Powered by Deep Web Technologies
Note: This page contains sample records for the topic "blue ruthenium dimer" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


1

Blue Ruthenium Dimer Catalysis for Hydrogen Generation | Advanced Photon  

NLE Websites -- All DOE Office Websites (Extended Search)

A High-Pressure Nano-imaging Breakthrough A High-Pressure Nano-imaging Breakthrough Protein Structure Could Lead to Better Treatments for HIV, Early Aging The Superpower behind Iron Oxyfluoride Battery Electrodes Watching a Protein as it Functions Shedding Light on Chemistry with a Biological Twist Science Highlights Archives: 2013 | 2012 | 2011 | 2010 2009 | 2008 | 2007 | 2006 2005 | 2004 | 2003 | 2002 2001 | 2000 | 1998 | Subscribe to APS Science Highlights rss feed Blue Ruthenium Dimer Catalysis for Hydrogen Generation APRIL 15, 2013 Bookmark and Share Key intermediates in the water oxidation catalytic cycle of the blue dimer characterized by x-ray spectroscopy. Optimization of the reactivity toward water (purple arrow) and oxidation of the resulting peroxo-intermediate (blue arrow) are needed for improved catalytic activity.

2

Structure and Electronic Configurations of the Intermediates of Water Oxidation in Blue Ruthenium Dimer Catalysis  

SciTech Connect

Catalytic O{sub 2} evolution with cis,cis-[(bpy){sub 2}(H{sub 2}O)Ru{sup III}ORu{sup III}(OH{sub 2})(bpy){sub 2}]{sup 4+} (bpy is 2,2-bipyridine), the so-called blue dimer, the first designed water oxidation catalyst, was monitored by UV-vis, EPR, and X-ray absorption spectroscopy (XAS) with ms time resolution. Two processes were identified, one of which occurs on a time scale of 100 ms to a few seconds and results in oxidation of the catalyst with the formation of an intermediate, here termed [3,4]'. A slower process occurring on the time scale of minutes results in the decay of this intermediate and O{sub 2} evolution. Spectroscopic data suggest that within the fast process there is a short-lived transient intermediate, which is a precursor of [3,4]'. When excess oxidant was used, a highly oxidized form of the blue dimer [4,5] was spectroscopically resolved within the time frame of the fast process. Its structure and electronic state were confirmed by EPR and XAS. As reported earlier, the [3,4]' intermediate likely results from reaction of [4,5] with water. While it is generated under strongly oxidizing conditions, it does not display oxidation of the Ru centers past [3,4] according to EPR and XAS. EXAFS analysis demonstrates a considerably modified ligand environment in [3,4]'. Raman measurements confirmed the presence of the O-O fragment by detecting a new vibration band in [3,4]' that undergoes a 46 cm{sup -1} shift to lower energy upon {sup 16}O/{sup 18}O exchange. Under the conditions of the experiment at pH 1, the [3,4]' intermediate is the catalytic steady state form of the blue dimer catalyst, suggesting that its oxidation is the rate-limiting step.

Moonshiram, Dooshaye; Jurss, Jonah W.; Concepcion, Javier J.; Zakharova, Taisiya; Alperovich, Igor; Meyer, Thomas J.; Pushkar, Yulia (Purdue); (UNC)

2013-04-08T23:59:59.000Z

3

Ruthenium-Catalyzed ROM?RCM of Cycloalkene-yne  

Science Journals Connector (OSTI)

Ruthenium-Catalyzed ROM?RCM of Cycloalkene-yne ... ROM?RCM (ring-opening and ring-closing metatheses) of cycloalkene-yne was demonstrated using a second-generation ruthenium complex. ... When cycloalkene bearing the alkyne moiety at the C-1 position was reacted with a ruthenium?carbene complex under an atmosphere of ethylene, ROM?RCM proceeded smoothly to give bicyclic compound and/or dimeric compound in good yields. ...

Miwako Mori; Yuichi Kuzuba; Tsuyoshi Kitamura; Yoshihiro Sato

2002-10-04T23:59:59.000Z

4

Synthesis and Hydrodeoxygenation Properties of Ruthenium Phosphide...  

NLE Websites -- All DOE Office Websites (Extended Search)

Hydrodeoxygenation Properties of Ruthenium Phosphide Catalysts. Synthesis and Hydrodeoxygenation Properties of Ruthenium Phosphide Catalysts. Abstract: Ru2PSiO2 and RuPSiO2...

5

Blue Note  

ScienceCinema (OSTI)

Argonne's Murray Gibson is a physicist whose life's work includes finding patterns among atoms. The love of distinguishing patterns also drives Gibson as a musician and Blues enthusiast."Blue" notes are very harmonic notes that are missing from the equal temperament scale.The techniques of piano blues and jazz represent the melding of African and Western music into something totally new and exciting.

Murray Gibson

2010-01-08T23:59:59.000Z

6

Cobalt-ruthenium catalysts for Fischer-Tropsch synthesis  

SciTech Connect

A hydrocarbon synthesis process is described which comprises reacting hydrogen and carbon monoxide in the presence of a catalyst comprised of cobalt and ruthenium on titania, at reaction conditions suitable for the formation of higher hydrocarbons. The catalyst is prepared by impregnating titania with solutions of cobalt and ruthenium salts, drying the impregnated support, reducing the cobalt and ruthenium, treating the reduced metals with an oxygen containing stream at conditions sufficient to form oxides of cobalt and oxides of ruthenium and reducing the cobalt and ruthenium oxides.

Iglesia, E.; Soled, S.L.; Fiato, R.A.

1989-04-18T23:59:59.000Z

7

ALD and Pulsed CVD of Ruthenium and Ruthenium Dioxide Thin Films From an Amidinate Precursor  

E-Print Network (OSTI)

Narrow window of O2 exposure (e.g. 0.02~0.04 Torr·s @ 325ºC) to obtain high quality pure Ru filmALD and Pulsed CVD of Ruthenium and Ruthenium Dioxide Thin Films From an Amidinate Precursor Xinwei, China Introduction Experimental ALD with O2 Ru metal film Pulsed CVD with NH3+H2 Ru metal film Pulsed

8

One-Pot Formation of Functionalized Indole and Benzofuran Derivatives Using a Single Bifunctional Ruthenium Catalyst  

E-Print Network (OSTI)

Bifunctional Ruthenium Catalyst Reji N. Nair Paul J. Lee bifunctional ruthenium catalyst for cyclization of terminalof transi- tion metal based catalysts have been reported to

Nair, Reji N; Lee, Paul J; Grotjahn, Douglas B

2010-01-01T23:59:59.000Z

9

A method for activation analysis of ruthenium in sea water  

E-Print Network (OSTI)

of these isotopes in the marine environment, it is essential that a method for the analysis of trace amounts of stable ruthenium be developed, and applied to the study of the chemical and physical dis- tribution of ruthenium in sea water, marine biota... 100 27. 2 82 34. 8 100 30. 2 91 30. 6 92 26. 9 81 8 (Tracer Only) 34. 5 100 Standard 33. 3 Average Counting time ? Eorty minutes 103 Tracer ? Ru 93 Stable ruthenium added ? 0. Z6 ug 14 TABLE 4 Nuclear Data for Ruthenium Isotope Per Cent...

Dixon, Bryan William

2012-06-07T23:59:59.000Z

10

CO oxidation on ruthenium: The nature of the active catalytic...  

NLE Websites -- All DOE Office Websites (Extended Search)

ruthenium has been extensively studied over the last several decades from ultrahigh (UHV) vacuum to ambient pressures. While Ru is an inferior catalyst for this reaction...

11

On the photophysics and photochemistry of the water dimer  

SciTech Connect

The photochemistry of the water dimer irradiated by UV light is studied by means of the complete active space perturbation theory//complete active space self-consistent field (CASPT2//CASSCF) method and accurate computational approaches like as minimum energy paths. Both electronic structure computations and ab initio molecular dynamics simulations are carried out. The results obtained show small shifts relative to a single water molecule on the vertical excitation energies of the dimer due to the hydrogen bond placed between the water donor (W{sub D}) and the water acceptor (W{sub A}). A red-shift and a blue-shift are predicted for the W{sub D} and W{sub A}, respectively, supporting previous theoretical and experimental results. The photoinduced chemistry of the water dimer is described as a process occurring between two single water molecules in which the effect of the hydrogen bond plays a minor role. Thus, the photoinduced decay routes correspond to two photodissociation processes, one for each water molecule. The proposed mechanism for the decay channels of the lowest-lying excited states of the system is established as the photochemical production of a hydrogen-bonded H{sub 2}O Horizontal-Ellipsis HO species plus a hydrogen H atom.

Segarra-Marti, Javier; Merchan, Manuela [Instituto de Ciencia Molecular, Universitat de Valencia, P.O. Box 22085, 46071 Valencia (Spain); Roca-Sanjuan, Daniel; Lindh, Roland [Department of Chemistry - Angstroem, Theoretical Chemistry Program, Uppsala University, Box 518, 75120 Uppsala (Sweden)

2012-12-28T23:59:59.000Z

12

Fiber optic D dimer biosensor  

DOE Patents (OSTI)

A fiber optic sensor for D dimer (a fibrinolytic product) can be used in vivo (e.g., in catheter-based procedures) for the diagnosis and treatment of stroke-related conditions in humans. Stroke is the third leading cause of death in the United States. It has been estimated that strokes and stroke-related disorders cost Americans between $15-30 billion annually. Relatively recently, new medical procedures have been developed for the treatment of stroke. These endovascular procedures rely upon the use of microcatheters. These procedures could be facilitated with this sensor for D dimer integrated with a microcatheter for the diagnosis of clot type, and as an indicator of the effectiveness, or end-point of thrombolytic therapy.

Glass, Robert S. (Livermore, CA); Grant, Sheila A. (Pleasanton, CA)

1999-01-01T23:59:59.000Z

13

Ultrafast Electron Transfer Dynamics in Ruthenium Polypyridyl Complexes with a -Conjugated Ligand  

E-Print Network (OSTI)

to the solvent and orders of magnitude more rapidly than in previously studied ruthenium-diquat or ruthenium [(bpy)2RuLDQ]4+ (Chart 1) by broadband femtosecond transient absorption spectroscopy in acetonitrile

Dutta, Prabir K.

14

A Very Short Ruthenium(II) - Nitrogen Heterocycle Bond  

NLE Websites -- All DOE Office Websites (Extended Search)

Very Short Ruthenium(II) - Nitrogen Heterocycle Bond: The Crystal Very Short Ruthenium(II) - Nitrogen Heterocycle Bond: The Crystal Structures of Pentaammine(N-methylpyrazinium)ruthenium(II) Iodide and Pentaammine(N-methylpyrazinium)ruthenium(III) p-Toluenesulfonate Pentahydrate James F. Wishart, Avi Bino and Henry Taube Inorg. Chem. 25, 3318-3321 (1986) Abstract: The crystal structures of [(NH3)5Ru(NC4H4NCH3)] I3 and [(NH3)5Ru(NC4H4NCH3)] (CH3C6H4SO3)4°5H2O have been solved to weighted R factors of 0.053 and 0.083, respectively. For the former structure, the space group is Pmma with a = 10.655(2)Å, b = 7.704(1)Å, c = 21.488(3)Å, and Z = 4. The Ru(II)-N(Mepyz) distance of 1.95(1)Å in this complex is the shortest yet reported for a ruthenium(II) to heteroctclic nitrogen bond. A difference of 0.04(1)Å between the cis (2.122(7)Å and 2.136(8)Å) and

15

Ruthenium polypyridyl phototriggers: from beginnings to perspectives  

Science Journals Connector (OSTI)

...C1428EHA,-Buenos Aires, Argentina One contribution of 18 to...a ligand. Given that the energy of the d-d state is somewhat...temperature, therefore, a higher energy 3MLCT band (which corresponds to a higher energy 1MLCT and a blue-shifted...

2013-01-01T23:59:59.000Z

16

Carbon dioxide adsorption and methanation on ruthenium  

SciTech Connect

The adsorption and methanation of carbon dioxide on a ruthenium-silica catalyst were studied using temperature-programmed desorption (TPD) and temperature-programmed reaction (TPR). Carbon dioxide adsorption was found to be activated; CO/sub 2/ adsorption increased significantly as the temperature increased from 298 to 435 K. During adsorption, some of the CO/sub 2/ dissociated to carbon monoxide and oxygen; upon hydrogen exposure at room temperature, the oxygen reacted to water. Methanation of adsorbed CO and of adsorbed CO/sub 2/, using TPR in flowing hydrogen, yielded a CH/sub 4/ peak with a peak temperature of 459 K for both adsorbates, indicating that both reactions follow the same mechanism after adsorption. This peak temperature did not change with initial surface coverage of CO, indicating that methanation is first order in CO coverage. The desorption and reaction spectra for Ru/SiO/sub 2/ were similar to those previously obtained for Ni/SiO/sub 2/, but both CO/sub 2/ formation and CH/sub 4/ formation proceeded faster on Ru. Also, the details of CO desorption and the changes in CO/sub 2/ and CO desorptions with initial coverage were different on the two metals. 5 figures, 3 tables.

Zagli, E.; Falconer, J.L.

1981-05-01T23:59:59.000Z

17

Benzene Dimer: Dynamic Structure and Thermodynamics Derived from...  

NLE Websites -- All DOE Office Websites (Extended Search)

Benzene Dimer: Dynamic Structure and Thermodynamics Derived from On-the-Fly ab initio DFT-D Molecular Dynamic Simulations. Benzene Dimer: Dynamic Structure and Thermodynamics...

18

Blue-eyed Babies  

NLE Websites -- All DOE Office Websites (Extended Search)

Blue-eyed Babies Blue-eyed Babies Name: Jill Location: N/A Country: N/A Date: N/A Question: One of my students asked me the other day why all babies are born with blue eyes, even though they are truly brown-eyed, once their eyes change colour. What causes this phenomenon? Exposure to air, maybe? Replies: Hi, First of all not all babies are born with blue eyes. This is especially evident in the Asian/ Indian continents. The cause for the delay is nothing more than a delay in the enzymes that bring on the darker color proteins. You are probably aware that eye color is determined by more than one gene. The darker colors have blue coloration as part of their make-up and that may be the only protein of the color exposed at birth for many individuals. The proteins that give the darker colors usually turn on within a year of birth and this timing varies with individuals.

19

Isotopic equilibration of carbon monoxide catalyzed by supported ruthenium  

SciTech Connect

Isotopic equilibration of carbon monoxide catalyzed by supported ruthenium was studied with oxygen-18 and carbon-13 labeled carbon monoxide in the presence and absence of hydrogen. The results showed that carbon monoxide was present on commercial alumina-supported ruthenium in a reactive undissociated form at 373/sup 0/K; that it adsorbed as a single carbonyl and in a geminal dicarbonyl form; and that hydrogen inhibited the exchange reaction by competitive adsorption and by stabilizing the carbonyl bond. The results elucidate the carbon monoxide methanation and Fischer-Tropsch reactions on this catalyst.

Bossi, A. (Cent. Ric. Novara); Zanderighi, L.; Carnisio, G.; Garbassi, F.; Giunchi, G.; Petrini, G.

1980-09-01T23:59:59.000Z

20

Single Bifunctional Ruthenium Catalyst for One-Pot Cyclization and Hydration giving Functionalized Indoles and Benzofurans  

E-Print Network (OSTI)

Soc. 2004, 126, 12232. Catalyst 1 is now available from7992 7995 Bifunctional Ruthenium Catalyst COMMUNICATIONuse of bifunctional catalyst 1 for hydration and cycliza-

Nair, Reji??N.; Lee, Paul??J.; Rheingold, Arnold??L.; Grotjahn, Douglas??B.

2010-01-01T23:59:59.000Z

Note: This page contains sample records for the topic "blue ruthenium dimer" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


21

Ruthenium Bisbipyridine Complexes of Horse Heart Cytochrome c  

NLE Websites -- All DOE Office Websites (Extended Search)

Ruthenium Bisbipyridine Complexes of Horse Heart Cytochrome c: Ruthenium Bisbipyridine Complexes of Horse Heart Cytochrome c: Characterization and Comparative Intramolecular Electron Transfer Rates Determined by Pulse Radiolysis and Flash Photolysis J. Luo, K. B. Reddy, A. S. Salameh, J. F. Wishart and S. S. Isied Inorg. Chem. 39, 2321-2329 (2000) [Find paper at ACS Publications] Abstract: The reaction of [Ru(bpy)2L(H2O)]2+ (bpy = 2,2'-bipyridine, L = imidazole, water) with reduced horse heart cytochrome c results in coordination of [RuII(bpy)2L] at the His 33 and His 26 sites. Coordination at the His 33 site gave a diastereomeric [RuII(bpy)2L]-His-cyt c (II) mixture favoring the L-Ru form regardless of the substituent on the bipyridine ligands, while substitution at the more buried His 26 site gave isomeric distribution that varies according to the substituent on the bipyridine

22

Hydrogen and oxygen adsorption stoichiometries on silica supported ruthenium nanoparticles  

SciTech Connect

Treatment under H{sub 2} at 300 C of Ru(COD)(COT) dispersed on silica yields 2 nm ruthenium nanoparticles, [Ru{sub p}/SiO{sub 2}], according to EXAFS, HRTEM and XPS. H{sub 2} adsorption measurements on [Ru{sub p}/SiO{sub 2}] in the absence of O{sub 2} show that Ru particles adsorb up to ca. 2 H per surface ruthenium atoms (2H/Ru{sub s}) on various samples; this technique can therefore be used to measure the dispersion of Ru particles. In contrast, O{sub 2} adsorption on [Ru{sub p}/SiO{sub 2}] leads to a partial oxidation of the bulk at 25 C, to RuO{sub 2} at 200 C and to sintering upon further reduction under H{sub 2}, showing that O{sub 2} adsorption cannot be used to measure the dispersion of Ru particles.

Berthoud, Romain; Delichere, Pierre; Gajan, David; Lukens, Wayne; Pelzer, Katrin; Basset, Jean-Marie; Candy, Jean-Pierre; Coperet, Christophe

2008-12-01T23:59:59.000Z

23

Synthesis of Ruthenium Carbonyl Complexes with Phosphine or Substituted Cp Ligands, and Their Activity in the Catalytic Deoxygenation of 1,2-Propanediol  

SciTech Connect

A ruthenium hydride with a bulky tetra-substituted Cp ligand, (Cp{sup iPr{sub 4}})Ru(CO){sub 2}H (Cp{sup iPr{sub 4}} = C{sub 5}(i-C{sub 3}H{sub 7}){sub 4}H) was prepared from the reaction of Ru{sub 3}(CO){sub 12} with 1,2,3,4-tetraisopropylcyclopentadiene. The molecular structure of (Cp{sup iPr{sub 4}})Ru(CO){sub 2}H was determined by X-ray crystallography. The ruthenium hydride complex (C{sub 5}Bz{sub 5})Ru(CO){sub 2}H (Bz = CH{sub 2}Ph) was similarly prepared. The Ru-Ru bonded dimer, [(1,2,3-trimethylindenyl)Ru(CO){sub 2}]{sub 2}, was produced from the reaction of 1,2,3-trimethylindene with Ru{sub 3}(CO){sub 12}, and protonation of this dimer with HOTf gives {l_brace}[(1,2,3-trimethylindenyl)Ru(CO){sub 2}]{sub 2}-({mu}-H){r_brace}{sup +}OTf{sup -}. A series of ruthenium hydride complexes CpRu(CO)(L)H [L = P(OPh){sub 3}, PCy{sub 3}, PMe{sub 3}, P(p-C{sub 6}H{sub 4}F){sub 3}] were prepared by reaction of Cp(CO){sub 2}RuH with added L. Protonation of (Cp{sup iPr{sub 4}})Ru(CO){sub 2}H, Cp*Ru(CO){sub 2}H, or CpRu(CO)[P-(OPh){sub 3}]H by HOTf at -80 C led to equilibria with the cationic dihydrogen complexes, but H{sub 2} was released at higher temperatures. Protonation of CpRu[P(OPh){sub 3}]{sub 2}H with HOTf gave an observable dihydrogen complex, {l_brace}CpRu[P-(OPh){sub 3}]{sub 2}({eta}{sup 2}-H{sub 2}){r_brace}+OTf{sup -} that was converted at -20 C to the dihydride complex {l_brace}CpRu[P(OPh){sub 3}]{sub 2}(H){sub 2}{r_brace}{sup +}OTf{sup -}. These Ru complexes serve as catalyst precursors for the catalytic deoxygenation of 1,2-propanediol to give n-propanol. The catalytic reactions were carried out in sulfolane solvent with added HOTf under H{sub 2} (750 psi) at 110 C.

Bullock, R.M.; Ghosh, P.; Fagan, P.J.; Marshall, W.J.; Hauptman, E.

2009-07-20T23:59:59.000Z

24

Stereoselective Binding of Ruthenium Complexes to Cytochrome c  

NLE Websites -- All DOE Office Websites (Extended Search)

Site-Dependent Stereoselective Binding of Ruthenium Aquobipyridine Site-Dependent Stereoselective Binding of Ruthenium Aquobipyridine Complexes to Histidine Side Chains in Horse Heart Cytochrome c Jian Luo, James F. Wishart, and Stephan S. Isied J. Am. Chem. Soc. 120, 12970-12971 (1998) [Find paper at ACS Publications] Abstract: Stereoselective covalent binding of the ruthenium complexes cis-[Ru(bpy)2(H2O)2]2+ (bpy = 2,2'-bipyridine) and cis-[Ru(dmbpy)2(H2O)2]2+ (dmbpy = 4,4'-dimethyl-2,2'-bipyridine) to the surface His 33 residue and the more buried His 26 residues of Horse heart cytochrome c (Hh cyt c) to form large enantiomeric excess of D-[Ru(dmbpy)2(H2O)]-His 26-cyt c (38%), but little or no excess of D-[Ru(bpy)2(H2O)]-His 26-cyt c (6%). At the surface exposed His 33 site, equal entiomeric excess of L-[Ru(dmbpy)2(H2O)]-His 33-cyt c and L-[Ru(bpy)2(H2O)]-His 33-cyt c (34%)

25

XPS Investigations of Ruthenium Deposited onto Representative Inner Surfaces of Nuclear Reactor Containment Buildings  

E-Print Network (OSTI)

XPS Investigations of Ruthenium Deposited onto Representative Inner Surfaces of Nuclear Reactor in a nuclear power plant, interactions of gaseous RuO4 with reactor containment building surfaces (stainless, during nuclear reactor operation, the fission-product ruthenium will accumulate in the fuel. The quantity

Paris-Sud XI, Université de

26

Vapor Deposition of Ruthenium from an Amidinate Precursor Huazhi Li,a  

E-Print Network (OSTI)

Vapor Deposition of Ruthenium from an Amidinate Precursor Huazhi Li,a Damon B. Farmer,b Roy G School of Engineering and Applied Sciences, Harvard University, Cambridge, Massachusetts 02138, USA October 11, 2007. Thin films of ruthenium have many current and potential appli- cations. They can be used

27

Permit Parking Emergency Blue Light  

E-Print Network (OSTI)

P P P P P P P P P P P P P P P P P PP P P P P P Permit Parking Food P P Emergency Blue Light underground Emergency Blue Light outdoors Wheelchair Wheelchair prior arrangements necessary Telephone Visitor 144 Albert Street 21 152 Albert Street 20 154 Albert Street 94 34 Barrie Street 91 68 Barrie Street 90

Abolmaesumi, Purang

28

Comparative study of dimer-vacancies and dimer-vacancy lines on Si(001) and Ge(001)  

E-Print Network (OSTI)

Comparative study of dimer-vacancies and dimer-vacancy lines on Si(001) and Ge(001) Cristian V that dimer- vacancy (DV) defects self-organize into vacancy lines (VLs) on Si(0 0 1), but not on Ge(0 0 1 the vacancies on Si(0 0 1) and Ge(0 0 1). We identify three energetic parameters which characterize the DVs

Ciobanu, Cristian

29

BlueFire Ethanol | Department of Energy  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

BlueFire Ethanol BlueFire Ethanol Construct and operate a facility that converts green waste and lignocellulosic fractions diverted from landfills or Southern California Materials...

