...

Note: This page contains sample records for the topic "bv dl deltak" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


181

Microsoft Word - Scott-CV2013Sept.docx  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Center, Spartanburg, South Carolina. Recent Publications (2000-2013): Submitted (in review)- Soteropoulos DL, Lance SL, Flynn RW, and Scott DE. Effects of copper exposure on...

182

Physiological effects of dietary amaranth  

E-Print Network [OSTI]

? free control diet. After four weeks, total serum cholesterol, triglycerides, HDL, LDL, VLDL cholesterol and liver cholesterol and triglycezides were determined. Whole amaranth (WA) resulted in significantly lower serum cholesterol values compared... to the fiber-free control (FF) (WA 148 + -8 mg/dl, FF 195 " -17 mg/dl, P&0. 05) appazently by decreasing LDL cholesterol (WA 96 10 mg/dl, FF 146 -+ 18 mg/dl) since HDL cholesterol levels of amaranth-fed animals were similar to those of controls (WA 33 -+ 2...

Danz, Ruth Ann

2012-06-07T23:59:59.000Z

183

E-Print Network 3.0 - active carbon process Sample Search Results  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

; Activated carbon; Carbon fibers; D. Electrical (electronic) properties Electromagnetic interference (EMI... in the composites is typically that ... Source: Chung, Deborah D.L....

184

E-Print Network 3.0 - activated carbon chemically Sample Search...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

; Activated carbon; Carbon fibers; D. Electrical (electronic) properties Electromagnetic interference (EMI... in the composites is typically that ... Source: Chung, Deborah D.L....

185

E-Print Network 3.0 - activated carbon treatment Sample Search...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

; Activated carbon; Carbon fibers; D. Electrical (electronic) properties Electromagnetic interference (EMI... in the composites is typically that ... Source: Chung, Deborah D.L....

186

E-Print Network 3.0 - activated carbon particles Sample Search...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

; Activated carbon; Carbon fibers; D. Electrical (electronic) properties Electromagnetic interference (EMI... in the composites is typically that ... Source: Chung, Deborah D.L....

187

E-Print Network 3.0 - activated carbon process Sample Search...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

; Activated carbon; Carbon fibers; D. Electrical (electronic) properties Electromagnetic interference (EMI... in the composites is typically that ... Source: Chung, Deborah D.L....

188

1547.ps  

E-Print Network [OSTI]

Dec 18, 2006 ... tic; [objt,Xt,yt,Zt,info] = mysdps(blk,A,C,b); t = toc;. >> tic; [fL, Y, dl] = vsdplow(blk,A,

189

Association of Serum Phosphorus Concentration with Mortality in Elderly and Non-Elderly Hemodialysis Patients  

E-Print Network [OSTI]

between serum phosphorous levels (main predictor) with all-likely to have serum phosphorous levels <3.5 mg/dl, compared

2013-01-01T23:59:59.000Z

190

E-Print Network 3.0 - american scorpions arachnida Sample Search...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Sample search results for: american scorpions arachnida Page: << < 1 2 3 4 5 > >> 1 Johnson, D.L. 2004. The Northern Scorpion, Paruroctonus boreus, in southern Alberta,...

191

DISCLAIMER  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

level AMF ARM Mobile Facility AMFDL AMF Doppler Lidar ARM Atmospheric Radiation Measurement DL Doppler Lidar DMF Data Management Facility DOE U.S. Department of Energy DQO...

192

Sun Protocols in the ISO Open Systems Interconnect Model Application  

E-Print Network [OSTI]

. Technical Report, (1985). [6] J. M. Chang, "SunNet," USENIX (1985). [7] D.L. Presotto and D. M. Ritchie

California at Davis, University of

193

Advanced Organic Vapor Cycles for Improving Thermal Conversion Efficiency in Renewable Energy Systems  

E-Print Network [OSTI]

DL Chase and PT Kehoe, "GE Combined-Cycle Product Line andand W Stenze, "Combined Cycle Heat Recovery Optimization,"bottoming cycle FOR combined cycle power plants," Applied

Ho, Tony

2012-01-01T23:59:59.000Z

194

Combining multivariate analysis and monosaccharide composition modeling to identify plant cell wall variations by Fourier Transform Near Infrared spectroscopy.  

E-Print Network [OSTI]

19. Wetzel DL: Near-infrared reflectance analysis - sleepertreatments of raw near-infrared signal in the measurement ofusing transmittance near-infrared spectroscopy. J Agric Food

2011-01-01T23:59:59.000Z

195

Combining multivariate analysis and monosaccharide composition modeling to identify plant cell wall variations by Fourier Transform Near Infrared spectroscopy  

E-Print Network [OSTI]

19. Wetzel DL: Near-infrared reflectance analysis - sleepertreatments of raw near-infrared signal in the measurement ofusing transmittance near-infrared spectroscopy. J Agric Food

2011-01-01T23:59:59.000Z

196

Minnesota's 5th congressional district: Energy Resources | Open Energy  

Open Energy Info (EERE)

Policy Organizations in Minnesota's 5th congressional district Policy Organizations in Minnesota's 5th congressional district Windustry Registered Energy Companies in Minnesota's 5th congressional district Advanced Bioenergy LLC Best Buy Best Power International LLC Bison Renewable Energy LLC Clear Wind Renewable Power Delphi Financial Corporation Deltak LLC Despatch Industries EcoSystem Corporation Emerald Renewable Energy FC3 Group FreEner-g Freener g Genmar Holdings Inc Great Plains Institute Honor the Earth International Green Power IGP MagStar Technologies NRG Thermal LLC National Wind National Wind Assessments formerly Romuld Wind Consulting Natural Resource Group Navitas Energy Inc Project Resources Corporation Ryan Companies U.S. Sunnyside Technologies Inc Superior Process Technology Inc Target The Center for Energy and the Environment

197

Expression of Aurora A (but Not Aurora B) Is Predictive of Survival in Breast Cancer  

Science Journals Connector (OSTI)

...Lett 2007;247:266-72. 33 Camp RL, Dolled-Filhart M, King...Res 2003;63:1445-8. 34 Camp RL, Chung GG, Rimm DL. Automated...A, Giltnane J, Cregger M, Camp RL, Rimm DL. Quantitative...Tumor Female History, 17th Century Humans Image Processing, Computer-Assisted...

Yasmine Nadler; Robert L. Camp; Candice Schwartz; David L. Rimm; Harriet M. Kluger; and Yuval Kluger

2008-07-15T23:59:59.000Z

198

Interspecific audience effects on the alarm-calling behaviour of a kleptoparasitic bird  

Science Journals Connector (OSTI)

...anbe.2000.1636 Cheney, D.L , and R.M Seyfarth1990How...x Leavesley, A.J , and R.D Magrath2005Communicating about...508809 Seyfarth, R.M , and D.L Cheney2003Signalers and receivers...Fitzpatrick Institute, DST/NRF Centre of Excellence, University...

2007-01-01T23:59:59.000Z

199

Extraction abilities of methods used for estimating of different phosphorus fractions  

E-Print Network [OSTI]

readily available P (P CaCl2 ). Anion exchange (AE)methods (P ar =100%) P CaCl2 P ex P DL P M3 P in P org P M-for different methods P CaCl2 P ex P DL P M3 P in P org P

Kulhanek, Martin; Balik, Jiri; Cerny, Jindrich; Kozlovsky, Ondrej; Nedved, Vaclav

2009-01-01T23:59:59.000Z

200

Genes from Pseudomonas sp. Strain BS Involved in the Conversion of l-2-Amino-?2-Thiazolin-4-Carbonic Acid to l-Cysteine  

Science Journals Connector (OSTI)

...purified intermediate by two-dimensional 1H nuclear magnetic resonance indicated that the intermediate...amidohydrolase from Pseudomonas sp. strain BS, which is able to convert dl-ATC to...l-cysteine synthesis from dl-ATC in strain BS. The 2.6-kb insert DNA fragment in...

Toshikazu Shiba; Kohji Takeda; Misako Yajima; Makoto Tadano

2002-05-01T23:59:59.000Z

Note: This page contains sample records for the topic "bv dl deltak" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


201

Similarity of genes horizontally acquired by Escherichia coli and Salmonella enterica is evidence of a supraspecies pangenome  

Science Journals Connector (OSTI)

...1073/pnas.1109451108 Katherine A. Karberg Gary J. Olsen James...Science 328 : 994 999 . 39 Wheeler DL ( 2007 ) Database...a supra-species pangenome Katherine A. Karberga,1, Gary J...Evol 27: 800 ZZQQhy810. 12. Wheeler, DL, et al. (2007) Database...

Katherine A. Karberg; Gary J. Olsen; James J. Davis

2011-01-01T23:59:59.000Z

202

Verrucomicrobia Are Candidates for Polysaccharide-Degrading Bacterioplankton in an Arctic Fjord of Svalbard  

Science Journals Connector (OSTI)

...DL Kirchman. 2011. Activity of abundant and rare bacteria in a coastal ocean. Proc. Natl. Acad. Sci. U. S. A. 108 :12776-12781. doi: 10.1073/pnas.1101405108 . 76. Landa, M , MT Cottrell, DL Kirchman, S Blain and I Obernosterer. 2013...

Z. Cardman; C. Arnosti; A. Durbin; K. Ziervogel; C. Cox; A. D. Steen; A. Teske

2014-04-11T23:59:59.000Z

203

NISF sub-group 04 March 2010  

E-Print Network [OSTI]

Woodland/ forest area (1(1--6)6) ·· Number of conifer species > 1% coverNumber of conifer species > 1% cover (21 NISF sub-group 04 March 2010 Belvoir Park Forest ­ Exhibition Room Chair: Dr Declan Looney (DL) Attendees (JL) Jon Lees -NIEA (DL) Declan Looney -NIEA (JG) John Griffin -Forest Service (DS) Richard

204

Carbon Nanotube Field-effect Transistors: AC Performance Capabilities.  

E-Print Network [OSTI]

Carbon Nanotube Field-effect Transistors: AC Performance Capabilities. D.L. Pulfrey, D.L. John-barrier carbon nanotube field-effect transistors are examined via simulations using a self-consistent Schrödinger is known about the DC capabilities of carbon nanotube field-effect transistors [1,2,3], and devices

Pulfrey, David L.

205

CARBON NANOTUBE TRANSISTORS: AN EVALUATION  

E-Print Network [OSTI]

CARBON NANOTUBE TRANSISTORS: AN EVALUATION L.C. Castro, D.L. John, and D.L. Pulfrey Department A simple, non-equilibrium model is used to evaluate the likely DC performance of carbon nanotube field and transcon- ductance close to the low-quantum-capacitance limit. Keywords: Carbon nanotubes, field

Pulfrey, David L.

206

Publications List Refereed: (78 Total)  

E-Print Network [OSTI]

. Southern pine volume equations and associated conversion factors for southwest Georgia. FL. Agr. Exp. Sta: 19 27. Frampton, LJ, Jr., and DL Rockwood. 1983. Genetic variation in traits important for energy Series Bull. No. 275, p. 28 39. Roeder, KR, and DL Rockwood. 1983. Potential stem biomass and energy

Hill, Jeffrey E.

207

Optimal Use of Groundwater and Surface Water to Reduce Land Subsidence  

E-Print Network [OSTI]

TR- 103 1980 Optimal Use of Groundwater and Surface Water to Reduce Land Subsidence G. Acosta-Gonzalez D.L. Reddell Texas Water Resources Institute Texas A&M University ...TR- 103 1980 Optimal Use of Groundwater and Surface Water to Reduce Land Subsidence G. Acosta-Gonzalez D.L. Reddell Texas Water Resources Institute Texas A&M University ...

Acosta-Gonzalez, G.; Reddell, D. L.

208

Non-nuclear attractors on SiSi bond in quantum-chemical modeling as basis set inadequacy  

E-Print Network [OSTI]

in disilane molecule computed using several methods (Hartree­Fock, Møller­Plesset perturbation theory, density distribution. ? 2003 Elsevier Science B.V. All rights reserved. Keywords: Disilane molecule; Electron density

209

E-Print Network 3.0 - association symposium freiberg Sample Search...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Freiberg University of Mining... and Technology, BvCotta Str. 2, D-09596 Freiberg, Germany E-mail: schaeben@geo.tu-freiberg.de P 2 ... Source: Potts, Daniel - Fakultt fr...

210

Please cite this article in press as: M.J. Martnez-Rodrguez, et al., J. Power Sources (2012), doi:10.1016/j.jpowsour.2012.01.132 ARTICLE IN PRESS  

E-Print Network [OSTI]

: shimpale@cec.sc.edu (S. Shimpalee). 1 Present address: Savannah River National Laboratory, Aiken, South as well as the cell operating conditions. © 2012 Elsevier B.V. All rights reserved. 1. Introduction

Van Zee, John W.

211

NATURE BIOTECHNOLOGY VOLUME 25 NUMBER 6 JUNE 2007 627 DNA synthesis and biological security  

E-Print Network [OSTI]

NATURE BIOTECHNOLOGY VOLUME 25 NUMBER 6 JUNE 2007 627 DNA synthesis and biological security Hans Biotechnology; Han-Oh Park is at Bioneer; Bas Reichert is at BaseClear B.V.; Ralf Wagner is at the University

Church, George M.

212

E-Print Network 3.0 - area baja california Sample Search Results  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Baja Project Types Flat Rolling Hills Rough... Prison Data Sources: ESRI, ESRI Online, Ventyx, B&V RETI Data, World Database on Protected Areas, AWS... TruewindNREL (ANSI Size D)...

213

A linguistic approach to user interface design  

Science Journals Connector (OSTI)

... 2001 Elsevier Science B.V. All rights...Articles A linguistic approach to user interface...User Interface Management Systems 1992 Morgan-Kaufman...object-oriented approach to distributed data management, The Journal of Systems......

Rumen Dimov Andreev

2001-05-01T23:59:59.000Z

214

Catalytically active gold: The role of cluster morphology T.V. Choudhary a  

E-Print Network [OSTI]

synthesis, water gas shift reaction [10,11], environmental catalysis [2,12,13] and hydrogenation reactions is sufficient to explain the reaction kinetics. # 2005 Published by Elsevier B.V. Keywords: CO oxidation; Gold

Goodman, Wayne

215

Ecological Engineering 20 (2003) 363377 Ecological engineering: A field whose time has come  

E-Print Network [OSTI]

of Pharmacy, Copenhagen, DK, Denmark Received 10 May 2002; received in revised form 14 December 2002; accepted Elsevier B.V. All rights reserved. Keywords: Ecotechnology; Self-design; Self-organization; Ecological

Tullos, Desiree

216

The Sequence of a 1.8-Mb Bacterial Linear Plasmid Reveals a Rich Evolutionary Reservoir of Secondary Metabolic  

E-Print Network [OSTI]

Physiology, Groningen Biomolecular Sciences and Biotechnology Institute, University of Groningen, Haren, The Netherlands 2 Groningen Bioinformatics Centre, Groningen Biomolecular Sciences and Biotechnology Institute, University of Groningen, Haren, The Netherlands 3 DSM Biotechnology Center, DSM Food Specialties B.V., Delft

Breitling, Rainer

217

E-Print Network 3.0 - analogos industriales del Sample Search...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

CFU Data nascita Summary: ,5 06011989 10 732911 A-DESIGN DEL PRODOTTO INDUSTRIALE BV MI 27,5 112,5 23121988 11 731567 A... 121989 13 732676 A-DESIGN DEL PRODOTTO...

218

Strontium isotope prole of the early Toarcian (Jurassic) oceanic anoxic event, the duration of ammonite biozones,  

E-Print Network [OSTI]

Strontium isotope pro¢le of the early Toarcian (Jurassic) oceanic anoxic event, the duration% TOC) sediments ? 2000 Elsevier Science B.V. All rights reserved. Keywords: strontium; isotope ratios

Fouke, Bruce W.

219

Strontium isotope variations in the lower Mississippi River and its estuarine mixing zone  

E-Print Network [OSTI]

Strontium isotope variations in the lower Mississippi River and its estuarine mixing zone Yingfeng for stratigraphic dating purposes. © 2007 Elsevier B.V. All rights reserved. Keywords: Strontium; 87 Sr/86 Sr

220

Evolution and comparative genomics of subcellular specializations: EST sequencing of Torpedo electric organ  

E-Print Network [OSTI]

Evolution and comparative genomics of subcellular specializations: EST sequencing of Torpedo discovery Open reading frame (ORF) Uncharacterized open reading frames (ORFs) in human genomic sequence Elsevier B.V. All rights reserved. 1. Introduction The availability of complete genomic sequences

Vertes, Akos

Note: This page contains sample records for the topic "bv dl deltak" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


221

General equilibrium, electricity generation technologies and the cost of carbon abatement: A structural sensitivity analysis  

E-Print Network [OSTI]

General equilibrium, electricity generation technologies and the cost of carbon abatement-down General equilibrium Electricity generation is a major contributor to carbon dioxide emissions Elsevier B.V. All rights reserved. 1. Introduction Electricity generation is a significant contributor

222

An adaptive mesh method for the simulation of Blade Vortex Interaction  

E-Print Network [OSTI]

An adaptive mesh method for the simulation of parallel ics. Blade Vortex Interaction (BV1) with an active Trailing Edge Flap (TEF) is presented. The two-dimensional 1111-steady problem is solved by a higher order upwind Euler method...

Kim, Kyu-Sup

2012-06-07T23:59:59.000Z

223

E-Print Network 3.0 - annual growth rings Sample Search Results  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Search Sample search results for: annual growth rings Page: << < 1 2 3 4 5 > >> 1 D Smith and D b d s , Univemily of Victorfa, V'ictoriq I@ XKn Ekevier B.V. All rightsr w w d ....

224

E-Print Network 3.0 - annual tree rings Sample Search Results  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Search Sample search results for: annual tree rings Page: << < 1 2 3 4 5 > >> 1 D Smith and D b d s , Univemily of Victorfa, V'ictoriq I@ XKn Ekevier B.V. All rightsr w w d ....

225

Comparing local vs. global visible and near-infrared (VisNIR) diffuse reflectance spectroscopy (DRS) calibrations for the prediction of soil clay, organic C  

E-Print Network [OSTI]

Comparing local vs. global visible and near-infrared (VisNIR) diffuse reflectance spectroscopy (DRS Elsevier B.V. All rights reserved. 1. Introduction Visible and near-infrared (VisNIR) diffuse reflectance

Lawrence, Rick L.

226

Chronology and integrated stratigraphy of the Miocene Sinj Basin (Dinaride Lake System, Croatia)  

E-Print Network [OSTI]

in the upper part of the basin stratigraphy. © 2010 Elsevier B.V. All rights reserved. 1. Introduction During), providing an excellent opportunity to study evolution in an isolated system. Moreover, lignite deposits

Utrecht, Universiteit

227

Integrated stratigraphy of the Early Miocene lacustrine deposits of Pag Island (SW Croatia): Palaeovegetation and environmental changes in the  

E-Print Network [OSTI]

lignite deposition and shallow lake facies. This suggests that both records are dominantly controlled Optimum. © 2009 Elsevier B.V. All rights reserved. 1. Introduction The Dinarids, and other areas

Utrecht, Universiteit

228

E-Print Network 3.0 - aquatic macrophytes eicchornia Sample Search...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Topic List Advanced Search Sample search results for: aquatic macrophytes eicchornia Page: << < 1 2 3 4 5 > >> 1 Aquatic Botany, 341--370 341 Elsevier Science Publishers B.V.,...

229

E-Print Network 3.0 - aquatic macrophyte modeling Sample Search...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Topic List Advanced Search Sample search results for: aquatic macrophyte modeling Page: << < 1 2 3 4 5 > >> 1 Aquatic Botany, 341--370 341 Elsevier Science Publishers B.V.,...

230

E-Print Network 3.0 - aquatic macrophyte detritus Sample Search...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Topic List Advanced Search Sample search results for: aquatic macrophyte detritus Page: << < 1 2 3 4 5 > >> 1 Aquatic Botany, 341--370 341 Elsevier Science Publishers B.V.,...

231

E-Print Network 3.0 - aromatic polyamide membranes Sample Search...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Topic List Advanced Search Sample search results for: aromatic polyamide membranes Page: << < 1 2 3 4 5 > >> 1 Desalination, 95 (1994) 325-345 Elsevier Science B.V....