30

Blue Ng | Open Energy Information  

Open Energy Info (EERE)

BA1 1SR Sector: Biomass Product: UK-based company that constructs and operates combined heat and intelligent power units fueled using liquid biomass. References: Blue-Ng1 This...

31

Cyanobacteria (blue-green algae)  

Science Journals Connector (OSTI)

Cyanobacteria (blue-green algae) occur naturally in freshwater environments including lakes...Reynolds, C.S. (1987) cyanobacterial blooms have done more to give eutrophication its bad name than any other conseque...

Alan Howard

1998-01-01T23:59:59.000Z

32

Substituents Dependent Capability of bis(ruthenium-dioxolene-terpyridine)Complexes Toward Water Oxidation  

SciTech Connect

The bridging ligand, 1,8-bis(2,2':6',2{double_prime}-terpyrid-4'-yl)anthracene (btpyan) was synthesized by the Miyaura-Suzuki cross coupling reaction of anthracenyl-1,8-diboronic acid and 4'-triflyl-2,2':6'-2{double_prime}-terpyridine in the presence of Pd(PPh{sub 3}){sub 4} (5 mol%) with 68% in yield. Three ruthenium-dioxolene dimers, [Ru{sub 2}(OH){sub 2}(dioxolene){sub 2}(btpyan)]{sup 0} (dioxolene = 3,6-di-tert-butyl-1,2-benzosemiquinone ([1]{sup 0}), 3,5-dichloro-1,2-benzosemiquinone ([2]{sup 0}) and 4-nitro-1,2-benzosemiquinone ([3]{sup 0})) were prepared by the reaction of [Ru{sub 2}Cl{sub 6}(btpyan)]{sup 0} with the corresponding catechol. The electronic structure of [1]{sup 0} is approximated by [Ru{sub 2}{sup II}(OH){sub 2}(sq){sub 2}(btpyan)]{sup 0} (sq = semiquinonato). On the other hand, the electronic states of [2]{sup 0} and [3]{sup 0} are close to [Ru{sub 2}{sup III}(OH){sub 2} (cat){sub 2}(btpyan)]{sup 0} (cat = catecholato), indicating that a dioxolene having electron-withdrawing groups stabilizes [Ru{sub 2}{sup III}(OH){sub 2}(cat){sub 2}(btpyan)]{sup 0} rather than [Ru{sub 2}{sup II}(OH){sub 2}(sq){sub 2}(btpyan)]{sup 0} as resonance isomers. No sign was found of deprotonation of the hydroxo groups of [1]{sup 0}, whereas [2]{sup 0} and [3]{sup 0} showed an acid-base equilibrium in treatments with t-BuOLi followed by HClO{sub 4}. Furthermore, controlled potential electrolysis of [1]{sup 0} deposited on an ITO (indium-tin oxide) electrode catalyzed the four-electron oxidation of H{sub 2}O to evolve O{sub 2} at potentials more positive than +1.6 V (vs. SCE) at pH 4.0. On the other hand, the electrolysis of [2]{sup 0} and [3]{sup 0} deposited on ITO electrodes did not show catalytic activity for water oxidation under similar conditions. Such a difference in the reactivity among [1]{sup 0}, [2]{sup 0} and [3]{sup 0} is ascribed to the shift of the resonance equilibrium between [Ru{sub 2}{sup II}(OH){sub 2}(sq){sub 2}(btpyan)]{sup 0} and [Ru{sub 2}{sup III}(OH){sub 2}(cat){sub 2}(btpyan)]{sup 0}.

Wada, T.; Muckerman, J.; Fujita, E.; Tanaka, K.

2010-12-23T23:59:59.000Z

33

On the Acid-Base Mechanism for Ruthenium Water Oxidation Catalysts  

E-Print Network (OSTI)

We present a detailed theoretical study of the pathway for water oxidation in synthetic ruthenium-based catalysts. As a first step, we consider a recently discovered single center catalyst, where experimental observations ...

Wang, Lee-Ping

34

Ruthenium or osmium complexes and their uses as catalysts for water oxidation  

DOE Patents (OSTI)

The present invention provides ruthenium or osmium complexes and their uses as a catalyst for catalytic water oxidation. Another aspect of the invention provides an electrode and photo-electrochemical cells for electrolysis of water molecules.

Concepcion Corbea, Javier Jesus; Chen, Zuofeng; Jurss, Jonah Wesley; Templeton, Joseph L; Hoertz, Paul; Meyer, Thomas J

2014-10-28T23:59:59.000Z

35

Helium 4 Dimer in Two Coaxial Adjacent Nanotubes  

Science Journals Connector (OSTI)

The ground state properties of the helium 4 dimer, within the geometry defined by two adjacent nanotubes with different radii and hard core walls,...

J. Brana; S. Kili?; L. Vranje

2002-01-01T23:59:59.000Z

36

Selective Aerobic Oxidation of 5-Hydroxymethylfurfural in Water Over Solid Ruthenium Hydroxide Catalysts with Magnesium-Based Supports  

Science Journals Connector (OSTI)

Solid catalyst systems comprised of ruthenium hydroxide supported on magnesium-based carrier materials (spinel, magnesium oxide and hydrotalcite) were investigated for the selective, aqueous aerobic oxidation of ...

Yury Y. Gorbanev; Sren Kegns; Anders Riisager

2011-12-01T23:59:59.000Z

37

Evidence from bond lengths and bond angles for enneacovalence of cobalt, rhodium, iridium, iron, ruthenium, and osmium in compounds with elements of medium electronegativity  

Science Journals Connector (OSTI)

...enneacovalence of cobalt, rhodium, iridium, iron, ruthenium, and osmium in compounds...enneacovalence of cobalt, rhodium, iridium, iron, ruthenium, and osmium in compounds...CO)10(diop)] 274.4 45 acac, acetylacetonate; diop, di-o-phthalate. Chemistry...

Linus Pauling

1984-01-01T23:59:59.000Z

38

Blue light emitting thiogallate phosphor  

DOE Patents (OSTI)

A crystalline blue emitting thiogallate phosphor of the formula RGa.sub.2 S.sub.4 :Ce.sub.x where R is selected from the group consisting of calcium, strontium, barium and zinc, and x is from about 1 to 10 atomic percent, the phosphor characterized as having a crystalline microstructure on the size order of from about 100 .ANG. to about 10,000 .ANG. is provided together with a process of preparing a crystalline blue emitting thiogallate phosphor by depositing on a substrate by CVD and resultant thin film electroluminescent devices including a layer of such deposited phosphor on an ordinary glass substrate.

Dye, Robert C. (Los Alamos, NM); Smith, David C. (Los Alamos, NM); King, Christopher N. (Portland, OR); Tuenge, Richard T. (Hillsboro, OR)

1998-01-01T23:59:59.000Z

39

Blue-green upconversion laser  

DOE Patents (OSTI)

A blue-green laser (450--550 nm) uses a host crystal doped with Tm[sup 3+]. The Tm[sup 3+] is excited through upconversion by a red pumping laser and an IR pumping laser to a state which transitions to a relatively lower energy level through emissions in the blue-green band, e.g., 450.20 nm at 75 K. The exciting laser may be tunable dye lasers or may be solid-state semiconductor laser, e.g., GaAlAs and InGaAlP. 3 figs.

Nguyen, D.C.; Faulkner, G.E.

1990-08-14T23:59:59.000Z

40

Blue-green upconversion laser  

DOE Patents (OSTI)

A blue-green laser (450-550 nm) uses a host crystal doped with Tm.sup.3+. The Tm.sup.+ is excited through upconversion by a red pumping laser and an IR pumping laser to a state which transitions to a relatively lower energy level through emissions in the blue-green band, e.g., 450.20 nm at 75 K. The exciting laser may be tunable dye lasers or may be solid-state semiconductor laser, e.g., GaAlAs and InGaAlP.

Nguyen, Dinh C. (Los Alamos, NM); Faulkner, George E. (Los Alamos, NM)

1990-01-01T23:59:59.000Z

Note: This page contains sample records for the topic "blue ruthenium dimer" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


41

Development of a stable cobalt-ruthenium Fisher-Tropsch catalyst. Final report  

SciTech Connect

The reverse micelle catalyst preparation method has been used to prepare catalysts on four supports: magnesium oxide, carbon, alumina- titania and steamed Y zeolite. These catalysts were not as active as a reference catalyst prepared during previous contracts to Union Carbide Corp. This catalyst was supported on steamed Y zerolite support and was impregnated by a pore-filling method using a nonaqueous solvent. Additional catalysts were prepared via pore- filling impregnation of steamed Y zeolites. These catalysts had levels of cobalt two to three and a half times as high as the original Union Carbide catalyst. On a catalyst volume basis they were much more active than the previous catalyst; on an atom by atom basis the cobalt was about of the same activity, i.e., the high cobalt catalysts` cobalt atoms were not extensively covered over and deactivated by other cobalt atoms. The new, high activity, Y zerolite catalysts were not as stable as the earlier Union Carbide catalyst. However, stability enhancement of these catalysts should be possible, for instance, through adjustment of the quantity and/or type of trace metals present. A primary objective of this work was determination whether small amounts of ruthenium could enhance the activity of the cobalt F-T catalyst. The reverse micelle catalysts were not activated by ruthenium, indeed scanning transmission electronic microscopy (STEM) analysis provided some evidence that ruthenium was not present in the cobalt crystallites. Ruthenium did not seem to activate the high cobalt Y zeolite catalyst either, but additional experiments with Y zeolite-supported catalysts are required. Should ruthenium prove not to be an effective promoter under the simple catalyst activation procedure used in this work, more complex activation procedures have been reported which are claimed to enhance the cobalt/ruthenium interaction and result in activity promotion by ruthenium.

Frame, R.R.; Gala, H.B.

1995-02-01T23:59:59.000Z

42

Blue Ribbon Commission on America's Nuclear Future Report to...  

Energy Savers (EERE)

Blue Ribbon Commission on America's Nuclear Future Report to the Secretary of Energy Blue Ribbon Commission on America's Nuclear Future Report to the Secretary of Energy The Blue...

43

High contrast solid state electrochromic devices based on Ruthenium Purple nanocomposites fabricated by layer-by-layer assemblyw  

E-Print Network (OSTI)

High contrast solid state electrochromic devices based on Ruthenium Purple nanocomposites: 10.1039/b803915a Electrochromic Ruthenium Purple­polymer nanocomposite films, fabricated by multilayer assembly, were found to exhibit sub-second switching speed and the highest electrochromic con

Heflin, Randy

44

Algae: Blue-greens in India  

Science Journals Connector (OSTI)

... THE recent upsurge of interest in the blue-green algae provided the background for the first international symposium on the taxonomy and biology of blue ... the background for the first international symposium on the taxonomy and biology of blue-green algae held at the University of Madras from January 8 to 13. The production of ...

A Correspondent

1970-01-24T23:59:59.000Z

45

Transport of Molecular Motor Dimers in Burnt-Bridge Models  

E-Print Network (OSTI)

Dynamics of molecular motor dimers, consisting of rigidly bound particles that move along two parallel lattices and interact with underlying molecular tracks, is investigated theoretically by analyzing discrete-state stochastic continuous-time burnt-bridge models. In these models the motion of molecular motors is viewed as a random walk along the lattices with periodically distributed weak links (bridges). When the particle crosses the weak link it can be destroyed with a probability $p$, driving the molecular motor motion in one direction. Dynamic properties and effective generated forces of dimer molecular motors are calculated exactly as a function of a concentration of bridges $c$ and burning probability $p$ and compared with properties of the monomer motors. It is found that the ratio of the velocities of the dimer and the monomer can never exceed 2, while the dispersions of the dimer and the monomer are not very different. The relative effective generated force of the dimer (as compared to the monomer) also cannot be larger than 2 for most sets of parameters. However, a very large force can be produced by the dimer in the special case of $c=1/2$ for non-zero shift between the lattices. Our calculations do not show the significant increase in the force generated by collagenase motor proteins in real biological systems as predicted by previous computational studies. The observed behavior of dimer molecular motors is discussed by considering in detail the particle dynamics near burnt bridges.

Alexander Yu. Morozov; Anatoly B. Kolomeisky

2007-09-21T23:59:59.000Z

46

Blue Summit | Open Energy Information  

Open Energy Info (EERE)

Summit Summit Jump to: navigation, search Name Blue Summit Facility Blue Summit Sector Wind energy Facility Type Commercial Scale Wind Facility Status In Service Owner NextEra Energy Resources Developer NextEra Energy Resources Energy Purchaser Undisclosed PPA Location Vernon TX Coordinates 34.304837°, -99.376873° Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"ROADMAP","zoom":14,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"350px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":34.304837,"lon":-99.376873,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}

47

Adsorption of silver dimer on graphene - A DFT study  

SciTech Connect

We performed a systematic density functional theory (DFT) study of the adsorption of silver dimer (Ag{sub 2}) on graphene using SIESTA (Spanish Initiative for Electronic Simulations with Thousands of Atoms) package, in the generalized gradient approximation (GGA). The adsorption energy, geometry, and charge transfer of Ag2-graphene system are calculated. The minimum energy configuration for a silver dimer is parallel to the graphene sheet with its two atoms directly above the centre of carbon-carbon bond. The negligible charge transfer between the dimer and the surface is also indicative of a weak bond. The methodology demonstrated in this paper may be applied to larger silver clusters on graphene sheet.

Kaur, Gagandeep, E-mail: gaganj1981@yahoo.com [Department of Physics and Centre of Advanced Studies in Physics, Panjab University, Chandigarh-160014, India and Chandigarh Engineering College, Landran, Mohali-140307, Punjab (India); Gupta, Shuchi [Department of Physics and Centre of Advanced Studies in Physics, Panjab University, Chandigarh-160014, India and University Institute of Engineering and Technology, Panjab University, Chandigarh -160014 (India); Rani, Pooja; Dharamvir, Keya [Department of Physics and Centre of Advanced Studies in Physics, Panjab University, Chandigarh-160014 (India)

2014-04-24T23:59:59.000Z

48

Isomerization of methyl linoleate on ruthenium(III) alkoxide complex; Mathematical modeling  

SciTech Connect

The isomerization of methyl linoleate using ruthenium alkoxide complexes is described. With alcohols, such as isopropyl alcohol (IPA), 1-butanol, 1-hexanol, and 1-octanol, isomerization of double bonds to produce a conjugated system is the main reaction, with hydrogenation being the side reaction. The latter is formed via the conjugated product. Based on kinetic and infrared spectroscopic data, it is concluded that the active catalytic species is a ruthenium hydride complex formed by the decomposition of the unstable alkoxide. The reaction is mathematically modeled, and the rate parameters are obtained by fitting the simulation to experimental data. These values are compared with data obtained from reactions carried out with supported ruthenium-nickel heterogeneous catalyst.

Mukesh, D.; Narasimhan, C.S.; Ramnarayan, K.; Deshpande, V.M

1989-08-01T23:59:59.000Z

49

Zeeman Effects in the Arc Spectrum of Ruthenium  

Science Journals Connector (OSTI)

Measurements on resolved Zeeman patterns of 450 lines of normal ruthenium are reported. Five exposures to each polarized component of the light from a 4-ampere arc, operated in magnetic fields of intensity between 71,000 and 92,200 gauss, resulted in 85 plates which were measured on an automatic comparator. J and g values have been determined from the various patterns. When data from the various lines arising from a given term are averaged, g values for 140 terms are obtained which appear to be correct to within 0.003 unit. The results obtained have been used to further the classification of Ru I, and to aid in the assignment of L and S values to highly perturbed terms. Though g values frequently depart strongly from values calculated for LS coupling, it is usually possible to assign meaningful L and S designations. Asymmetrical patterns in lines arising from the terms y5D30 and y5D40 are discussed.

George R. Harrison and J. Rand McNally; Jr.

1940-10-15T23:59:59.000Z

50

Selective oxidative synthesis of meso-beta fused porphyrin dimers  

NLE Websites -- All DOE Office Websites (Extended Search)

Selective oxidative synthesis of meso-beta fused porphyrin dimers Authors: Brennan, B.J., Arero, J., Liddell, P.A., Moore, T.A., Moore, A.L., and Gust, D. Title: Selective...

51

Deep Blue No. 2-A Resource in the Making at Blue Mountain | Open Energy  

Open Energy Info (EERE)

Deep Blue No. 2-A Resource in the Making at Blue Mountain Deep Blue No. 2-A Resource in the Making at Blue Mountain Jump to: navigation, search OpenEI Reference LibraryAdd to library Journal Article: Deep Blue No. 2-A Resource in the Making at Blue Mountain Abstract This paper provides a summary of the drilling operations, flow and injection testing and downhole measurements obtained during the drilling and testing of Deep Blue No.2. This well was sited as a step out to Deep Blue No.1 which measured 145°C at a depth of 645 meters. The maximum temperature recorded in Deep Blue No.2 while drilling was 167.5°C at a depth of 585 meters. Preliminary geothermometry from the short rigon flow test conducted last April 2004 indicated a parent reservoir temperature of 240°C. The results from the November 2004 flow and injection testing

52

{sup 106}Ruthenium Plaque Therapy (RPT) for Retinoblastoma  

SciTech Connect

Purpose: To evaluate the effectiveness of episcleral {sup 106}ruthenium plaque therapy (RPT) in the management of retinoblastoma. Methods and Materials: One hundred one RPTs were retrospectively analyzed that were performed in 90 eyes of 85 patients with retinoblastoma at National Cancer Center Hospital between 1998 and 2008. Each RPT had a corresponding tumor and 101 tumors were considered in the analysis of local control. Median follow-up length was 72.8 months. Median patient age at the RPT was 28 months. Median prescribed doses at reference depth and outer surface of the sclera were 47.4 Gy and 162.3 Gy, respectively. Results: Local control rate (LCR) and ocular retention rate (ORR) at 2 years were 33.7% and 58.7%, respectively. Unilateral disease, International Classification of Retinoblastoma group C or more advanced at the first presentation or at the time of RPT, vitreous and/or subretinal seeding, tumor size greater than 5 disc diameter (DD), reference depth greater than 5 mm, dose rate at reference depth lower than 0.7 Gy/hour, dose at the reference depth lower than 35 Gy, and (biologically effective dose with an {alpha}/{beta} ratio of 10 Gy) at the reference depth lower than 40 Gy{sub 10} were associated with unfavorable LCR. Two patients died of metastatic disease. Radiation complications included retinal detachment in 12 eyes (13.3%), proliferative retinopathy in 6 (6.7%), rubeosis iris in 2 (2.2%), and posterior subcapsular cataract in 23 (25.6%). Conclusion: RPT is an effective eye-preserving treatment for retinoblastoma.

Murakami, Naoya, E-mail: namuraka@ncc.go.jp [Department of Radiation Oncology, National Cancer Center Hospital, Tokyo (Japan)] [Department of Radiation Oncology, National Cancer Center Hospital, Tokyo (Japan); Suzuki, Shigenobu [Department of Ophthalmic Oncology, National Cancer Center Hospital, Tokyo (Japan)] [Department of Ophthalmic Oncology, National Cancer Center Hospital, Tokyo (Japan); Ito, Yoshinori [Department of Radiation Oncology, National Cancer Center Hospital, Tokyo (Japan)] [Department of Radiation Oncology, National Cancer Center Hospital, Tokyo (Japan); Yoshimura, Ryoichi [Department of Diagnostic Radiology and Oncology, Head and Neck Reconstruction Division, Graduate School, Tokyo Medical and Dental University, Tokyo (Japan)] [Department of Diagnostic Radiology and Oncology, Head and Neck Reconstruction Division, Graduate School, Tokyo Medical and Dental University, Tokyo (Japan); Inaba, Koji; Kuroda, Yuki; Morota, Madoka; Mayahara, Hiroshi; Sakudo, Mototake; Wakita, Akihisa; Okamoto, Hiroyuki; Sumi, Minako; Kagami, Yoshikazu [Department of Radiation Oncology, National Cancer Center Hospital, Tokyo (Japan)] [Department of Radiation Oncology, National Cancer Center Hospital, Tokyo (Japan); Nakagawa, Keiichi; Ohtomo, Kuni [Department of Radiology, University of Tokyo Hospital, Tokyo (Japan)] [Department of Radiology, University of Tokyo Hospital, Tokyo (Japan); Itami, Jun [Department of Radiation Oncology, National Cancer Center Hospital, Tokyo (Japan)] [Department of Radiation Oncology, National Cancer Center Hospital, Tokyo (Japan)

2012-09-01T23:59:59.000Z

53

Near-Infrared Electrochromic and Electroluminescent Polymers Containing Pendant Ruthenium Complex Groups  

E-Print Network (OSTI)

Near-Infrared Electrochromic and Electroluminescent Polymers Containing Pendant Ruthenium ComplexVised Manuscript ReceiVed August 30, 2006 ABSTRACT: A series of near-infrared (NIR) electrochromic. All the polymers are near-infrared (NIR) electrochromic, displaying an intense absorption centered

Wan, Xin-hua

54

Vapor Deposition of Ruthenium from an Amidinate Precursor Huazhi Li,a  

E-Print Network (OSTI)

Vapor Deposition of Ruthenium from an Amidinate Precursor Huazhi Li,a Damon B. Farmer,b Roy G. Gordon* ,a Youbo Lin,b Joost Vlassakb a Department of Chemistry and Chemical Biology and b School and potential applications. They can be used as electrodes for capacitors, in which their high work function

55

Investigation of ruthenium dioxide formation mechanisms in containment glass synthesized by liquid feed  

SciTech Connect

The presenting paper focuses on the structural configuration of ruthenium in vitreous matrices with the objective of obtaining more insight into ruthenium incorporation and solubilization mechanisms in borosilicate glasses. To determine the structural effect of an increasing RuO{sub 2} in a borosilicate glass, a series of glass samples were selected from a benchmark composition. {sup 11}B NMR shows that the borate network is influenced by the presence of RuO{sub 2} in the glass: the addition of 2% RuO{sub 2} in a borosilicate glass led to a significant rise of BO{sub 4}. RuO{sub 2} precipitated in the glass does not seem to be the cause of this modification because when RuO{sub 2} increase there is no further change of BO{sub 4} fraction. This effect can be therefore attributed to RuO{sub 2} dissolved in the glass. RuO{sub 2} is known to have a very low solubility in borosilicate glasses (50 to 2000 ppm depending on the temperature, sodium concentration and conditions of synthesis). The link between the ruthenium and the borated network is not yet clearly identified, however, assumptions can be made such as the formation of Ru-O-B when a sufficient quantity of Ru is add (> 400 ppm). Ruthenium could play the role of silicon in increasing the possibility of bridging bond formation with boron coordination number IV.

Sawada, K.; Shimada, T.; Sako, N.; Enokida, Y. [Graduate School of Engineering, Nagoya University (Japan); Schuller, S.; Angeli, F. [CEA-DEN-DTCD-LCV-SECM, 30207 Bagnols-sur-Ceze (France); Charpentier, T. [CEA-Saclay, DSM-IRAMIS-SIS2M, 91191 Gif-sur-Yvette (France)

2013-07-01T23:59:59.000Z

56

Blue Sky Batteries Inc | Open Energy Information  

Open Energy Info (EERE)

Batteries Inc Jump to: navigation, search Name: Blue Sky Batteries Inc Place: Laramie, Wyoming Zip: 82072-3 Product: Nanoengineers materials for rechargeable lithium batteries....

57

Blue Ribbon Commission (BRC) Activities - SRSCRO  

NLE Websites -- All DOE Office Websites (Extended Search)

canceled plans to build a permanent underground nuclear storage facility at Yucca Mountain in Nevada. The Department of Energy formed the 15-member Blue Ribbon...

58

Blue Oak Energy Inc | Open Energy Information  

Open Energy Info (EERE)

California Zip: 95618 Sector: Services Product: Focused on PV system design, planning, engineering, testing and commissioning services. References: Blue Oak Energy Inc1 This...

59

Blue Sun Biodiesel | Open Energy Information  

Open Energy Info (EERE)

Biodiesel Place: Fort Collins, Colorado Zip: 80525 Product: Privately held Blue Sun Biodiesel is a breakthrough agriculture energy company, developing oilseed energy crops and...

60

Blue Green Capital | Open Energy Information  

Open Energy Info (EERE)

Green Capital Jump to: navigation, search Name: Blue Green Capital Place: Spain Zip: 8860 Sector: Renewable Energy, Solar Product: String representation "Spanish develop ... their...

Note: This page contains sample records for the topic "blue ruthenium dimer" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


61

Nicole Hudson Sillerman Center Summer Internship at the Blue Cross Blue Shield of Massachusetts Foundation  

E-Print Network (OSTI)

Foundation Reflection Paper As a result of the generosity of the Sillerman Center for the Advancement of Philanthropy, I had the privilege of interning at The Blue Cross Blue Shield of Massachusetts Foundation (the Foundation) during the summer of 2011. The Foundation was founded in 2001 with an endowment from Blue Cross

Snider, Barry B.

62

Highly stable tetrathiafulvalene radical dimers in [3]catenanes  

SciTech Connect

Two [3]catenane 'molecular flasks' have been designed to create stabilized, redox-controlled tetrathiafulvalene (TTF) dimers, enabling their spectrophotometric and structural properties to be probed in detail. The mechanically interlocked framework of the [3]catenanes creates the ideal arrangement and ultrahigh local concentration for the encircled TTF units to form stable dimers associated with their discrete oxidation states. These dimerization events represent an affinity umpolung, wherein the inversion in electronic affinity replaces the traditional TTF-bipyridinium interaction, which is over-ridden by stabilizing mixed-valence (TTF){sub 2}{sup {sm_bullet}+} and radical-cation (TTF{sup {sm_bullet}+}){sub 2} states inside the 'molecular flasks.' The experimental data, collected in the solid state as well as in solution under ambient conditions, together with supporting quantum mechanical calculations, are consistent with the formation of stabilized paramagnetic mixed-valence dimers, and then diamagnetic radical-cation dimers following subsequent one-electron oxidations of the [3]catenanes.

Spruell, Jason M.; Coskun, Ali; Friedman, Douglas C.; Forgan, Ross S.; Sarjeant, Amy A.; Trabolsi, Ali; Fahrenbach, Albert C.; Barin, Gokhan; Paxton, Walter F.; Dey, Sanjeev K.; Olson, Mark A.; Bentez, Diego; Tkatchouk, Ekaterina; Colvin, Michael T.; Carmielli, Raanan; Caldwell, Stuart T.; Rosair, Georgina M.; Hewage, Shanika Gunatilaka; Duclairoir, Florence; Seymour, Jennifer L.; Slawin, Alexandra M.Z.; Goddard, III, William A.; Wasielewski, Michael R.; Cooke, Graeme; Stoddart, J. Fraser (CNRS-UMR); (CIT); (NWU); (Glasgow); (Heriot-Watt); (St Andrews)

2010-12-03T23:59:59.000Z

63

TEMPERATURE-PROGRAMMED DESORPTION AND REACTION OF CO AND H2 ON ALUMINA-SUPPORTED RUTHENIUM CATALYST  

E-Print Network (OSTI)

over Group VIII Metal Catalysts" J.T. Kummer and P.H.and Fischer- Iron Catalyst", to be published. P.R. Wentrek,on Alumina-supported Ruthenium Catalyst" to be published. M.

Low, Gordon Gongngai

2011-01-01T23:59:59.000Z

64

Ruthenium(VI) catalyzed oxidation of sodium salts of lactic, tartaric and glycolic acid by alkaline hexacyanoferrate(III)  

Science Journals Connector (OSTI)

The kinetics of ruthenium(VI) catalyzed oxidation of sodium salts of lactic, tartaric and glycolic acid by hexacyanoferrate(III) in aqueous alkaline medium have been studied at constant ionic strength. The rea...

P. Kumar; K. C. Gupta; K. Vehari

1985-01-01T23:59:59.000Z

65

Blue Flint Ethanol | Open Energy Information  

Open Energy Info (EERE)

Flint Ethanol Flint Ethanol Jump to: navigation, search Name Blue Flint Ethanol Place Underwood, North Dakota Zip ND 58576 Product Joint Venture bentween Great River Energy and Headwaters Incorporated, was established to build and operate a 50 million gallon per year dry mill ethanol plant in Underwood, North Dakota. References Blue Flint Ethanol[1] LinkedIn Connections CrunchBase Profile No CrunchBase profile. Create one now! This article is a stub. You can help OpenEI by expanding it. Blue Flint Ethanol is a company located in Underwood, North Dakota . References ↑ "Blue Flint Ethanol" Retrieved from "http://en.openei.org/w/index.php?title=Blue_Flint_Ethanol&oldid=342914" Categories: Clean Energy Organizations Companies Organizations Stubs What links here

66

Blue Marble Energy Corporation | Open Energy Information  

Open Energy Info (EERE)

Energy Corporation Energy Corporation Jump to: navigation, search Name Blue Marble Energy Corporation Place Seattle, Washington Zip 98108 Sector Bioenergy Product Washington State-based firm developing technology to convert biowaste into bioenergy and biochemicals. References Blue Marble Energy Corporation[1] LinkedIn Connections CrunchBase Profile No CrunchBase profile. Create one now! This article is a stub. You can help OpenEI by expanding it. Blue Marble Energy Corporation is a company located in Seattle, Washington . References ↑ "Blue Marble Energy Corporation" Retrieved from "http://en.openei.org/w/index.php?title=Blue_Marble_Energy_Corporation&oldid=380764" Categories: Clean Energy Organizations Companies Organizations Stubs What links here Related changes

67

Big Blue Wind Farm | Open Energy Information  

Open Energy Info (EERE)

Big Blue Wind Farm Big Blue Wind Farm Jump to: navigation, search Name Big Blue Wind Farm Facility Big Blue Wind Farm Sector Wind energy Facility Type Commercial Scale Wind Facility Status In Service Owner Exergy Developer Exergy Energy Purchaser Xcel Energy Location Blue Earth MN Coordinates 43.64324946°, -94.22179699° Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"ROADMAP","zoom":14,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"350px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":43.64324946,"lon":-94.22179699,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}

68

Protonation effect on the electronic properties of 2-pyridone monomer, dimer and its water clusters: A theoretical study  

SciTech Connect

The CC2 (second order approximate coupled cluster method) has been applied to investigate protonation effect on electronic transition energies of 2-pyridone (2PY), 2-pyridone dimer, and micro-solvated 2-pyridone (0-2 water molecules). The PE profiles of protonated 2-pyridone (2PYH{sup +}) as well as monohydrated 2PYH{sup +} at the different electronic states have been investigated. The {sup 1}??* state in protonated species (2PYH{sup +}) is a barrier free and dissociative state along the O-H stretching coordinate. In this reaction coordinate, the lowest lying {sup 1}??* predissociates the bound S{sub 1}({sup 1}??*) state, connecting the latter to a conical intersection with the S{sub 0} state. These conical intersections lead the {sup 1}??* state to proceed as predissociative state and finally direct the excited system to the ground state. Furthermore, in presence of water molecule, the {sup 1}??* state still remains dissociative but the conical intersection between {sup 1}??* and ground state disappears. In addition, according to the CC2 calculation results, it has been predicted that protonation significantly blue shifts the S{sub 1}-S{sub 0} electronic transition of monomer, dimer, and microhydrated 2-pyridone.

Saed, Behnaz [Department of Chemistry, University of Isfahan, 81746-73441 Isfahan (Iran, Islamic Republic of)] [Department of Chemistry, University of Isfahan, 81746-73441 Isfahan (Iran, Islamic Republic of); Omidyan, Reza, E-mail: r.omidyan@sci.ui.ac.ir, E-mail: reza.omidyan@u-psud.fr [Department of Chemistry, University of Isfahan, 81746-73441 Isfahan (Iran, Islamic Republic of) [Department of Chemistry, University of Isfahan, 81746-73441 Isfahan (Iran, Islamic Republic of); Centre Laser de lUniversit Paris Sud (LUMAT, FR, 2764), Bt. 106, Univ. Paris-Sud 11, 91405 Orsay Cedex (France)

2014-01-14T23:59:59.000Z

69

Deep Blue No 2- A Resource In The Making At Blue Mountain | Open Energy  

Open Energy Info (EERE)

2- A Resource In The Making At Blue Mountain 2- A Resource In The Making At Blue Mountain Jump to: navigation, search GEOTHERMAL ENERGYGeothermal Home Conference Paper: Deep Blue No 2- A Resource In The Making At Blue Mountain Details Activities (1) Areas (1) Regions (0) Abstract: This paper provides a summary of the drilling operations, flow and injection testing and downhole measurements obtained during the drilling and testing of Deep Blue No.2. This well was sited as a step out to Deep Blue No.1 which measured 145°C at a depth of 645 meters. The maximum temperature recorded in Deep Blue No.2 while drilling was 167.5°C at a depth of 585 meters. Preliminary geothermometry from the short rigon flow test conducted last April 2004 indicated a parent reservoir temperature of 240°C. The results from the November 2004 flow and

70

BluePlanet Capital LLC | Open Energy Information  

Open Energy Info (EERE)

BluePlanet Capital LLC Jump to: navigation, search Name: BluePlanet Capital LLC Place: Washington, Connecticut Zip: 6793 Sector: Services Product: BluePlanet Capital is an...

71

Magnetic-field induced absorption of zero-phonon lines in tris(bipyridine)ruthenium(2+) bis(hexafluorophosphate) and diperchlorate single crystals  

Science Journals Connector (OSTI)

Magnetic-field induced absorption of zero-phonon lines in tris(bipyridine)ruthenium(2+) bis(hexafluorophosphate) and diperchlorate single crystals ...

G. Hensler; E. Gallhuber; H. Yersin

1987-06-01T23:59:59.000Z

72

EA-1746: Blue Mountain Geothermal Development Project, Humboldt...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

NV EA-1746: Blue Mountain Geothermal Development Project, Humboldt & Pershing County, NV December 3, 2007 EA-1746: Final Environmental Assessment Blue Mountain Geothermal...

73

Blue Ribbon Commission on Americas Nuclear Future...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Future&0; Blue Ribbon Commission on America&8217;s Nuclear Future&0; Blue Ribbon Commission on America&8217;s Nuclear Future&0; More Documents & Publications Document...

74

Slim Holes At Blue Mountain Area (Warpinski, Et Al., 2002) |...  

Open Energy Info (EERE)

Blue Mountain Area (Warpinski, Et Al., 2002) Jump to: navigation, search GEOTHERMAL ENERGYGeothermal Home Exploration Activity: Slim Holes At Blue Mountain Area (Warpinski, Et Al.,...

75

Carolina Blue Skies & Green Jobs Initiative | Department of Energy  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

arravt064tiboyer2012o.pdf More Documents & Publications Carolinas Blue Skies & Green Jobs Initiative Carolina Blue Skies & Green Jobs Initiative New York State-wide...

76

Carolinas Blue Skies & Green Jobs Initiative | Department of...  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

Carolinas Blue Skies & Green Jobs Initiative Carolinas Blue Skies & Green Jobs Initiative 2010 DOE Vehicle Technologies and Hydrogen Programs Annual Merit Review and Peer...

77

Carolina Blue Skies & Green Jobs Initiative | Department of Energy  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

arravt064tiboyer2011p.pdf More Documents & Publications Carolinas Blue Skies & Green Jobs Initiative Carolina Blue Skies & Green Jobs Initiative Puget Sound Clean Cities...

78

Blue Ridge Renewable Energy LLC | Open Energy Information  

Open Energy Info (EERE)

Arlington, Virginia Zip: 22209 Product: Developer and operator of the Blue Ridge landfill energy project. References: Blue Ridge Renewable Energy LLC1 This article is a...

79

Structure of a Loose Dimer: an Intermediate in Nitric Oxide Synthase Assembly  

SciTech Connect

Cooperativity among ligand binding, subunit association, and protein folding has implications for enzyme regulation as well as protein aggregation events associated with disease. The binding of substrate l-arginine or cofactor tetrahydrobiopterin converts nitric oxide synthases (NOSs) from a 'loose dimer', with an exposed active center and higher sensitivity to proteolysis, to a 'tight dimer' competent for catalysis. The crystallographic structure of the Bacillus subtilis NOS loose dimer shows an altered association state with severely destabilized subdomains. Ligand binding or heme reduction converts loose dimers to tight dimers in solution and crystals. Mutations at key positions in the dimer interface that distinguish prokaryotic from eukaryotic NOSs affect the propensity to form loose dimers. The loose dimer structure indicates that non-native interactions can mediate subunit association in NOS.

Pant,K.; Crane, B.

2005-01-01T23:59:59.000Z

80

Zn?Zn Porphyrin Dimer-Sensitized Solar Cells: Toward 3-D Light Harvesting  

Science Journals Connector (OSTI)

Zn?Zn porphyrin dimers have been incorporated into thin dye-sensitized solar cells (DSSCs) to boost their light harvesting efficiency. The photoexcited dimers show efficient and fast electron injection into TiO2 indicating that both photoexcited ...

Attila J. Mozer; Matthew J. Griffith; George Tsekouras; Pawel Wagner; Gordon G. Wallace; Shogo Mori; Kenji Sunahara; Masanori Miyashita; John C. Earles; Keith C. Gordon; Luchao Du; Ryuzi Katoh; Akihiro Furube; David L. Officer

2009-10-09T23:59:59.000Z

Note: This page contains sample records for the topic "blue ruthenium dimer" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


81

Mercury dimer spectroscopy and an Einstein-Podolsky-Rosen experiment  

E-Print Network (OSTI)

The dissociation of a 199Hg2 dimer prepares an entangled state of two spatially separated 199Hg atoms, each with nuclear spin 1/2, and with zero total electron and nuclear spin angular momenta. This is identical to the entangled state of the two...

Qu, Xinmei

2009-05-15T23:59:59.000Z

82

Click Dimers To Target HIV TAR RNA Conformation Sunil Kumar,  

E-Print Network (OSTI)

toward HIV TAR RNA, when compared to the fluorescent Tat peptide, and show increased selectivity over acid protein) and regulates the level of transcription of HIV.4,5 The cooperative interaction of TatClick Dimers To Target HIV TAR RNA Conformation Sunil Kumar, Patrick Kellish, W. Edward Robinson

Stuart, Steven J.

83

Experimental Investigation of the Kinetics of a Ruthenium-Catalyzed Deconstruction of Lignin Model Compounds  

SciTech Connect

Lignin is a major component of plant cell walls that is typically underutilized in selective conversion strategies for renewable fuels and chemicals. The mechanisms by which thermal and catalytic treatments deconstruct lignin remain elusive. In this work, we have investigated the kinetics of the catalytic deconstruction of lignin model compounds using a ruthenium catalyst reported by Bergman et al. in 2010. A series of investigations using NMR spectroscopy and GC/MS will be presented. In addition, we propose detailed mechanisms for lignin depolymerization with ruthenium catalysts. We have also used DFT to compute transition state geometries of catalytic cycle intermediates and compare the values determined computationally with those observed experimentally. Ultimately, our objective is to apply our methods to the design of new homogeneous and heterogeneous catalysts for the effective deconstruction and valorization of lignin.

Bu, L.; Nimlos, M. R.; Shirts, M. R.; Himmel, M. E.; Crowley, M. F.; Beckham, G. T.

2012-01-01T23:59:59.000Z

84

Polyribosomes in Rat Tissues: IV. On the Abnormal Dimer Peak in Hepatomas  

Science Journals Connector (OSTI)

...previously (11) that the dimer peak which is present in both the...between the monomer and dimer peaks. Also only slight changes are...height of the monomer and dimer peaks when the Novikoff hepatoma was...in an equal volume of mineral oil 12 hr before removal of the...

Thomas E. Webb and Van R. Potter

1966-05-01T23:59:59.000Z

85

Precise ruthenium fission product isotopic analysis using dynamic reaction cell inductively coupled plasma mass spectrometry (DRC-ICP-MS)  

SciTech Connect

99Tc is a subsurface contaminant of interest at numerous federal, industrial, and international facilities. However, as a mono-isotopic fission product, 99Tc lacks the ability to be used as a signature to differentiate between the different waste disposal pathways that could have contributed to subsurface contamination at these facilities. Ruthenium fission-product isotopes are attractive analogues for the characterization of 99Tc sources because of their direct similarity to technetium with regard to subsurface mobility, and their large fission yields and low natural background concentrations. We developed an inductively coupled plasma mass spectrometry (ICP-MS) method capable of measuring ruthenium isotopes in groundwater samples and extracts of vadose zone sediments. Samples were analyzed directly on a Perkin Elmer ELAN DRC II ICP-MS after a single pass through a 1-ml bed volume of Dowex AG 50W-X8 100-200 mesh cation exchange resin. Precise ruthenium isotopic ratio measurements were achieved using a low-flow Meinhard-type nebulizer and long sample acquisition times (150,000 ms). Relative standard deviations of triplicate replicates were maintained at less than 0.5% when the total ruthenium solution concentration was 0.1 ng/ml or higher. Further work was performed to minimize the impact caused by mass interferences using the dynamic reaction cell (DRC) with O2 as the reaction gas. The aqueous concentrations of 96Mo and 96Zr were reduced by more than 99.7% in the reaction cell prior to injection of the sample into the mass analyzer quadrupole. The DRC was used in combination with stable-mass correction to quantitatively analyze samples containing up to 2-orders of magnitude more zirconium and molybdenum than ruthenium. The analytical approach documented herein provides an efficient and cost-effective way to precisely measure ruthenium isotopes and quantitate total ruthenium (natural vs. fission-product) in aqueous matrixes.

Brown, Christopher F.; Dresel, P. Evan; Geiszler, Keith N.; Farmer, Orville T.

2006-05-09T23:59:59.000Z

86

CA-TRIBE-BLUE LAKE RANCHERIA  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

CA-TRIBE-BLUE LAKE RANCHERIA CA-TRIBE-BLUE LAKE RANCHERIA Location: Tribe CA-TRIBE-BLUE CA LAKE RANCHERIA American Recovery and Reinvestment Act: Proposed Action or Project Description The Blue Lake Rancheria Tribe of California proposes to hire a technical consultant to gather additional information and make recommendations as to the best energy efficiency and conservation project or projects to utilize energy efficiency and conservation block grant funds. Following these recommendations, a decision will be made on building retrofits, and the specific retrofits will be identified and submitted for NEPA review. Conditions: None Categorical Exclusion(s) Applied: A9, A11 *-For the complete DOE National Environmental Policy Act regulations regarding categorical exclusions, see Subpart D of 10 CFR10 21

87

Blue Star Energy Services | Open Energy Information  

Open Energy Info (EERE)

BlueStar) BlueStar) Jump to: navigation, search Name Blue Star Energy Services Place Illinois Utility Id 55722 Utility Location Yes Ownership R NERC Location RFC NERC RFC Yes Activity Retail Marketing Yes References EIA Form EIA-861 Final Data File for 2010 - File1_a[1] LinkedIn Connections CrunchBase Profile No CrunchBase profile. Create one now! This article is a stub. You can help OpenEI by expanding it. Utility Rate Schedules Grid-background.png No rate schedules available. Average Rates Residential: $0.1180/kWh Commercial: $0.0687/kWh References ↑ "EIA Form EIA-861 Final Data File for 2010 - File1_a" Retrieved from "http://en.openei.org/w/index.php?title=Blue_Star_Energy_Services&oldid=409064" Categories: EIA Utility Companies and Aliases

88

Blue Ribbon Commission Tour of Hanford Site  

SciTech Connect

The Blue Ribbon Commission on America's Nuclear Future toured the Department of Energy's Hanford Site on July 14, 2010. Commission members, invited guests, and members of the public visited facilities that store high-level, radioactive waste.

Paul Saueressig

2010-07-14T23:59:59.000Z

89

Geothermal Technologies Program Blue Ribbon Panel Recommendations  

Energy.gov (U.S. Department of Energy (DOE))

This report describes the recommendations of the Geothermal Blue Ribbon Panel, a panel of geothermal experts assembled in March 2011 for a discussion on the future of geothermal energy in the U.S.

90

Blue Ribbon Commission Tour of Hanford Site  

ScienceCinema (OSTI)

The Blue Ribbon Commission on America's Nuclear Future toured the Department of Energy's Hanford Site on July 14, 2010. Commission members, invited guests, and members of the public visited facilities that store high-level, radioactive waste.

Paul Saueressig

2010-09-01T23:59:59.000Z

91

Thread-leaf Blue Star Amsonia hubrichtii  

E-Print Network (OSTI)

-20 inches tall. Upright. 8-14 inches tall. HABIT Early flowering. Light blue star- shaped flowers. Fine perennial for the right place. Right Perennial, Right Place Cornell University Department of Horticulture

92

Blue Jeans overview | Argonne National Laboratory  

NLE Websites -- All DOE Office Websites (Extended Search)

Desk Location Building 240, Room 1416 Type Meeting Blue Jeans is Argonne's new video, audio and web conferencing solution. Join CIS for an overview Monday, November 10, 2 p.m.,...

93

Inhomogeneous problems Q. How do you kill a blue elephant?  

E-Print Network (OSTI)

Inhomogeneous problems Q. How do you kill a blue elephant? A. With a blue elephant gun Q. How do you kill a pink elephant? A. Squeeze its trunk until it turns blue, and then shoot it with a blue elephant gun. Q. How do you kill a white elephant? A. Tickle it pink, then squeeze its trunk until it turns

DeTurck, Dennis

94

Structural and Functional Analysis of Mutations along the Crystallographic Dimer Interface of the Yeast TATA Binding Protein  

Science Journals Connector (OSTI)

...titration of recombinant TBP standards, spiked into a null...crystallographic dimer interface were mutated. Mutation...crystallographic dimer interface. Shown is a space-filling...wild type; std., standard. FIG. 3. Dimerization...crystallographic dimer interface. (A) Shown are space-filling...