232

Focus on histone variant H2AX: To be or not to be Jingsong Yuan, Rachel Adamski, Junjie Chen *  

E-Print Network [OSTI]

of European Biochemical Societies. Published by Elsevier B.V. All rights reserved. 1. Introduction The genome or inaccurate repair can create mutations and chromosomal translocations that induce genomic instability

233

Research Report Cortical pyramidal cells as non-linear oscillators  

E-Print Network [OSTI]

follows a complex "devil's staircase" phenomena, where locked modes are interleaved with irregular firing Elsevier B.V. All rights reserved. Keywords: Bifurcation theory Devil's staircase Endogenous oscillator 1

Brumberg, Joshua

234

Monitoring Energy Losses  

E-Print Network [OSTI]

MAIN STEAM PRESSURE Increase boiler pressure Close turbine control valves Increase firing rate Pressure limited bV water Quality Referred to Maintenance Referred to Results Other No action taken HIGH REHEAT SUPERHEATER ATTEMPERATION FLOW Soot... MAIN STEAM PRESSURE Increase boiler pressure Close turbine control valves Increase firing rate Pressure limited bV water Quality Referred to Maintenance Referred to Results Other No action taken HIGH REHEAT SUPERHEATER ATTEMPERATION FLOW Soot...

Eulinger, R. D.

235

Ebola virus-like particles produced in insect cells exhibit dendritic cell stimulating activity and induce neutralizing antibodies  

SciTech Connect (OSTI)

Recombinant baculoviruses (rBV) expressing Ebola virus VP40 (rBV-VP40) or GP (rBV-GP) proteins were generated. Infection of Sf9 insect cells by rBV-VP40 led to assembly and budding of filamentous particles from the cell surface as shown by electron microscopy. Ebola virus-like particles (VLPs) were produced by coinfection of Sf9 cells with rBV-VP40 and rBV-GP, and incorporation of Ebola GP into VLPs was demonstrated by SDS-PAGE and Western blot analysis. Recombinant baculovirus infection of insect cells yielded high levels of VLPs, which were shown to stimulate cytokine secretion from human dendritic cells similar to VLPs produced in mammalian cells. The immunogenicity of Ebola VLPs produced in insect cells was evaluated by immunization of mice. Analysis of antibody responses showed that most of the GP-specific antibodies were of the IgG2a subtype, while no significant level of IgG1 subtype antibodies specific for GP was induced, indicating the induction of a Th1-biased immune response. Furthermore, sera from Ebola VLP immunized mice were able to block infection by Ebola GP pseudotyped HIV virus in a single round infection assay, indicating that a neutralizing antibody against the Ebola GP protein was induced. These results show that production of Ebola VLPs in insect cells using recombinant baculoviruses represents a promising approach for vaccine development against Ebola virus infection.

Ye Ling [Department of Microbiology and Immunology and Emory Vaccine Center, Emory University School of Medicine, Atlanta, GA 30322 (United States); Lin Jianguo [Department of Microbiology and Immunology and Emory Vaccine Center, Emory University School of Medicine, Atlanta, GA 30322 (United States); Sun Yuliang [Department of Microbiology and Immunology and Emory Vaccine Center, Emory University School of Medicine, Atlanta, GA 30322 (United States); Bennouna, Soumaya [Department of Microbiology and Immunology and Emory Vaccine Center, Emory University School of Medicine, Atlanta, GA 30322 (United States); Department of Pathology, Emory University School of Medicine, Atlanta, GA 30322 (United States); Lo, Michael [Department of Microbiology and Immunology and Emory Vaccine Center, Emory University School of Medicine, Atlanta, GA 30322 (United States); Department of Pathology, Emory University School of Medicine, Atlanta, GA 30322 (United States); Wu Qingyang [Department of Microbiology and Immunology and Emory Vaccine Center, Emory University School of Medicine, Atlanta, GA 30322 (United States); Bu Zhigao [Department of Microbiology and Immunology and Emory Vaccine Center, Emory University School of Medicine, Atlanta, GA 30322 (United States); Pulendran, Bali [Department of Microbiology and Immunology and Emory Vaccine Center, Emory University School of Medicine, Atlanta, GA 30322 (United States); Department of Pathology, Emory University School of Medicine, Atlanta, GA 30322 (United States); Compans, Richard W. [Department of Microbiology and Immunology and Emory Vaccine Center, Emory University School of Medicine, Atlanta, GA 30322 (United States)]. E-mail: compans@microbio.emory.edu; Yang Chinglai [Department of Microbiology and Immunology and Emory Vaccine Center, Emory University School of Medicine, Atlanta, GA 30322 (United States)]. E-mail: chyang@emory.edu

2006-08-01T23:59:59.000Z

236

Double layer created by electron cyclotron resonance heating in an inhomogeneously magnetized plasma with high-speed ion flow  

SciTech Connect (OSTI)

A potential jump, i.e., an electric double layer (DL) is formed near an electron cyclotron resonance (ECR) point when an electron cyclotron wave is injected into an inhomogeneously magnetized plasma with high-speed ion flow. A charge separation is caused by an electron reflection due to -{mu}{nabla}B{sub z} force enhanced by ECR heating and ion inertia. It is clearly demonstrated in the experiment that the potential height of the DL is almost proportional to the field-aligned ion flow energy; the DL is found to be self-consistently formed for maintaining charge neutrality by reflecting a part of the flowing ions.

Takahashi, K.; Kaneko, T.; Hatakeyama, R. [Department of Electronic Engineering, Tohoku University, Sendai, 980-8579 (Japan)

2008-07-15T23:59:59.000Z

237

Voxel-based T2 relaxation rate measurements in temporal lobe epilepsy (TLE) with and without mesial temporal sclerosis  

E-Print Network [OSTI]

Voxel-based T2 Relaxation Rate Measurements in Temporal LobeD, Pike BG, Arnold DL. T2 relaxometry can lateralize mesialC, Grucker D. Contribution of T2 relaxation time mapping in

Mueller, S G; Laxer, K D; Schuff, N; Weiner, Michael W

2007-01-01T23:59:59.000Z

238

Enzymes of the shikimic acid pathway encoded in the genome of a basal metazoan, Nematostella vectensis, have microbial origins  

Science Journals Connector (OSTI)

...VDQHIKGLQAMGAEVRVEHGYVQAQVPRLKGARLFTDMVTVTGTENLMMAACLAQGETVI 182 Query 181 ENAAMEAEIDDLVCMLRKMGAQIDKNRDTKTWFITGVSSLHGADHGVVPDRIVAGTYAVA 240 ENAA E E+ DL L MGAQI T I GV +LHGA H ++PDRI GTY A Sbjct 183 ENAAREPEVVDLANCLVAMGAQI-SGAGTDVIRIRGVDALHGATHRIMPDRIETGTYLCA 241 Query 241 AVMTGGELTLT-LGPCPVPALMGCVLTCLRAAGAEVMELAEGIRVRGGRRPRSVSITTSP...

Antonio Starcevic; Shamima Akthar; Walter C. Dunlap; J. Malcolm Shick; Daslav Hranueli; John Cullum; Paul F. Long

2008-01-01T23:59:59.000Z

239

An empirical evaluation of live cattle futures and options for short hedging slaughter cattle in the Texas Panhandle  

E-Print Network [OSTI]

were able to derive the model: W(X, T) = XN(dl) ? Ce N(d2), ln X/C + (R + I/2V )(T) (10) dl = v Tl/2 sTI/2 2 1 where W(X, T) is the premium for a call stock option with an exercise 20 price of C and time T until expiration, the underlying stock... the necessary modifications, Black derived the commod- ity contract pricing model: CP(Z T) e [ZN(dl) CN(d2) ] X S (12) dl = [ln ? + ? (T)]ST C 2 d d uTI/2 2 1 This formula is identical to the Black-Scholes model if Ze is substi- tuted for X everywhere...

Winder, Jim R.

2012-06-07T23:59:59.000Z

240

ACM Reference Format Wei, X., Zhang, P., Chai, J. 2012. Accurate Realtime Full-body Motion Capture Using a Single Depth Cam-  

E-Print Network [OSTI]

-based animation, human motion tracking, 3D pose detection, vision-based motion modeling Links: DL PDF e-mail: xwei parallel and is therefore easily implemented on a GPU. We demonstrate the power of our approach

Chai, Jinxiang

Note: This page contains sample records for the topic "bv dl deltak" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


241

Download Full-text PDF  

Science Journals Connector (OSTI)

types of sedimentary environments in the southern and eastern North Sea in August 1991 and ..... fusion (D,) coefficients (both in units of m2 d-l), the sedi-.

242

Communications mensuelles de l'lnstitut International dela Potasse, Berne (Suisse) Science du sol N 5/1981  

E-Print Network [OSTI]

sciences vc!igc!itales, Universitc!i de Delaware, Newark, Delaware 19711, USA Resume condense des publications suivantes: Sparks D.L., Martens D.C., Zelazny L. W.: Plant Uptake and Leaching of applied

Sparks, Donald L.

243

LCLS CDR Chapter 11 - Controls  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

will be EPICS-based. These systems include: (1) The LCLS Injector systems, such as, the gun, the gun laser, the injector linac and the DL1 beamline. (2) The undulator segments,...

244

E-Print Network 3.0 - anemia status hemoglobin Sample Search...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Sargent, MD Summary: dL after adjustments for children's age, hemoglobin level, and insurance status (12). The second, a study... Test children at risk for anemia (e.g., those...

245

The Personalized, Collaborative Digital Library Environment CYCLADES and Its Collections Management  

Science Journals Connector (OSTI)

Usually, a Digital Library (DL) is an information resource where ... additionally as a personalized collaborative working and meeting space of people sharing common interests, where users...i may organize the inf...

Leonardo Candela; Umberto Straccia

2004-01-01T23:59:59.000Z

246

Effects of Physical Activity and Restricted Energy Intake on Chemically Induced Mammary Carcinogenesis  

Science Journals Connector (OSTI)

...induces a greater flux of energy through the system that could...stress, whereas restricted energy intake (RE) reduces oxidative...maltodextrin, cornstarch, corn oil, cellulose, minerals...and dl-methionine. The energy distribution was protein (20...

Weiqin Jiang; Zongjian Zhu; and Henry J. Thompson

2009-04-01T23:59:59.000Z

247

Sources of CAM3 temperature bias during northern winter from diagnostic study of the temperature bias equation  

E-Print Network [OSTI]

References Boville BA, Rasch PJ, Hack JJ, McCaa JR (2006)WD, Rasch PJ, Boville BA, Hack JJ, McCaa JR, Williamson DL,602. doi:10.1002/joc.1423 Hack JJ, Kiehl JT, Hurrell JW (

Pan, Lin-Lin; Grotjahn, Richard; Tribbia, Joe

2010-01-01T23:59:59.000Z

248

1  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Spectroscopy and Radiative Transfer 91:233-244. Collins, WD, PJ Rasch, BA Boville, JJ Hack, JR McCaa, DL Williamson, BP Briegleb, CM Bitz, S-J Lin, and M Zhang 2006. "The...

249

1  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

absorption of radiation." Contributions to Atmospheric Physics, 52, 1-16. Kiehl, JT, JJ Hack, GB Bonan, BA Boville, BP Briegleb, DL Williamson, and PJ Rasch. 1996. Description of...

250

Effectiveness of Employing Multimedia Principles in The Design of Computer-Based Math Tutorials for Students with Learning Disabilities  

E-Print Network [OSTI]

DL). The animated tutorial prototype, which was studied as part of this project, was for young children. The study evaluated a prototype of online instructional tutorial in mathematics designed for students with disabilities. The tutorial prototype was instructional...

Kanitkar, Anjali Shridhar

2010-04-28T23:59:59.000Z

251

EROSION-CORROSION-WEAR PROGRAM  

E-Print Network [OSTI]

MD, Oct. 1979. dl. Oil Shale Retort Components" A. Levy andCorrosion of Metals in Oil Shale Retorts,'' AS! v! WESTEC 'of metals in coal and oil shale conver- sion environments

Levy, Alan V.

2013-01-01T23:59:59.000Z

252

October 1992 ISOLATOR-10  

E-Print Network [OSTI]

Suggested Reading Material A-1 CIRCUIT DIAGRAMS B-1 WARRANTY C-1 WARNING D-l RETURN MERCHANDISE be handled at all times with caution. ISOLATOR-10, COPYRIGHT OCTOBER 1992, AXON INSTRUMENTS, INC. #12;Page V

Kleinfeld, David

253

EROSION-CORROSION-WEAR PROGRAM  

E-Print Network [OSTI]

will also be conducted in shale oil product material. 1979MD, Oct. 1979. dl. Oil Shale Retort Components" A. Levy andof metals in coal and oil shale conver- sion environments

Levy, Alan V.

2013-01-01T23:59:59.000Z

254

Manufacturability Study and Scale-Up for Large Format Lithium...  

Broader source: Energy.gov (indexed) [DOE]

contributions out of over 40 in FY1314 * Selected publications 1. J. Li, B.L. Armstrong, J. Kiggans, C. Daniel, and D.L. Wood, "Lithium Ion Cell Performance Enhancement...

255

[)r PAR1 rMF.Nr o Dr (.FIrMr( A .IF]CNC)I,OGIi,  

E-Print Network [OSTI]

[)r PAR1 rMF.Nr o Dr (.FIrMr( A E .IF]CNC)I,OGIi, f)?]I I-ARMACo @ ;^.*r.l-EN,.m BANDO Dl SELEZIONE

Guidoni, Leonardo

256

Sustained fecundity when phytoplankton resources are in short supply  

Science Journals Connector (OSTI)

rates of egg production (1 l-45 eggs female 1 d-l) in the open waters of the Gulf of St. Lawrence in late. June-early July. These rates were comparable to egg...

1999-12-19T23:59:59.000Z

257

Science in support of the Deepwater Horizon response  

Science Journals Connector (OSTI)

...are total discharge: oil plus liquid natural gas. The total discharge (oil + liquid...science and views. Protecting intellectual capital is also important. However, some scientists...48 Redmond MC Valentine DL ( 2012 ) Natural gas and temperature structured...

Jane Lubchenco; Marcia K. McNutt; Gabrielle Dreyfus; Steven A. Murawski; David M. Kennedy; Paul T. Anastas; Steven Chu; Tom Hunter

2012-01-01T23:59:59.000Z

258

Structure of the rare archaeal biosphere and seasonal dynamics of active ecotypes in surface coastal waters  

Science Journals Connector (OSTI)

...Heidelberg JF Kirchman DL ( 2011 ) Activity of abundant and rare bacteria in a coastal ocean . Proc Natl Acad Sci USA 108 : 12776 12781 . 5 Lennon JT Jones SE ( 2011 ) Microbial seed banks: The ecological and evolutionary implications of dormancy...

Mylne Hugoni; Najwa Taib; Didier Debroas; Isabelle Domaizon; Isabelle Jouan Dufournel; Gisle Bronner; Ian Salter; Hlne Agogu; Isabelle Mary; Pierre E. Galand

2013-01-01T23:59:59.000Z

259

Single bacterial strain capable of significant contribution to carbon cycling in the surface ocean  

Science Journals Connector (OSTI)

...Heidelberg JF Kirchman DL ( 2011 ) Activity of abundant and rare bacteria in a coastal ocean . Proc Natl Acad Sci USA 108 ( 31 ): 12776 12781 . 52 Hunt DE ( 2013 ) Relationship between abundance and specific activity of bacterioplankton in open ocean surface...

Byron E. Pedler; Lihini I. Aluwihare; Farooq Azam

2014-01-01T23:59:59.000Z

260

Licensing stop place before laterals : a study of acoustic cues relevant to the perception of stop-lateral sequences  

E-Print Network [OSTI]

In phonological analyses of both adult and child language, a *dl constraint has frequently been used as a shorthand to indicate that coronal stops are dispreferred before laterals (Dinnsen et al. 2001). This dispreference ...

Michaels, Jennifer M. (Jennifer Marie)

2011-01-01T23:59:59.000Z

Note: This page contains sample records for the topic "bv dl deltak" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


261

E-Print Network 3.0 - arterial blood gas Sample Search Results  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

54 ml CO2 dL blood The total CO2 content of blood in any systemic artery 49 ml CO2 d... of gas exchange with environment Difference in blood respiratory gas after...

262

A Unique Set of 11,008 Onion Expressed Sequence Tags Reveals Expressed Sequence and Genomic Differences between the Monocot Orders Asparagales and Poales  

Science Journals Connector (OSTI)

...Applied Biosystems, Foster City, CA). Analyses...the Entrez retrieval system to specify plant sequences...Food and Agricultural Systems Grant 2001-04434...Ostell, J., and Wheeler, D.L. (2003...Monocotyledons: A Comparative Study. (London: Academic...

Joseph C. Kuhl; Foo Cheung; Qiaoping Yuan; William Martin; Yayeh Zewdie; John McCallum; Andrew Catanach; Paul Rutherford; Kenneth C. Sink; Maria Jenderek; James P. Prince; Christopher D. Town; Michael J. Havey

2003-12-11T23:59:59.000Z

263

Reciprocal feeding facilitation between above- and below-ground herbivores  

Science Journals Connector (OSTI)

...potential mechanisms are induction of ethylene or abscisic acid in leaves by root...153-170. Wallingford, UK: CABI. 4 Price, PW , RF Denno, MD Eubanks, DL...Bhattarai, and I Kaloshian. 2009 Ethylene contributes to potato aphid susceptability...

2013-01-01T23:59:59.000Z

264

Improvement of epidemiological data analysis by unbiased estimates of log-normal dose distribution  

Science Journals Connector (OSTI)

The effects of radiation on population and risk assessment are studied through epidemiological studies that are heavily dependent on dose distribution. Radiation doses to individual workers follow a log-normal distribution. Computation of the collective dose with the minimum detectable values (Detection Limit or DL) as zero is biased. Hence the expectation value of the 'missed' doses is computed as the ratio of the collective dose of all dosimeters with DL to the product of the total number of dosimeters. So far, in all epidemiological studies, doses below DL are set equal to the DL itself and yield a positive bias in the dose-response relation. This paper presents an enhanced method by removing the bias with the help of the Expectation Maximisation (EM) algorithm. This algorithm, along with unbiased characteristic estimates of log-normal distribution, significantly improves the estimation of confounders by 95%, and improves the dose-response relationship.

Joyeeta Mukhopadhyaya; D. Datta; H.S. Kushwaha

2007-01-01T23:59:59.000Z

265

2007/08/1747  

E-Print Network [OSTI]

[6] Ian Porteous. Topological ... as a subgroup of U(n) decomposes into irreducible representations R1,...,Rl of dimensions d1,...,dl and with multiplicities m1,...,ml...

2008-10-06T23:59:59.000Z

266

RFP_WhitePaper_v4  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

White paper for 2014 FESAC Strategic Planning Aug. 2014 1 Opportunities and Context for Reversed Field Pinch Research J.S. Sarff 1 , A.F. Almagri, J.K. Anderson, D.L. Brower, B.E....

267

viennaking.PDF  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

IMPROVED ACCURACY FOR LOW-COST SOLAR IRRADIANCE SENSORS D.L. King, W.E. Boyson, B.R. Hansen, and W.I. Bower, Sandia National Laboratories Presented at the 2 nd World Conference and...

268

Rate-limiting Factors in Glycolysis and Transport of Inorganic Phosphate in DBAH1 Tumor, DBAG Tumor, Novikoff Hepatoma, and Novikoff Ascites Tumor  

Science Journals Connector (OSTI)

...are in SI units. The conversion factor for glucose is mg/dl...High-risk lifestyle factors may lead to insulin resistance...circulating levels of energy substrates, insulin, and insulin-like growth factor-1, may promote the...

Ray Wu; Helen Power; and David Hamerman

1965-11-01T23:59:59.000Z

269

Enhanced killing of pancreatic cancer cells by expression of fusogenic membrane glycoproteins in combination with chemotherapy  

Science Journals Connector (OSTI)

...and Medical Virology, Institute of Microbiology and Hygiene, Ruhr-University Bochum...Freytag SO, Rogulski KR, Paielli DL, Gilbert JD, Kim JH. A novel three-pronged...and Medical Virology, Institute of Microbiology and Hygiene, Ruhr-University Bochum...