Haiping Kou; Jordan D. Irvin; Kathryn L. Huisinga; Madhusmita Mitra; B. Franklin Pugh

2003-05-01T23:59:59.000Z

95

Ab initio correlated calculations of rare-gas dimer quadrupoles  

SciTech Connect

This paper reports ab initio calculations of rare gas (RG=Kr, Ar, Ne, and He) dimer quadrupoles at the second order of Moeller-Plesset perturbation theory (MP2). The study reveals the crucial role of the dispersion contribution to the RG{sub 2} quadrupole in the neighborhood of the equilibrium dimer separation. The magnitude of the dispersion quadrupole is found to be much larger than that predicted by the approximate model of Hunt. As a result, the total MP2 quadrupole moment is significantly smaller than was assumed in virtually all previous related studies. An analytical model for the distance dependence of the RG{sub 2} quadrupole is proposed. The model is based on the effective-electron approach of Jansen, but replaces the original Gaussian approximation to the electron density in an RG atom by an exponential one. The role of the nonadditive contribution in RG{sub 3} quadrupoles is discussed.

Donchev, Alexander G. [Algodign, LLC, Bolshaya Sadovaya 8, Moscow 123001 (Russian Federation)

2007-10-15T23:59:59.000Z

96

UV resonance Raman analysis of trishomocubane and diamondoid dimers  

SciTech Connect

We present resonance Raman measurements of crystalline trishomocubane and diamantane dimers containing a C=C double bond. Raman spectra were recorded with excitation energies between 2.33eV and 5.42eV. The strongest enhancement is observed for the C=C stretch vibration and a bending mode involving the two carbon atoms of the C=C bond, corresponding to the B{sub 2g} wagging mode of ethylene. This is associated with the localization of the ?-HOMO and LUMO and the elongation of the C=C bond length and a pyramidalization of the two sp{sup 2}-hybridized carbon atoms at the optical excitation. The observed Raman resonance energies of the trishomocubane and diamantane dimers are significantly lower than the HOMO-LUMO gaps of the corresponding unmodified diamondoids.

Meinke, Reinhard, E-mail: rene@physik.tu-berlin.de; Thomsen, Christian; Maultzsch, Janina [Institut fr Festkrperphysik, Technische Universitt Berlin, Hardenbergstr. 36, D-10623 Berlin (Germany)] [Institut fr Festkrperphysik, Technische Universitt Berlin, Hardenbergstr. 36, D-10623 Berlin (Germany); Richter, Robert; Merli, Andrea [Institut fr Optik und Atomare Physik, Technische Universitt Berlin, Hardenbergstr. 36, D-10623 Berlin (Germany)] [Institut fr Optik und Atomare Physik, Technische Universitt Berlin, Hardenbergstr. 36, D-10623 Berlin (Germany); Fokin, Andrey A. [Institute of Organic Chemistry, Justus-Liebig University, Heinrich-Buff-Ring 58, D-35392 Giessen (Germany) [Institute of Organic Chemistry, Justus-Liebig University, Heinrich-Buff-Ring 58, D-35392 Giessen (Germany); Department of Organic Chemistry, Kiev Polytechnic Institute, pr. Pobedy 37, 03056 Kiev (Ukraine); Koso, Tetyana V.; Schreiner, Peter R. [Institute of Organic Chemistry, Justus-Liebig University, Heinrich-Buff-Ring 58, D-35392 Giessen (Germany)] [Institute of Organic Chemistry, Justus-Liebig University, Heinrich-Buff-Ring 58, D-35392 Giessen (Germany); Rodionov, Vladimir N. [Department of Organic Chemistry, Kiev Polytechnic Institute, pr. Pobedy 37, 03056 Kiev (Ukraine)] [Department of Organic Chemistry, Kiev Polytechnic Institute, pr. Pobedy 37, 03056 Kiev (Ukraine)

2014-01-21T23:59:59.000Z

97

Pressure dependent diffraction and spectroscopy of a dimerized antiferromagnet  

SciTech Connect

We present pressure dependent neutron diffraction and inelastic neutron scattering measurements of the dimerized antiferromagnet Ba$_3$Mn$_2$O$_8$. The room temperature diffraction measurements reveal a linear decrease in lattice constant as a function of applied pressure. No structural transitions are observed. The low-temperature neutron spectroscopy measurements indicate a small change in magnetic scattering intensity in the vicinity of the spin gap for pressures up to $P=0.6$~kbar.

Stone, Matthew B [ORNL; Tulk, Christopher A [ORNL; dos Santos, Antonio M. [Oak Ridge National Laboratory (ORNL); Molaison, Jamie J [ORNL; Chang, S. [Ames Laboratory; Leo, J B [National Institute of Standards and Technology (NIST), Gaithersburg, MD; Samulon, Eric C [Stanford University; Shapiro, Max C [Stanford University; Fisher, Ian R [Stanford University

2011-01-01T23:59:59.000Z

98

Dynamics of microcavity exciton polaritons in a Josephson double dimer  

Science Journals Connector (OSTI)

We study the dynamics of exciton polaritons in a double-well configuration. The system consists of two weakly coupled Bose-Josephson junctions, each corresponding to a different circular polarization of the polaritons, forming a Josephson double dimer. We show that the Josephson oscillation between the wells is strongly coupled to the polarization rotation and that, consequently, Josephson excitation is periodically exchanged between the two polarizations. Linearized analysis agrees well with numerical simulations using typical experimental parameters.

Christine Khripkov; Carlo Piermarocchi; Amichay Vardi

2013-12-10T23:59:59.000Z

99

Coherence oscillations between weakly coupled Bose-Hubbard dimers  

Science Journals Connector (OSTI)

We study theoretically the dynamics of two weakly coupled Bose-Josephson junctions, prepared with the same particle number N and Josephson excitation number ? but with different reduced one-particle purity ?. An entropy oscillation mode is predicted, in which one-particle coherence is transferred between the Bose-Hubbard dimers with no particle or energy transfer. We explain this purity oscillation using a semiclassical picture.

Christine Khripkov and Amichay Vardi

2014-05-30T23:59:59.000Z

100

Deep Blue No 1- A Slimhole Geothermal Discovery At Blue Mountain, Humboldt  

Open Energy Info (EERE)

1- A Slimhole Geothermal Discovery At Blue Mountain, Humboldt 1- A Slimhole Geothermal Discovery At Blue Mountain, Humboldt County, Nevada Jump to: navigation, search GEOTHERMAL ENERGYGeothermal Home Conference Paper: Deep Blue No 1- A Slimhole Geothermal Discovery At Blue Mountain, Humboldt County, Nevada Details Activities (2) Areas (1) Regions (0) Abstract: The purpose of this paper is to provide a summary of the geology, drilling operations, and down-hole measurements obtained during the drilling of Deep Blue No.1. This well was sited on the basis of proximity to numerous gold exploration holes that indicated thermal water, high temperature gradients recorded in the 12 shallow gradient holes, and low resistivity values associated with certain interpreted major faults. The well was targeted to intersect fracture zones associated with the West and

Note: This page contains sample records for the topic "blue ruthenium dimer" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


101

Deep Blue No. 1-A Slimhole Geothermal Discovery at Blue Mountain, Humboldt  

Open Energy Info (EERE)

No. 1-A Slimhole Geothermal Discovery at Blue Mountain, Humboldt No. 1-A Slimhole Geothermal Discovery at Blue Mountain, Humboldt County, Nevada Jump to: navigation, search OpenEI Reference LibraryAdd to library Journal Article: Deep Blue No. 1-A Slimhole Geothermal Discovery at Blue Mountain, Humboldt County, Nevada Abstract The purpose of this paper is to provide a summary of the geology, drilling operations, and down-hole measurements obtained during the drilling of Deep Blue No.1. This well was sited on the basis of proximity to numerous gold exploration holes that indicated thermal water, high temperature gradients recorded in the 12 shallow gradient holes, and low resistivity values associated with certain interpreted major faults. The well was targeted to intersect fracture zones associated with the West and Central Faults, two

102

On the origin of the selectivity of oxygen reduction of ruthenium-containing electrocatalysts in methanol-containing electrolyte  

SciTech Connect

The reactivity with water and methanol of oxygen-reducing (Ru{sub 1{minus}x}Mo{sub x}SeO{sub z}) and oxygen (from water)-evolving electrocatalysts (RuS{sub 2}, RuO{sub 2}), which permit electron transfer via ruthenium d-states, was studied using electrochemical techniques and differential electrochemical mass spectroscopy (DEMS). In contrast to platinum, which is depolarized by methanol, ruthenium compounds show a high reactivity with water species and an extremely low reactivity with methanol. The authors conclude that the ruthenium-centered coordination chemical reactivity with water channels electrochemical currents, thus producing kinetic selectivity. The reason for the higher reactivity with water of Ru d-states as compared to platinum is seen in the higher density of d-states near the Fermi level as shown by this comparative study.

Alonso-Vante, N.; Bogdanoff, P.; Tributsch, H.

2000-03-10T23:59:59.000Z

103

Blue Valley Energy | Open Energy Information  

Open Energy Info (EERE)

Blue Valley Energy Blue Valley Energy Name Blue Valley Energy Address 3075 75th Street Place Boulder, Colorado Zip 80301 Sector Efficiency Product Geothermal heating and cooling systems Website http://www.bluevalleyenergy.co Coordinates 40.030298°, -105.179643° Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"ROADMAP","zoom":14,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"350px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":40.030298,"lon":-105.179643,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}

104

BlueFire Ethanol | Open Energy Information  

Open Energy Info (EERE)

BlueFire Ethanol BlueFire Ethanol Jump to: navigation, search Name BlueFire Ethanol Place Irvine, California Zip 92618 Sector Hydro Product US biofuel producer that utilises a patented concentrated acid hydrolysis technology to process various cellulosic waste materials into ethanol. Coordinates 41.837752°, -79.268594° Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"ROADMAP","zoom":14,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"350px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":41.837752,"lon":-79.268594,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}

105

Blue Waters: An Extraordinary Research Capability for  

E-Print Network (OSTI)

questions. The Office of C berinfrastr ct re in the National Science Fo ndation isThe OfficeBlue Waters: An Extraordinary Research Capability for Ad ancing Science & Engineering Frontiers in Computational and Information Sciences Seminar Series Advancing Science & Engineering Presented byPresented by

106

Blue Mountain Geothermal Area | Open Energy Information  

Open Energy Info (EERE)

Blue Mountain Geothermal Area Blue Mountain Geothermal Area (Redirected from Blue Mountain Area) Jump to: navigation, search GEOTHERMAL ENERGYGeothermal Home Geothermal Resource Area: Blue Mountain Geothermal Area Contents 1 Area Overview 2 History and Infrastructure 3 Regulatory and Environmental Issues 4 Exploration History 5 Well Field Description 6 Geology of the Area 7 Geofluid Geochemistry 8 NEPA-Related Analyses (2) 9 Exploration Activities (15) 10 References Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"TERRAIN","zoom":6,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"500px","height":"300px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":41,"lon":-118.13,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}

107

Blue Sun Biodiesel LLC | Open Energy Information  

Open Energy Info (EERE)

Blue Sun Biodiesel LLC Blue Sun Biodiesel LLC Jump to: navigation, search Logo: Blue Sun Energy, Inc. Name Blue Sun Energy, Inc. Address 14143 Denver West Parkway Place Golden, Colorado Zip 80401 Sector Biofuels Product Biofuels marketer and distributor Year founded 2001 Number of employees 11-50 Phone number 303-865-7700 Website http://www.gobluesun.com/ Coordinates 39.7438336°, -105.1614242° Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"ROADMAP","zoom":14,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"350px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":39.7438336,"lon":-105.1614242,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}

108

A problem on a dimer adsorbed at single-sheet graphene  

SciTech Connect

In the context of the previously proposed M model for the density of states in graphene (Davydov and Sabirova [3]), two adatoms coupled via the amplitude of electron transitions from one adatom to the other (direct exchange) are considered. An analytical expression for the energy density of states in/for the dimer is derived, and the dependence of the charge of the dimer's constituent atoms on the parameters of the problem is analyzed. The effect of image forces is investigated. In the context of the surface molecule model, a dimer composed of hydrogen adatoms is considered. The dissociation and desorption energies of such a dimer are estimated.

Davydov, S. Yu., E-mail: Sergei_Davydov@mail.ru [Russian Academy of Sciences, Ioffe Physical Technical Institute (Russian Federation)

2012-03-15T23:59:59.000Z

109

IBM Blue Gene Parallel Supercomputer, Brookhaven National Laboratory, (BNL)  

NLE Websites -- All DOE Office Websites (Extended Search)

How to Login How to Login Please note, New York Blue/L has been decommissioned and these web pages have not yet been updated to reflect its removal from service. The New York Blue/P is now one rack and remains in service. The BNL Blue Gene/Q also remains in service. Introduction Accessing the Blue Gene SSH Gateways Accessing the Blue Gene Front-End Nodes Accessing the Visualization Cluster Accessing the CSC GPU Cluster SSH Tunneling Introduction The only way to access Blue Gene computing resources remotely (outside the Blue Gene network enclave) is through the Blue Gene ssh gateways. Even users connecting from inside the BNL campus network need to go through the gateways. Outside the BNL campus the gateways are known as: ssh.bluegene.bnl.gov Inside the BNL campus they are known as: ssh.bluegene.bnl.local

110

BlueSol Solar Energy | Open Energy Information  

Open Energy Info (EERE)

BlueSol Solar Energy Jump to: navigation, search Name: BlueSol - Solar Energy Place: Sao Paulo, Sao Paulo, Brazil Zip: 04551-060 Sector: Solar Product: Sao Paulo-based sole...

111

T-720: Blue Coat Director HTTP Trace Processing Flaw Permits...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

0: Blue Coat Director HTTP Trace Processing Flaw Permits Cross-Site Scripting Attacks T-720: Blue Coat Director HTTP Trace Processing Flaw Permits Cross-Site Scripting Attacks...

112

Green Lands Blue Water 2014 Fall Conference | Department of Energy  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

Green Lands Blue Water 2014 Fall Conference Green Lands Blue Water 2014 Fall Conference November 18, 2014 10:00AM CST to November 20, 2014 4:00PM CST Richland Community College...

113

Well Log Data At Blue Mountain Geothermal Area (Fairbank & Niggemann...  

Open Energy Info (EERE)

well Deep Blue No. 1. Notes Well log data was collected in Deep Blue No. 1 upon its completion. The logging was conducted by Welaco Well Analysis Corporation. Temperature,...

114

Interested Parties - BlueGreen Alliance | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

BlueGreen Alliance Interested Parties - BlueGreen Alliance 09-25-10Section136ATVM.pdf More Documents & Publications Interested Parties - MEMA Interested Parties - United Auto...

115

Reaction of trans-dichloro-bis[N(1)-methyl-2-(arylazo)imidazole] ruthenium(II) with tertiary phosphines  

Science Journals Connector (OSTI)

Trans-dichloro-bis[N(1)-methyl-2-(arylazo)imidazol e] ruthenium(II) (tcc-Ru(MeL)2Cl2) reacts with tertiary phosphines giving rise to species of type [RuCl(P)-(MeL)2]+ and [Ru(P-P)(MeL)2]2+ in which Cl, P and P...

Tarun Kumar Misra; Chittaranjan Sinha

1999-04-01T23:59:59.000Z

116

Emission Zone Control in Blue Organic Electrophosphorescent Devices...  

NLE Websites -- All DOE Office Websites (Extended Search)

Electrophosphorescent Devices Through Chemical Modification of Host Materials . Emission Zone Control in Blue Organic Electrophosphorescent Devices Through Chemical...

117

Laboratory Shuttle Bus Routes: Blue Route  

NLE Websites -- All DOE Office Websites (Extended Search)

Blue Route Map (On-Site/Off-Site) Blue Route Map (On-Site/Off-Site) Scroll down or click here for schedule ↓ Printable Map Blue Route map Blue Route Schedule Effective May 3, 2013 Text Box: BLUE SHUTTLE SCHEDULE BLUE Route # 65 DOWNHILL BART 65 UPHILL 62/66 1 6:20 AM 6:30 AM 6:40 AM 6:52 AM 2 6:30 AM 6:40 AM 6:50 AM 7:02 AM 3 6:40 AM 6:50 AM 7:00 AM 7:12 AM 4 6:50 AM 7:00 AM 7:10 AM 7:22 AM 1 7:04 AM 7:16 AM 7:28 AM 7:40 AM 2 7:16 AM 7:28 AM 7:40 AM 7:52 AM 3 7:28 AM 7:40 AM 7:52 AM 8:04 AM 4 7:40 AM 7:52 AM 8:04 AM 8:16 AM 1 7:52 AM 8:04 AM 8:16 AM 8:28 AM 2 8:04 AM 8:16 AM 8:28 AM 8:40 AM 3 8:16 AM 8:28 AM 8:40 AM 8:52 AM 4 8:28 AM 8:40 AM 8:52 AM 9:04 AM 1 8:40 AM 8:52 AM 9:04 AM 9:16 AM 2 8:52 AM 9:04 AM 9:16 AM 9:28 AM 3 9:04 AM 9:16 AM 9:28 AM 9:40 AM 4 9:16 AM 9:28 AM 9:40 AM 9:52 AM 1 9:28 AM 9:40 AM 9:52 AM 10:04 AM 2 9:40 AM 9:52 AM 10:04 AM 10:16 AM 3 9:52 AM 10:04 AM

118

Blue Ribbon Commission on America's Nuclear Future  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Blue Ribbon Commission on America's Nuclear Future Blue Ribbon Commission on America's Nuclear Future Agenda March 25 - 26, 2010 Willard Intercontinental Hotel, Washington, DC Thursday, March 25, 2010 Open Meeting - Grand Ballroom 11:00 a.m. Open meeting/review agenda Tim Frazier 11:10 a.m. Opening comments from Secretary Chu 11:25 a.m. Opening discussion - Co-chairs Honorable Lee Hamilton General Brent Scowcroft 11:35 a.m. Opening discussion - members Honorable Pete Domenici Honorable Chuck Hagel Honorable Phil Sharp Mr. Mark H. Ayers Honorable Vicky Bailey Dr. Albert Carnesale Ms. Susan Eisenhower Mr. Jonathan Lash Dr. Allison Macfarlane Dr. Richard A. Meserve Dr. Ernie Moniz Mr. John Rowe Dr. Per F. Peterson 12:30 p.m. Lunch

119

Blue Canyon VI | Open Energy Information  

Open Energy Info (EERE)

VI VI Jump to: navigation, search Name Blue Canyon VI Facility Blue Canyon VI Sector Wind energy Facility Type Commercial Scale Wind Facility Status In Service Owner EDP Renewables North America LLC Developer EDP Renewables North America LLC Energy Purchaser Merchant Location Lawton OK Coordinates 34.8582°, -98.54752° Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"ROADMAP","zoom":14,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"350px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":34.8582,"lon":-98.54752,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}

120

Blue Creek Wind Farm | Open Energy Information  

Open Energy Info (EERE)

Farm Farm Jump to: navigation, search Name Blue Creek Wind Farm Facility Blue Creek Wind Farm Sector Wind energy Facility Type Commercial Scale Wind Facility Status In Service Owner Iberdrola Renewables Developer Iberdrola Renewables Energy Purchaser First Energy Solutions Location Van Wert County OH Coordinates 41.018286°, -84.615355° Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"ROADMAP","zoom":14,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"350px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":41.018286,"lon":-84.615355,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}

Note: This page contains sample records for the topic "blue ruthenium dimer" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


121

Blue Sky Optimum Energy | Open Energy Information  

Open Energy Info (EERE)

Optimum Energy Optimum Energy Jump to: navigation, search Name Blue Sky Optimum Energy Place Buffalo, New York Product Blue Sky offers a processing system to produce biodiesel at a cheaper price. Coordinates 42.88544°, -78.878464° Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"ROADMAP","zoom":14,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"350px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":42.88544,"lon":-78.878464,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}

122

Summit Blue Consulting | Open Energy Information  

Open Energy Info (EERE)

Summit Blue Consulting Summit Blue Consulting Place Boulder, Colorado Zip 80302 Sector Efficiency, Renewable Energy Product String representation "Consulting firm ... egy development" is too long. Coordinates 42.74962°, -109.714163° Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"ROADMAP","zoom":14,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"350px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":42.74962,"lon":-109.714163,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}

123

Blue Sky Bio Fuels | Open Energy Information  

Open Energy Info (EERE)

Bio Fuels Bio Fuels Jump to: navigation, search Name Blue Sky Bio-Fuels Place Oakland, California Zip 94602 Product Blue Sky owns and operates a biodiesel plant in Idaho with a capacity of 37.9mLpa (10m gallons annually). Coordinates 37.805065°, -122.273024° Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"ROADMAP","zoom":14,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"350px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":37.805065,"lon":-122.273024,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}

124

Internal Kinematics of Luminous Compact Blue Galaxies  

E-Print Network (OSTI)

We describe the dynamical properties which may be inferred from HST/STIS spectroscopic observations of luminous compact blue galaxies (LCBGs) between 0.1blue rest-frame color, small size and line-width, and high surface-brightness, their detailed morphology is eclectic. Here we determine the amplitude of rotation versus random, or disturbed motions of the ionized gas. This information affirms the accuracy of dynamical mass and M/L estimates from Keck integrated line-widths, and hence also the predictions of the photometric fading of these unusual galaxies. The resolved kinematics indicates this small subset of LCBGs are dynamically hot, and unlikely to be embedded in disk systems.

Matthew A. Bershady; M. Vils; C. Hoyos; R. Guzman; D. C. Koo

2004-11-22T23:59:59.000Z

125

THE 3D DIMER AND ISING PROBLEMS REVISITED MARTIN LOEBL AND LENKA ZDEBOROV  

E-Print Network (OSTI)

THE 3D DIMER AND ISING PROBLEMS REVISITED MARTIN LOEBL AND LENKA ZDEBOROV #19; A Abstract. We adjacency matrices, and the #12;nite 3D Ising partition sum as a linear combination of products over in basic statistical physics models, the Ising and the Dimer models. Let us mention two such recent

Loebl, Martin

126

An ethanol-solvated centrosymmetric dimer of bismuth(III) and thiosaccharinate resulting from `semicoordination' contacts  

Science Journals Connector (OSTI)

In an ethanol-solvated centrosymmetric dimer of bismuth(III) and thiosaccharinate, the Bi3+ cation is coordinated by three thiosaccharinate ligands, all of them acting as bidentate chelates through the N and exocyclic S atoms (in a 2N,S mode). Centrosymmetric dimers result from the association of molecules via - interactions.

Dennehy, M.

2014-05-28T23:59:59.000Z

127

Photochemical dimerization of a fluorinated dibenzylideneacetone in chloroform solution  

Science Journals Connector (OSTI)

(1E,4E)-1,5-Bis(2,6-difluorophenyl)penta-1,4-dien-3-one dimerizes under sunlight in chloroform solution to form the corresponding cyclobutane derivative. The dimer shows the `truxillic acid'-type arrangement of crystallographic centres of inversion, with cell dimensions closely related to those of the monomer.

Schwarzer, A.

2014-01-09T23:59:59.000Z

128

Higher Energy States in the CO Dimer: Millimeter-Wave Spectra and Rovibrational Calculations  

E-Print Network (OSTI)

Higher Energy States in the CO Dimer: Millimeter-Wave Spectra and Rovibrational Calculations Leonid millimeter-wave data yielded the precise location of 33 new energy levels of A+ symmetry and 20 levels of A extensive millimeter-wave measurements of the 12C16O dimer have been made, and more than 300 new spectral

129

Complexation of fisetin with novel cyclosophoroase dimer to improve solubility and bioavailability  

Science Journals Connector (OSTI)

Abstract Rhizobium species produce cyclosophoraose (Cys), which is an unbranched cyclic ?-(1,2)-glucan. We synthesized novel cationic cyclosophoraose dimer (Cys dimer) and its structure was confirmed via NMR spectroscopy and MALDI-TOF mass spectrometry analysis. In this study, we investigated the complexation of hardly soluble drug fisetin (3,3?,4?,7-tetrahydroxyflavone) with Cys dimer to improve the solubility of fisetin, and its solubility was increased up to 6.5-fold. The solubility of fisetin with Cys dimer showed 2.4-fold better than with ?-cyclodextrin. The fisetinCys dimer complex was characterized by using, phase solubility diagram, 2D NMR, FT-IR spectroscopy, SEM, DSC analysis and molecular modeling. Through the molecular docking simulations, complexation ability of fisetin with host molecules were in the following order: Cys dimer>Cys monomer>?-CD. The fisetinCys dimer complex showed also higher cytotoxicity to HeLa cells than free fisetin, indicating that the Cys dimer to improve bioavailability of fisetin.

Daham Jeong; Jae Min Choi; Youngjin Choi; Karpjoo Jeong; Eunae Cho; Seunho Jung

2013-01-01T23:59:59.000Z

130

Nonlinear friction of a damped dimer sliding on a periodic substrate S. Gonalves,1,2,  

E-Print Network (OSTI)

Nonlinear friction of a damped dimer sliding on a periodic substrate S. Gonçalves,1,2, * V. M, USA (Received 23 July 2004; published 12 November 2004) The nonlinear sliding friction of a dimer over that the friction force has an approximate v-3 depen- dence if the velocity is sufficiently large

Kenkre, V.M.

131

Modulation of Substrate Efflux in Bacterial Small Multidrug Resistance Proteins by Mutations at the Dimer Interface  

Science Journals Connector (OSTI)

...WT structure by measuring the intermonomer...the propagated standard errors of the means...was determined by measuring bacterial cell...TM4 dimerization interface have different...2003. Three-dimensional structure of the...mutations at the dimer interface. | Bacteria evade...

Bradley E. Poulsen; Fiona Cunningham; Kate K. Y. Lee; Charles M. Deber

2011-09-02T23:59:59.000Z

132

Crossover energetics for halogenated Si(100): Vacancy line defects, dimer vacancy lines, and atom vacancy lines  

Science Journals Connector (OSTI)

We investigated surface patterning of I-Si(100)-(21) both experimentally and theoretically. Using scanning tunneling microscopy, we first examined I destabilization of Si(100)-(21) at near saturation. Dimer vacancies formed on the terraces at 600 K, and they grew into lines that were perpendicular to the dimer rows, termed vacancy line defects. These patterns were distinctive from those induced by Cl and Br under similar conditions since the latter formed atom and dimer vacancy lines that were parallel to the dimer rows. Using first-principles density functional theory, we determined the steric repulsive interactions associated with iodine and showed how the observed defect patterns were related to these interactions. Concentration-dependent studies showed that the vacancy patterns were sensitive to the I concentration. Dimer and atom vacancy lines that were elongated along the dimer row direction were favored at lower coverage. Atom vacancy lines dominated at ?0.8ML, they coexisted with dimer vacancy lines at ?0.6-0.7ML, and dimer vacancy lines were exclusively observed below ?0.5ML. These surface patterns reflect the mean strength of the adatom repulsive interactions.

G. J. Xu; N. A. Zarkevich; Abhishek Agrawal; A. W. Signor; B. R. Trenhaile; D. D. Johnson; J. H. Weaver

2005-03-30T23:59:59.000Z

133

Electron-nuclear correlations for photo-induced dynamics in molecular dimers  

E-Print Network (OSTI)

processes are accompanied by a noticeable growth of the nuclear coordinate dispersion associatedElectron-nuclear correlations for photo-induced dynamics in molecular dimers Dmitri S. Kilin, Yuri dimers is drastically affected by the dynamic reorganization of inter- and intra- molecular nuclear

134

Superfluidity and Dimerization in a Multilayered System of Fermionic Polar Molecules  

SciTech Connect

We consider a layered system of fermionic molecules with permanent dipole moments aligned perpendicular to the layers by an external field. The dipole interactions between fermions in adjacent layers are attractive and induce interlayer pairing. Because of the competition for pairing among adjacent layers, the mean-field ground state of the layered system is a dimerized superfluid, with pairing only between every other layer. We construct an effective Ising-XY lattice model that describes the interplay between dimerization and superfluid phase fluctuations. In addition to the dimerized superfluid ground state, and high-temperature normal state, at intermediate temperature, we find an unusual dimerized ''pseudogap'' state with only short-range phase coherence. We propose light-scattering experiments to detect dimerization.

Potter, Andrew C. [Department of Physics, Massachusetts Institute of Technology, Cambridge, Massachusetts 02139 (United States); Berg, Erez; Halperin, Bertrand I.; Demler, Eugene [Department of Physics, Harvard University, Cambridge, Massachusetts 02138 (United States); Wang, Daw-Wei [Physics Department and NCTS, National Tsing-Hua University, Hsinchu 30013, Taiwan (China)

2010-11-26T23:59:59.000Z

135

Human Macrophage Inflammatory Protein 3?: Protein and Peptide Nuclear Magnetic Resonance Solution Structures, Dimerization, Dynamics, and Anti-Infective Properties  

Science Journals Connector (OSTI)

...directly across the dimer interface on top of the b sheet...away from the dimer interface and is therefore not...the core b strands, measuring about 76 2.0 (59...by the use of two-dimensional homonuclear proton...His40 in the dimer interface. Moreover, a constrained...

David I. Chan; Howard N. Hunter; Brian F. Tack; Hans J. Vogel

2007-12-17T23:59:59.000Z

136

MOCK OBSERVATIONS OF BLUE STRAGGLERS IN GLOBULAR CLUSTER MODELS  

SciTech Connect

We created artificial color-magnitude diagrams of Monte Carlo dynamical models of globular clusters and then used observational methods to determine the number of blue stragglers in those clusters. We compared these blue stragglers to various cluster properties, mimicking work that has been done for blue stragglers in Milky Way globular clusters to determine the dominant formation mechanism(s) of this unusual stellar population. We find that a mass-based prescription for selecting blue stragglers will select approximately twice as many blue stragglers than a selection criterion that was developed for observations of real clusters. However, the two numbers of blue stragglers are well-correlated, so either selection criterion can be used to characterize the blue straggler population of a cluster. We confirm previous results that the simplified prescription for the evolution of a collision or merger product in the BSE code overestimates their lifetimes. We show that our model blue stragglers follow similar trends with cluster properties (core mass, binary fraction, total mass, collision rate) as the true Milky Way blue stragglers as long as we restrict ourselves to model clusters with an initial binary fraction higher than 5%. We also show that, in contrast to earlier work, the number of blue stragglers in the cluster core does have a weak dependence on the collisional parameter ? in both our models and in Milky Way globular clusters.

Sills, Alison; Glebbeek, Evert [Department of Physics and Astronomy, McMaster University, Hamilton, Ontario L8S 4M1 (Canada); Chatterjee, Sourav [Department of Astronomy, University of Florida, Gainesville, FL 32611 (United States); Rasio, Frederic A., E-mail: asills@mcmaster.ca, E-mail: e.glebbeek@astro.ru.nl, E-mail: s.chatterjee@astro.ufl.edu, E-mail: rasio@northwestern.edu [Center for Interdisciplinary Exploration and Research in Astrophysics (CIERA) and Department of Physics and Astronomy, Northwestern University, 2145 Sheridan Road, Evanston, IL 60208 (United States)

2013-11-10T23:59:59.000Z

137

Blue, green, orange, and red upconversion laser  

DOE Patents (OSTI)

A laser for outputting visible light at the wavelengths of blue, green, orange and red light. This is accomplished through the doping of a substrate, such as an optical fiber or waveguide, with Pr.sup.3+ ions and Yb.sup.3+ ions. A light pump such as a diode laser is used to excite these ions into energy states which will produce lasing at the desired wavelengths. Tuning elements such as prisms and gratings can be employed to select desired wavelengths for output.

Xie, Ping (San Jose, CA); Gosnell, Timothy R. (Sante Fe, NM)

1998-01-01T23:59:59.000Z

138

Blue, green, orange, and red upconversion laser  

DOE Patents (OSTI)

A laser is disclosed for outputting visible light at the wavelengths of blue, green, orange and red light. This is accomplished through the doping of a substrate, such as an optical fiber or waveguide, with Pr{sup 3+} ions and Yb{sup 3+} ions. A light pump such as a diode laser is used to excite these ions into energy states which will produce lasing at the desired wavelengths. Tuning elements such as prisms and gratings can be employed to select desired wavelengths for output. 11 figs.

Xie, P.; Gosnell, T.R.

1998-09-08T23:59:59.000Z

139

IBM Blue Gene Parallel Supercomputer, Brookhaven National Laboratory, (BNL)  

NLE Websites -- All DOE Office Websites (Extended Search)

L L Overview Simple Example: Compile, Link, Run Compiler Invocation Compile and Link Tips Batch Job Submission Applications Support Math Libraries MPI Version IBM Fortran Blue Gene & Linux Manuals (IBM Redbooks) Much of the info you need will be in the Linux manual, but there is also some Blue Gene-specific info in the Blue Gene manual. Current Fortran compiler version number can be determined on fen by typing: ls /opt/ibmcmp/xlf/bg, will be highest number listed. IBM C/C++ Blue Gene & Linux Manuals (IBM Redbooks) Much of the info you need will be in the Linux manual, but there is also some Blue Gene-specific info in the Blue Gene manual. Linux Manual: Go to XL C/C++ for Linux, choose the Product Library link, then select current version number in tab at page top. (Current C/C++

140

A Preliminary Structural Model for the Blue Mountain Geothermal Field,  

Open Energy Info (EERE)

Structural Model for the Blue Mountain Geothermal Field, Structural Model for the Blue Mountain Geothermal Field, Humboldt County, Nevada Jump to: navigation, search OpenEI Reference LibraryAdd to library Journal Article: A Preliminary Structural Model for the Blue Mountain Geothermal Field, Humboldt County, Nevada Abstract The Blue Mountain geothermal field is a blind geothermalprospect (i.e., no surface hot springs) along the west flank of BlueMountain in southern Humboldt County, Nevada. Developmentwells in the system have high flow rates and temperatures above190°C at depths of ~600 to 1,070 m. Blue Mountain is a small~8-km-long east-tilted fault block situated between the EugeneMountains and Slumbering Hills. The geothermal field occupiesthe intersection between a regional NNE- to ENE-striking,west-dipping

Note: This page contains sample records for the topic "blue ruthenium dimer" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


141

Blue-Green Algae: Use of Antibiotics to purify Blue-Green Algae  

Science Journals Connector (OSTI)

... for tissue cultures suggests that such techniques may also be useful for freeing blue-green algae of contaminants. Our results with antibiotics have not been entirely successful, but it may ... and fungostatin are not inhibitory. It is possible to eliminate fungal contaminants by cultivation of algae in the presence of actidione and fungostatin, but not possible to free the ...

Y. T. TCHAN; J. GOULD

1961-12-30T23:59:59.000Z

142

Matching measure, Benjamini-Schramm convergence and the monomer-dimer free energy  

E-Print Network (OSTI)

We define the matching measure of a lattice L as the spectral measure of the tree of self-avoiding walks in L. We connect this invariant to the monomer-dimer partition function of a sequence of finite graphs converging to L. This allows us to express the monomer-dimer free energy of L in terms of the measure. Exploiting an analytic advantage of the matching measure over the Mayer series then leads to new, rigorous bounds on the monomer-dimer free energies of various Euclidean lattices. While our estimates use only the computational data given in previous papers, they improve the known bounds significantly.

Mikls Abrt; Pter Csikvri; Tams Hubai

2014-05-26T23:59:59.000Z

143

Solvent Viscosity and Interrelated Effects on Electrochemiluminescence Intensity of Tris(2,2-bipyridyl)ruthenium(II)  

Science Journals Connector (OSTI)

Solvent Viscosity and Interrelated Effects on Electrochemiluminescence Intensity of Tris(2,2-bipyridyl)ruthenium(II) ... 1 The mechanism accepted in the literature1b is the following: Clearly several processes occur in the mechanism, and each is dependent upon solvent properties to a certain degree. ... Solvent viscosity maps the macroscopic transition between the liquid and solid states and affects each component process of ECL. ...

Amy M. Scott; Radha Pyati

2001-08-02T23:59:59.000Z

144

Environmentally Friendly Oxidation of Biomass Derived 5-Hydroxymethylfurfural into 2,5-Diformylfuran Catalyzed by Magnetic Separation of Ruthenium Catalyst  

Science Journals Connector (OSTI)

Environmentally Friendly Oxidation of Biomass Derived 5-Hydroxymethylfurfural into 2,5-Diformylfuran Catalyzed by Magnetic Separation of Ruthenium Catalyst ... In this study, aerobic oxidation of 5-hydroxymethylfurfural (HMF) to 2,5-diformylfuran (DFF) was studied over a magnetic catalyst [Fe3O4@SiO2-NH2-Ru(III)]. ... 5-Hydroxymethylfurfural (HMF), which is generated by the dehydration of C6-based carbohydrates, is considered to be a key platform molecule. ...

Shuguo Wang; Zehui Zhang; Bing Liu; Jinlin Li

2014-03-12T23:59:59.000Z

145

Blue Oak Energy | Open Energy Information  

Open Energy Info (EERE)

Energy Energy Jump to: navigation, search Logo: Blue Oak Energy Name Blue Oak Energy Address 4614 Second Street Place Davis, California Zip 95618 Sector Solar Product photovoltaics, design and engineering, feasibility studies, turn-key installation, system maintenance, PV products Year founded 2003 Number of employees 11-50 Phone number (530) 747-2026 Website http://www.blueoakenergy.com Coordinates 38.5509256°, -121.7069073° Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"ROADMAP","zoom":14,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"350px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":38.5509256,"lon":-121.7069073,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}

146

Blue Mountain Geothermal Area | Open Energy Information  

Open Energy Info (EERE)

form form View source History View New Pages Recent Changes All Special Pages Semantic Search/Querying Get Involved Help Apps Datasets Community Login | Sign Up Search Page Edit with form History Facebook icon Twitter icon » Blue Mountain Geothermal Area Jump to: navigation, search GEOTHERMAL ENERGYGeothermal Home Geothermal Resource Area: Blue Mountain Geothermal Area Contents 1 Area Overview 2 History and Infrastructure 3 Regulatory and Environmental Issues 4 Exploration History 5 Well Field Description 6 Geology of the Area 7 Geofluid Geochemistry 8 NEPA-Related Analyses (2) 9 Exploration Activities (15) 10 References Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"TERRAIN","zoom":6,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"500px","height":"300px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":41,"lon":-118.13,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}

147

Blue Hill Partners LLC | Open Energy Information  

Open Energy Info (EERE)

Logo: Blue Hill Partners LLC Name Blue Hill Partners LLC Address 40 W. Evergreen Ave. Place Philadelphia, Pennsylvania Zip 19118 Region Northeast - NY NJ CT PA Area Product Invests equity capital in venture-stage companies in the advanced industrial technology sector Phone number (215) 247-2400 Website http://www.bluehillpartners.co Coordinates 40.075493°, -75.208266° Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"ROADMAP","zoom":14,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"350px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":40.075493,"lon":-75.208266,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}

148

Self Potential At Blue Mountain Area (Fairbank Engineering, 2008) | Open  

Open Energy Info (EERE)

Page Page Edit History Facebook icon Twitter icon » Self Potential At Blue Mountain Area (Fairbank Engineering, 2008) Jump to: navigation, search GEOTHERMAL ENERGYGeothermal Home Exploration Activity: Self Potential At Blue Mountain Area (Fairbank Engineering, 2008) Exploration Activity Details Location Blue Mountain Area Exploration Technique Self Potential Activity Date Usefulness not indicated DOE-funding Unknown Notes Geophysical surveys that have been conducted specifically for the geothermal program at Blue Mountain include a self-potential (SP) survey, and additional IP/electrical resistivity traversing. These surveys were conducted under a cooperative program between Noramex Corporation and the Energy and Geosciences Institute (EGI), University of Utah, with funding

149

Core Holes At Blue Mountain Geothermal Area (Fairbank & Niggemann...  

Open Energy Info (EERE)

Exploration Activity Details Location Blue Mountain Geothermal Area Exploration Technique Core Holes Activity Date 2002 - 2004 Usefulness useful DOE-funding Unknown Exploration...

150

Alternative Fuels Data Center: Blue Ridge Parkway Incorporates...  

NLE Websites -- All DOE Office Websites (Extended Search)

Incorporates Alternative Fuels in Its Fleet to someone by E-mail Share Alternative Fuels Data Center: Blue Ridge Parkway Incorporates Alternative Fuels in Its Fleet on Facebook...

151

Flow Test At Blue Mountain Geothermal Area (Fairbank Engineering...  

Open Energy Info (EERE)

Jump to: navigation, search GEOTHERMAL ENERGYGeothermal Home Exploration Activity: Flow Test At Blue Mountain Geothermal Area (Fairbank Engineering Ltd, 2003) Exploration Activity...

152

Hyperspectral Imaging At Blue Mountain Geothermal Area (Calvin...  

Open Energy Info (EERE)

Calvin, Et Al., 2010) Jump to: navigation, search GEOTHERMAL ENERGYGeothermal Home Exploration Activity: Hyperspectral Imaging At Blue Mountain Geothermal Area (Calvin, Et Al.,...

153

Reflection Survey At Blue Mountain Geothermal Area (Melosh, Et...  

Open Energy Info (EERE)

Melosh, Et Al., 2010) Jump to: navigation, search GEOTHERMAL ENERGYGeothermal Home Exploration Activity: Reflection Survey At Blue Mountain Geothermal Area (Melosh, Et Al., 2010)...

154

Electrical Resistivity and Self-Potential Surveys Blue Mountain...  

Open Energy Info (EERE)

been completed at the Blue Mountain geothermal area to search for the source of thermal fluids discovered during drilling for mineral exploration, and to help characterize the...

155

Blue Peter Project Group Inc | Open Energy Information  

Open Energy Info (EERE)

Canada Zip: L6M 2B8 Sector: Solar Product: Alternative energy project developer in Canada, specifically solar thermal systems. References: Blue Peter Project Group Inc1...

156

E-Print Network 3.0 - active dimeric form Sample Search Results  

NLE Websites -- All DOE Office Websites (Extended Search)

dimers, with the aim of explaining how these form at a comparatively low temperature. Disilane (which... to di11;use at 400500K 3 . When two groups are on adjacent ... Source:...

157

Relationship between Ultraviolet-B Sensitivity and Cyclobutane Pyrimidine Dimer Photorepair in Rice  

Science Journals Connector (OSTI)

......or photorepair, at least three independent experiments were car- ried out. The data taken from these experiments were averaged...Sutherland, B. M. (2000) UV-sensitive Norin 1 rice contains defective cyclobutane pyrimidine dimer photolyase. Plant Cell 12: 15691578......

Jun Hidema; Il-Kyung Song; Tadashi Sato; Tadashi Kumagai

2001-09-01T23:59:59.000Z

158

Photoionization spectra of silver dimers adsorbed on the surface of a ZnS single crystal  

Science Journals Connector (OSTI)

We use the photostimulated luminescence flash method to measure photoionization spectra of Ag2 clusters adsorbed on the surface of a ZnS single crystal. Adsorbed dimers of silver are prepared by treatment of the ...

O. V. Ovchinnikov; D. A. Minakov; M. S. Smirnov

2007-07-01T23:59:59.000Z

159

On the ro-vibrational energies for the lithium dimer; maximum-possible rotational levels  

E-Print Network (OSTI)

The Deng-Fan potential is used to discuss the reliability of the improved Greene-Aldrich approximation and the factorization recipe of Badawi et al.'s [17] for the central attractive/repulsive core. The factorization recipe is shown to be a more reliable approximation and is used to obtain the ro-vibrational energies for the lithium dimer. For each vibrational state only a limited number of the rotational levels are found to be supported by the lithium dimer.

Omar Mustafa

2015-01-27T23:59:59.000Z

160

Pacific Blue Energy | Open Energy Information  

Open Energy Info (EERE)

Jump to: navigation, search Name Pacific Blue Energy Place Flagstaff, Arizona Zip 86001 Sector Solar Product Arizona-based solar project developer. Coordinates 45.238793°, -70.330276° Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"ROADMAP","zoom":14,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"350px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":45.238793,"lon":-70.330276,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}

Note: This page contains sample records for the topic "blue ruthenium dimer" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


161

Protein folding, anisotropic collapse and blue phases  

E-Print Network (OSTI)

We study a homopolymer model of a protein chain, where each monomer carries a dipole moment. To mimic the geometry of the peptidic bond, these dipoles are constrained to be locally perpendicular to the chain. The tensorial character of the dipolar interaction leads naturally to a (tensorial) liquid crystal-like order parameter. For non chiral chains, a mean field study of this model shows that a classical $\\theta$ collapse transition occurs first; at lower temperature, nematic order sets in. For chiral chains, an anisotropic (tensorial) collapse transition may occur before the $\\theta$ temperature is reached: the ordered phase can be described as a ``compact phase of secondary structures'', and possesses great similarities with the liquid crystal blue phases.

E. Pitard; T. Garel; H. Orland

1997-06-11T23:59:59.000Z

162

Blue Dots Team Transits Working Group Review  

E-Print Network (OSTI)

Transiting planet systems offer an unique opportunity to observationally constrain proposed models of the interiors (radius, composition) and atmospheres (chemistry, dynamics) of extrasolar planets. The spectacular successes of ground-based transit surveys (more than 60 transiting systems known to-date) and the host of multi-wavelength, spectro-photometric follow-up studies, carried out in particular by HST and Spitzer, have paved the way to the next generation of transit search projects, which are currently ongoing (CoRoT, Kepler), or planned. The possibility of detecting and characterizing transiting Earth-sized planets in the habitable zone of their parent stars appears tantalizingly close. In this contribution we briefly review the power of the transit technique for characterization of extrasolar planets, summarize the state of the art of both ground-based and space-borne transit search programs, and illustrate how the science of planetary transits fits within the Blue Dots perspective.

Sozzetti, A; Alonso, R; Blank, D L; Catala, C; Deeg, H; Grenfell, J L; Hellier, C; Latham, D W; Minniti, D; Pont, F; Rauer, H

2009-01-01T23:59:59.000Z

163

What are the Luminous Compact Blue Galaxies?  

E-Print Network (OSTI)

Luminous Compact Blue Galaxies (LCBGs) are common at z~1, contributing significantly to the total star formation rate density. By z~0, they are a factor of ten rarer. While we know that LCBGs evolve rapidly, we do not know what drives their evolution nor into what types of galaxies they evolve. We present the results of a single-dish HI survey of local LCBGs undertaken to address these questions. Our results indicate that LCBGs have M(HI) and M(DYN) consistent with low-mass spirals, but typically exhaust their gas reservoirs in less than 2 Gyr. Overall, the properties of LCBGs are consistent with them evolving into high-mass dwarf elliptical or dwarf irregular galaxies or low-mass, late-type spiral galaxies.