Dennis Hoffmann and Oliver Wildner

2006-08-01T23:59:59.000Z

270

LU Surface Chemistry 17 STM of (2222)R45-Ti5O8/Pt(100)  

E-Print Network [OSTI]

absorption with an evacuated FTIR spectrometer. RMS signal to noise ratios of over a million to one have been.bath.ac.uk/~chsacf/solartron/electro/html/dl.htm #12;LU Surface Chemistry 32 Exemplary Electrochemical Problems Requ

Gilchrist, James F.

271

Mycorrhizal fungi in roots of Texas crops  

E-Print Network [OSTI]

~h, 1 f d ' d with peanuts grown at Stephenville, Texas. In watermelon material, five different kinds of mycorrhiza1 ~ p ly d, ' 1 d' S h* G~ p G~t 11 'd, G. ~l d G. ~h, d p ' f S~ltt, S. Slf 1 d S. ~tfd . 1'h ~dl ' p 1 *1 f d ' h ll p t ~dl... ~h, 1 f d ' d with peanuts grown at Stephenville, Texas. In watermelon material, five different kinds of mycorrhiza1 ~ p ly d, ' 1 d' S h* G~ p G~t 11 'd, G. ~l d G. ~h, d p ' f S~ltt, S. Slf 1 d S. ~tfd . 1'h ~dl ' p 1 *1 f d ' h ll p t ~dl...

Yeh, May-Wei Mavix

2012-06-07T23:59:59.000Z

272

Modeling of Energy Production Decisions: An Alaska Oil Case Study  

E-Print Network [OSTI]

and Weimer, D.L. (1984) Oil prices shock, market response,OPEC behavior and world oil prices (pp. 175-185) London:many decades. Recent high oil prices have caused oil-holding

Leighty, Wayne

2008-01-01T23:59:59.000Z

273

Bilevel Direct Search Method for Leader-Follower Equilibrium ...  

E-Print Network [OSTI]

electricity markets [42, 46, 16], Nash equilibrium model in transportation [27] and signal trans- mission in wireless ...... Private market share (DH,DL). (0.62, 0.41)...

2012-02-12T23:59:59.000Z

274

The Very Large Telescope Interferometer: an update Pierre Haguenauer*a  

E-Print Network [OSTI]

, Casilla 19001, Santiago, Chile; b European Southern Observatory, Karl-Schwarzschild-Str. 2, 85748 Garching long tunnel. A system of movable mirrors allows sending the light from each DL to any of the sixteen

Liske, Jochen

275

E-Print Network 3.0 - area electron beam Sample Search Results  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

D.L. Summary: , Ann Arbor, MI 48109, USA Abstract We have used electron and photon beams from the 50 MV electron... the magnetic confinement of HE electron and photon...

276

Composition of Dioxin-like PCBs in Fish: An Application for Risk  

E-Print Network [OSTI]

Composition of Dioxin-like PCBs in Fish: An Application for Risk Assessment S A T Y E N D R A P . B in Aroclors and that toxicity varies considerably among the congeners with dioxin-like PCBs (dl

Jackson, Don

277

Carbohydrate-like composition of submicron atmospheric particles and their production from ocean bubble bursting  

Science Journals Connector (OSTI)

...much of the International Chemistry...trajectories and radon concentrations...campaign, with project averages...these two projects, two coastal [International Consortium...0.91) Radon (mBq m-3...the ICEALOT project. "<DL...

Lynn M. Russell; Lelia N. Hawkins; Amanda A. Frossard; Patricia K. Quinn; Tim S. Bates

2010-01-01T23:59:59.000Z

278

Modern Methods of Monosaccharide Synthesis from Non-Carbohydrate Tomas Hudlicky,* David A. Entwistle, Kevin K. Pitzer, and Andrew J. Thorpe  

E-Print Network [OSTI]

and Tafel to consist of a mixture of carbo- hydrates, two of which were identified as DL-arabino- hexulose, and propagation. Figure 1. Fischer and Tafel's synthesis of nonracemic sugars from formose. Figure 2. The first

Hudlicky, Tomas

279

KRAGER, CLINTON D., AND SARAH ANN WOODIN. Spatial ...  

Science Journals Connector (OSTI)

Exposure times for all quadrats ranged from 6 to 9 h d-l ... quadrats were started on 25 June and ended ...... morphology of the alimentary tract, food and feeding.

1999-12-22T23:59:59.000Z

280

ILDS  

Energy Science and Technology Software Center (OSTI)

003176IBMPC00 Intelligent Leak Detection System https://www.dropbox.com/sh/aycss2bffzmur10/AAAJvqH8IKmrA93kngsAy45qa?dl=0

Note: This page contains sample records for the topic "bv dl deltak" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


281

EFFECT OF NITROGEN OXIDE PRETREATMENTS ON ENZYMATIC HYDROLYSIS OF CELLULOSE  

E-Print Network [OSTI]

Jerusalem, loR. Parkinson, Tappi, Meller, Holzforschung,L.L. Schaleger and D.L. Brink, Tappi, No.4, 65 ( 1978). N.I.Holocellulose in Wood," Tappi Standard T9 m-54. C.R.

Borrevik, R.K.

2011-01-01T23:59:59.000Z

282

Potassium-Calcium Exchange in a Multireactive Soil System: II. Thermodynamics1 P. M. JARDINE ANDD. L. SPARKS2  

E-Print Network [OSTI]

ions and sup- ports the hypothesis of the multireactive natureof the soil. Although K was selectively energy of ex- change, enthalpy of exchange, entropy of exchange. Jardine, P.M., and D.L. Sparks. 1984

Sparks, Donald L.

283

Memory, brain and aging: The good, the bad and the promising  

E-Print Network [OSTI]

temporal region endur- ing memory impairment following aE. 1994. What are the memory systems of 1994? In: SchacterDL, Tulving E (eds. ). Memory Systems 1994. Cambridge, MA:

Ober, Beth A.

2010-01-01T23:59:59.000Z

284

HUTCHINS, DA, GR DITULLIO, Y. ZHANG, AND KW BRULAND. An ...  

Science Journals Connector (OSTI)

organic Fe was added as a 26 M stock in 0.01 N Ultrex .... Results. In keeping with the large heterogeneity in Fe supplies along the ..... expressed in units of d-l.

285

Borehole geophysics evaluation of the Raft River geothermal reservoir...  

Open Energy Info (EERE)

GEOTHERMAL SYSTEMS; HYDROTHERMAL SYSTEMS; NORTH AMERICA; PACIFIC NORTHWEST REGION; USA Authors Applegate, J.K.; Donaldson, P.R.; Hinkley, D.L.; Wallace and T.L. Published...

286

A DNA Nanostructure Platform for Directed Assembly of Synthetic Vaccines  

Science Journals Connector (OSTI)

A DNA Nanostructure Platform for Directed Assembly of Synthetic Vaccines ... Here we report the design and synthesis of a 1,669-nucleotide, single-stranded DNA mol. ... These DL-DNAs induced greater amts. of tumor necrosis factor-? and interleukin-6 from RAW264.7 macrophage-like cells than did a mixt. of Y-DNA with the same sequences as the corresponding DL-DNA. ...

Xiaowei Liu; Yang Xu; Tao Yu; Craig Clifford; Yan Liu; Hao Yan; Yung Chang

2012-07-03T23:59:59.000Z

287

Shock-induced hyperalgesia: the role of the gaba and glutamate systems of the dorsolateral periaqueductal gray  

E-Print Network [OSTI]

sensitization bears similarities to the sensitization of acoustic startle. Both forms of sensitization can be induced by moderate shock and have a similar time course (approximately 30 min; Illich et al. , 1995). Recent This thesis follows the format... of the Journal of Neuroscience. evidence has implicated the dorsolateral PAG (dlPAG) in both forms of environmentally-induced sensitization. Lesions of the dlPAG eliminate shock- induced sensitization of acoustic startle, shock-induced hyperalgesia...

Sieve, Amy Nicole

2012-06-07T23:59:59.000Z

288

Effects of stress ratio and fiber orientation on fatigue crack growth behavior in APAL  

SciTech Connect (OSTI)

A new hybrid composite (APAL; Aramid Patched Aluminum Alloy), consisting of 2024-T3 aluminum alloy plate sandwiched between aramid/epoxy prepregs (HK 285/RS 1222), was developed. Fatigue crack growth behavior was examined at stress ratios of R = 0.2, 0.5 using two kinds of APAL with different fiber orientation (0{degree}/90{degree} and {+-} 45{degree} for crack direction). The APAL showed superior fatigue crack growth resistance, which may be attributed to the crack bridging effect imposed by the intact fibers in the crack wave. The magnitude of crack bridging was estimated quantitatively and determined by a new technique on the basis of the compliances of 2024-T3 aluminum alloy and APAL specimens. The crack growth rate of the APAL specimens was reduced significantly as comparison to the monolithic aluminum alloy and was not adequately correlated with the conventional stress intensity factor range ({Delta}K). It was found that the crack growth rate was successfully correlated with the effective stress intensity factor range ( {Delta}K{sub eff} = K{sub br} {minus} K{sub cl}) allowing for the crack closure and the crack bridging. The relation between da/dN and {Delta}K{sub eff} was plotted within a narrow scatter band regardless at loading line of 2024-T3 aluminum alloy, two kinds of the APAL (APAL 0{degree}/90{degree}, APAL {+-} 45{degree}) and two kinds of stress ratios (R = 0.2, 0.5).

Oh, S.W.; Park, W.J. [Dong-A Univ., Pusan (Korea, Republic of). Dept. of Mechanical Engineering; Yoon, H.K.; Lee, K.G. [Dong-Eui Univ., Pusan (Korea, Republic of). Dept. of Mechanical Engineering; Cho, J.M.; Lee, K.B. [Han Kuk Fiber Glass Co. Ltd., Kyungnam (Korea, Republic of)

1993-12-31T23:59:59.000Z

289

MICROX-2 cross section library based on ENDF/B-VII  

SciTech Connect (OSTI)

New cross section libraries of a neutron transport code MICROX-2 have been generated for advanced reactor design and fuel cycle analyses. A total of 386 nuclides were processed, including 10 thermal scattering nuclides, which are available in ENDF/B-VII release 0 nuclear data. The NJOY system and MICROR code were used to process nuclear data and convert them into MICROX-2 format. The energy group structure of the new library was optimized for both the thermal and fast neutron spectrum reactors based on Contributon and Point-wise Cross Section Driven (CPXSD) method, resulting in a total of 1173 energy groups. A series of lattice cell level benchmark calculations have been performed against both experimental measurements and Monte Carlo calculations for the effective/infinite multiplication factor and reaction rate ratios. The results of MICROX-2 calculation with the new library were consistent with those of 15 reference cases. The average errors of the infinite multiplication factor and reaction rate ratio were 0.31% {delta}k and 1.9%, respectively. The maximum error of reaction rate ratio was 8% for {sup 238}U-to-{sup 235}U fission of ZEBRA lattice against the reference calculation done by MCNP5. (authors)

Hou, J.; Ivanov, K. [Dept. of Mechanical and Nuclear Engineering, Pennsylvania State Univ., Univ. Park, PA 16802-1414 (United States); Choi, H. [General Atomics, 3550 General Atomics Court, San Diego, CA 92121-1122 (United States)

2012-07-01T23:59:59.000Z

290

The effect of temperature and cyclic frequency upon fatigue crack growth behavior of several steels in an elevated temperature aqueous environment  

SciTech Connect (OSTI)

The fatigue crack propagation (FCP) behavior of several ASTM A302-B and A508-2 steels was characterized in deaerated elevated temperature aqueous environment. FCP behavior was determined over the range 121 C to 343 C at a constant value of [Delta]K, stress ratio, and load rise time. A complex response of FCP rates as a function of temperature was observed, and this is discussed in the light of similar results developed by others within the nuclear industry. Corrosion potentials (referenced to the standard hydrogen electrode) were measured for each of the steels over the above temperature range and comparisons are made to the observed FCP behavior. Cyclic frequency effects were studied at two temperatures, 149 C and 243 C, and these are analyzed within the time domain'' format first suggested by Shoji et al. The results, when expressed in the time domain format, clearly show regions where environmentally assisted cracking (EAC) occurs, and regions where EAC does not occur. A threshold'' for EAC was noted at 149 C, and the possibility of an EAC threshold was observed at 243 C.

James, L.A. (Westinghouse Electric Corp., West Mifflin, PA (United States))

1994-05-01T23:59:59.000Z

291

Observations and Modeling of Shallow Convective Clouds: Implications for the Indirect Aerosol Effects  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Observations Observations and Modeling of Shallow Convective Clouds: Implications for the Indirect Aerosol Effects Sylwester Arabas 1 , Joanna Slawinska 1 , Wojciech Grabowski 2 , Hugh Morrison 2 , Hanna Pawlowska 1 1 : Institute of Geophysics, University of Warsaw, Poland 2 : National Center for Atmospheric Research, Boulder, Colorado, USA 348 constants for reference state and lateral boundary conditions 349 ibcx=icyx 350 ibcy=icyy*j3 351 ibcz=icyz 352 irlx=irelx 353 irly=irely*j3 354 irdbc=0 355 fcr0=fcr0*icorio 356 itdl=0 357 tdt=40.*3600. 358 u0tdl=u00 359 360 361 constants for thermodynamics 362 c bv=sqrt(st*g) 363 bv=st 364 st=bv**2/g 365 cp=3.5*rg 366 cap=rg/cp 367 pr00=rg*rh00*tt00

292

Systems, methods and computer-readable media to model kinetic performance of rechargeable electrochemical devices  

DOE Patents [OSTI]

A system includes an electrochemical cell, monitoring hardware, and a computing system. The monitoring hardware samples performance characteristics of the electrochemical cell. The computing system determines cell information from the performance characteristics. The computing system also analyzes the cell information of the electrochemical cell with a Butler-Volmer (BV) expression modified to determine exchange current density of the electrochemical cell by including kinetic performance information related to pulse-time dependence, electrode surface availability, or a combination thereof. A set of sigmoid-based expressions may be included with the modified-BV expression to determine kinetic performance as a function of pulse time. The determined exchange current density may be used with the modified-BV expression, with or without the sigmoid expressions, to analyze other characteristics of the electrochemical cell. Model parameters can be defined in terms of cell aging, making the overall kinetics model amenable to predictive estimates of cell kinetic performance along the aging timeline.

Gering, Kevin L.

2013-01-01T23:59:59.000Z

293

Some Dependence Relations of Empirical Belief  

E-Print Network [OSTI]

that two apples should differ only in this respect, that one is a good apple and the other not good, but goodness is not reducible to a set of natural properties. We might say, as a working definition of a dependence relation, that if realm B, a set... of states b j . n with properties BP describable in vocabulary BV, is necessary for the instantiation of a realm D, where D = (s:s has properties DP describable in DV], then the elements of D depend on those of B. BP and DP, BV and DV, may be completely...

Malherbe, Jeanette

294

Bulk Vitrification Performance Enhancement: Refractory Lining Protection Against Molten Salt Penetration  

SciTech Connect (OSTI)

Bulk vitrification (BV) is a process that heats a feed material that consists of glass-forming solids and dried low-activity waste (LAW) in a disposable refractory-lined metal box using electrical power supplied through carbon electrodes. The feed is heated to the point that the LAW decomposes and combines with the solids to generate a vitreous waste form. This study supports the BV design and operations by exploring various methods aimed at reducing the quantities of soluble Tc in the castable refractory block portion of the refractory lining, which limits the effectiveness of the final waste form.

Hrma, Pavel R.; Bagaasen, Larry M.; Schweiger, Michael J.; Evans, Michael B.; Smith, Benjamin T.; Arrigoni, Benjamin M.; Kim, Dong-Sang; Rodriguez, Carmen P.; Yokuda, Satoru T.; Matyas, Josef; Buchmiller, William C.; Gallegos, Autumn B.; Fluegel, Alexander

2007-08-06T23:59:59.000Z

295

A review of "The Ostend Story Early Tales of the Great Siege and the Mediating Role of Henrick van Haestens." by Anna E. C. Simoni  

E-Print Network [OSTI]

: Hes & De Graaf Publishers BV, 2003. 232 pp. + 27 illus. Euros 75. Review by EDWARD M. FURGOL, NAVAL HISTORICAL CENTER. Simoni has written a valuable book for early modern historians. While the main events of Ostend?s three year long siege unfolds...: Hes & De Graaf Publishers BV, 2003. 232 pp. + 27 illus. Euros 75. Review by EDWARD M. FURGOL, NAVAL HISTORICAL CENTER. Simoni has written a valuable book for early modern historians. While the main events of Ostend?s three year long siege unfolds...

Edward M. Furgol

2004-01-01T23:59:59.000Z

296

Design and Simulation of Novel Enhancement Mode 520 kV GaN Vertical Superjunction High Electron Mobility Transistors for Smart Grid Applications  

Science Journals Connector (OSTI)

We report on the design, simulations and optimization of a novel enhancement mode 520 kV GaN vertical superjunction (SJ) high electron mobility transistor (HEMT). We optimize the space charge in GaN pillars using GaN SJ pn diode for the best trade-off between breakdown voltage (BV) and specific on-resistance (Ronsp), by varying the pillar dosage, length and width. The resulting GaN SJ field effect transistor (FET) structure is projected to have, for example, Ronsp of 4.2 m? cm2 with BV of 12.4 kV.

Zhongda Li; T. Paul Chow

2013-01-01T23:59:59.000Z

297

Predicting dioxin-like \\{PCBs\\} soil contamination levels using milk of grazing animal as indicator  

Science Journals Connector (OSTI)

Dioxin-like \\{PCBs\\} (dl-PCBs) are ubiquitous persistent organic pollutants of recognized negative effects on human health. Assessing highly polluted areas should be an important public health issue. This study proposes to use the milk of grazing animals as a bioindicator of dl-PCB contamination in the environment. The hypothesis is that milk concentration of dl-PCBs are related to soil concentrations of these compounds, and that soils are generally reflective of a larger environmental issue of dl-PCB contamination. In this study, we evaluate the possibility of predicting soil concentrations using milk of sheep, cows and buffalos in a spatial model. For this purpose, samples of soil and milk collected in Campania (Italy) were introduced in a GIS platform to perform geostatistical analysis for building a simple predictive model. The ordinary least squares regressions (OLS) showed a statistically significant correlation (pPCBs using sheeps, cows and buffalos milk showed a mean error of 23%, 25% and 36% respectively. According to these results the sheeps milk can be considered the best bioindicator of dl-PCBs contamination among the three species. The results of this project evidence the potentialities of the proposed approach to assess bioindicator performance in a spatial predictive model.

Monia Perugini; Esteban Gabriel Herrera Nuez; Loredana Baldi; Mauro Esposito; Francesco Paolo Serpe; Michele Amorena

2012-01-01T23:59:59.000Z

298

e00605-13.full.pdf  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Clostridium Clostridium sp. Strain DL-VIII, a Novel Solventogenic Clostridium Species Isolated from Anaerobic Sludge Safiyh Taghavi, a,b Javier A. Izquierdo, a Daniel van der Lelie a,b Center for Agricultural and Environmental Biosolutions, RTI International, Research Triangle Park, North Carolina, USA a ; Biosciences Department, Brookhaven National Laboratory, Upton, New York, USA b We report the genome sequence of Clostridium sp. strain DL-VIII, a novel Gram-positive, endospore-forming, solventogenic bacterium isolated from activated anaerobic sludge of a wastewater treatment plant. Aside from a complete sol operon, the 6,477,357-bp genome of DL-VIII reveals genes for several unique enzymes with applications in lignocellulose degradation, in- cluding two phenolic acid decarboxylases. Received 5 July 2013 Accepted 11 July 2013 Published 8 August 2013 Citation Taghavi S,

299

Effect of Induced-Charge Electro-Kinetics on Concentration-Polarization in a Microchannel-Nafion System  

E-Print Network [OSTI]

Induced-charge electro-osmosis (ICEO) is shown to control the length scale of the diffusion layer (DL), which in turn, affects the diffusion limited ion transport through the microchannel-Nafion membrane system. The ICEO vortices form at an interdigitated floating electrode array embedded within a microchannel interfacing a Nafion membrane and stir the fluid, arresting the diffusive growth of the depletion layer. By varying the spacing between the array and the membrane we are able to control the length of the DL. Activating the electrodes results in further enhancement of the fluid stirring due to the emergence of alternating-current electro-osmotic (ACEO) flow on top of the ICEO. Such a new method of controlling the DL with an electrode array is of great importance in many CP related realizations.