D. J. Pisano; C. A. Garland; R. Guzman; J. Perez Gallego; F. J. Castander; N. Gruel

2007-12-07T23:59:59.000Z

164

Blue Canyon Wind Farm | Open Energy Information  

Open Energy Info (EERE)

Wind Farm Wind Farm Facility Blue Canyon Sector Wind energy Facility Type Commercial Scale Wind Facility Status In Service Owner Babcock & Brown/Horizon Developer Zilkha Renewable/Kirmart Corp. Energy Purchaser Western Farmers' Electric Cooperative Location North of Lawton OK Coordinates 34.852678°, -98.551807° Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"ROADMAP","zoom":14,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"350px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":34.852678,"lon":-98.551807,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}

165

Blue Marble Energy | Open Energy Information  

Open Energy Info (EERE)

Energy Energy Jump to: navigation, search Name Blue Marble Energy Address P.O. Box 9190 Place Seattle, Washington Zip 98109 Sector Biomass Product Aims to turn algae and other cellulosic biomass into natural gas Website http://www.bluemarbleenergy.ne Coordinates 47.6163159°, -122.3463563° Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"ROADMAP","zoom":14,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"350px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":47.6163159,"lon":-122.3463563,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}

166

White marlin (Tetrapturus albidus) and blue marlin (Makaira nigricans)  

E-Print Network (OSTI)

659 White marlin (Tetrapturus albidus) and blue marlin (Makaira nigricans) are widely distributed assessment indicators indicate that the white marlin population has been severely overfished for several regarding the repro- Movements and spawning of white marlin (Tetrapturus albidus) and blue marlin (Makaira

167

Special Aspects of Nitrogen Fixation by Blue-Green Algae  

Science Journals Connector (OSTI)

...Aspects of Nitrogen Fixation by Blue-Green Algae Rosalie M. Cox P. Fay When carbon dioxide...required for nitrogen fixation in this alga. A ratio of pyruvate decarboxylation to...independent of photosynthesis in blue-green algae. Special aspects of nitrogen fixation...

1969-01-01T23:59:59.000Z

168

Direct-Current Resistivity At Blue Mountain Area (Fairbank Engineering,  

Open Energy Info (EERE)

Direct-Current Resistivity At Blue Mountain Area (Fairbank Engineering, Direct-Current Resistivity At Blue Mountain Area (Fairbank Engineering, 2005) Jump to: navigation, search GEOTHERMAL ENERGYGeothermal Home Exploration Activity: Direct-Current Resistivity At Blue Mountain Area (Fairbank Engineering, 2005) Exploration Activity Details Location Blue Mountain Area Exploration Technique Direct-Current Resistivity Survey Activity Date Usefulness not indicated DOE-funding Unknown Notes Geophysical surveys that have been conducted specifically for the geothermal program at Blue Mountain include a self-potential (SP) survey, and additional IP/electrical resistivity traversing. These surveys were conducted under a cooperative program between Noramex Corporation and the Energy and Geosciences Institute (EGI), University of Utah, with funding

169

Static Temperature Survey At Blue Mountain Area (Fairbank Engineering,  

Open Energy Info (EERE)

Static Temperature Survey At Blue Mountain Area (Fairbank Engineering, Static Temperature Survey At Blue Mountain Area (Fairbank Engineering, 2010) Jump to: navigation, search GEOTHERMAL ENERGYGeothermal Home Exploration Activity: Static Temperature Survey At Blue Mountain Area (Fairbank Engineering, 2010) Exploration Activity Details Location Blue Mountain Area Exploration Technique Static Temperature Survey Activity Date Usefulness useful DOE-funding Unknown Notes Using a precision thermistor probe, EGI, University of Utah, obtained detailed temperature logs of eleven new mineral exploration holes drilled at Blue Mountain. The holes, ranging in depth from 99 to 244 meters (325 to 800 feet), were drilled in areas to the northeast, northwest and southwest of, and up to distances of two kilometers from, the earlier mineral exploration drill holes that encountered hot artesian flows. Unfortunately,

170

The Blue Ribbon Commission Offers Strong Step Forward | Department of  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

The Blue Ribbon Commission Offers Strong Step Forward The Blue Ribbon Commission Offers Strong Step Forward The Blue Ribbon Commission Offers Strong Step Forward July 29, 2011 - 12:27pm Addthis Damien LaVera Damien LaVera Deputy Director, Office of Public Affairs Today, the Blue Ribbon Commission on America's Nuclear Future issued a draft of its recommendations. The Obama Administration continues to believe that nuclear energy has an important role to play as America moves to a clean energy future. As part of our commitment to restarting the American nuclear industry and creating thousands of new jobs and export opportunities in the process, we are committed to finding a sustainable approach to assuring safe, secure long-term disposal of used nuclear fuel and nuclear waste. Secretary Chu appreciates the hard work done by the members of the Blue

171

Geophysical Studies in the Vicinity of Blue Mountain and Pumpernickel  

Open Energy Info (EERE)

the Vicinity of Blue Mountain and Pumpernickel the Vicinity of Blue Mountain and Pumpernickel Valley near Winnemucca, North-Central Nevada Jump to: navigation, search OpenEI Reference LibraryAdd to library Report: Geophysical Studies in the Vicinity of Blue Mountain and Pumpernickel Valley near Winnemucca, North-Central Nevada Abstract From May 2008 to September 2009, the U.S. Geological Survey (USGS) collected data from more than 660 gravity stations, 100 line-km of truck-towed magnetometer traverses, and 260 physical-property sites in the vicinity of Blue Mountain and Pumpernickel Valley, northern Nevada (fig. 1). Gravity, magnetic, and physical-property data were collected to study regional crustal structures as an aid to understanding the geologic framework of the Blue Mountain and Pumpernickel Valley areas, which in

172

Blue Lake Plant Biomass Facility | Open Energy Information  

Open Energy Info (EERE)

Blue Lake Plant Biomass Facility Blue Lake Plant Biomass Facility Jump to: navigation, search Name Blue Lake Plant Biomass Facility Facility Blue Lake Plant Sector Biomass Location Blue Lake, California Coordinates 40.8829072°, -123.9839488° Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"ROADMAP","zoom":14,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"350px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":40.8829072,"lon":-123.9839488,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}

173

Building Energy Software Tools Directory: BlueSol  

NLE Websites -- All DOE Office Websites (Extended Search)

BlueSol BlueSol tool_bluesol BlueSol is a software for the design of photovoltaic systems in every country in the world. It allows you to perform the entire process of designing a PV system, from the preliminary assessment of producibility to the realization of the project documentation. Screen Shots Keywords PV system sizing, PV system simulation, grid-connected PV systems, electrical components, shading, economic analysis. Validation/Testing N/A Expertise Required No special expertise or training needed. Users BlueSol runs in English language and has been released in may 2013. BlueSol originates from his Italian version: over 2100 copies of Italian version dowloaded since it was first release in november 2009. Audience PV specialists, energy and electrical engineers, system installers, energy

174

An infrared study of the influence of CO adsorption on the topology of supported ruthenium  

SciTech Connect

The interaction of CO with alumina-supported ruthenium, reduced at different temperatures, was investigated by following the development of infrared bands due to adsorbed CO. It was concluded that the adsorption of Co on Ru at 170-350 K leads to the oxidative disruption of Ru clusters as indicated by the slow transformation of the band at 2020-2040 cm{sup {minus}1} due to Ru{sub x}-CO to bands at 2140 and 2075 cm{sup {minus}1} attributed to Ru{sup n+}(CO){sub 2} species (n = 1-3). This process occurred more slowly under dry conditions, and in the presence of hydrogen, whereas it was accelerated by H{sub 2}O addition. Analysis of spectral features suggested the involvement of the isolated OH groups on the alumina support in the oxidative disruption process. It was demonstrated that at higher temperatures, namely at around 500 K, the presence of CO causes the reductive agglomeration of Ru{sup n+} sites, i.e., the reformation of Ru{sub x} clusters.

Solymosi, F.; Rasko, J. (Univ. of Szeged (Hungary))

1989-01-01T23:59:59.000Z

175

E-Print Network 3.0 - astrazon blue fgrl Sample Search Results  

NLE Websites -- All DOE Office Websites (Extended Search)

and Blue Shield Plans This health plan meets Minimum... of the Massachusetts Health Care Reform Law. Blue Care ElectSM Enhanced Value (PPO) Summary of Benefits Boston...

176

Direct-Current Resistivity Survey At Blue Mountain Area (Fairbank  

Open Energy Info (EERE)

5) 5) Jump to: navigation, search GEOTHERMAL ENERGYGeothermal Home Exploration Activity: Direct-Current Resistivity Survey At Blue Mountain Area (Fairbank Engineering, 2005) Exploration Activity Details Location Blue Mountain Area Exploration Technique Direct-Current Resistivity Survey Activity Date Usefulness not indicated DOE-funding Unknown Notes Geophysical surveys that have been conducted specifically for the geothermal program at Blue Mountain include a self-potential (SP) survey, and additional IP/electrical resistivity traversing. These surveys were conducted under a cooperative program between Noramex Corporation and the Energy and Geosciences Institute (EGI), University of Utah, with funding support from the DOE's Office of Geothermal Technology (DOE/OGT).

177

Electron-electron interaction effects on Peierls dimerization in a half-filled band  

Science Journals Connector (OSTI)

A novel real-space approach to dimerization in a half-filled band is developed to investigate effects of electron-electron interactions on the Peierls instability. Dimerization is shown to be a result of imperfect resonance between pairs of electron configurations related to each other by a mirror-plane symmetry passing through the longest diagonal of the infinite ring, and the kinetic- and potential-energy contributions to the barrier to resonance are identified separately. The effects of including the on-site, nearest-neighbor, and next-nearest-neighbor interactions are investigated, and in each case it is shown that the enhancement or reduction in dimerization can be predicted from elementary physical arguments. These predictions are then substantiated by exact numerical calculations on a ten-site ring, and finite-size effects are shown to be small. The principal results that are obtained are the following: (i) The on-site correlation U strongly enhances the dimerization, the enhancement being strongest for U?4t0, where 4t0 is the bandwidth of the uniform chain; (ii) the nearest-neighbor interaction V1 further enhances the dimerization until V1?12U, while V1>12U favors a uniform chain with a different broken-symmetry ground state, an on-site charge-density wave; (iii) for V1?12U, the second-neighbor interaction V2 reduces the dimerization slightly, although the dimerization is still stronger than that with an effective nearest-neighbor interaction V1-V2; (iv) for V1>12U, V2 destroys the on-site charge-density wave and the ground state is strongly dimerized again. The complete Parisier-Parr-Pople (PPP) Hamiltonian is discussed, and it is pointed out that the above results, together with the excited-state orderings in the PPP Hamiltonian, strongly indicate that the ground state of the PPP Hamiltonian is the dimerized state. The excited-state orderings in finite polyenes, spin-density distributions in polyacetylene, and our theoretical results all indicate then that explicit inclusion of Coulomb interactions may be necessary for an accurate description of the ground and excited states in polyacetylene.

S. N. Dixit and S. Mazumdar

1984-02-15T23:59:59.000Z

178

Task Force for Strategic Developments to Blue Ribbon Commission  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Task Force for Strategic Developments to Blue Ribbon Commission Task Force for Strategic Developments to Blue Ribbon Commission Recommendations Task Force for Strategic Developments to Blue Ribbon Commission Recommendations Formed at the direction of the President to Secretary Chu and included leading experts. Purpose to conduct a comprehensive review of polices for managing the back end of the nuclear fuel cycle; i.e., recycle before storage and permanent disposal. Detailed analysis, with eight major recommendations; also recommended near-term actions. Task Force for Strategic Developments to Blue Ribbon Commission Recommendations More Documents & Publications Categorization of Used Nuclear Fuel Inventory in Support of a Comprehensive National Nuclear Fuel Cycle Strategy DOE Office of Nuclear Energy Transportation Planning, Route Selection, and

179

Epithermal Gold Mineralization and a Geothermal Resource at Blue Mountain,  

Open Energy Info (EERE)

Epithermal Gold Mineralization and a Geothermal Resource at Blue Mountain, Epithermal Gold Mineralization and a Geothermal Resource at Blue Mountain, Humboldt County, Nevada Jump to: navigation, search OpenEI Reference LibraryAdd to library Journal Article: Epithermal Gold Mineralization and a Geothermal Resource at Blue Mountain, Humboldt County, Nevada Abstract Shallow exploration drilling on the west flank of Blue Mountain discovered sub economic gold mineralization and a spatially associated active geothermal system. The gold mineralization is an unusual example of an acid sulfate type epithermal system developed in pre Tertiary sedimentary host rocks. The geothermal system is largely unexplored but is unusual in that surface manifestation s typically associated with active geothermal system are not present. Authors Andrew J. Parr and Timothy J. Percival

180

USD 384 Blue Valley Wind Project | Open Energy Information  

Open Energy Info (EERE)

Blue Valley Wind Project Blue Valley Wind Project Jump to: navigation, search Name USD 384 Blue Valley Wind Project Facility USD 384 Blue Valley Sector Wind energy Facility Type Community Wind Location KS Coordinates 39.433575°, -96.758011° Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"ROADMAP","zoom":14,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"350px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":39.433575,"lon":-96.758011,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}

Note: This page contains sample records for the topic "blue ruthenium dimer" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


181

Geothermal Drilling Success at Blue Mountain, Nevada | Open Energy  

Open Energy Info (EERE)

Drilling Success at Blue Mountain, Nevada Drilling Success at Blue Mountain, Nevada Jump to: navigation, search OpenEI Reference LibraryAdd to library Conference Paper: Geothermal Drilling Success at Blue Mountain, Nevada Abstract Exploration in a blind prospect has led to the confirmation of a geothermal resource at Blue Mt.Nevada. The latest results include drilling of three production wells into Piedmont faults. These wells produce from a 185 to 190°C dilute benign brine reservoir. Short flow tests have shown prolific flow rates and indications of reservoir continuity.Well entries have shown that system permeability is fault-dominated. This is confirmed by the results of seismic reflection imaging. Young faulting in the area includes intersecting range front faults that strike NW, NS, and NE. Exposure of

182

Aeromagnetic Survey At Blue Mountain Area (Fairbank Engineering, 2003) |  

Open Energy Info (EERE)

Blue Mountain Area (Fairbank Blue Mountain Area (Fairbank Engineering, 2003) Exploration Activity Details Location Blue Mountain Area Exploration Technique Aeromagnetic Survey Activity Date Usefulness not indicated DOE-funding Unknown Notes The airborne magnetometer and VLF-EM surveys carried out by Aerodat Limited, in 1988, covered the western flank of Blue Mountain including most of the geothermal lease area. The interpreted data (total field magnetic contours; calculated vertical magnetic gradient) indicate parallel sets of northerly, northeasterly, and northwesterly-trending structures that correspond well with the major fault sets identified from geologic mapping and interpreted drilling sections. Also, an elongate northerly-trending area of low magnetic gradient coincides closely with the area of intense

183

MHK Technologies/Blue Motion Energy marine turbine | Open Energy  

Open Energy Info (EERE)

Motion Energy marine turbine Motion Energy marine turbine < MHK Technologies Jump to: navigation, search << Return to the MHK database homepage Blue Motion Energy marine turbine.jpg Technology Profile Primary Organization Blue Motion Energy Technology Resource Click here Current Technology Type Click here Cross Flow Turbine Technology Description The Blue Motion Energy marine turbine however uses a patented system of seawalls A placed radial around the vertically mounted rotor B this way it is possible to funnel the current and significantly increase the flow velocity independent of the direction of the current Technology Dimensions Device Testing Date Submitted 59:30.2 << Return to the MHK database homepage Retrieved from "http://en.openei.org/w/index.php?title=MHK_Technologies/Blue_Motion_Energy_marine_turbine&oldid=681547

184

Geology and Temperature Gradient Surveys Blue Mountain Geothermal  

Open Energy Info (EERE)

Geology and Temperature Gradient Surveys Blue Mountain Geothermal Geology and Temperature Gradient Surveys Blue Mountain Geothermal Discovery, Humboldt County, Nevada Jump to: navigation, search OpenEI Reference LibraryAdd to library Journal Article: Geology and Temperature Gradient Surveys Blue Mountain Geothermal Discovery, Humboldt County, Nevada Abstract Triassic argillite and sandstone of the Grass Valley Formation and phyllitic mudstone of the overlying Raspberry Formation, also of Triassic age, host a blind geothermal system under exploration by Blue Mountain Power Company Inc. with assistance from the Energy & Geoscience Institute. Geologically young, steeply dipping, open fault sets, striking N50-60°E,N50-60°W, and N-S intersect in the geothermal zone providing deep permeability over a wide area. Extensive silicification andhydro

185

Secretary Chu Announces Blue Ribbon Commission on America's Nuclear  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Blue Ribbon Commission on America's Blue Ribbon Commission on America's Nuclear Future Secretary Chu Announces Blue Ribbon Commission on America's Nuclear Future January 29, 2010 - 12:57pm Addthis As part of the Obama Administration's commitment to restarting America's nuclear industry, U.S. Secretary of Energy Steven Chu today announced the formation of a Blue Ribbon Commission on America's Nuclear Future to provide recommendations for developing a safe, long-term solution to managing the Nation's used nuclear fuel and nuclear waste. The Commission is being co-chaired by former Congressman Lee Hamilton and former National Security Advisor Brent Scowcroft. In light of the Administration's decision not to proceed with the Yucca Mountain nuclear waste repository, President Obama has directed Secretary

186

Blue Ridge Electric Cooperative - Heat Pump Loan Program | Department of  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

You are here You are here Home » Blue Ridge Electric Cooperative - Heat Pump Loan Program Blue Ridge Electric Cooperative - Heat Pump Loan Program < Back Eligibility Residential Savings Category Heating & Cooling Commercial Heating & Cooling Heat Pumps Maximum Rebate 12,000 Program Info State South Carolina Program Type Utility Loan Program Rebate Amount $500 - $12,000 Provider Blue Ridge Electric Cooperative Blue Ridge Electric Cooperative (BREC) offers low interest loans to help members finance the purchase of energy efficient heat pumps. Loans under $1,500 can be financed for up to 42 months, and loans above $1,500 can be financed for up to 60 months for houses and 48 months for mobile homes. Homeowners planning to install one heat pump, electric or geothermal can

187

Reflection Survey At Blue Mountain Area (Fairbank Engineering, 2007) | Open  

Open Energy Info (EERE)

Blue Mountain Area (Fairbank Engineering, 2007) Blue Mountain Area (Fairbank Engineering, 2007) Jump to: navigation, search GEOTHERMAL ENERGYGeothermal Home Exploration Activity: Reflection Survey At Blue Mountain Area (Fairbank Engineering, 2007) Exploration Activity Details Location Blue Mountain Area Exploration Technique Reflection Survey Activity Date Usefulness useful DOE-funding Unknown Notes A high-resolution seismic reflection survey was conducted by Utah Geophysical, Inc. (1990) along four widely spaced survey lines normal to range front fault sets. The survey was designed primarily to detect silicified zones or zones of argillic alteration, and faulting, to depths of about 300 meters (1000 feet), as part of the precious metals exploration program. One interpretation of the data showed discrete, high-angle faults

188

Rack-induced bonding in blue-copper proteins  

Science Journals Connector (OSTI)

The unique spectroscopic properties of blue-copper centers, i.e. the strong charge-transfer band at approximately 600 nm and the narrow hyperfine coupling in the EPR spectrum, are reviewed. The concept of rack-in...

Bo G. Malmstrm

1995-01-01T23:59:59.000Z

189

Second Generation Renewable Fuels Blue-Green Seminar  

E-Print Network (OSTI)

Abstract Second Generation Renewable Fuels Blue-Green Seminar at University of Michigan by Michael Ladisch Laboratory of Renewable Resources Engineering Purdue University Potter Engineering Center 500 footprint will require commercialization of industrial processes that transform renewable lignocellulosic

Eustice, Ryan

190

Physiology and cytological chemistry blue-green algae.  

Science Journals Connector (OSTI)

...activity in ex- tracts of heterocystous and non-heterocystous blue-green algae. Arch...1968. Protein aggregation. Studies of larger aggregates of C-phycocyanin. Biochem...H., and H. W. Siegelman. 1967. Large- scale autotrophic culture of Euglena...

C P Wolk

1973-03-01T23:59:59.000Z

191

Self Potential At Blue Mountain Geothermal Area (Fairbank Engineering...  

Open Energy Info (EERE)

geothermal activity which could be linked to faults that serve as pathways for geothermal fluids. Notes This survey was conducted on the western flank of Blue Mountain. SP Profile...

192

Secretary Chu Announces Blue Ribbon Commission on America's Nuclear Future  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Blue Ribbon Commission on America's Nuclear Blue Ribbon Commission on America's Nuclear Future Secretary Chu Announces Blue Ribbon Commission on America's Nuclear Future January 29, 2010 - 12:00am Addthis Washington, D.C. - As part of the Obama Administration's commitment to restarting America's nuclear industry, U.S. Secretary of Energy Steven Chu today announced the formation of a Blue Ribbon Commission on America's Nuclear Future to provide recommendations for developing a safe, long-term solution to managing the Nation's used nuclear fuel and nuclear waste. The Commission is being co-chaired by former Congressman Lee Hamilton and former National Security Advisor Brent Scowcroft. In light of the Administration's decision not to proceed with the Yucca Mountain nuclear waste repository, President Obama has directed Secretary

193

Task Force for Strategic Developments to Blue Ribbon Commission  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Task Force for Strategic Developments to Blue Ribbon Commission Task Force for Strategic Developments to Blue Ribbon Commission Recommendations Task Force for Strategic Developments to Blue Ribbon Commission Recommendations Formed at the direction of the President to Secretary Chu and included leading experts. Purpose to conduct a comprehensive review of polices for managing the back end of the nuclear fuel cycle; i.e., recycle before storage and permanent disposal. Detailed analysis, with eight major recommendations; also recommended near-term actions. Task Force for Strategic Developments to Blue Ribbon Commission Recommendations More Documents & Publications DOE Office of Nuclear Energy Transportation Planning, Route Selection, and Rail Issues Categorization of Used Nuclear Fuel Inventory in Support of a Comprehensive

194

FERN Blue Ribbon Wind Farm I | Open Energy Information  

Open Energy Info (EERE)

FERN Blue Ribbon Wind Farm I FERN Blue Ribbon Wind Farm I Jump to: navigation, search Name FERN Blue Ribbon Wind Farm I Facility FERN Blue Ribbon Wind Farm I Sector Wind energy Facility Type Offshore Wind Facility Status Proposed Developer Fishermen's Energy Location Offshore from Atlantic City NJ Coordinates 39.311°, -74.41° Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"ROADMAP","zoom":14,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"350px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":39.311,"lon":-74.41,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}

195

Record External Quantum Efficiency in Blue OLED Device  

Energy.gov (U.S. Department of Energy (DOE))

Scientists at Pacific Northwest National Laboratory (PNNL) have created a blue organic light emitting diode (OLED) with an external quantum efficiency (EQE) of 11% at 800 cd/m2, exceeding their previous record EQE of 8%. The EQE of blue OLEDs is a major challenge in OLED technology development. This achievement is particularly notable since it was accomplished at a much lower operating voltage (6.2V) than previous demonstrations using similar structures, revealing the potential for much higher power efficiencies.

196

Identifying vocalizations and their possible function in Texas Blue Jays  

E-Print Network (OSTI)

IDENTIFYING VOCALIZATIONS AND THEIR POSSIBLE FUNCTION IN TEXAS BLUE JAYS A Thesis JULIE JETER-EDWARDS Submitted to the Office of Graduate Studies of Texas A&M University in partial fulfillment of the requirements for the degree of MASTER... OF SCIENCE December 1989 Major Subject: Wildlife & Fisheries Science IDENTIFYING VOCALIZATIONS AND THEIR POSSIBLE FUNCTION IN TEXAS BLUE JAYS A Thesis JULIE JETER-EDWARDS Approved as to style and content by: Keith A. Arnold (Chair of Committee...

Jeter-Edwards, Julie

2012-06-07T23:59:59.000Z

197

Persistence of magnons in a site-diluted dimerized frustrated antiferromagnet  

NLE Websites -- All DOE Office Websites (Extended Search)

Persistence of magnons in a site-diluted dimerized frustrated antiferromagnet Persistence of magnons in a site-diluted dimerized frustrated antiferromagnet This article has been downloaded from IOPscience. Please scroll down to see the full text article. 2011 J. Phys.: Condens. Matter 23 416003 (http://iopscience.iop.org/0953-8984/23/41/416003) Download details: IP Address: 128.219.49.9 The article was downloaded on 17/10/2011 at 17:07 Please note that terms and conditions apply. View the table of contents for this issue, or go to the journal homepage for more Home Search Collections Journals About Contact us My IOPscience IOP PUBLISHING JOURNAL OF PHYSICS: CONDENSED MATTER J. Phys.: Condens. Matter 23 (2011) 416003 (9pp) doi:10.1088/0953-8984/23/41/416003 Persistence of magnons in a site-diluted dimerized frustrated antiferromagnet M B Stone 1 , A Podlesnyak 1 , G Ehlers

198

Dimerization Induced Deprotonation of Water on RuO2(110)  

SciTech Connect

RuO2 has proven to be indispensable as a co-catalyst in numerous systems designed for photocatalytic water splitting. In this study we have carried out a detailed mechanistic study of water behavior on the most stable RuO2 face, RuO2(110), by employing variable temperature scanning tunneling microscopy and density functional theory calculations. We show that water monomers adsorb molecularly on Ru sites, become mobile above 238 K, diffuse along the Ru rows and form water dimers. The onset for dimer diffusion is observed at ~277 K indicating significantly higher diffusion barrier than that for monomers. More importantly, we find that water dimers deprotonate readily to form Ru-bound H3O2 and bridging OH species. The observed behavior is compared and contrasted with that observed for water on isostructural rutile TiO2(110).

Mu, Rentao; Cantu Cantu, David; Lin, Xiao; Glezakou, Vassiliki Alexandra; Wang, Zhitao; Lyubinetsky, Igor; Rousseau, Roger J.; Dohnalek, Zdenek

2014-10-02T23:59:59.000Z

199

Transformation of carbon monoxide dimer surface structures on yttrium oxide modified by silver  

SciTech Connect

It has been established that introducing ions of silver(II) in yttrium(III) oxide leads to the formation of a significant concentration of a paramagnetic dimer species (CO)/sub 2/-in the course of the adsorption of carbon monoxide, and that these dimers exhibit high thermal stability and reactivity. Reactions are proposed for the formation of the dimer species (CO)/sub 2//sup 2 -/ and (CO)/sub 2//sup -/ on the surface of the Ag/Y/sub 2/O/sub 3/ catalyst that involve the reduction of the anion vacancies and a change in the oxidation state of the silver ions. Modifying the yttrium oxide with ionic silver leads to a marked decrease in the strength of the oxidative ability of the surface of the catalyst for CO, while the nature of the active sites of the yttrium oxide, which adsorbs CO in three forms, remains unchanged.

Vydrin, S.N.; Bobolev, A.V.; Loginov, A.Yu.

1987-09-10T23:59:59.000Z

200

A phenylcarbazole functionalized ruthenium dye for efficient dye-sensitized solar cells  

Science Journals Connector (OSTI)

A new heteroleptic Ru(II) complex of [Ru(Hcpip)(Hdcbpy)(NCS)2]?[N(C4H9)4]+H2O {where Hcpip=2-(4-(9H-carbazol-9-yl)phenyl)-1H-imidazo[4,5-f] [1,10]phenanthroline, Hdcbpy=4-carboxylic acid-4?-carboxylate-2,2?-bipyridine} has been synthesized and demonstrated to function as an efficient sensitizer for nanocrystalline TiO2-based dye-sensitized solar cell (DSSC). The DSSC based on this Ru(II) complex showed a short-circuit photocurrent density of 19.2mAcm?2, an open-circuit photovoltage of 630mV, a fill factor of 57.7%, corresponding to an overall light to electricity conversion efficiency of 6.98% under simulated solar light irradiation at 100mWcm?2. This efficiency value is 2.81- and 1.08-fold efficiency values of 2.48% and 6.47% observed for carbazole-free parent complex [Ru(Hpip)(Hdcbpy)(NCS)2]?[N(C4H9)4]+H2O {where Hpip=2-phenyl-1H-imidazo[4,5-f][1,10]phenanthroline}- and cis-bis(isothiocyanato)bis(4,4?-dicarboxylic acid-2,2?-bipyridine)ruthenium(II) N3-based solar cells respectively, under identical experimental conditions. The molecular structures and electronic properties of the Ru(II) complexes were also investigated by means of density functional theory calculations in an effort to understand the device performance observed.

Su-Hua Fan; An-Guo Zhang; Chuan-Chuan Ju; Ke-Zhi Wang

2011-01-01T23:59:59.000Z

Note: This page contains sample records for the topic "blue ruthenium dimer" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


201

Blue Breezes I & II Wind Farm | Open Energy Information  

Open Energy Info (EERE)

Blue Breezes I & II Wind Farm Blue Breezes I & II Wind Farm Jump to: navigation, search Name Blue Breezes I & II Wind Farm Facility Blue Breezes I & II Sector Wind energy Facility Type Community Wind Facility Status In Service Owner John Deere Wind Energy Developer Dan Moore/John Deere Wind Energy Energy Purchaser City of Blue Earth Location City of Blue Earth MN Coordinates 43.6352°, -94.0942° Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"ROADMAP","zoom":14,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"350px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":43.6352,"lon":-94.0942,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}

202

Universal Dimer in a Collisionally Opaque Medium: Experimental Observables and Efimov Resonances  

Science Journals Connector (OSTI)

A universal dimer is subject to secondary collisions with atoms when formed in a cloud of ultracold atoms via three-body recombination. We show that in a collisionally opaque medium, the value of the scattering length that results in the maximum number of secondary collisions may not correspond to the Efimov resonance at the atom-dimer threshold and thus cannot be automatically associated with it. This result explains a number of controversies in recent experimental results on universal three-body states and supports the emerging evidence for the significant finite range corrections to the first excited Efimov energy level.

Olga Machtey; David A. Kessler; Lev Khaykovich

2012-03-30T23:59:59.000Z

203

Thermal Gradient Holes At Blue Mountain Area (Fairbank & Neggemann, 2004) |  

Open Energy Info (EERE)

Blue Mountain Area (Fairbank & Neggemann, 2004) Blue Mountain Area (Fairbank & Neggemann, 2004) Jump to: navigation, search GEOTHERMAL ENERGYGeothermal Home Exploration Activity: Thermal Gradient Holes At Blue Mountain Area (Fairbank & Neggemann, 2004) Exploration Activity Details Location Blue Mountain Area Exploration Technique Thermal Gradient Holes Activity Date Usefulness useful DOE-funding Unknown References Brian D. Fairbank, Kim V. Niggemann (2004) Deep Blue No 1- A Slimhole Geothermal Discovery At Blue Mountain, Humboldt County, Nevada Retrieved from "http://en.openei.org/w/index.php?title=Thermal_Gradient_Holes_At_Blue_Mountain_Area_(Fairbank_%26_Neggemann,_2004)&oldid=386709" Category: Exploration Activities What links here Related changes Special pages Printable version Permanent link

204

Dimerization of wild-type and mutant epidermal growth factor receptors prevalent in glioblastoma multiforme, using bioluminescent resonance energy transfer  

Science Journals Connector (OSTI)

...bioluminescent resonance energy transfer Aaron Gajadhar...however, the dimerization status of mutant EGFRs remain...to study dimerization status of wt and mutant EGFRs...bioluminescence resonance energy transfer, or BRET. This...BRET signal will allow us to decipher the different...

Aaron Gajadhar and Abhijit Guha

2007-05-01T23:59:59.000Z

205

Human Macrophage Inflammatory Protein 3?: Protein and Peptide Nuclear Magnetic Resonance Solution Structures, Dimerization, Dynamics, and Anti-Infective Properties  

Science Journals Connector (OSTI)

...hydrodynamic radii for spherical proteins similar in size...manner, with the loop bent toward the face of the...simulations. In the crystal dimer structures of MIP-3a...interactions with Phe4. In the crystal dimer structure of MIP-3a...than they are in the crystal structure (Fig. 5B...

David I. Chan; Howard N. Hunter; Brian F. Tack; Hans J. Vogel

2007-12-17T23:59:59.000Z

206

Stepout-Deepening Wells At Blue Mountain Area (Niggemann Et Al, 2005) |  

Open Energy Info (EERE)

Blue Mountain Area (Niggemann Et Al, 2005) Blue Mountain Area (Niggemann Et Al, 2005) Jump to: navigation, search GEOTHERMAL ENERGYGeothermal Home Exploration Activity: Step-out Well At Blue Mountain Area (Niggemann Et Al, 2005) Exploration Activity Details Location Blue Mountain Area Exploration Technique Step-out Well Activity Date Usefulness not indicated DOE-funding Unknown Notes Deep Blue No. 2 was sited as a step out t5 meters.5o Deep Blue No. 1 which measured 145oC at a depth of 645 m. Max temp recorded in Deep Blue No. 2 while drilling was 167.5oC at References Kim Niggemann, Brian Fairbank, Susan Petty (2005) Deep Blue No 2- A Resource In The Making At Blue Mountain Retrieved from "http://en.openei.org/w/index.php?title=Stepout-Deepening_Wells_At_Blue_Mountain_Area_(Niggemann_Et_Al,_2005)&oldid=687863"

207

Extraction behavior of uranium(VI), plutonium(IV), zirconium(IV), ruthenium(III) and europium(III) with ?-pre-irradiated solutions of N,N?-methylbutyl substituted amides in n-dodecane  

Science Journals Connector (OSTI)

The extraction of plutonium(IV), uranium(VI), zirconium(IV), europium(III) and ruthenium(III) with ?-pre-irradiated n-dodecane solutions of methylbutyl substituted hexanamide (MBHA), octanamide (MBOA) and deca...

P. B. Ruikar; M. S. Nagar; M. S. Subramanian

1995-09-15T23:59:59.000Z

208

The critical Z-invariant Ising model via dimers: the periodic case  

E-Print Network (OSTI)

The critical Z-invariant Ising model via dimers: the periodic case C´edric Boutillier , B´eatrice de Tili`ere Abstract We study a large class of critical two-dimensional Ising models namely critical Z-invariant Ising models on periodic graphs, example of which are the classical Z2 , triangular

Boutillier, Cédric

209

The critical Z-invariant Ising model via dimers: locality property  

E-Print Network (OSTI)

The critical Z-invariant Ising model via dimers: locality property C´edric Boutillier , B´eatrice de Tili`ere Abstract We study a large class of critical two-dimensional Ising models, namely critical Z-invariant Ising models. Fisher [Fis66] introduced a correspondence between the Ising model

Boutillier, Cédric

210

Formation of clean dimers during gas-source growth of Si(001) D.R.Bowler  

E-Print Network (OSTI)

-source growth of Si(001) using hydrogen-based precursors (such as SiH 4 , silane, and Si 2 H 6 , disilane observations of the growth of Si(001) from disilane, both at room temperature following anneals 1 dimers, with the aim of explaining how these form at a comparatively low temperature. Disilane (which

Bowler, David

211

Rows of ATP Synthase Dimers in Native Mitochondrial Inner Membranes Nikolay Buzhynskyy,* Pierre Sens,y  

E-Print Network (OSTI)

Rows of ATP Synthase Dimers in Native Mitochondrial Inner Membranes Nikolay Buzhynskyy,* Pierre Marseille, France ABSTRACT The ATP synthase is a nanometric rotary machine that uses a transmembrane electrochemical gradient to form ATP. The structures of most components of the ATP synthase are known, andtheir

Sens, Pierre

212

Proton transfer in adsorbed water dimers Xiao Liang Hu, Jir i Klimes and Angelos Michaelides*  

E-Print Network (OSTI)

of intact and dissociated states of water are similar. Proton transfer between water moleculesProton transfer in adsorbed water dimers Xiao Liang Hu, Jir i´ Klimes and Angelos Michaelides 25th February 2010 DOI: 10.1039/b924422k Density functional theory simulations of water on MgO(001

Alavi, Ali

213

Isotope effects and Born-Oppenheimer breakdown in excited singlet states of the lithium dimer  

E-Print Network (OSTI)

Isotope effects and Born-Oppenheimer breakdown in excited singlet states of the lithium dimer A of infrared electronic transitions involving the 1 1 g state of 7 Li2 has instigated an investigation of Born-Oppenheimer and the leading vibrational and/or rotational Born-Oppenheimer breakdown terms for the X 1 g , A 1 u , B 1 u

Le Roy, Robert J.

214

UV Radiation??Sensitive Norin 1 Rice Contains Defective Cyclobutane Pyrimidine Dimer Photolyase  

Science Journals Connector (OSTI)

...increasing UVB doses, kept in the...the no-UV radiation (no dimer...the measured range of initial net...Quantitation of radiation-, chemical...ultraviolet light and ionizing radiation Harm W. Rupert...ultraviolet dose-rate meter...

Jun Hidema; Tadashi Kumagai; Betsy M. Sutherland

215

Self-Assembly of Filamentous Amelogenin Requires Calcium and Phosphate: From Dimers via Nanoribbons to Fibrils  

E-Print Network (OSTI)

Self-Assembly of Filamentous Amelogenin Requires Calcium and Phosphate: From Dimers via Nanoribbons, San Francisco, California 94143, United States *S Supporting Information ABSTRACT: Enamel matrix self-assembly tested if amelogenin, the main enamel matrix protein, can self-assemble into ribbon-like structures

Sali, Andrej

216

Forster resonance energy transfer in liposomes: Measurements of transmembrane helix dimerization in the native  

E-Print Network (OSTI)

Fo¨rster resonance energy transfer in liposomes: Measurements of transmembrane helix dimerization membranes. ? 2005 Elsevier Inc. All rights reserved. Free energy measurements of transmembrane (TM)1 helix system, however, measuring the thermodynamics of membrane protein association is a challenge. Here we

Wimley, William C.

217

Recognition of HIV TAR RNA by triazole linked neomycin dimers Sunil Kumar, Dev P. Arya  

E-Print Network (OSTI)

located at 50 -end of all nascent HIV-1 transcripts interacts with a key regulatory protein, Tat protein, (a 86 amino acid protein) and regulates the transcription of HIV virus. TAR RNA­Tat proteinRecognition of HIV TAR RNA by triazole linked neomycin dimers Sunil Kumar, Dev P. Arya Laboratory

Stuart, Steven J.

218

Alignment of molecules in gaseous transport: Alkali dimers in supersonic nozzle beams  

E-Print Network (OSTI)

Alignment of molecules in gaseous transport: Alkali dimers in supersonic nozzle beams M. P. SinhaO) + a.P lcosO), where 0 is the angle between the angular momentum vector J of the molecule and the beam direction. This method is applied to determine the alignment of Na2 molecules in a supersonic nozzle beam

Zare, Richard N.

219

BlueTorrent: Cooperative content sharing for Bluetooth users  

Science Journals Connector (OSTI)

People wish to enjoy their everyday lives in various ways, among which entertainment plays a major role. In order to improve lifestyle with more ready access to entertainment content, we propose BlueTorrent, a P2P file sharing application based on ubiquitous Bluetooth-enabled devices such as PDAs, cellphones and smart phones. Using BlueTorrent, people can share audio/video contents as they move about shopping malls, airports, subway stations etc. BlueTorrent poses new challenges caused by limited bandwidth, short communications range, mobile users and variable population density. A key ingredient is efficient peer discovery. This paper approaches the problem by analyzing the Bluetooth periodic inquiry mode and by finding the optimum inquiry/connection time settings. At the application layer, the BlueTorrent index/block dissemination protocol is then designed and analyzed. The entire system is integrated and implemented both in simulation and in an experimental testbed. Simulation and measurement results are used to evaluate and validate the performance of BlueTorrent in content sharing scenarios.

Sewook Jung; Uichin Lee; Alexander Chang; Dae-Ki Cho; Mario Gerla

2007-01-01T23:59:59.000Z

220

Electrical Resistivity and Self-Potential Surveys Blue Mountain Geothermal  

Open Energy Info (EERE)

Page Page Edit with form History Facebook icon Twitter icon » Electrical Resistivity and Self-Potential Surveys Blue Mountain Geothermal Area, Nevada Jump to: navigation, search OpenEI Reference LibraryAdd to library Journal Article: Electrical Resistivity and Self-Potential Surveys Blue Mountain Geothermal Area, Nevada Abstract Self potential and electrical resistivity surveys have been completed at the Blue Mountain geothermal area to search for the source of thermal fluids discovered during drilling for mineral exploration, and to help characterize the geothermal resource. Two large SP anomalies are associated with the artesian thermal area and the area of highest temperature observed in drill holes. Two similar anomalies were mapped 1 to 3 km to the south

Note: This page contains sample records for the topic "blue ruthenium dimer" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


221

Blue Ribbon Commission on America's Nuclear Future Charter | Department of  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Blue Ribbon Commission on America's Nuclear Future Charter Blue Ribbon Commission on America's Nuclear Future Charter Blue Ribbon Commission on America's Nuclear Future Charter March 2, 2010 - 12:00am Addthis The Secretary of Energy, acting at the direction of the President, is establishing the Commission to conduct a comprehensive review of policies for managing the back end of the nuclear fuel cycle, including all alternatives for the storage, processing, and disposal of civilian and defense used nuclear fuel, high-level waste, and materials derived from nuclear activities. Specifically, the Commission will provide advice, evaluate alternatives, and make recommendations for a new plan to address these issues, including: Evaluation of existing fuel cycle technologies and R&D programs. Criteria for evaluation should include cost, safety, resource utilization

222

BlueWave Capital LLC | Open Energy Information  

Open Energy Info (EERE)

BlueWave Capital LLC BlueWave Capital LLC Jump to: navigation, search Name BlueWave Capital LLC Place Boston, Massachusetts Sector Renewable Energy Product Knowledge-based investment firm focused on early- and expansion-stage environmental and renewable energy-related operating companies. Coordinates 42.358635°, -71.056699° Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"ROADMAP","zoom":14,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"350px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":42.358635,"lon":-71.056699,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}

223

Why sequence Eukaryotic microbial metatranscriptome of blue grama grass  

NLE Websites -- All DOE Office Websites (Extended Search)

eukaryotic microbial metatranscriptome of blue grama grass eukaryotic microbial metatranscriptome of blue grama grass rhizosphere soils? About 50 miles south of Albuquerque, New Mexico is the Sevilleta National Wildlife Refuge managed by the U.S. Department of the Interior, Fish and Wildlife Service. The region is the intersection of several regional ecosystems, including grasslands, woodlands and riparian vegetation. The location is ideal for researchers to study how climate variability and climate change can act together to impact ecosystem dynamics and is known as the Sevilleta Long Term Ecological Research (LTER) site. This project focuses on the blue grama grass rhizosphere of the LTER site. Aridland ecosystems such as the one found in the Sevilleta represent at least a third of terrestrial biomes and are known for their nutrient-poor

224

Blue Ridge Mountain Electric Membership Corporation - Water Heater Rebate  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

You are here You are here Home » Blue Ridge Mountain Electric Membership Corporation - Water Heater Rebate Program Blue Ridge Mountain Electric Membership Corporation - Water Heater Rebate Program < Back Eligibility Residential Savings Category Home Weatherization Commercial Weatherization Sealing Your Home Heating & Cooling Commercial Heating & Cooling Cooling Construction Design & Remodeling Ventilation Manufacturing Heat Pumps Appliances & Electronics Water Heating Program Info State Georgia Program Type Utility Rebate Program Rebate Amount In-Home Energy Evaluation Program Windows: $500 Duct Repair: $500 Rehabilitation Work: $250 HVAC Replacement: $250/unit HVAC Tune-up: $150/unit Insulation: $500 Water Heater and Pipe Insulation: $50 Air Sealing: $500 Energy Right Program

225

Blue Mountain, Humboldt County, Nevada, U.S.A  

SciTech Connect

The report documents the drilling of well Deep Blue No.2, the second deep geothermal test hole at the Blue Mountain Geothermal Area, Humboldt County, Nevada. The well was drilled by Noramex Corp, a Nevada company, with funding support from the US Department of Energy, under the DOEs GRED II Program. Deep Blue No.2 was drilled as a step-out hole from Deep Blue No.1, to further evaluate the commercial potential of the geothermal resource. Deep Blue No.2 was designed as a vertical, slim observation test hole to a nominal target depth of 1000 meters (nominal 3400 feet). The well tests an area of projected high temperatures at depth, from temperature gradients measured in a group of shallow drill holes located approximately one kilometer to the northeast of observation hole Deep Blue No.1. The well is not intended for, or designed as, a commercial well or a production well. Deep Blue No.2 was spudded on March 25, 2004 and completed to a total depth of 1127.76m (3700 ft) on April 28, 2004. The well was drilled using conventional rotary drilling techniques to a depth of 201.17 m (660 ft), and continuously cored from 201.17m (660 ft) to 1127.76m (3700 ft). A brief rig-on flow-test was conducted at completion to determine basic reservoir parameters and obtain fluid samples. A permeable fracture zone with measured temperatures of 150 to 167C (302 to 333F) occurs between 500 to 750m (1640 to 2461ft). The well was left un-lined in anticipation of the Phase III - Flow and Injection Testing. A further Kuster temperature survey was attempted after the well had been shut in for almost 3 weeks. The well appears to have bridged off at 439m (1440ft) as the Kuster tool was unable to descend past this point. Several attempts to dislodge the obstruction using tube jars were unsuccessful. Deep Blue No.2 encountered variably fractured and veined, fine-grained rocks of the Singas Formation, and intruded by minor strongly altered fine-grained felsic dikes, and less altered fineto medium-grained felsic to intermediate dikes. Widespread open fractures and extensive of quartz veining in many intervals of the core indicate a high degree of fracturing and flow of silica-bearing fluids, almost certainly hotter than 200C (392F), at some time, but these fractures are now partially sealed. Intervals of soft shaly mudstone, common clay gouge, and rocks with generally low permeability (few veins and fractures) may also form a seal or cap above the main high temperature reservoir at Blue Mountain. The encouraging results from Deep Blue No.2 support further drilling at Blue Mountain. Higher temperature fluids can be expected where fractures providing channels for the circulation of hot water from depth have not been sealed extensively by silica deposition.