Park, Sinwook

2015-01-01T23:59:59.000Z

300

Wear 260 (2006) 509522 Role of phase transition in the unusual microwear behavior of  

E-Print Network [OSTI]

. © 2005 Elsevier B.V. All rights reserved. Keywords: Wear; Hardness; Nickel titanium; Shape memory alloyWear 260 (2006) 509­522 Role of phase transition in the unusual microwear behavior of superelastic NiTi shape memory alloy Linmao Qiana,b,1, Qingping Suna,, Xudong Xiaob a Department of Mechanical

Sun, Qing-Ping

Note: This page contains sample records for the topic "bv dl deltak" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


301

An electron microscopy study of wear in polysilicon microelectromechanical systems in ambient air  

E-Print Network [OSTI]

. © 2006 Elsevier B.V. All rights reserved. Keywords: Silicon; MEMS; Wear; Electron microscopy 1An electron microscopy study of wear in polysilicon microelectromechanical systems in ambient air D.H. Alsem a,b,c,, E.A. Stach d , M.T. Dugger e , M. Enachescu b , R.O. Ritchie a,b a Department of Materials

Ritchie, Robert

302

Wear 266 (2009) 605608 Contents lists available at ScienceDirect  

E-Print Network [OSTI]

Dentistry a b s t r a c t Wear measurement implies the need for comparative measurements based to be adequate to quantify tooth wear. © 2008 Elsevier B.V. All rights reserved. 1. Introduction ManagingWear 266 (2009) 605­608 Contents lists available at ScienceDirect Wear journal homepage: www.elsevier.com/locate/wear

Hao, Pengwei

303

This article was originally published in a journal published by Elsevier, and the attached copy is provided by Elsevier for the  

E-Print Network [OSTI]

and potentially highly toxic in comparison with other ``heavy metals'' (Schachtschabel et al., 1992; see Duffus or biological soil properties. # 2006 Published by Elsevier B.V. Keywords: Agriculture; Glomus; Heavy metals, 2002, for a discussion of the term heavy metal). It is classified as a known human carcinogen (Class 1

Janouskova, Martina

304

Structural and thermal characters of the Longmen Shan (Sichuan, China) A. Robert a,  

E-Print Network [OSTI]

thick material abutting the resistant and cold Yangtze crust. © 2010 Elsevier B.V. All rights reservedStructural and thermal characters of the Longmen Shan (Sichuan, China) A. Robert a, , M. Pubellier: Longmen Shan Thermal data Crustal deformation Structural geology The Longmen Shan (Sichuan, China

Nicolas, Chamot-Rooke

305

Official Publications Received  

Science Journals Connector (OSTI)

... Whale Shark, Rhineodon typus-Description of the Skeletal Parts "iid Classification based on the Marathon Specimen captured in 1923. By B. Grace White. Pp. 129-160+plates 4 ... Adsorption by Means of X-Rays, bv Moriso Hirata; High Voltage Phenomena in Insulating Oil, Part 2 (Abridgment), by Takeshi Nishi, Kiyoki Ohtsuka and Yasuo Arakawa. Pp ...

1930-10-04T23:59:59.000Z

306

Recognition of human periodic movements from unstructured information using a motion-based frequency domain approach  

E-Print Network [OSTI]

the parameter domain in the presence of human motion irregularities. q 2006 Elsevier B.V. All rights reserved processing of feature detection. Motion power spectral analysis is applied to a set of unidentified trajectories of feature points representing whole body kinematics. Feature power vectors are extracted from

Li, Baihua

307

Agriculture, Ecosystems and Environment 144 (2011) 319329 Contents lists available at SciVerse ScienceDirect  

E-Print Network [OSTI]

Sistema Terrestre, Instituto Nacional de Pesquisas Espaciais, Cachoeira Paulista, SP, Brazil b Energy. © 2011 Elsevier B.V. All rights reserved. 1. Introduction Clean and renewable sources of energy covariance technique was used to calculate fluxes of carbon dioxide and energy balance components

DeLucia, Evan H.

308

ARTICLE IN PRESS Landscape disequilibrium on 100010,000 year scales  

E-Print Network [OSTI]

ARTICLE IN PRESS Landscape disequilibrium on 1000­10,000 year scales Marsyandi River, Nepal In an actively deforming orogen, maintenance of a topographic steady state requires that hillslope erosion, river 2003 Elsevier B.V. All rights reserved. Keywords: Cosmogenic dating; Landscape evolution; Marsyandi

Heimsath, Arjun M.

309

Formation of CO precursors during char gasification with O2, CO2 and H2O  

E-Print Network [OSTI]

Formation of CO precursors during char gasification with O2, CO2 and H2O Alejandro Montoya a are presented to get insight into an unified mechanism of uncatalyzed carbon gasification. D 2002 Elsevier Science B.V. All rights reserved. Keywords: Gasification; Chemisorption; Molecular simulation; Surface

Truong, Thanh N.

310

Wave Motion 33 (2001) 225243 Boussinesq-type equations with improved nonlinear performance  

E-Print Network [OSTI]

Wave Motion 33 (2001) 225­243 Boussinesq-type equations with improved nonlinear performance Andrew In this paper, we derive and test a set of extended Boussinesq equations with improved nonlinear performance Elsevier Science B.V. All rights reserved. Keywords: Boussinesq equations; Water waves; Numerical methods

Kirby, James T.

311

Simplified higher-order Boussinesq equations I. Linear simplifications  

E-Print Network [OSTI]

Simplified higher-order Boussinesq equations I. Linear simplifications Andrew B. Kennedy a,*, James derive and test simplified higher-order Boussinesq equations, i.e., higher-order Boussinesq equations Science B.V. All rights reserved. Keywords: Boussinesq equations; Dispersion; Shoaling 1. Introduction

Kirby, James T.

312

Biological Invasions ISSN 1387-3547  

E-Print Network [OSTI]

treatment resulted in very low seed set, which indicates that G. flavum is to a large degree self-incompatible Science+Business Media B.V.. This e-offprint is for personal use only and shall not be self- archived in electronic repositories. If you wish to self-archive your work, please use the accepted author's version

Petanidou, Theodora

313

Preliminary Examination of Lunar Samples from Apollo 11  

Science Journals Connector (OSTI)

...I hev wxerc observed bv VAnmstroni, who recogn ized that they had been produncedl on the SUrface of the rocks anrd that they eere dlistin-Llrishable f'rom vesicles. As described hcblos mianxy of these pits are liniedi SCIF NCF VOL. 165 -5-S with...

1969-09-19T23:59:59.000Z

314

New late Paleozoic paleopoles from the Donbas Foldbelt (Ukraine): Implications for the Pangea A vs. B controversy  

E-Print Network [OSTI]

New late Paleozoic paleopoles from the Donbas Foldbelt (Ukraine): Implications for the Pangea A vs and Production B.V., Kessler Park 1, 2288 GS Rijswijk, The Netherlands e National Academy of Sciences Ukraine, 55-B Gonchar Street, Kiev 01601, Ukraine f Dept. of Geology and Petroleum Geology, University

Utrecht, Universiteit

315

Review and comparison of methods to study the contribution of variables in artificial neural network models  

E-Print Network [OSTI]

, Greece Abstract Convinced by the predictive quality of artificial neural network (ANN) models in ecology. # 2002 Published by Elsevier Science B.V. Keywords: Artificial neural networks; Backpropagation; NonReview and comparison of methods to study the contribution of variables in artificial neural

Lek, Sovan

316

Multi-point tidal prediction using artificial neural network with tide-generating forces  

E-Print Network [OSTI]

Multi-point tidal prediction using artificial neural network with tide-generating forces Hsien Available online 23 June 2006 Abstract This paper presents a neural network model of simulating tides Elsevier B.V. All rights reserved. Keywords: Neural networks; Tides; Tide-generating forces; Harmonic

317

Ecological Modelling 120 (1999) 349358 Use of artificial neural networks for predicting rice crop  

E-Print Network [OSTI]

Ecological Modelling 120 (1999) 349­358 Use of artificial neural networks for predicting rice crop of artificial neural networks (ANN) in predicting presence or absence of flamingo damages from 11 variables B.V. All rights reserved. Keywords: Flamingos; Rice; Damage; Artificial neural networks; Prediction

Lek, Sovan

318

Carbon dioxide sequestration: how much and when? Klaus Keller & David McInerney & David F. Bradford  

E-Print Network [OSTI]

Carbon dioxide sequestration: how much and when? Klaus Keller & David McInerney & David F. Bradford + Business Media B.V. 2008 Abstract Carbon dioxide (CO2) sequestration has been proposed as a key component fossil fuel requirement of CO2 sequestration, and the growth rate of carbon taxes. In this analytical

Keller, Klaus

319

Neurocomputing 5860 (2004) 449454 www.elsevier.com/locate/neucom  

E-Print Network [OSTI]

of depression at the calyx of Held Bruce P. Grahama; , Adrian Y.C. Wongb , Ian D. Forsytheb a Abstract An average-response model of depression at the calyx of Held, a giant glutamatergic synapse included. c 2004 Elsevier B.V. All rights reserved. Keywords: Calyx of Held; Synaptic transmission

Graham, Bruce

320

ISSN 1745-9648 Stock Market Event Studies and  

E-Print Network [OSTI]

.5 South East Water and Mid Kent Water 25 4.6 Payment Protection Insurance 29 4.7 Wienerberger Finance BV/Baggeridge Brick plc 31 4.8 Stericycle International LLC/Sterile Technologies Group Limited 32 4.9 Home Credit 33 5 in value of a share holding over a specified period, assuming that dividends are re- invested to purchase

Feigon, Brooke

Note: This page contains sample records for the topic "bv dl deltak" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


321

Physica A 305 (2002) 287296 www.elsevier.com/locate/physa  

E-Print Network [OSTI]

for the width of the spectral distribution of kinetic Green functions is analyzed. The asymptotic behavior 2002 Elsevier Science B.V. All rights reserved. Keywords: Distribution function; Green function; Lorentz gas; Self-energy; Density matrix 1. Introduction In classical statistics the commutativity

322

Studies on Structural, Magnetic and Thermal Properties of xFe2TiO4-(1x)Fe3O4 (0rxr1) Pseudo-binary System  

E-Print Network [OSTI]

and cation distribution. The hyperfine magnetic field is observed to decrease with increasing Fe2TiO4 that magnetite is not stable, and thermal decomposition of magnetite occurs with weight losses accompanying with exothermic processes under heat treatment in inert atmosphere. & 2011 Elsevier B.V. All rights reserved. 1

McHenry, Michael E.

323

On the Floquet formulation of time-dependent density functional theory  

E-Print Network [OSTI]

On the Floquet formulation of time-dependent density functional theory Neepa T. Maitra *, Kieron by Elsevier Science B.V. Ground-state density functional theory (DFT) [1] has been tremendously successful generalized ground-state density functional theory to time-dependent problems (TDDFT) [4]. TDDFT has become

324

THE AMERICAN CHEMICAL SOCIETY  

Science Journals Connector (OSTI)

...comnpounds are readily decomposed bv water and alcohol, giving the origriinal...J. STUTZMAN. The benzoin condensation is found to be reversible...oiaitge is readily soluble itt water. Newv heterocyclic arsenic...cent. of ether acid. The recovery an7d reflning of pyr-idine...

W. H. Hunter; Charles L. Parsons

1922-10-27T23:59:59.000Z

325

AAAS ANNUAL MEETING  

Science Journals Connector (OSTI)

...tullh,v B./Zlloa-1tie.S.S Xl//llttlttt/tloll ll' thriiublt he ice. [I Iillmleh Oil ( tIlVpiinv HtOlPsiti, 'I esVt Climate and Man (29 Dec.) Airan,_ccl bv I or,is Battan. For hIrilholas ot \\eais the Cli mate al the carth hla, hanrged...

1969-11-21T23:59:59.000Z

326

Role of step roughening in the formation of Ce silicide H.G. Lee a,b  

E-Print Network [OSTI]

Role of step roughening in the formation of Ce silicide on Si(111) H.G. Lee a,b , D. Lee a , S. Kim, and then diffuse toward the step edges whilst forming a more stable Ce silicide. The step roughening at the step at the same temperature. ? 2005 Elsevier B.V. All rights reserved. Keywords: Step roughening; STM; XPS

Kim, Sehun

327

Z .Physics of the Earth and Planetary Interiors 119 2000 2536 www.elsevier.comrlocaterpepi  

E-Print Network [OSTI]

Z .Physics of the Earth and Planetary Interiors 119 2000 25­36 www a Department of Earth and Planetary Physics, Faculty of Science, Tokyo Uni?ersity, Hongo 7-3-1, Bunkyo algorithms, Phys. Earth Planet. Inter., this issue . q 2000 Elsevier Science B.V. All rights reserved

Geller, Robert

328

Phase transitions and the stability of atomic and molecular ions Sabre Kaisa,  

E-Print Network [OSTI]

Phase transitions and the stability of atomic and molecular ions Sabre Kaisa, *, Juan Pablo is varied. For such transitions, crossing the phase boundary means that the quantum ground state changes Mass Spectrom 182/183 (1999) 23­29) © 1999 Elsevier Science B.V. Keywords: Phase transitions; Stability

Kais, Sabre

329

NEW PRODUCTS:  

Science Journals Connector (OSTI)

......Concentrations from 0.01 to 5 percent by volume are detected. Response time is 0.2 seconds with a flame ionization detector. WTI B.V. 28 Triglyceride Analysis by HPLC SUPELCOSIL-LC columns are high efficiency reverse-phase HPLC col- umns, which......

New Products

1980-05-01T23:59:59.000Z

330

14 Engineering Drive Hanover, NH 03755  

E-Print Network [OSTI]

of their sponsors, the CEDC staff, faculty advisors and mentors, and the technical staff of Thayer's CAD facility Formula Racing Dartmouth Organic Farm Graphicast Maponics Norwich Technologies Optra Inc. Dr. Joseph Technologies Terry Smith Solaflect Energy Matt Strand Victor Technologies Walvisstaart B.V. Dr. Mitchell Wolf

331

ATP signalling in epilepsy Ashwin Kumaria & Christos M. Tolias &  

E-Print Network [OSTI]

REVIEW ATP signalling in epilepsy Ashwin Kumaria & Christos M. Tolias & Geoffrey Burnstock Received Media B.V. 2008 Abstract This paper focuses on a role for ATP neurotrans- mission and gliotransmission in the pathophysiology of epileptic seizures. ATP along with gap junctions propagates the glial calcium wave, which

Burnstock, Geoffrey

332

Contact angle measurements and wetting behavior of inner surfaces of pipelines exposed to heavy crude oil and water  

E-Print Network [OSTI]

alternative for the transportation of heavy crude oils. The lubricating effect of the aqueous film leads of such surfaces by crude oils through contact angle measurements in systems containing heavy oil/aqueous phase Elsevier B.V. All rights reserved. Keywords: Heavy oil; Asphaltenes; Naphthenic acids; Wettability; Oil

Loh, Watson

333

ORIGINAL PAPER Estimation of tree biomass, carbon pool and net primary  

E-Print Network [OSTI]

ORIGINAL PAPER Estimation of tree biomass, carbon pool and net primary production of an old Science+Business Media B.V. 2011 Abstract & Background The data on carbon pool and biomass distribution in north-eastern India, using biomass equations developed from 40 harvested trees between 9 and 63 cm

Paris-Sud XI, Université de

334

Lattice Boltzmann method for moving boundaries Pierre Lallemand a  

E-Print Network [OSTI]

Lattice Boltzmann method for moving boundaries Pierre Lallemand a , Li-Shi Luo b,* a Laboratoire propose a lattice Boltzmann method to treat moving boundary problems for solid objects moving in a fluid the Galilean invariance of the lattice Boltzmann method. ? 2002 Elsevier Science B.V. All rights reserved

Luo, Li-Shi

335

Lattice Boltzmann method and gas-kinetic BGK scheme in the low-Mach number viscous flow simulations  

E-Print Network [OSTI]

Lattice Boltzmann method and gas-kinetic BGK scheme in the low-Mach number viscous flow simulations 2002; received in revised form 23 April 2003; accepted 5 May 2003 Abstract Both lattice Boltzmann Elsevier B.V. All rights reserved. AMS: 65M06; 65N06; 76P05; 76T05 Keywords: Lattice Boltzmann method; Gas

Xu, Kun

336

This article appeared in a journal published by Elsevier. The attached copy is furnished to the author for internal non-commercial research  

E-Print Network [OSTI]

, USA a b s t r a c ta r t i c l e i n f o Article history: Received 2 March 2013 Accepted 11 March 2013 Published by Elsevier B.V. 1. Introduction Lithium-ion batteries are very popular due the high energy in the portable electronics market and the automotive market. In particular, the performances of electro

Cui, Yi

337

Theoretical Computer Science 306 (2003) 339351 www.elsevier.com/locate/tcs  

E-Print Network [OSTI]

of petroleum products. It uses a directed graph G, where arcs represent pipes and nodes represent locations Elsevier B.V. All rights reserved. Keywords: Petroleum; Transportation; Oil pipeline; Complexity; Approximability 1. Introduction Petroleum products are typically transported through pipelines. Pipelines are di

Laber, Eduardo Sany

338

Neurocomputing 70 (2007) 16261629 A biophysical model of short-term plasticity at the calyx of Held  

E-Print Network [OSTI]

of Held Matthias H. Henniga,b,?, Michael Postlethwaitec , Ian D. Forsythed , Bruce P. Grahama a Computing November 2006 Abstract The calyx of Held is a giant glutamatergic synapse in the auditory system 2006 Elsevier B.V. All rights reserved. Keywords: Calyx of Held; Synaptic transmission; Synaptic

Graham, Bruce

339

Reservoir oil bubblepoint pressures revisited; solution gasoil ratios and surface gas specific gravities  

E-Print Network [OSTI]

Reservoir oil bubblepoint pressures revisited; solution gas­oil ratios and surface gas specific, for bubblepoint pressure and other fluid properties, require use of stock-tank gas rate and specific gravity in estimating stock-tank vent gas rate and quality for compliance purposes. D 2002 Elsevier Science B.V. All

Valkó, Peter

340

First-order disorder-driven transition and inverse melting of the vortex lattice  

E-Print Network [OSTI]

`inverse' melting behavior. ? 2001 Published by Elsevier Science B.V. Keywords: Type-II superconductivity-order transition (FOT) [1±5] whereas at low temperatures the ordered vortex lattice transforms into a disordered open questions in the phase diagram of HTS is the thermodynamic nature of the disorder-dri- ven

Zeldov, Eli

Note: This page contains sample records for the topic "bv dl deltak" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


341

Far-infrared signature of animal tissues characterized by terahertz time-domain spectroscopy  

E-Print Network [OSTI]

, is observed to show very similar water absorption. ? 2005 Elsevier B.V. All rights reserved. PACS: 42.65.Re; 87.80.?y Keywords: Terahertz time-domain spectroscopy; Animal tissue; Water content; Absorption. As the sen- sitivity of terahertz radiation to polar molecules of water is very high, biological tissues

342

The end of the sauropod dinosaur hiatus in North America Michael D. D'Emic a,  

E-Print Network [OSTI]

with the dispersal of derived hadrosaurids to South America. © 2010 Elsevier B.V. All rights reserved. 1 extinction in North America at ca. 100 Ma followed by dispersal of Alamosaurus from South America ca. 25The end of the sauropod dinosaur hiatus in North America Michael D. D'Emic a, , Jeffrey A. Wilson

Thompson, Richard Maxwell

343

A redox switch hypothesis for the origin of two light reactions in photosynthesis  

E-Print Network [OSTI]

Cogdell Abstract Photosynthesis provides energy in the Earth?s bio- sphere and oxygen in its atmosphere to oxidise water; an inexhaustible supply of reductant; and the selective advantages and pressures of an aerobic world. ? 2005 Federation of European Biochemical Societies. Published by Elsevier B.V. All rights

Allen, John F.

344

Carbon isotope chemostratigraphy of the Middle Riphean type section (Avzyan Formation, Southern Urals, Russia)  

E-Print Network [OSTI]

Urals, Russia): Signal recovery in a fold-and-thrust belt Julie K. Bartley a,, Linda C. Kah b , Julie L The Avzyan Formation of the southern Ural Mountains, Russia, forms part of the Middle Riphean (1300­1000 Ma Mesoproterozoic age. © 2006 Elsevier B.V. All rights reserved. Keywords: Mesoproterozoic; Russia; Urals; Carbonate

Perfect, Ed

345

UBV(RI)C photometry of the open clusters Be 15, Be 80 and NGC 2192  

Science Journals Connector (OSTI)

......photometry have been used for handling the standard-star...the various CC and CM diagrams. This macro defines...use only a single CM diagram (V, BV) to estimate...parameters, that is no CC diagram for the interstellar...functionality of any supporting materials supplied by the authors......

M. T. Tapia; W. J. Schuster; R. Michel; C. Chavarra-K.; W. S. Dias; R. Vzquez; A. Moitinho

2010-01-01T23:59:59.000Z

346

Evolution of mineralfluid interfaces studied at pressure with synchrotron X-ray techniques  

E-Print Network [OSTI]

(CaCO3) and halite (NaCl) as reactant crystals are presented and compared to other atomic at this pressure cannot be monitored in experiments of several days duration. Experiments with halite, a much more to pressure solution. © 2006 Elsevier B.V. All rights reserved. Keywords: Synchrotron; Calcite; Halite

Dysthe, Dag Kristian

347

Limited lithium isotopic fractionation during progressive metamorphic dehydration in metapelites: A case study  

E-Print Network [OSTI]

Limited lithium isotopic fractionation during progressive metamorphic dehydration in metapelites-zone metamorphism far removed from the pluton to partially melted rocks adjacent to the pluton. Lithium on the aureole scale. Published by Elsevier B.V. Keywords: Lithium; Isotope fractionation; Metamorphic

Mcdonough, William F.

348

An ecologicaleconomic model for catchment management: The case of Tonameca, Oaxaca, Mxico  

E-Print Network [OSTI]

, Mexico b Arizona State University, Arizona, United States c University of York, UK a b s t r a c ta r t i Accepted 15 January 2009 Available online 4 May 2009 Keywords: Ecological­economic catchment model Mexico of Oaxaca in Mexico. © 2009 Elsevier B.V. All rights reserved. 1. Introduction Coastal environmental impacts

349

Discrete Mathematics 233 (2001) 175182 www.elsevier.com/locate/disc  

E-Print Network [OSTI]

Discrete Mathematics 233 (2001) 175­182 www.elsevier.com/locate/disc Some remarks on cycles on cycles of graphs and directed graphs of the following form: `Does there exist a set of cycles with a property P that generates all the cycles by operation O?'. c 2001 Published by Elsevier Science B.V. 1

Matamala, Martín

350

Living memory: agent-based information management for connected local communities  

Science Journals Connector (OSTI)

... 2002 Elsevier Science B.V. All right reserved...agent-based information management for connected local...Imperial College of Science, Technology and Medicine...effective information management in support of social...The novelty of our approach is based on combining......

Kostas Stathis; Oscar de Bruijn; Silvio Macedo

2002-12-01T23:59:59.000Z

351

Evaluation of extraction and purification methods for obtaining PCR-amplifiable DNA from compost  

E-Print Network [OSTI]

: Donald Bren School of Environmental Science and Management, University of California, Santa Barbara, CA not consistent and introduced a bias towards lower estimates of diversity. D 2002 Elsevier Science B.V. All approaches.Compostingisanaerobicthermophilicpro- cess widely used to recycle organic residues (Fogarty 0167

Michel Jr., Frederick C.

352

Ionic transport in nanocapillary membrane systems Vikhram V. Swaminathan Larry R. Gibson II  

E-Print Network [OSTI]

. Keywords Membranes Á Nanostructures Á Nanofluidics Á Microfluidics Á Ion transport Á Electrokinetics Á lREVIEW Ionic transport in nanocapillary membrane systems Vikhram V. Swaminathan · Larry R. Gibson / Accepted: 23 May 2012 ? Springer Science+Business Media B.V. 2012 Abstract Species transport

353

University and Educational Intelligence  

Science Journals Connector (OSTI)

... , and by pumping. The main topic of the third lecture will be the gfeat hydroelectric installations, some of which have units of 20,000 h.p. working under exceptionally ... an extremely interesting power station at Larderello in Central Tuscany, in which steam for three turbines, each of 4000 h.p., is derived from volcanic heat tapped bv pipes ...

1921-03-10T23:59:59.000Z

354

Letters to the Editor  

Science Journals Connector (OSTI)

...Shailow Epicontinental Sea Edited bs B. H. Purse; M.ore than...only increase the production cost, but would also reduce the...HUMAN AND ECOLOGIC EFFECTS OF NUCLEAR POWER PLANTS edit-ed bv Leonard...Conitribuitors) Iln the niext decades. nuclear power is likely to experienice...

Wayne H. Davis

1975-01-31T23:59:59.000Z

355

Journal of Power Sources 166 (2007) 6467 Short communication  

E-Print Network [OSTI]

-scale electrocatalyst particles in solid oxide fuel cell anodes B.D. Madsen, W. Kobsiriphat, Y. Wang, L.D. Marks, S the initial stages of solid oxide fuel cell operation, yielding improved anode performance without additional.2 cm2 . © 2007 Elsevier B.V. All rights reserved. Keywords: Solid oxide fuel cell; Nanoparticle

Marks, Laurence D.

356

ORIGINAL PAPER Drought-tolerance of an invasive alien tree, Acacia mearnsii  

E-Print Network [OSTI]

ORIGINAL PAPER Drought-tolerance of an invasive alien tree, Acacia mearnsii and two native+Business Media B.V. 2011 Abstract Invasive alien plants (IAPs) have success- fully invaded many riparian zones. Keywords Invasive alien plant Á Water potential Á Carbon isotope Á Restoration Á Streamflow Á Xylem

357

Characterization of chromophoric dissolved organic matter (CDOM) in the Baltic Sea by excitation emission  

E-Print Network [OSTI]

contribution of fluorescence peak intensities to the total fluorescence along the salinity gradient showed in the Baltic Sea occurred over a much smaller salinity gradient. D 2005 Elsevier B.V. All rights reserved of salinity. Samples from different locations and over different seasons were collected during four cruises

Durako, Michael J.

358

Fusion Engineering and Design 81 (2006) 455460 Breeder foam: an innovative low porosity solid breeder material  

E-Print Network [OSTI]

Fusion Engineering and Design 81 (2006) 455­460 Breeder foam: an innovative low porosity solid@ucla.edu (S. Sharafat). breeder pebble beds remains a field of intense R&D for fusion power reactor B.V. All rights reserved. doi:10.1016/j.fusengdes.2005.06.374 #12;456 S. Sharafat et al. / Fusion

Ghoniem, Nasr M.

359

Materials Science and Engineering A 445446 (2007) 669675 Degradation of elastomeric gasket materials in PEM fuel cells  

E-Print Network [OSTI]

to the overall durability of the fuel cell stacks. The degradation of four commercially available gasket as well. © 2006 Elsevier B.V. All rights reserved. Keywords: Gasket material; Fuel cell; Degradation; ATR materials in PEM fuel cells Jinzhu Tana,b,1, Y.J. Chaob,, J.W. Van Zeec, W.K. Leec a College of Mechanical

Van Zee, John W.

360

Sensors and Actuators B 185 (2013) 166173 Contents lists available at SciVerse ScienceDirect  

E-Print Network [OSTI]

Membrane degradation Electrostatic self-assembly of polyelectrolytes Fuel cell PEMFC a b s t r a c electrolyte membrane fuel cells. © 2013 Elsevier B.V. All rights reserved. 1. Introduction Hydrogen peroxide of the electrochemical reactions in a polymer electrolyte membrane fuel cell (PEMFC) [9]. Local- ized measurements of H2O

Brolo, Alexandre G.

Note: This page contains sample records for the topic "bv dl deltak" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


361

Batch-to-batch model improvement for cooling crystallization  

E-Print Network [OSTI]

Massachusetts Avenue Cambridge MA 02139, USA c Albemarle Catalysts Company B.V., Nieuwendammerkade 1-3, 1030 consisting of a solute dissolved into a solvent is loaded at high temperature into a vessel called, the desired cooling profile is given as set-point to a feedback temperature control loop. However, even when

Van den Hof, Paul

362

Reframing social sustainability reporting: towards an engaged approach  

E-Print Network [OSTI]

Studies, Social Science and Planning, RMIT University, Melbourne, Australia 123 Environ Dev Sustain (2013Reframing social sustainability reporting: towards an engaged approach Liam Magee · Andy Scerri+Business Media B.V. 2012 Abstract Existing approaches to sustainability assessment are typically characterized

Padgham, Lin

363

Reports and other Publications  

Science Journals Connector (OSTI)

... Pp. 1993-2002. (Tokyo: Tokyo Astronomical Observatory, 1961 and 1962.) [249Norsk Polarinstitutt, Oslo. Skrifter Nr. 125: Studies in the Tertiary Flora of Spitsbergen, ... Iceland-a Palynological Investigation. By Svein Manum. Pp. 128+21 plates. (Oslo: Norsk Polarinstitutt, 1962. Distributed bv Oslo University Press.) 26 Kr. [249

1962-11-17T23:59:59.000Z

364

Joining of highly aluminum-doped lanthanum strontium manganese oxide with tetragonal zirconia by plastic deformation  

E-Print Network [OSTI]

Joining of highly aluminum-doped lanthanum strontium manganese oxide with tetragonal zirconia February 2008; accepted 24 March 2008 Abstract Aluminum-doped lanthanum strontium manganese oxide, La0.77Sr at the interface. © 2008 Elsevier B.V. All rights reserved. Keywords: Lanthanum strontium aluminum manganese oxide

Dutta, Prabir K.

365

Diffusion of Te vacancy and interstitials of Te, Cl, O, S, P and Sb in CdTe: A density functional theory study  

E-Print Network [OSTI]

Diffusion of Te vacancy and interstitials of Te, Cl, O, S, P and Sb in CdTe: A density functional profiles in CdTe of native, Te adatom and vacancy, and anionic non-native interstitial adatoms P, Sb, O, S B.V. All rights reserved. 1. Introduction Cadmium telluride (CdTe) based thin films have emerged

Khare, Sanjay V.

366

Point of zero charge determination in soils and minerals via traditional methods and detection  

E-Print Network [OSTI]

-specific ion adsorption as a function of pH and I (point of zero net charge), and (3) electroacoustic mobility Elsevier Science B.V. All rights reserved. Keywords: Point of zero charge; Point of zero net charge; Point, or positive, or no charge. The pH where the net total particle charge is zero is called the point of zero

Ma, Lena

367

Implicit level set schemes for modeling hydraulic fractures using the Elizaveta Gordeliy, Anthony Peirce  

E-Print Network [OSTI]

Implicit level set schemes for modeling hydraulic fractures using the XFEM Elizaveta Gordeliy Copyright ? 2013 Published by Elsevier B.V. All rights reserved. 1. Introduction Hydraulic fractures (HF form 13 July 2013 Accepted 27 July 2013 Available online 20 August 2013 Keywords: XFEM Hydraulic

Peirce, Anthony

368

Analysis of model equations for stress-enhanced diffusion in coal layers. Part I: Existence of a weak solution.  

E-Print Network [OSTI]

in the glass state and orders of magnitude higher value for > c, when coal is in the rubber like state International Exploration and Production B.V., NWO-Novem and the Greenhouse-gas Removal Apprenticeship. Carbon dioxide displaces the methane adsorbed on the internal surface of the coal. A production well

Eindhoven, Technische Universiteit

369

PRODUCT LISTINGS:  

Science Journals Connector (OSTI)

......Mfg. Co., Ltd. Constant Temperature, Oil Ace Glass Inc. Blue M Electric Co. Carlo...Currently six columns are available over a price range of $180 to $240. The table below...Inc. Xpectrix International SA SAMPLE HEATING TABLES Chrompack Nederland b.v. Kontes......

Product Listings

1977-03-01T23:59:59.000Z

370

Journal of Power Sources xxx (2004) xxxxxx Block and graft copolymer electrolytes for high-performance,  

E-Print Network [OSTI]

-performance, solid-state, lithium batteries Donald R. Sadoway Department of Materials Science and Engineering for a solid-state battery would have the ionic conductivity of a liquid, the mechanical properties of a solid are described along with the prognosis for their deployment in a solid-state battery. © 2003 Elsevier B.V. All

Sadoway, Donald Robert

371

Building trees based on aggregation efficiency in sensor networks Albert F. Harris III a,*, Robin Kravets b  

E-Print Network [OSTI]

-mail addresses: harris@dei.unipd.it (A.F. Harris III), rhk@cs.uiuc.edu (R. Kravets), indy@cs.uiuc.edu (I. GuptaBuilding trees based on aggregation efficiency in sensor networks Albert F. Harris III a,*, Robin 2007 Elsevier B.V. All rights reserved. doi:10.1016/j.adhoc.2007.02.021 * Corresponding author. E

Kravets, Robin

372

Optical Stability Investigation of High-Performance Silicon-Based VUV Photodiodes  

E-Print Network [OSTI]

Optical Stability Investigation of High-Performance Silicon-Based VUV Photodiodes L. Shi, L. K Netherlands B.V. Veldhoven, the Netherlands Abstract--Silicon p+ n photodiodes fabricated by a pure boron. It is demonstrated that the junctions formed by the B-layer process are so ultrashallow that the photodiodes are able

Technische Universiteit Delft

373

The mid-Cretaceous water bearer: isotope mass balance quantication of the Albian hydrologic cycle  

E-Print Network [OSTI]

. Witzke a;b;c a Department of Geoscience, University of Iowa, Iowa City, IA 52242-1379, USA b Center of the equable `greenhouse' Albian Stage in the KWIB. The mass balance model tracks the evolving isotopic conditions. ? 2002 Elsevier Science B.V. All rights reserved. Keywords: sphaerosiderites; Cretaceous; oxygen

González, Luis A.

374

Journal of Magnetism and Magnetic Materials 225 (2001) 337345 Irreversible magnetization in nickel nanoparticles  

E-Print Network [OSTI]

in this magnetic nanoparticle system. # 2001 Elsevier Science B.V. All rights reserved. PACS: 75.10.Nr; 75.50.KjJournal of Magnetism and Magnetic Materials 225 (2001) 337­345 Irreversible magnetization in nickel in revised form 20 October 2000 Abstract We report magnetic studies on nickel nanoparticle films of average

Zuo, Fulin

375

Fusion Engineering and Design 54 (2001) 117134 Simulation studies of plasma shape identification and  

E-Print Network [OSTI]

, is presented. © 2001 Elsevier Science B.V. All rights reserved. Keywords: Plasma; Tokamak; Magnetic flux www , Jin-Yong Kim a , S.C. Jardin b , G.S. Lee a a Korea Basic Science Institute, 52, Yeoeun-dong, Yusung number of magnetic measurements can be effectively reduced by considering the patterns of magnetic flux

376

The Cambridge Forum for Sustainability and the Environment Members: Biographies  

E-Print Network [OSTI]

and development economics · state-society interactions in development · public policy in the developing world · biodiversity conservation e-mail: bv101@cam.ac.uk and for more information see his website Chris Gilligan-founder of Cambridge Wireless, co-founder and Chairman of Cambridge Angels and is a member of the IET Communications

Edinburgh, University of

377

Evaluation of ultrasound transmission velocity and 3-dimensional radiology in different bone types for dental implantology: a comparative ex vivo study  

Science Journals Connector (OSTI)

Objective To evaluate ultrasound transmission velocity (UTV) for assessment of mechanical bone quality, an ex vivo comparison of different bone types measured with UTV, 2-dimensional (2D) histomorphometry and with 3-dimensional (3D) radiology (cone-beam computerized tomography [CBCT], computerized microtomography [?CT]) was conducted. Study Design Clinical cortical, cancellous, and mixed bone (each n = 6) was measured via UTV (m/s), CBCT (white pixel/black pixel ratio [WP/BP]), ?CT (bone volume/total volume [?BV/TV]), and histomorphometry (bone volume/total volume [hBV/TV]). UTV values were correlated with 2D-histomorphometry and 3D-radiologic results. Results For the cortical, cancellous, and mixed bone samples, respectively, UTV values were 1,945.17, 1,266.9,and 1472.2 m/s, WP/BP quotients were 0.96, 0.15, and 0.33, ?BV/TV quotients were 0.94, 0.2, and 0.47, and hBV/TV quotients were 0.96, 0.24 and 0.39. Significant correlations between UTV and the other methods were seen (P < .0001). Conclusions Similar to the other methods, UTV is able to discriminate between different bone types ex vivo.

Peer W. Kmmerer; Vinay V. Kumar; Dan Brllmann; Hermann Gtz; Peter H. Kann; Bilal Al-Nawas; Marcus O. Klein

2013-01-01T23:59:59.000Z

378

Domain cooperativity in multidomain proteins: what can we learn from molecular alignment in anisotropic media?  

E-Print Network [OSTI]

Conformational ensemble Á Conformational disorder Á Tandem SH3 construct Á PALES software Á Steric alignment ÁARTICLE Domain cooperativity in multidomain proteins: what can we learn from molecular alignment July 2011 ? Springer Science+Business Media B.V. 2011 Abstract Many proteins have modular design

Skrynnikov, Nikolai

379

Effects of Mg composition on open circuit voltage of Cu2OMgxZn1xO heterojunction solar cells  

E-Print Network [OSTI]

(ZnO) Cuprous oxide (Cu2O) Solar cells Electrodeposition MOCVD (metal-organic chemical vapor solar cells, where Ag and FTO are used as top and bottom electrodes, respectively. An enhancement on the MgxZn1?xO (x¼10%) based solar cell. & 2011 Elsevier B.V. All rights reserved. 1. Introduction Zn

Garfunkel, Eric

380

560 Nuclear Instruments and Methods in Physics Research B43 (1989) 560-564 North-Holland, Amsterdam  

E-Print Network [OSTI]

560 Nuclear Instruments and Methods in Physics Research B43 (1989) 560-564 North-Holland, Amsterdam curve (XRC) and Raman 0168-583X/89/$03.50 0 Elsevier Science Publishers B.V. (North-Holland Physics

Woodall, Jerry M.

Note: This page contains sample records for the topic "bv dl deltak" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


381

Applied Soil Ecology 23 (2003) 187198 Species diversity and spatial distribution of enchytraeid  

E-Print Network [OSTI]

communities in forest soils: effects of habitat characteristics and heavy metal contamination Pawel Kapusta but was not influenced by heavy metal content in soil. © 2003 Elsevier Science B.V. All rights reserved. Keywords of anthropogenic impacts (such as pollution) upon the structure and ecosystem function of biotic communi- ties

Weiner, January

382

Environmental Biology of Fishes ISSN 0378-1909  

E-Print Network [OSTI]

period, the water level rises and may form side channels and pools in the floodplain. The subsequent B.V. 2011 Abstract In regulated rivers, fluctuating water depths associated with pulsed discharges may strand small fish in side channels and pools. Quantitative assess- ments of stranded fish

Klimley, A. Peter

383

Managing invasive species: Rules of thumb for rapid assessment Brian Leung a,*, David Finnoff b  

E-Print Network [OSTI]

Act, 2000) and international agreements (Inter- national Plant Protection Convention, 1997 and control investments. Unfortunately, recent research is frequently in a form inaccessible to policy for prevention and control investments. D 2005 Elsevier B.V. All rights reserved. Keywords: Exotic; Decision

Leung, Brian

384

Z .Biochimica et Biophysica Acta 1342 1997 164174 Calcium binding to recoverin: implications for secondary structure and  

E-Print Network [OSTI]

a calcium-binding loop com- 0167-4838r97r$17.00 q 1997 Elsevier Science B.V. All rights reserved. Z .PII SZ .Biochimica et Biophysica Acta 1342 1997 164­174 Calcium binding to recoverin: implications Received 15 May 1997; accepted 30 May 1997 Abstract Recoverin is an EF-hand calcium-binding protein

Palczewski, Krzysztof

385

Journal of Membrane Science 228 (2004) 516 Experimental study of desalination using direct contact membrane  

E-Print Network [OSTI]

Journal of Membrane Science 228 (2004) 5­16 Experimental study of desalination using direct contact and a new membrane module were investigated to improve water desalination. The performances of three with the reverse osmosis (RO) process for desalination. © 2003 Elsevier B.V. All rights reserved. Keywords

386

ELSEVIER Desalination 179 (2005) 323-333 DESALINATION  

E-Print Network [OSTI]

ELSEVIER Desalination 179 (2005) 323-333 DESALINATION www.elsevier.com/locate/desal Chemical. Organized by the European Desalination Society. 0011-9164/05/$- See front matter © 2005 Elsevier B.V. All rights reserved doi:10.1016/j.desal.2004.11.078 #12;324 D. Kuzmenko et aL / Desalination 179 (2005) 323

Freger, Viatcheslav "Slava"

387

Biogeography, ecoregions, and geomorphology affect fish species composition in streams of eastern Oklahoma, USA  

E-Print Network [OSTI]

Biogeography, ecoregions, and geomorphology affect fish species composition in streams of eastern B.V. 2007 Abstract Stream fish assemblages are structured by biogeographical, physical and stream habitat, influenced fish species composition (presence­absence) in eastern Oklahoma, USA relative

Marston, Richard A.

388

Engineering Geology 54 (1999) 159165 Mechanical interaction between swelling compacted clay and  

E-Print Network [OSTI]

a a EnvirosQuantiSci Ltd., 45 Station Road, Henley-On-Thames RG9 1AT, UK b University of Bath, Bath, UK. We show that such mass loss is limited as a mechanism for leaching away the emplaced barrier, yet may Elsevier Science B.V. All rights reserved. Keywords: Clay barrier; Colloids; Fractured rock; Leaching

Peletier, Mark

389

Stochastic Processes and their Applications 117 (2007) 16061620 www.elsevier.com/locate/spa  

E-Print Network [OSTI]

model and a utility function defined on the positive real line. c 2007 Elsevier B.V. All rights reserved.elsevier.com/locate/spa Asymptotic analysis of utility-based hedging strategies for small number of contingent claims D. Kramkova,, M; accepted 11 April 2007 Available online 2 June 2007 Abstract We study the linear approximation of utility

Kramkov, Dmitry

390

Application of wavelet analysis to ecological data Eungchun Choa  

E-Print Network [OSTI]

are required to properly extract information out of the complex data. Wavelets have good time­frequency (time data analysis. Wavelets are well suited for building mathematical models of ecological data complex ecological and environmental phenomena. © 2006 Elsevier B.V. All rights reserved. Keywords

Chon, Tae-Soo

391

Climatic Change (2007) 85:1931 DOI 10.1007/s10584-007-9315-7  

E-Print Network [OSTI]

Climatic Change (2007) 85:19­31 DOI 10.1007/s10584-007-9315-7 Expressions of likelihood Media B.V. 2007 Abstract Communication of uncertainty information in Intergovernmental Panel on Climate and is described here. 1 Introduction Every assessment of climate change is faced with the need to characterize

Risbey, James S.

392

Tabulation of Alcohol Content of Beer and Malt Beverages  

Science Journals Connector (OSTI)

......no Amstel LightBeer 12 3.61 Light Amstel Brouwerij B.V. Holland...CA no Anchor OurSpecialAle Christmas 1997 12 5.28 Ale - Seasonal...Budweiser BudweiserIce BudweiserIce Light BudweiserLight BullIce BurtonAle...Anheuser-BuschBrewingCo. 12 5.41 Light Anheuser-BuschBrewingCo......

Glenn A. Case; Sandra Distefano; Barry K. Logan

2000-04-01T23:59:59.000Z

393

Proximal Fluid Proteome Profiling of Mouse Colon Tumors Reveals Biomarkers for Early Diagnosis of Human Colorectal Cancer  

Science Journals Connector (OSTI)

...Human Colorectal Cancer Remond J.A. Fijneman 1 2 Meike de Wit 1 Maral Pourghiasian 1 2 Sander R. Piersma 2 Thang V. Pham...1065-82. 33. Johansen JS , Jensen BV, Roslind A, Nielsen D Price PA.Serum YKL-40, a new prognostic biomarker in cancer patients...

Remond J.A. Fijneman; Meike de Wit; Maral Pourghiasian; Sander R. Piersma; Thang V. Pham; Marc O. Warmoes; Mehrdad Lavaei; Chloe Piso; Fiona Smit; Pien M. Delis-van Diemen; Sietze T. van Turenhout; Jochim S. Terhaar sive Droste; Chris J.J. Mulder; Marinus A. Blankenstein; Els C. Robanus-Maandag; Ron Smits; Riccardo Fodde; Victor W.M. van Hinsbergh; Gerrit A. Meijer; and Connie R. Jimenez

2012-05-01T23:59:59.000Z

394

ORIGINAL PAPER Influence of tree species on carbon and nitrogen  

E-Print Network [OSTI]

/nutrient ratios, pH and nutrient contents according to the tree species (Vesterdal and Raulund-Rasmussen 1998ORIGINAL PAPER Influence of tree species on carbon and nitrogen transformation patterns in forest Science+Business Media B.V. 2011 Abstract · Background Among forest management practices, forest tree

Paris-Sud XI, Université de

395

Granular computing, rough entropy and object extraction Sankar K. Pal a,1  

E-Print Network [OSTI]

of image object extraction in the framework of rough sets and granular computing is addressed. A mea- sure of rough entropy are described. ? 2005 Elsevier B.V. All rights reserved. Keywords: Rough sets; Entropy in the process of prob- lem solving. Recently, rough set theory (Pawlak, 1991) has become a popular mathematical

Mitra, Pabitra

396

Identification and characterization of the gene encoding the Acidobacterium capsulatum major sigma factor  

E-Print Network [OSTI]

, Wisconsin 53706, USA c McArdle Laboratory for Cancer Research, University of Wisconsin-Madison, Madison. capsulatum major sigma factor and the gene product is active in E. coli. © 2006 Elsevier B.V. All rights isolated from acid mine drainage (Kishimoto et al., 1991). A. capsulatum is a member of the Acidobacteria

Handelsman, Jo

397

Analysis and modeling of gas exchange processes in Scaevola aemula Soo-Hyung Kim a,*, Paul R. Fisher b  

E-Print Network [OSTI]

the model to predict the effects of supplemental lighting and CO2 enrichment on canopy photosynthesis for S. aemula production in the greenhouse. # 2007 Elsevier B.V. All rights reserved. Keywords: C3; Greenhouse; Ornamental crops 1. Introduction Scaevola aemula, commonly known as Australian fan flower

Lieth, J. Heinrich

398

Journal of Power Sources 156 (2006) 677684 Thermodynamic analysis of electrokinetic energy conversion  

E-Print Network [OSTI]

is carried out for electrokinetic energy conversion. We demonstrate that the efficiencies depend solely Elsevier B.V. All rights reserved. Keywords: Electrokinetic energy conversion; Generator; Pump; Figure) are generated between the ends of the capillary, indicating a conversion of mechan- ical energy into electrical

Xuan, Xiangchun "Schwann"

399

Beach Dune Sand Hydrophobicity Due to the Presence of Beach Vitex (Vitex rotundifolia L. f.)  

Science Journals Connector (OSTI)

Vitex rotundifolia L. f. [beach vitex (BV)] was introduced as a salt-tolerant woody ground cover, but it has since become invasive on primary and secondary dunes in coastal areas of the southeastern United States. ... Hydrophobic soils have been documented in many areas of the world including beach dunes (13), areas subject to frequent fire (14), forests (15), and desert scrub communities (16). ...

Matthew M. Cousins; Charles A. Gresham; Melissa B. Riley; Ted Whitwell

2008-12-17T23:59:59.000Z

400

The 2 1 reconstruction of the rutile TiO2(011) surface: A combined density functional theory, X-ray diffraction, and scanning  

E-Print Network [OSTI]

for publication 28 October 2008 Available online 5 November 2008 Keywords: Titanium dioxide Surface reconstruction exhibits two different types of undercoordinated oxygen and titanium atoms, and is, in its stoichiometric form, predicted to be rather inert towards the adsorption of probe molecules. ? 2008 Elsevier B.V. All

Diebold, Ulrike

Note: This page contains sample records for the topic "bv dl deltak" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


401

Available online at www.sciencedirect.com Talanta 74 (2008) 14141419  

E-Print Network [OSTI]

synthesized, such as TiO2, ZnO, ZrO2, Al2O3 and so on [11­14]. Titanium dioxide is a widely used, inorganic 2007 Available online 29 September 2007 Abstract Titanium oxide nanotubes (TiO2-NTs) synthesized B.V. All rights reserved. Keywords: Titanium oxide nanotubes; Hemoglobin; Electrochemistry; Hydrogen

Zheng, Yufeng

402

Water softening using microbial desalination cell technology Kristen S. Brastad a,b  

E-Print Network [OSTI]

and reduce the volumetric ratio between wastewater and hard water. © 2012 Elsevier B.V. All rights reserved% of the population, including 99% of the rural popu- lation, and accounts for 20% of national water withdrawals [1, a subset of water treatment, makes up approxi- mately 30% of the residential water treatment market

403

Shape optimization and preform design in metal forming Akkaram Srikanth, Nicholas Zabaras *  

E-Print Network [OSTI]

Shape optimization and preform design in metal forming processes Akkaram Srikanth, Nicholas Zabaras optimization in metal forming. The eectiveness of the proposed methodology is demonstrated by solving practical shape optimal design problems in forging processing. ? 2000 Elsevier Science B.V. All rights reserved

Zabaras, Nicholas J.

404

Truth and meaning redux Ernie Lepore Kirk Ludwig  

E-Print Network [OSTI]

Truth and meaning redux Ernie Lepore · Kirk Ludwig ? Springer Science+Business Media B.V. 2010 Abstract In this paper, we defend Davidson's program in truth-theoretical semantics against recent criticisms by Scott Soames. We argue that Soames has misunderstood Davidson's project, that in consequence

Indiana University

405

REVIEW ARTICLE Potato soil-borne diseases. A review  

E-Print Network [OSTI]

REVIEW ARTICLE Potato soil-borne diseases. A review Marie Fiers & Véronique Edel /Published online: 24 June 2011 # INRA and Springer Science+Business Media B.V. 2011 Abstract Potato crop potato and cause severe damages especially on tubers, the economically most impor- tant part of the plant

Paris-Sud XI, Université de

406

A case study for demonstrating the application of U.S. EPA's monitored natural attenuation  

E-Print Network [OSTI]

remedial option for the site. The site data along with the modeling results indicate that the chlorinated as one of the feasible remediation options for the site. D 2002 Elsevier Science B.V. All rights reserved other refineries. Based on a preliminary site investigation, which was completed by NPC Services

Clement, Prabhakar

407

AN UPWIND FINITE-DIFFERENCE METHOD FOR TOTAL ...  

E-Print Network [OSTI]

A standard approach, as first suggested in [28], is to regularize the BV seminorm and ..... The result applied to our (finite-dimensional) problem gives the following: if 0 .... We did a series of experiments (a) to measure the ..... sets in the plane by the minimizing total variation flow, Interfaces Free Bound., 7 (2005), pp. 2953.

2010-09-17T23:59:59.000Z

408

An Upwind Finite-Difference Method for Total VariationBased ...  

E-Print Network [OSTI]

standard approach, as first suggested in [28], is to regularize the BV seminorm and consider ..... The result applied to our (finite-dimensional) problem gives the following: if .... We did a series of experiments (a) to measure the effectiveness ..... plane by the minimizing total variation flow, Interfaces Free Bound., 7 (2005), pp.

2011-03-17T23:59:59.000Z

409

ELSEVIER Earth and Planetary Science Letters 148 (1997) 38 I-394 Evaluating southern Red Sea corals as a proxy record for the  

E-Print Network [OSTI]

corals as a proxy record for the Asian monsoon R. Klein a,d.* , A.W. Tudhope a, C.P. Chilcott a, J 1997 Elsevier Science B.V. All rights reserved. Pi1 SOOl2-821X(97)00021-6 #12;382 R. Klein et al

410

Energy and Buildings 82 (2014) 310321 Contents lists available at ScienceDirect  

E-Print Network [OSTI]

Clustering algorithm a b s t r a c t Energy consumption and air quality index (AQI) prediction is important clustering method. © 2014 Elsevier B.V. All rights reserved. 1. Introduction The huge energy consumption 50% of the energy consumed of office buildings in the US [1,2]. The modeling and short

Kusiak, Andrew

411

Energy and Buildings 81 (2014) 371380 Contents lists available at ScienceDirect  

E-Print Network [OSTI]

s t r a c t A model for minimization of HVAC energy consumption and room temperature ramp rate Elsevier B.V. All rights reserved. 1. Introduction Minimizing the energy consumption of heating energy consumed in the US [1]. Stud- ies of saving energy in HVAC systems have been addressed using two

Kusiak, Andrew

412

Fusion Engineering and Design 53 (2001) 105111 Fast ion collective Thomson scattering, JET results  

E-Print Network [OSTI]

dynamics and specific issues for ion cyclotron resonance heating. © 2001 Elsevier Science B.V. All rights of energetic ion distributions generated by fusion reactions and ion cyclotron resonance heating (ICRH). CTS reserved. Keywords: Fast ions; Collective Thomson scattering; JET; TEXTOR; ICRH (Ion Cyclotron Resonance

Egedal, Jan

413

PC II fr Biochemiker Eberhard-Karls-Universitt Tbingen, Institut fr Physikalische und Theoretische Chemie, Prof. Dr. J. Enderlein, http://www.joerg-enderlein.de  

E-Print Network [OSTI]

Theoretische Chemie, Prof. Dr. J. Enderlein, http://www.joerg-enderlein.de Osmose Steigrohr Wasser Zucker Biochemiker Eberhard-Karls-Universität Tübingen, Institut für Physikalische und Theoretische Chemie, Prof. Dr Physikalische und Theoretische Chemie, Prof. Dr. J. Enderlein, http://www.joerg-enderlein.de Osmose BV p Nk T n

Enderlein, Jörg

414

Journal of Hazardous Materials 165 (2009) 148155 Contents lists available at ScienceDirect  

E-Print Network [OSTI]

in their frequent detection in soils, groundwater, and wastewater. The fate and transport of these compounds be a good candidate to remove TC from wastewater containing higher amounts of TC. © 2008 Elsevier B.V. All rights reserved. 1. Introduction A recent survey in 1999­2000 on 139 US streams revealed that among

Li, Zhaohui

415

Water Management EC Kumbur and MM Mench, The Pennsylvania State University, University Park, PA, USA  

E-Print Network [OSTI]

, hydrogen-based proton-exchange membrane fuel cells (PEMFCs) are the most suited for many stationary power fuel cell (PEMFC) assembly and components. CL, catalyst layer; DM, diffusion medium, PEM, polymer, USA & 2009 Elsevier B.V. All rights reserved. Introduction Fuel cells hold great promise to meet

Mench, Matthew M.

416

Susceptibility of provenances and families of Pinus maximinoi and Pinus tecunumanii to frost in South Africa  

E-Print Network [OSTI]

in South Africa R. G. Mitchell · M. J. Wingfield · G. R. Hodge · W. S. Dvorak · T. A. Coutinho Received: 15+Business Media B.V. 2012 Abstract The future of South Africa's most important pine species, Pinus patula subtropical species that provide an alternative to planting P. patula on the warmer sites of South Africa

417

Journal of Power Sources 165 (2007) 509516 Direct NaBH4/H2O2 fuel cells  

E-Print Network [OSTI]

Published by Elsevier B.V. Keywords: Fuel cell; Hydrogen peroxide; Regenerative fuel cell; Sodium) /hydrogen per- oxide (H2O2) fuel cell (FC) is under development jointly by the University of IllinoisJournal of Power Sources 165 (2007) 509­516 Direct NaBH4/H2O2 fuel cells George H. Mileya,e,, Nie

Carroll, David L.

418

Journal of Biotechnology 168 (2013) 478485 Contents lists available at ScienceDirect  

E-Print Network [OSTI]

. Capturing renewable energy from sun and wind through efficient photovoltaic devices or wind turbines of Pennsylvania, West Chester, PA 19383, USA a r t i c l e i n f o Article history: Received 25 June 2013 Received Elsevier B.V. All rights reserved. 1. Introduction Mankind faces increasing energy demands associated

419

Oxygen Consumption by Germinating Seeds Advisor: Dr. Neil Budko (n.v.budko@tudelft.nl)  

E-Print Network [OSTI]

Oxygen Consumption by Germinating Seeds Advisor: Dr. Neil Budko (n.v.budko@tudelft.nl) Problem) by the Fytagoras B.V. (Leiden): "Seed germination in most seeds depends on the availability of oxygen. Living seeds commences. The availability of oxygen to the embryo in the seed depends on the oxygen concentration around

Vuik, Kees

420

Beneficial properties of single-domain antibody fragments for application in immunoaffinity purification and  

E-Print Network [OSTI]

.T. Verripsa,d , J.J.W. de Haardb,1 a Department of Molecular and Cellular Biology, University of Utrecht, Utrecht 3500 TB, The Netherlands b Biotechnology Application Centre BV, Bussum 1400 CA, The Netherlands c explored the possibility to apply single-domain antibodies from Camelidae for immunoaffinity purification

Lebendiker, Mario

Note: This page contains sample records for the topic "bv dl deltak" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


421

3 September 1999 Z .Chemical Physics Letters 310 1999 385389  

E-Print Network [OSTI]

, Norway c Theoretical Chemistry Group, Debye Institute, Utrecht Uni?ersity, Padualaan 14, NL-3584 CH Utrecht, The Netherlands d Department of Theoretical Chemistry, Eot?os Uni?ersity, P.O. Box 32, H-1518 it is aiming beyond and should be applied with caution. q 1999 Elsevier Science B.V. All rights reserved. 1

Helgaker, Trygve

422

a0005 Landscape Ecology J Wu, Arizona State University, Tempe, AZ, USA  

E-Print Network [OSTI]

ELSEVIER FIRST PROOF a0005 Landscape Ecology J Wu, Arizona State University, Tempe, AZ, USA ª 2008 Elsevier B.V. All rights reserved. What Is Landscape Ecology? Evolving Perspectives in Landscape Ecology Some Key Topics in Landscape Ecology Concluding Remarks Further Reading s0005 What Is Landscape Ecology

Wu, Jianguo "Jingle"

423

Landscape of culture and culture of landscape: does landscape ecology need culture?  

E-Print Network [OSTI]

EDITORIAL Landscape of culture and culture of landscape: does landscape ecology need culture Science+Business Media B.V. 2010 The objects of study in landscape ecology become increasingly ``cultural), and almost all ecosys- tems and landscapes around the world have been influenced or even ``domesticated

Wu, Jianguo "Jingle"

424

Neutronic aspects of inert matrix fuels for application in ADS J. Wallenius *  

E-Print Network [OSTI]

, safety parameters of 800 MWth ADS cores operating on oxide and nitride fuels with high americium content for americium and magnesia the highest burnup potential. ? 2003 Elsevier Science B.V. All rights reserved. 1. Introduction In the Double Strata fuel cycle [1,2], the americium and curium produced in critical power

425

Interaction between shallow groundwater, saline surface water and contaminant discharge at a seasonally  

E-Print Network [OSTI]

the behaviour of the hydrocarbon plume at the groundwater/surface water transition zone to be strongly B.V. All rights reserved. Keywords: Ground water; Surface water; Hydrocarbons; Discharge; TidesInteraction between shallow groundwater, saline surface water and contaminant discharge

Clement, Prabhakar

426

Pollen record and integrated high-resolution chronology of the early Pliocene Dacic Basin (southwestern Romania)  

E-Print Network [OSTI]

, the regional lignite stratigraphy, records of large and small mammals, large climatic fluctuations according kyrs eccentricity cycles are clearly identified. © 2006 Elsevier B.V. All rights reserved. Keywords: Pliocene; Lignite; Pollen; Magnetostratigraphy; Cyclostratigraphy; Romania 1. Introduction The western part

Utrecht, Universiteit

427

ELSEVIER Earth and Planetary Science Letters 164 (1998) 535551 Magnetostratigraphy-based astronomical tuning of the early Pliocene  

E-Print Network [OSTI]

Ptolemais basin in NW Greece display rhythmical alternations of lignite and marl beds. Three parallel. Sci. Lett. 104 (1991) 211­225] -- on a bed-to-bed scale. It is concluded that lignite corresponds continental Greece. © 1998 Elsevier Science B.V. All rights reserved. Keywords: magnetostratigraphy; fluvi

Utrecht, Universiteit

428

This article appeared in a journal published by Elsevier. The attached copy is furnished to the author for internal non-commercial research  

E-Print Network [OSTI]

performance of the SiO2­TiO2 nanocomposite. © 2007 Elsevier B.V. All rights reserved. Keywords: Mercury Flue ) is the dominant species present in flue gas when burning low rank (subbituminous or lignite) coals. However

Li, Ying

429

Orbital forcing in PliocenePleistocene Mediterranean lacustrine deposits: dominant expression of eccentricity versus precession  

E-Print Network [OSTI]

expression in this lignite±siliciclastic basin in detail with the time-equivalent lignite±carbonate basin of Ptolemais (northern Greece), the middle Pleistocene lignite±siliciclastic basin of Megalopolis (southern Elsevier Science B.V. All rights reserved. Keywords: Orbital forcing; Sedimentary cycles

Utrecht, Universiteit

430

Non-Gaussian noise in quantum wells infrared photodetectors , Y. Paltiel a,*, A. Zussman a  

E-Print Network [OSTI]

distribution of electric field in the device. Non-Gaussian noise was found in both n- and p- type QWIPs capacitance and contacts resistance. ? 2006 Elsevier B.V. All rights reserved. Noise investigations a combined action of a large ensemble of elementary fluctuators, since according to the central limit theorem

Perera, A. G. Unil

431

This article appeared in a journal published by Elsevier. The attached copy is furnished to the author for internal non-commercial research  

E-Print Network [OSTI]

Elsevier B.V. All rights reserved. 1. Introduction The enzyme-based biofuel cell (BFC) is a special fuel's personal copy A glucose/O2 biofuel cell base on nanographene platelet-modified electrodes W. Zheng a , H f o Article history: Received 22 March 2010 Received in revised form 8 April 2010 Accepted 9 April

Zheng, Yufeng

432

Membrane properties revealed by spatiotemporal response to a local inhomogeneity  

E-Print Network [OSTI]

pH difference across the membrane to synthesize adenosine tri- phosphate, the cell's fuel Cedex 13, France a b s t r a c ta r t i c l e i n f o Article history: Received 29 May 2012 Received-difference elasticity model. © 2012 Elsevier B.V. All rights reserved. 1. Introduction During cell life, membranes

Fournier, Jean-Baptiste - Laboratoire Matière et Systèmes Complexes, Université Paris 7

433

This article appeared in a journal published by Elsevier. The attached copy is furnished to the author for internal non-commercial research  

E-Print Network [OSTI]

of the IG-11 graphite. a r t i c l e i n f o Article history: Received 3 November 2011 Received in revised is the shear stress. There are also a large amount of secondary cracks inside unit cells and on cell walls Elsevier B.V. All rights reserved. 1. Introduction Graphite materials have been widely used as fuel blocks

Martin, Ralph R.

434

Reverse saturation current density imaging of highly doped regions in silicon: A photoluminescence approach  

E-Print Network [OSTI]

´ a , Rolf Brendel a,b a Institute for Solar Energy Research Hamelin (ISFH), Am Ohrberg 1, 31860 Emmerthal Doping (LTD) as well as standard tube furnace phosphorus diffusion. We find a considerably smaller J0 for process optimization. & 2012 Elsevier B.V. All rights reserved. 1. Introduction In silicon solar cells

435

Mutation Research 504 (2002) 91100 Bystander effects in radiation-induced genomic instability  

E-Print Network [OSTI]

Mutation Research 504 (2002) 91­100 Bystander effects in radiation-induced genomic instability recombination and other phenotypes associated with genomic instability. © 2002 Elsevier Science B.V. All rights reserved. Keywords: Bystander effects; Genomic instability; Ionizing radiation 1. Introduction Exposure

436

Ji Jaromr Klemes, Peter Sabev Varbanov and Peng Yen Liew (Editors) Proceedings of the 24th  

E-Print Network [OSTI]

operating costs in a refinery, and limited global resources and strong competition are forcing plant owners. © Elsevier B.V. All rights reserved. A Self-Optimizing Strategy for Optimal Operation of a Preheating Train of a preheating train of the crude oil unit at the Mongstad Refinery in Norway. To maximize heat transfer, we

Skogestad, Sigurd

437

Theory of Structures and of Strength of Materials. By HENRY T. BOVEY. New York, J. Wiley & Sons, 1893. 817 p. 8. $7.50  

Science Journals Connector (OSTI)

...ki, thu, zal. Pro-fessor Newnman does not think the Etrus2an language either Aryan or Semitic, but does not proceed fa 'ther in its identifica-tion...CentUrY CO. is about to publish "1 A H'andbook of Invalid Cooxking," bv Mary A. Boland...

1893-02-24T23:59:59.000Z

438

Mutation of the serine 312 phosphorylation site does not alter the ability of mouse p53 to inhibit simian virus 40 DNA replication in vivo.  

Science Journals Connector (OSTI)

...state of phosphoryla- tion of serine 312 does not affect inhibition of SV40 DNA replication...permissive for SV40 replication) which does not express endogenous p53. It is also...and T. Curran (ed.), The oncogene handbook. Elsevier Science Publishers B.V...

D W Meek; W Eckhart

1990-04-01T23:59:59.000Z

439

Complete devil's staircase in the one-dimensional lattice gas Comment on one-dimensional lattice gas and the universality  

E-Print Network [OSTI]

L-247 Complete devil's staircase in the one-dimensional lattice gas Comment on « one-dimensional lattice gas and the universality of the devil's staircase » bv S. E. Burkov S. Aubry Laboratoire Léon of the complete devil's staircase for the lattice gas model. Thus, we show that the behaviour at the commensurate

Boyer, Edmond

440

Three oscillator model of the heartbeat generator Meghan Suchorsky *, Richard Rand  

E-Print Network [OSTI]

: 05.45.Xt 87.19.ug Keywords: Phase-only oscillators Phase-locking Devil's staircase Sinoatrial node of bifurcations called the ``devil's staircase". We use our system to derive a 1D discontinuous map which exhibits the devil's staircase, and we analyze its dynamics. ? 2008 Elsevier B.V. All rights reserved. 1

Rand, Richard H.

Note: This page contains sample records for the topic "bv dl deltak" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


441

The Bournemouth Meeting of the British Association: Inaugural Address  

Science Journals Connector (OSTI)

... time of the Newcastle meeting in 1916 had increased so much in intensity by the spring of 1917 that the council, after consultation with the local committee at Bournemouth, finally ... present proud position bv her early enterprise and by the success of the Watt steam-engine, which enabled her to become the first countrv to develop her resources in coal, ...

CHARLES A. PARSONS

1919-09-11T23:59:59.000Z

442

NATIONAL ACADEMY OF SCIENCES  

Science Journals Connector (OSTI)

...by barometric pres-sures, or bv the waterof the lake oscillating as if it were in a great waosh-basin, The correct knowledge...these points are atlmost inappreeiable. J uist as a piano string struck once, or the air in an organ pipe continu-ously...

1922-05-05T23:59:59.000Z

443

Wetlands Ecology and ISSN 0923-4861  

E-Print Network [OSTI]

1 23 Wetlands Ecology and Management ISSN 0923-4861 Volume 19 Number 3 Wetlands Ecol Manage (2011 / Published online: 5 March 2011 ? Springer Science+Business Media B.V. 2011 Abstract Coastal wetlands sensing imagery to map wetland habitat. In this study, we use IKONOS satellite imagery to classify coastal

McMaster University

444

Boundary-Layer Meteorol DOI 10.1007/s10546-011-9682-5  

E-Print Network [OSTI]

, Momentum, and Energy Exchange Rates of a Uniform Crop Situated in an Extensive Screenhouse Mario B Science+Business Media B.V. 2011 Abstract The area of crops cultivated in extensive screenhouses heat released or taken up by crops within such protected environments can substantially alter

Katul, Gabriel

445

Nutrient Bioaccumulation in Phragmites australis: Management Tool for Reduction of Pollution  

E-Print Network [OSTI]

Nutrient Bioaccumulation in Phragmites australis: Management Tool for Reduction of Pollution + Business Media B.V. 2009 Abstract We studied nutrient removal by Phragmites australis in the Albujón rambla, and lower risk of strong precipitation. Keywords Phragmites australis . Nutrients . Bioaccumulation . Mar

Murcia, Universidad de

446

Folding simulations of small proteins Seung-Yeon Kima  

E-Print Network [OSTI]

Abstract Understanding how a protein folds is a long-standing challenge in modern science. We have used-native conformations are carried out for each protein. In all cases, proteins fold into their native-like conformations, ~108 Monte Carlo steps). D 2004 Elsevier B.V. All rights reserved. Keywords: Protein folding; Computer

Lee, Jooyoung

447

BOOK REVIEW Gernot Renger (ed): Primary processes of photosynthesis  

E-Print Network [OSTI]

BOOK REVIEW Gernot Renger (ed): Primary processes of photosynthesis: principles and apparatus Springer Science+Business Media B.V. 2009 The book Primary Processes of Photosynthesis: Principles of photosynthesis research, was published in 2008 in the Comprehensive Series in Photochemistry and Photobiology

Govindjee "Gov"

448

Growth and field emission properties of small diameter carbon nanotube films  

E-Print Network [OSTI]

Growth and field emission properties of small diameter carbon nanotube films Y.Y. Wanga,*, S of the emission site intensity. D 2004 Elsevier B.V. All rights reserved. Keywords: Small diameter carbon nanotubes; MWCVD; Growth; Field emission 1. Introduction Single- or double-wall carbon nanotubes (CNT

Qin, Lu-Chang

449

Journal of Crystal Growth 308 (2007) 105109 The effect of growth time on the morphology of ZnO structures  

E-Print Network [OSTI]

, it is very important for low-voltage and short wavelength electro- optical devices such as light emitting­19]. ARTICLE IN PRESS www.elsevier.com/locate/jcrysgro 0022-0248/$ - see front matter r 2007 Elsevier B.V. All-toxic reagents, while the remaining by-products are non-hazardous. Moreover, the size and shape of the structures

450

Optical spectra of quantum dots: A non-adiabatic approach T.O. Cheche a,b,*, M.C. Chang b  

E-Print Network [OSTI]

and increase to measurable values with temperature. ? 2005 Elsevier B.V. All rights reserved. Experimentally. Firstly, a general expression of the linear absorption coefficient is derived by applying a semi(|fæ) the EHP eigenvalues (eigen- states). The radiation field is modeled as a single mode of linearly polarized

Chang, Ming-Che

451

Pion elastic scattering from ?p4?sHe  

E-Print Network [OSTI]

) = . 4. 46 APPEVDIX B pppl Cttttttt'tttttt twtxtetett ttttttt PPP2 Cttttttt*tttttt*tettttt*tttttetttttt 0003 SUBROUTIiVE WFiVCRD(LT, TNSH, EFCTR, R) 0004 IiNCLL DE 'RVIPPRM. FOR' 0101 0102 0103 COMMON /LSINT j XXQLS(DlV'INS5), AAQLS(DMNS5...) = . 4. 46 APPEVDIX B pppl Cttttttt'tttttt twtxtetett ttttttt PPP2 Cttttttt*tttttt*tettttt*tttttetttttt 0003 SUBROUTIiVE WFiVCRD(LT, TNSH, EFCTR, R) 0004 IiNCLL DE 'RVIPPRM. FOR' 0101 0102 0103 COMMON /LSINT j XXQLS(DlV'INS5), AAQLS(DMNS5...

Mahmoud, Ahmed Mohamed

2012-06-07T23:59:59.000Z

452

Thesaurus construction through knowledge representation  

Science Journals Connector (OSTI)

Semantic metadata describing subject content plays a vital role in supporting indexing and retrieval in Digital Libraries. Mechanisms used to deliver this metadata include keyword collections, thesauri and classifications. Constructing a large thesaurus, however, is a difficult process which can be facilitated through the application of knowledge representation techniques developed for managing and reasoning about concepts. We describe such a scheme a Description Logic (DL) and show through an example how a DL can play a part in the classification construction process, aiding in the production of coherent hierarchies and ensuring that the relationships represented in a thesaurus are sensible.

Sean Bechhofer; Carole Goble

2001-01-01T23:59:59.000Z

453

Mandatory Dedication of Park and Open Space Lands: The Situation in Texas.  

E-Print Network [OSTI]

267S02d860; Krughoff v . NaperVille 354NE2d489 (1975); Calls v. Bloomington 246NW2dl9 (1976). 'California Business and Professions Code, Section 11546. tional denial of due process or equal protection. The land developer who brought this action con... Ridge Estates. Inc. v. Planning Commission of Danbury 230A2d45 (1967); Krughoff v. Naperville 345NE2d489 (1974); Collis v. Bloomington 246NW2dl9 (1976). 'OJordan v. Menomonee Falls 137NW2d442 (1965). " Frank Ansuini. Inc. v. Cranston 264A2d91O (1970...

Taylor, P. D.; Kamp, B. D.; Seymour, J. S.

1979-01-01T23:59:59.000Z

454

CRYOPUMP BEHAVIOR IN THE PRESENCE OF BEAM OR NUCLEAR RADIATION  

E-Print Network [OSTI]

1976). D.M. Meade. Nuclear Fusion lU, 289 (197**). W.J.p. 68l, D.L. Jassby. Nuclear Fusion 17 1.2), 309 (1977). R.vacuum in a thermo nuclear fusion device is essential due

Law, P.K.

2011-01-01T23:59:59.000Z

455

Statistical Issues in Translational Cancer Research  

Science Journals Connector (OSTI)

...Storm Peterson, and others. The fundamental idea behind the concept of personalized...979-85. 8 Crowley J, Ankerst DP. Handbook of statistics in clinical oncology...Friedman LM, Furberg CD, Demets DL. Fundamentals of clinical trials. 3rd ed. New York...

Stephen L. George

2008-10-01T23:59:59.000Z

456

Wear 267 (2009) 653660 Contents lists available at ScienceDirect  

E-Print Network [OSTI]

Wear 267 (2009) 653­660 Contents lists available at ScienceDirect Wear journal homepage: www.elsevier.com/locate/wear A route to wear resistant PTFE via trace loadings of functionalized nanofillers D.L. Burrisa, , S. Zhaob, Newark, DE, USA b Rensselaer Polytechnic Institute, Troy, NY, USA c University of Florida, Gainesville

Sawyer, Wallace

457

NK Cell Genotype and Phenotype at Diagnosis of Acute Lymphoblastic Leukemia Correlate with Postinduction Residual Disease  

Science Journals Connector (OSTI)

...Hospital, 262 Danny Thomas Place, Memphis, TN 38105. Phone: 901-595-2554; Fax...MRD-positive patients were more likely to have KIR2DL5A (P = 0.006) and expressed...lymphoblastic leukemia has been established to be one of the most important prognostic...

Erin M. Sullivan; Sima Jeha; Guolian Kang; Cheng Cheng; Barbara Rooney; Martha Holladay; Rafijul Bari; Sarah Schell; MaCal Tuggle; Ching-Hon Pui; Wing Leung

2014-12-01T23:59:59.000Z

458

LTERE DEUTSCHE LITERATUR ...............S. 1 FACHDIDAKTIK DEUTSCH ...............S. 8  

E-Print Network [OSTI]

Inhalt: ?LTERE DEUTSCHE LITERATUR ...............S. 1 FACHDIDAKTIK DEUTSCH ...............S. 8 NEUERE DEUTSCHE LITERATUR ...............S. 13 ?LTERE DEUTSCHE LITERATUR ?DL I ?ltere deutsche Literatur Mo, 10:15 ­ 11:45 Uhr HS OpWsches Museum, CZ 12 J

Rossak, Wilhelm R.

459

Enzymatic Hydrolysis of Poly(lactide)s:? Effects of Molecular Weight, l-Lactide Content, and Enantiomeric and Diastereoisomeric Polymer Blending  

Science Journals Connector (OSTI)

Nonblended poly(l-lactide) (PLLA) films having different molecular weights and nonblended poly(lactide) (PLA) films, enantiomeric blend films from PLLA and poly(d-lactide) (PDLA), and diastereoisomeric blend films of poly(dl-lactide) (PDLLA) with either ...

Hideto Tsuji; Shinya Miyauchi

2001-04-24T23:59:59.000Z

460

The environmental impact of recombinant bovine somatotropin (rbST) use in dairy production  

Science Journals Connector (OSTI)

...Audsley E Sandars DL ( 2006 ) DEFRA Research Project ISO205 , Determining the Environmental Burdens and...supported in part by funding provided by the Liberty Hyde Bailey Professorship in College...Monsanto, holding the position of Technical Project Manager for POSILAC rbST with the primary...

Judith L. Capper; Euridice Castaeda-Gutirrez; Roger A. Cady; Dale E. Bauman

2008-01-01T23:59:59.000Z

Note: This page contains sample records for the topic "bv dl deltak" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


461

IS C O N SIN FUSION TECHNOLOGY INSTITUTE  

E-Print Network [OSTI]

W IS C O N SIN · FUSION·T E CHNOLOGY · INSTITUTE FUSION TECHNOLOGY INSTITUTE UNIVERSITY at the 6th International Symposium on Fusion Nuclear Technology, 7­12 April 2002, San Diego CA #12 Wall Chamber L.A. El-Guebaly, D.L. Henderson, P.P.H. Wilson, A.E. Abdou, ARIES Team Fusion Technology

462

Matrix Effect and Cross-Reactivity of Select Amphetamine-Type Substances, Designer Analogues, and Putrefactive Amines using the Bio-Quant Direct ELISA Presumptive Assays for Amphetamine and Methamphetamine  

Science Journals Connector (OSTI)

......Li, D-L. Lin, and R.H. Liu. Performance...2003). 2. H. Zhao, R. Brenneisen, A. Scholar, A.J.McNally, M.A. Elsohly, T...Kerriganand W.H. Phillips, Jr.Comparison of ELISAsfor...540-547 (2001). 18. H.R.M. Far,F.Torabi......

Luigino G. Apollonio; Ian R. Whittall; Dennis J. Pianca; Jennelle M. Kyd; William A. Maher

463

Is low pathogenic avian influenza virus virulent for wild waterbirds?  

Science Journals Connector (OSTI)

...JD , DE Stallknecht, JR Beck, DL Suarez, and...Bestebroer, WE Beyer, R van Lavieren, AD Osterhaus...Bewick's swans. Proc. R. Soc. B 279, 529-534...settings. Chicago, IL: Rand McNally College Publishing. 52...or vice versa? Proc. R. Soc. B 276, 2345-2346...

2013-01-01T23:59:59.000Z

464

High-Performance Liquid Chromatography of Industrial Polyurethane Polyols  

Science Journals Connector (OSTI)

......D.L. Hendrix, R.E. Lee, Jr., J.G. Baust...McFadden and D.R. Scheuing. Determination...L.L. Merritt, Jr., J.A. Dean...Callis, and L.R. Field. Fourier transform...1983). 16. M.E. McNally and L.B. Rogers......

D. Nol; P. VanGheluwe

1987-06-01T23:59:59.000Z

465

DIPARTIMENTO DI MEDICINA MOLECOI,ARE  

E-Print Network [OSTI]

DIPARTIMENTO DI MEDICINA MOLECOI,ARE @;.ffiJ#Nm AWISO DI CONFERIMENTO DI COLLABORAZIONE Cod ice Ba; si rende noto che il Dipartimento di Medicina Molecolare intende conferire un incarico per lo Dl ESECUZIONE: 6 mesi - Dipartimento di Medicina Molecolare - Sezione di Storia della Medicina

Guidoni, Leonardo

466

DIPARTIMENTo DI MEDICINA MOLECOI,ARE  

E-Print Network [OSTI]

DIPARTIMENTo DI MEDICINA MOLECOI,ARE -z\\/i\\E!t/L\\ rM) 5APTET\\IZAlmnrflEl wZ tJNtvFRsrrA Dt Ro che il Dipartimento di Medicina Molecolare intende conferire un incarico per lo svolgimento della'italiano all'inglese di testi letterari DURATA E WOGO Dl ESECUZIONE: 6 mesi - Dipartimento di Medicina

Guidoni, Leonardo

467

10354 DOI: 10.1021/la900907d Langmuir 2009, 25(17), 1035410363Published on Web 06/05/2009 pubs.acs.org/Langmuir  

E-Print Network [OSTI]

.; Flynn, T. M.; Marsh, A.; Knowles, P. F.; Bushby, R. J.; Boden, N. Langmuir 1997, 13, 751. (10) Cornell. Faragher, Renate Naumann,§ Wolfgang Knoll,§ John R. Dutcher, and Jacek Lipkowski*, Department of Chemistry the conformation, orientation, and hydration of a monolayer of 2,3-di-O-phytanyl-sn-glycerol-1-tetraethylene glycol-DL-R

Dutcher, John

468

Permanent magnet helicon source for ion propulsion Francis F. Chen  

E-Print Network [OSTI]

. These ion energy peaks at the 29 eV plasma potential and at 47 eV behind the DL. The latter is supersonic, size, impulse, and gas efficiency of the thruster. This paper concerns the source itself and shows , which should yield much higher ion currents than reported so far. The design principles have been

Chen, Francis F.

469

Testing the DistanceDuality Relation with Galaxy Clusters and Type Ia Supernovae  

Science Journals Connector (OSTI)

In this Letter, we propose a new and model-independent cosmological test for the distance-duality (DD) relation, ? = DL (z)(1 + z)2/DA (z) = 1, where DL and DA are, respectively, the luminosity and angular diameter distances. For DL we consider two sub-samples of Type Ia supernovae (SNe Ia) taken from Constitution data whereas DA distances are provided by two samples of galaxy clusters compiled by De Filippis etal. and Bonamente etal. by combining Sunyaev-Zeldovich effect and X-ray surface brightness. The SNe Ia redshifts of each sub-sample were carefully chosen to coincide with the ones of the associated galaxy cluster sample (?z DA (z) ? DL (z), we have tested the DD relation by assuming that ? is a function of the redshift parameterized by two different expressions: ?(z) = 1 + ?0 z and ?(z) = 1 + ?0 z/(1 + z), where ?0 is a constant parameter quantifying a possible departure from the strict validity of the reciprocity relation (?0 = 0). In the best scenario (linear parameterization), we obtain ?0 = 0.28+0.44 0.44 (2?, statistical + systematic errors) for the De Filippis etal. sample (elliptical geometry), a result only marginally compatible with the DD relation. However, for the Bonamente etal. sample (spherical geometry) the constraint is ?0 = 0.42+0.34 0.34 (3?, statistical + systematic errors), which is clearly incompatible with the duality-distance relation.

R. F. L. Holanda; J. A. S. Lima; M. B. Ribeiro

2010-01-01T23:59:59.000Z

470

Presented at the 13th ICTMC, Oct 14 18, 2002  

E-Print Network [OSTI]

Effect on the Photovoltaic Properties of Solar Cells K. Ramanathan, F. S. Hasoon, S. Smith, D.L. Young solar cells based on CuInSe2 (CIS) have been developed as a competitive option for low cost power generation. Photovoltaic cells and modules made using alloys of CIS with Ga and or S have demonstrated

Sites, James R.

471

Shedding light on carbon-mineral complexation in the soil environment: impacts on C sequestration and cycling  

E-Print Network [OSTI]

42 Shedding light on carbon-mineral complexation in the soil environment: impacts on C sequestration and cycling Sparks, D.L. & C. Chen Department of Plant and Soil Sciences and Delaware@udel.edu) Abstract Organic matter (OM)-mineral complexation plays a critical role in soil carbon (C) stabilization

Sparks, Donald L.

472

Transmission Line Theory 51 MOTOROLAECLinPS and ECLinPS Lite  

E-Print Network [OSTI]

Transmission Line Theory 5­1 MOTOROLAECLinPS and ECLinPS Lite DL140 -- Rev 3 SECTION 2 Transmission interconnects to determine if transmission line phenomena will occur. A handy rule of thumb to determine if an interconnect trace should be considered a transmission line is if the interconnect delay is greater than 1/8th

McNeill, John A.

473

Impact of mating systems on patterns of sequence polymorphism in flowering plants  

Science Journals Connector (OSTI)

...Table 3 Results of ANOVAs for nuclear gene patterns of LD, including...Purugganan, and D.L Hartl2002The cost of inbreeding in Arabidopsis...an ancestral recombination graph with partial self-fertilization...2004Comparison of different nuclear DNA markers for estimating intraspecific...

2006-01-01T23:59:59.000Z

474

A Population Genomics Study of the Arabidopsis Core Cell Cycle Genes Shows the Signature of Natural Selection  

Science Journals Connector (OSTI)

...region was to keep resequencing costs and efforts at a minimum, while...from the 2010 data set. The graphs of the distributions are normal...Hartl, D.L. (2002). The cost of inbreeding in Arabidopsis...retinoblastoma homologues control nuclear proliferation in the female...

Roel Sterken; Raphaël Kiekens; Emmy Coppens; Ilse Vercauteren; Marc Zabeau; Dirk Inzé; Jonathan Flowers; Marnik Vuylsteke

2009-10-30T23:59:59.000Z

475

Automated Quantitative Analysis of HDM2 Expression in Malignant Melanoma Shows Association with Early-Stage Disease and Improved Outcome  

Science Journals Connector (OSTI)

...NIH Grant K0-8 ES11571 (R. Camp), C. J. Swebilius Award...issues as we approach the 21st century. J Am Acad Dermatol 1996...Med 1998;4:844-7. 16 Camp RL, Chung GG, Rimm DL Automated...Med 2002;8:1323-7. 17 Camp RL, Dolled-Filhart M, King...

Aaron J. Berger; Robert L. Camp; Kyle A. DiVito; Harriet M. Kluger; Ruth Halaban; and David L. Rimm

2004-12-01T23:59:59.000Z

476

Potassium-argon and uranium-lead ages from two localities  

Science Journals Connector (OSTI)

...etal'.,(7956)to advocatethe view o 3 a h T b 0 A T ;x)aoc\\-1.,6l I o i b i l n l s,, i l o o v ! \\ i Y t 4 5 I...o + aoc! ;; Dl'-ci 6i 0) * t _ I t F.

Sheila M.A Boutcher; G. L. Davis; W. W. Moorhouse

477

Bending Energy of Rods and Plates  

E-Print Network [OSTI]

bending energy over a rod of length L is therefore ( )21 2 0 L llEI dl r (9.2) For 2D objects185 Chapter 9 Bending Energy of Rods and Plates Integrated curvature and bending energy of a closed curvature/energy values over a chain-code description of the contour (as in binary length estimators). We

van Vliet, Lucas J.

478

BAT RESEARCH NEWS Volume 37: Number 4 Winter 1996  

E-Print Network [OSTI]

, BAT RESEARCH NEWS Volume 37: Number 4 Winter 1996 Bat Collisions with Wind Turbines colliding with a lighthouse at LODg POlDL. OnWlo. Bat collisions with wind turbines used to produce e \\IIRA IS a 25·megawau faciluy and conSISts cf 73 KVS-33 wind turbines thaI were grouped InlO 10 Stnngs

479

AACR Cancer Progress Report 2013  

Science Journals Connector (OSTI)

...main source of ionizing radiation is a natural source: Radon gas. However, people are also exposed to ionizing radiation from...95:825-8. 42. Jiao L , Duan Z, Sangi-Haghpeykar H, Hale L, White DL El-Serag HB. Sleep duration and incidence of...

Charles L. Sawyers; Cory Abate-Shen; Kenneth C. Anderson; Anna Barker; Jose Baselga; Nathan A. Berger; Margaret Foti; Ahmedin Jemal; Theodore S. Lawrence; Christopher I. Li; Elaine R. Mardis; Peter J. Neumann; Drew M. Pardoll; George C. Prendergast; John C. Reed; and George J. Weiner

2013-10-15T23:59:59.000Z

480

Impact of Tumor Microenvironment and Epithelial Phenotypes on Metabolism in Breast Cancer  

Science Journals Connector (OSTI)

...4-bromo-dl-phenylalanine, and 0.5 mug/mL amitryptyline. For gas chromatography/mass spectrometry (GC/MS), samples were...Cancer Res 2010;12:R68. 21. Santarpia L , Qi Y, Stemke-Hale K, Wang B, Young EJ, Booser DJ, et alMutation profiling identifies...

Heather Ann Brauer; Liza Makowski; Katherine A. Hoadley; Patricia Casbas-Hernandez; Lindsay J. Lang; Erick Romn-Prez; Monica D'Arcy; Alex J. Freemerman; Charles M. Perou; and Melissa A. Troester

2013-02-01T23:59:59.000Z

Note: This page contains sample records for the topic "bv dl deltak" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


481

DONALD BURKHOLDER'S WORK IN MARTINGALES AND ...  

E-Print Network [OSTI]

Dec 21, 2010 ... singular integral operator (the two dimensional Hilbert transform) and .... For example, R.E.A.C. Paley [138] proved an inequality for the Haar system ...... [53] D.L. Burkholder, Martingales and singular integrals, in Banach spaces, Handbook .... Lp estimates for powers of the Ahlfors-Beurling operator, J. Math.

2010-12-21T23:59:59.000Z

482

Comparative structural modeling and docking studies of uricase: Possible implication in enzyme supplementation therapy for hyperuricemic disorders  

Science Journals Connector (OSTI)

Uricase (EC 1.7.3.3, UC) catalyzes the oxidation of uric acid (UA) to more soluble allantoin thereby lowering plasma UA levels. In humans, when concentration of UA exceeds >7mg/dl, it leads to hyperuricemia, gout, nephrolithiasis and urolithiasis. A ... Keywords: Automated docking, Gout, Homology modeling, Regio-specificity of enzyme, Uricase

Supriya D. Beedkar; C. N. Khobragade; Ragini G. Bodade; Aruna S. Vinchurkar

2012-06-01T23:59:59.000Z

483

Individuals in foraging groups may use vocal cues when assessing their need for anti-predator vigilance  

Science Journals Connector (OSTI)

...as random terms in the LMM.) full model d.f. x2 p foraging group size 1 22.86...tree.2003.10.003 Krause, J , and G.D Ruxton2002Living in groupsOxford, UK:Oxford...1006/anbe.2001.1860 Palombit, R.A , D.L Cheney, and R.M Seyfarth1999Male grunts...

2007-01-01T23:59:59.000Z

484

UNIVERSITY OF BRISTOL Minutes of the 102nd  

E-Print Network [OSTI]

Cottrell Mr R Cowap Mr R Cross Dr M Crossley Evans Dr N Dahnoun Mrs CA Davies Dr R Davies Mr W Davies Dr G-Chancellor), Dr JS Foulds (Pro-Chancellor), Sir James Tidmarsh (Pro-Chancellor), Dr JM Woolley (Pro Honour Paul Batterbury TD DL Ms S Bennett Prof Sir John Beringer Prof Sir Michael Berry Prof R Bickers Dr

Bristol, University of

485

Quantitative structural analysis using remote sensing data: Kurdistan, northeast Iraq  

Science Journals Connector (OSTI)

...10.1130/0091-7613(2002)0302.0.CO;2 . Autodeak AutoCAD dxf file technical description: http://usa.autodesk.com/adsk/servlet/ps/dl/item?siteID=123112linkID=9240617 (accessed July 10, 2010). Bahroudi, A., and...

Daniel Reif; Bernhard Grasemann; Robert H. Faber

486

A&G Volume 55 Issue 1, Full Issue  

Science Journals Connector (OSTI)

......Should the UK government fund the launch of prebuilt...uk News A&G February 2014 Vol. 55 1.5 Lennon...astronomy. A&G February 2014 Vol. 55 1.39 Society...universities who are seeking funds to support vacation studentships...1dck5dl NAM2014 The 2014 National Astronomy Meeting......

A&G Volume 55 Issue 1; Full Issue

487

Harnessing Genetic Diversity in Saccharomyces cerevisiae for Fermentation of Xylose in Hydrolysates of Alkaline Hydrogen Peroxide-Pretreated Biomass  

Science Journals Connector (OSTI)

...inhibitory effects on cell growth and fermentation...34). Alkaline hydrogen peroxide (AHP...production of fuel ethanol. J...characterization of cell wall decomposition...Banerjee, G , S Car, T Liu, DL Williams...integration of alkaline hydrogen peroxide pretreatment...organization of plant cell walls, p 61-93...

Trey K. Sato; Tongjun Liu; Lucas S. Parreiras; Daniel L. Williams; Dana J. Wohlbach; Benjamin D. Bice; Irene M. Ong; Rebecca J. Breuer; Li Qin; Donald Busalacchi; Shweta Deshpande; Chris Daum; Audrey P. Gasch; David B. Hodge

2013-11-08T23:59:59.000Z

488

Mutational Scan of the Human Immunodeficiency Virus Type 2 Integrase Protein  

Science Journals Connector (OSTI)

...1089 V249D;L213I...D193E;K219R * ** 1079 C65S;W131N;C182S...1080 G59S...1085 S81R ND ND ND ND ND ND...1086 Q146R...

Fusinita M. I. van den Ent; Arnold Vos; Ronald H. A. Plasterk

1998-05-01T23:59:59.000Z

489

Scientific basis for safely shutting in the Macondo Well after the April 20, 2010 Deepwater Horizon blowout  

Science Journals Connector (OSTI)

...6-m-thick) M110 sand: (i) a circular...regarding the amount of gas dissolved in the oil and...that the targets were hydrate-coated methane bubbles...Orange DL ( 1998 ) Gas hydrate formation in the deep...methane, natural gas, and carbon dioxide...

Stephen H. Hickman; Paul A. Hsieh; Walter D. Mooney; Catherine B. Enomoto; Philip H. Nelson; Larry A. Mayer; Thomas C. Weber; Kathryn Moran; Peter B. Flemings; Marcia K. McNutt

2012-01-01T23:59:59.000Z

490

-./012&3)45&%$6'&78 -.//$9$).:);$573/)<$(&=&5$  

E-Print Network [OSTI]

Cardiovascular Disease (heart trouble, heart attack, angina, coronary insufficiency, coronary occlusion, FIC/derrame cerebral Heart Attack Ataque al corazón FIC)JC&K DL)JD.K If yes, when? Si es así, ¿cuando padecido alguna vez de alguna de las siguientes enfermedades o problemas? Damaged heart valves

Grishok, Alla

491

A Population Genomics Study of the Arabidopsis Core Cell Cycle Genes Shows the Signature of Natural Selection  

Science Journals Connector (OSTI)

...region was to keep resequencing costs and efforts at a minimum, while...Hartl, D.L. (2002). The cost of inbreeding in Arabidopsis...retinoblastoma homologues control nuclear proliferation in the female...URen J, Tenaillon O, Gaut BS. (2004). Selection versus...

Roel Sterken; Raphaël Kiekens; Emmy Coppens; Ilse Vercauteren; Marc Zabeau; Dirk Inzé; Jonathan Flowers; Marnik Vuylsteke

2009-10-30T23:59:59.000Z

492

Skeletal Complications of Breast Cancer Therapies  

Science Journals Connector (OSTI)

...Katherine Weilbaecher Requests for reprints: Katherine Weilbaecher, Division of Oncology...Direct effects. Animal studies by Wheeler et al. (34) showed that male rats...Cancer Treat Rev 2005;31:115-42. 34 Wheeler DL, Vander Griend RA, Wronski TJ...

Angela Hirbe; Elizabeth A. Morgan; zge Ulukan; and Katherine Weilbaecher

2006-10-15T23:59:59.000Z

493

Patients with hippocampal amnesia cannot imagine new experiences  

Science Journals Connector (OSTI)

...Schrauf RW Greenberg DL ( 2003 ) Mem Cognit 31 : 887 901 . 23 Wheeler MA Stuss DT Tulving E ( 1997 ) Psychol Bull 121 : 331 354 . 24 Burgess N Becker S King...Hospital (London) for patient referrals; and Peter Aston, Katherine Woollett, Hugo Spiers, and Neil Burgess for assistance and...

Demis Hassabis; Dharshan Kumaran; Seralynne D. Vann; Eleanor A. Maguire

2007-01-01T23:59:59.000Z

494

Phage auxiliary metabolic genes and the redirection of cyanobacterial host carbon metabolism  

Science Journals Connector (OSTI)

...pnas.1102164108 Luke R. Thompson Qinglu Zeng Libusha Kelly Katherine H. Huang Alexander U. Singer JoAnne Stubbe Sallie W. Chisholm...Benson DA, Karsch-Mizrachi I, Lipman DJ, Ostell J, Wheeler DL (2008) GenBank. Nucleic Acids Res 36(database issue...

Luke R. Thompson; Qinglu Zeng; Libusha Kelly; Katherine H. Huang; Alexander U. Singer; JoAnne Stubbe; Sallie W. Chisholm

2011-01-01T23:59:59.000Z

495

GULF OF MEXICO RESEARCH PLAN SEPTEMBER 2009  

E-Print Network [OSTI]

GULF OF MEXICO RESEARCH PLAN SEPTEMBER 2009 #12;Suggested citation: Sempier, S.H., K. Havens, R. Stickney, C. Wilson, and D.L. Swann. 2009. Gulf of Mexico Research Plan. MASGP-09-024. Document design organizations. Texas · Louisiana · Florida Mississippi-Alabama #12;iGulf of Mexico Research Plan CONTENTS TABLE

496

Rainfall-induced carbon dioxide pulses result from sequential resuscitation of phylogenetically clustered microbial groups  

Science Journals Connector (OSTI)

...Heidelberg JF Kirchman DL ( 2011 ) Activity of abundant and rare bacteria in a coastal ocean . Proc Natl Acad Sci USA 108 : 12776 12781 . 29 Mukamolova GV Kaprelyants AS Young DI Young M Kell DB ( 1998 ) A bacterial cytokine . Proc Natl Acad Sci USA...

Sarah A. Placella; Eoin L. Brodie; Mary K. Firestone

2012-01-01T23:59:59.000Z

497

Identification of Soil Bacteria Susceptible to TiO2 and ZnO Nanoparticles  

Science Journals Connector (OSTI)

...DL Kirchman. 2011. Activity of abundant and rare bacteria in a coastal ocean. Proc. Natl. Acad. Sci. U. S. A. 108 :12776-12781. 7. Caporaso, JG , et al. 2010. QIIME allows analysis of high-throughput community sequencing data. Nat. Methods...

Yuan Ge; Joshua P. Schimel; Patricia A. Holden

2012-07-13T23:59:59.000Z

498

Relationship between Abundance and Specific Activity of Bacterioplankton in Open Ocean Surface Waters  

Science Journals Connector (OSTI)

...DL Kirchman. 2011. Activity of abundant and rare bacteria in a coastal ocean. Proc. Natl. Acad. Sci. U. S. A. 108 :12776-12781. 10. Pedros-Alio, C . 2012. The rare bacterial biosphere. Ann. Rev. Mar. Sci. 4 :449-466. 11. Lennon...

Dana E. Hunt; Yajuan Lin; Matthew J. Church; David M. Karl; Susannah G. Tringe; Lisa K. Izzo; Zackary I. Johnson

2012-10-19T23:59:59.000Z

499

Conditionally Rare Taxa Disproportionately Contribute to Temporal Changes in Microbial Diversity  

Science Journals Connector (OSTI)

...Kirchman DL. 2011. Activity of abundant and rare bacteria in a coastal ocean. Proc. Natl. Acad. Sci. U. S. A. 108 :12776-12781. doi: 10.1073/pnas.1101405108 . 15. Jones SE and Lennon JT. 2010. Dormancy contributes to the maintenance...

Ashley Shade; Stuart E. Jones; J. Gregory Caporaso; Jo Handelsman; Rob Knight; Noah Fierer; Jack A. Gilbert

2014-08-01T23:59:59.000Z

500

IAEA-F1-CN69.pdf  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

CONFINEMENT IN THE RFP: LUNDQUIST NUMBER SCALING, PLASMA FLOW, AND REDUCED TRANSPORT G. Fiksel, 1 A.F. Almagri, 1 J.K. Anderson, 1 T.M. Biewer, 1 D.L. Brower, 2 C-S. Chiang, 1 B.E....