Ted Fitzpatrick, Brian D. Fairbank

2005-04-01T23:59:59.000Z

226

Selective Transformation of 5-Hydroxymethylfurfural into the Liquid Fuel 2,5-Dimethylfuran over Carbon-Supported Ruthenium  

Science Journals Connector (OSTI)

Selective Transformation of 5-Hydroxymethylfurfural into the Liquid Fuel 2,5-Dimethylfuran over Carbon-Supported Ruthenium ... A simple and efficient process was presented for the selective hydrogenation of 5-hydroxymethylfurfural (HMF) into the high-quality liquid fuel 2,5-dimethylfuran (DMF) in the presence of tetrahydrofuran (THF). ... (1-3) Among the many possible chemicals, 5-hydroxymethylfurfural (HMF), which can be produced from a variety of biomass-derived carbohydrates,(4-8) is recognized as a versatile intermediate (Scheme 1), and it can be further converted into a series of high-quality fuels such as ethyl levulinate (EL),(9) 5-ethoxymethylfurfural (EMF),(10) 2,5-dimethylfuran (DMF),(11) C9C15 alkanes,(12) and high-value chemicals such as levulinic acid (LA),(13) 2,5-dihydroxymethylfurfural (DHMF),(14) 2,5-diformylfuran (DFF),(15) and 2,5-furandicarboxylic acid (FDCA). ...

Lei Hu; Xing Tang; Jiaxing Xu; Zhen Wu; Lu Lin; Shijie Liu

2014-02-02T23:59:59.000Z

227

Blue Canyon II Wind Farm | Open Energy Information  

Open Energy Info (EERE)

Blue Canyon II Wind Farm Blue Canyon II Wind Farm Jump to: navigation, search Name Blue Canyon II Wind Farm Facility Blue Canyon II Sector Wind energy Facility Type Commercial Scale Wind Facility Status In Service Owner Horizon Wind Energy Developer Horizon Wind Energy Energy Purchaser American Electric Power Location North of Lawton OK Coordinates 34.8582°, -98.54752° Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"ROADMAP","zoom":14,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"350px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":34.8582,"lon":-98.54752,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}

228

CHEMICAL CRITERIA OF ANAEROBIOSIS WITH SPECIAL REFERENCE TO METHYLENE BLUE  

Science Journals Connector (OSTI)

...plain or constricted tube, or sand in a Smith fermentation tube...subgtances, notably carbo- hydrates. A correspondence between...des alcalis dilues sur les hydrates de carbone. I. Rec. trav...CLOSSEN 1905 The physiological behavior of methylene blue and methylene...

Ivan C. Hall

1921-01-01T23:59:59.000Z

229

Exposure to seismic survey alters blue whale acoustic communication  

Science Journals Connector (OSTI)

...research-article Animal behaviour 1001 14 Exposure to seismic survey alters blue whale acoustic communication...their natural functions. Sounds from seismic surveys are intense and have peak frequency...changed their vocal behaviour during a seismic survey that deployed a low-medium power...

2010-01-01T23:59:59.000Z

230

Alcian Blue Alizarin Red Skeletal Staining October 2003  

E-Print Network (OSTI)

. Fix the specimen in 95% ethanol for 12-48 hours slowly rocking at room temperature. (Older embryos require longer fixation!!) The specimen may be placed in 95% ethanol for long periods of time without any damage. 3. Replace 95% ethanol with Alcian blue staining solution for 1-3 days slowly rocking at room

De Robertis, Eddy M.

231

Nitrogenase Activity in Heterocysts of BlueGreen Algae  

Science Journals Connector (OSTI)

... are the loci of nitrogenase activity, (iii) the requirements Or nitrogenase activity in algae are similar to the re.quirements for nitrogenase activity in other nitrogen-fixing plants, ... of phyco-cyanin, photosystem II may not be present in the heterocysts of blue-green algae and thus these cells would not evolve oxygen. But, on the other hand, ...

W. D. P. STEWART; A. HAYSTEAD; H. W. PEARSON

1969-10-18T23:59:59.000Z

232

Atomic site sensitive processes in low energy ion-dimer collisions  

E-Print Network (OSTI)

Electron capture processes for low energy Ar9+ ions colliding on Ar2 dimer targets are investigated, focusing attention on charge sharing as a function of molecule orientation and impact parameter. A preference in charge-asymmetric dissociation channels is observed, with a strong correlation between the projectile scattering angle and the molecular ion orientation. The measurements provide here clear evidences that projectiles distinguish each atom in the target and, that electron capture from near-site atom is favored. Monte Carlo calculations based on the classical over-the-barrier model, with dimer targets represented as two independent atoms, are compared to the data. They give a new insight into the dynamics of the collision by providing, for the di erent electron capture channels, the two-dimensional probability maps p(~b), where ~b is the impact parameter vector in the molecular frame.

W. Iskandar; J. Matsumoto; A. Leredde; X. Flchard; B. Gervais; S. Guillous; D. Hennecart; A. Mry; J. Rangama; C. L. Zhou; H. Shiromaru; A. Cassimi

2014-05-12T23:59:59.000Z

233

A Concise and Versatile Double-Cyclization Strategy for the Highly Stereoselective Synthesis and Arylative Dimerization of Aspidosperma Alkaloids  

E-Print Network (OSTI)

Building cycles: A strategy for the concise, stereoselective synthesis of aspidosperma alkaloids and related structures via a common putative diiminium ion intermediate is reported. The approach enables the dimerization ...

Medley, Jonathan William

234

T-720: Blue Coat Director HTTP Trace Processing Flaw Permits Cross-Site  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

0: Blue Coat Director HTTP Trace Processing Flaw Permits 0: Blue Coat Director HTTP Trace Processing Flaw Permits Cross-Site Scripting Attacks T-720: Blue Coat Director HTTP Trace Processing Flaw Permits Cross-Site Scripting Attacks September 19, 2011 - 8:45am Addthis PROBLEM Blue Coat Director HTTP Trace Processing Flaw Permits Cross-Site Scripting Attacks. PLATFORM: All versions of Director prior to 5.5.2.3 are vulnerable. ABSTRACT: A vulnerability was reported in Blue Coat Director. A remote user can conduct cross-site scripting attacks. reference LINKS: Blue Coat Advisories ID: SA62 SecurityTracker Alert ID: 1026061 Blue Coat Director 510 Blue Coat SGME 5 IMPACT ASSESSMENT: Medium Discussion: An attacker can use the HTTP TRACE method to echo malicious script back to the client as part of a Cross Site Scripting (XSS) attack. No

235

T-651: Blue Coat ProxySG Discloses Potentially Sensitive Information...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

1: Blue Coat ProxySG Discloses Potentially Sensitive Information in Core Files T-651: Blue Coat ProxySG Discloses Potentially Sensitive Information in Core Files June 21, 2011 -...

236

Report of the Blue Ribbon Panel on the Review of the Radiation...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Report of the Blue Ribbon Panel on the Review of the Radiation Effects Research Foundation Report of the Blue Ribbon Panel on the Review of the Radiation Effects Research...

237

Structural Basis of the GreenBlue Color Switching in Proteorhodopsin as Determined by NMR Spectroscopy  

Science Journals Connector (OSTI)

Structural Basis of the GreenBlue Color Switching in Proteorhodopsin as Determined by NMR Spectroscopy ... Consequently, the S0S1 energy gap increases, resulting in the observed blue shift. ...

Jiafei Mao; Nhu-Nguyen Do; Frank Scholz; Lenica Reggie; Michaela Mehler; Andrea Lakatos; Yean-Sin Ong; Sandra J. Ullrich; Lynda J. Brown; Richard C. D. Brown; Johanna Becker-Baldus; Josef Wachtveitl; Clemens Glaubitz

2014-11-21T23:59:59.000Z

238

I Have Seen the Light and It's Green...or Pink, or Blue, or Purple...  

Office of Environmental Management (EM)

or Blue, or Purple. Shucks, it's LED Solid-State Lighting. I Have Seen the Light and It's Green...or Pink, or Blue, or Purple. Shucks, it's LED Solid-State Lighting. May 5, 2009 -...

239

Conditional Glycosylation in Eukaryotic Cells Using a Biocompatible Chemical Inducer of Dimerization  

Science Journals Connector (OSTI)

Here we report a new biocompatible CID, Tmp-SLF, which dimerizes E. coli DHFR and FKBP and has no endogenous mammalian targets that would lead to unwanted in vivo side effects. ... We employed Tmp-SLF to modulate gene expression in a yeast three-hybrid assay. ... Finally, we engineered the Golgi-resident glycosyltransferase FucT7 for tunable control by Tmp-SLF in mammalian cells. ...

Jennifer L. Czlapinski; Michael W. Schelle; Lawrence W. Miller; Scott T. Laughlin; Jennifer J. Kohler; Virginia W. Cornish; Carolyn R. Bertozzi

2008-09-13T23:59:59.000Z

240

A Triphenylamine-Grafted Imidazo[4,5-f][1,10]phenanthroline Ruthenium(II) Complex: Acid?Base and Photoelectric Properties  

Science Journals Connector (OSTI)

A new heteroleptic ruthenium(II) complex of [Ru(Hipdpa)(Hdcbpy)(NCS)2]?0.5H+0.5[N(C4H9)4]+Ru(Hipdpa) {where Hdcbpy = monodeprotonated 4,4?-dicarboxy-2,2?-bipyridine and Hipdpa = 4-(1H-imidazo[4,5-f][1,10]phenanthrolin-2-yl)-N,N-diphenylaniline} was ...

Su-Hua Fan; An-Guo Zhang; Chuan-Chuan Ju; Li-Hua Gao; Ke-Zhi Wang

2010-03-25T23:59:59.000Z

Note: This page contains sample records for the topic "blue ruthenium dimer" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


241

Theoretical Studies on Two-Dimensional Nonlinear Optical Chromophores with Pyrazinyl Cores and Organic or Ruthenium(II) Ammine Electron Donors  

Science Journals Connector (OSTI)

Benjamin J. Coe * and Rachel A. Pilkington ... Coe, B. J.; Harris, J. A.; Asselberghs, I.; Persoons, A.; Jeffery, J. C.; Rees, L. H.; Gelbrich, T.; Hursthouse, M. B.Tuning of Charge-Transfer Absorption and Molecular Quadratic Nonlinear Optical Properties in Ruthenium(II) Ammine Complexes J. Chem. ... Coe, Benjamin J.; Harris, James A.; Asselberghs, Inge; Persoons, Andre; Jeffery, John C.; Rees, Leigh H.; Gelbrich, Thomas; Hursthouse, Michael B. ...

Benjamin J. Coe; Rachel A. Pilkington

2014-02-27T23:59:59.000Z

242

Lab Safety: RuO4Lab Safety: RuO4 Ruthenium tetroxide is a strong oxidizing agent and must be stored in the  

E-Print Network (OSTI)

Lab Safety: RuO4Lab Safety: RuO4 RuO4 Note: Ruthenium tetroxide is a strong oxidizing agent with sodium bisulfite solution to decompose RuO4 and then flush with plenty of water. #12;Lab Safety:Lab Safety: Reaction used to create RuO4 for staining: RuCl3 #12;Sodium hypochlorite: HARMFUL IF SWALLOWED

Cohen, Robert E.

243

Blue-Green Algae: Isolation of Bacteria-free Cultures from Hormogone-producing Blue-Green Algae  

Science Journals Connector (OSTI)

... THE difficulties associated with obtaining bacteria -free cultures of blue-green algae are well known. Various techniques, involving the use of toxic physical or chemical agents ... of others, based on the assumption that an agent might be found to which the algae alone would be insusceptible, gave equally disappointing results. The possibility of using antibiotics has ...

J. S. BUNT

1961-12-30T23:59:59.000Z

244

The reaction dynamics of alkali dimer molecules and electronically excited alkali atoms with simple molecules  

SciTech Connect

This dissertation presents the results from the crossed molecular beam studies on the dynamics of bimolecular collisions in the gas phase. The primary subjects include the interactions of alkali dimer molecules with simple molecules, and the inelastic scattering of electronically excited alkali atoms with O{sub 2}. The reaction of the sodium dimers with oxygen molecules is described in Chapter 2. Two reaction pathways were observed for this four-center molecule-molecule reaction, i.e. the formations of NaO{sub 2} + Na and NaO + NaO. NaO{sub 2} products exhibit a very anisotropic angular distribution, indicating a direct spectator stripping mechanism for this reaction channel. The NaO formation follows the bond breaking of O{sub 2}, which is likely a result of a charge transfer from Na{sub 2} to the excited state orbital of O{sub 2}{sup {minus}}. The scattering of sodium dimers from ammonium and methanol produced novel molecules, NaNH{sub 3} and Na(CH{sub 3}OH), respectively. These experimental observations, as well as the discussions on the reaction dynamics and the chemical bonding within these molecules, will be presented in Chapter 3. The lower limits for the bond dissociation energies of these molecules are also obtained. Finally, Chapter 4 describes the energy transfer between oxygen molecules and electronically excited sodium atoms.

Hou, H. [Univ. of California, Berkeley, CA (United States). Dept. of Chemistry]|[Lawrence Berkeley National Lab., CA (United States). Chemical Sciences Div.

1995-12-01T23:59:59.000Z

245

The Structure of the MAP2K MEK6 Reveals an Autoinhibitory Dimer  

SciTech Connect

MAP2Ks are dual-specificity protein kinases functioning at the center of three-tiered MAP kinase modules. The structure of the kinase domain of the MAP2K MEK6 with phosphorylation site mimetic aspartic acid mutations (MEK6/{Delta}N/DD) has been solved at 2.3 {angstrom} resolution. The structure reveals an autoinhibited elongated ellipsoidal dimer. The enzyme adopts an inactive conformation, based upon structural queues, despite the phosphomimetic mutations. Gel filtration and small-angle X-ray scattering analysis confirm that the crystallographically observed ellipsoidal dimer is a feature of MEK6/{Delta}N/DD and full-length unphosphorylated wild-type MEK6 in solution. The interface includes the phosphate binding ribbon of each subunit, part of the activation loop, and a rare 'arginine stack' between symmetry-related arginine residues in the N-terminal lobe. The autoinhibited structure likely confers specificity on active MAP2Ks. The dimer may also serve the function in unphosphorylated MEK6 of preventing activation loop phosphorylation by inappropriate kinases.

Min, Xiaoshan; Akella, Radha; He, Haixia; Humphreys, John M.; Tsutakawa, Susan E.; Lee, Seung-Jae; Tainer, John A.; Cobb, Melanie H.; Goldsmith, Elizabeth J.

2009-07-13T23:59:59.000Z

246

The HPr Proteins from the Thermophile Bacillus stearothermophilus Can Form Domain-swapped Dimers  

SciTech Connect

The study of proteins from extremophilic organisms continues to generate interest in the field of protein folding because paradigms explaining the enhanced stability of these proteins still elude us and such studies have the potential to further our knowledge of the forces stabilizing proteins. We have undertaken such a study with our model protein HPr from a mesophile, Bacillus subtilis, and a thermophile, Bacillus stearothermophilus. We report here the high-resolution structures of the wild-type HPr protein from the thermophile and a variant, F29W. The variant proved to crystallize in two forms: a monomeric form with a structure very similar to the wild-type protein as well as a domain-swapped dimer. Interestingly, the structure of the domain-swapped dimer for HPr is very different from that observed for a homologous protein, Crh, from B. subtilis. The existence of a domain-swapped dimer has implications for amyloid formation and is consistent with recent results showing that the HPr proteins can form amyloid fibrils. We also characterized the conformational stability of the thermophilic HPr proteins using thermal and solvent denaturation methods and have used the high-resolution structures in an attempt to explain the differences in stability between the different HPr proteins. Finally, we present a detailed analysis of the solution properties of the HPr proteins using a variety of biochemical and biophysical methods.

Sridharan, Sudharsan; Razvi, Abbas; Scholtz, J. Martin; Sacchettini, James C. (TAM)

2010-07-20T23:59:59.000Z

247

The use of Tafel back extrapolation to clarify the influence of ruthenium and palladium alloying on the corrosion behaviour of titanium in concentrated hydrochloric acid  

Science Journals Connector (OSTI)

Tafel back extrapolation of the cathodic reaction was used to interpret polarization data obtained for titanium alloyed with small amounts of ruthenium and palladium in concentrated hydrochloric acid. It was found that the ruthenium and palladium stimulated the cathodic reaction, but that the anodic behaviour of the titanium was unchanged. The results indicate that the corrosion of the titanium is increased by the small amount of alloying as the catalysis of the hydrogen reduction reaction was not strong enough to cause passivity of the titanium under these conditions. This was even so at longer times of exposure when significant enrichment of the ruthenium and palladium occurred on the surface of the titanium. Thermodynamic data were used to give further perspective to the results. Although excellent Tafel behaviour was found for the cathodic reaction, the exchange current densities and Tafel slopes obtained, are specific to the prior exposure time and surface enrichment of the alloying elements, and should not be interpreted as steady state data.

R.F. Sandenbergh; E. Van der Lingen

2005-01-01T23:59:59.000Z

248

A Novel Dimer Interface and Conformational Changes Revealed by an X-ray Structure of B. subtilis SecA  

SciTech Connect

The SecA ATPase moves polypeptides post-translationally across the plasma membrane of eubacteria, but the mechanism of transport is still unclear. We describe the crystal structure of a novel dimeric form of Bacillus subtilis SecA. Dimerization of SecA occurs at the prominent groove formed by the nucleotide binding domain 2 (nbd2) and the preprotein cross-linking (ppx) domain. The dimer interface is very large, burying approximately 5400 {angstrom}{sup 2} of solvent accessible surface per monomer. Single cysteine disulfide cross-linking shows the presence of this novel SecA dimer in solution. In addition, other dimers also exist in solution, arguing that they all are in equilibrium with monomeric SecA and supporting the idea that the monomer may be the functional species. Dimerization of SecA causes an {alpha}-helix of one subunit to convert to a short {beta}-strand that participates in {beta}-sheet formation with strands in the other subunit. This conversion of secondary structure elements occurs close to the connection between the nbd1 and ppx domains, a potential site of interaction with translocation substrate. Comparing the different X-ray structures of B. subtilis SecA suggests that small changes in the nucleotide binding domains could be amplified via helix 1 of the helical scaffold domain (hsd) to generate larger movements of the domains involved in polypeptide binding.

Zimmer,J.; Li, W.; Rapoport, T.

2006-01-01T23:59:59.000Z

249

The Structure of the Poxvirus A33 Protein Reveals a Dimer of Unique C-Type Lectin-Like Domains  

SciTech Connect

The current vaccine against smallpox is an infectious form of vaccinia virus that has significant side effects. Alternative vaccine approaches using recombinant viral proteins are being developed. A target of subunit vaccine strategies is the poxvirus protein A33, a conserved protein in the Chordopoxvirinae subfamily of Poxviridae that is expressed on the outer viral envelope. Here we have determined the structure of the A33 ectodomain of vaccinia virus. The structure revealed C-type lectin-like domains (CTLDs) that occur as dimers in A33 crystals with five different crystal lattices. Comparison of the A33 dimer models shows that the A33 monomers have a degree of flexibility in position within the dimer. Structural comparisons show that the A33 monomer is a close match to the Link module class of CTLDs but that the A33 dimer is most similar to the natural killer (NK)-cell receptor class of CTLDs. Structural data on Link modules and NK-cell receptor-ligand complexes suggest a surface of A33 that could interact with viral or host ligands. The dimer interface is well conserved in all known A33 sequences, indicating an important role for the A33 dimer. The structure indicates how previously described A33 mutations disrupt protein folding and locates the positions of N-linked glycosylations and the epitope of a protective antibody.

Su, Hua-Poo; Singh, Kavita; Gittis, Apostolos G.; Garboczi, David N. (NIH)

2010-11-03T23:59:59.000Z

250

School of Psychology Blue Book's Friend 2011-2012 School of Psychology  

E-Print Network (OSTI)

School of Psychology Blue Book's Friend 2011-2012 1 School of Psychology The Queen's University of Belfast The Blue Book's Friend 2011-2012 Undergraduate #12;School of Psychology Blue Book's Friend 2011 of Staff in the School of Psychology ... ... ... ... ... 3 More Details about Your Degree

Müller, Jens-Dominik

251

Blue Earth-Nicollet-Faribault | Open Energy Information  

Open Energy Info (EERE)

Earth-Nicollet-Faribault Earth-Nicollet-Faribault Jump to: navigation, search Name Blue Earth-Nicollet-Faribault Place Minnesota Utility Id 1884 Utility Location Yes Ownership C NERC Location MRO NERC MRO Yes Activity Distribution Yes Alt Fuel Vehicle Yes Alt Fuel Vehicle2 Yes References EIA Form EIA-861 Final Data File for 2010 - File1_a[1] LinkedIn Connections CrunchBase Profile No CrunchBase profile. Create one now! This article is a stub. You can help OpenEI by expanding it. Utility Rate Schedules Grid-background.png No rate schedules available. Average Rates Residential: $0.1120/kWh Commercial: $0.0912/kWh References ↑ "EIA Form EIA-861 Final Data File for 2010 - File1_a" Retrieved from "http://en.openei.org/w/index.php?title=Blue_Earth-Nicollet-Faribault&oldid=409059

252

Blue Canyon V Wind Farm | Open Energy Information  

Open Energy Info (EERE)

V Wind Farm V Wind Farm Jump to: navigation, search Name Blue Canyon V Wind Farm Facility Blue Canyon V Sector Wind energy Facility Type Commercial Scale Wind Facility Status In Service Owner Horizon-EDPR Developer Horizon-EDPR Energy Purchaser Public Service of Oklahoma Location Caddo & Comanche Counties OK Coordinates 34.8582°, -98.54752° Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"ROADMAP","zoom":14,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"350px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":34.8582,"lon":-98.54752,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}

253

Blue Ridge Elec Member Corp | Open Energy Information  

Open Energy Info (EERE)

Blue Ridge Elec Member Corp Blue Ridge Elec Member Corp Place North Carolina Utility Id 1889 Utility Location Yes Ownership C NERC Location SERC NERC SERC Yes Activity Transmission Yes Activity Distribution Yes References EIA Form EIA-861 Final Data File for 2010 - File1_a[1] LinkedIn Connections CrunchBase Profile No CrunchBase profile. Create one now! This article is a stub. You can help OpenEI by expanding it. Utility Rate Schedules Grid-background.png Cogeneration and Independent Power Porducers Industrial General Service - Single-Phase Commercial General Service - Three-Phase Commercial General Service Small Commercial - Single-Phase Commercial General Service Small Commercial - Three-Phase Commercial Growth Zone Pricing Industrial Industrial Economic Development Textile Industrial

254

Blue Spruce Farm Ana Biomass Facility | Open Energy Information  

Open Energy Info (EERE)

Spruce Farm Ana Biomass Facility Spruce Farm Ana Biomass Facility Jump to: navigation, search Name Blue Spruce Farm Ana Biomass Facility Facility Blue Spruce Farm Ana Sector Biomass Location Vermont Coordinates 44.5588028°, -72.5778415° Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"ROADMAP","zoom":14,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"350px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":44.5588028,"lon":-72.5778415,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}

255

Blue Ash, Ohio: Energy Resources | Open Energy Information  

Open Energy Info (EERE)

Blue Ash, Ohio: Energy Resources Blue Ash, Ohio: Energy Resources Jump to: navigation, search Equivalent URI DBpedia Coordinates 39.2320029°, -84.3782734° Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"ROADMAP","zoom":14,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"350px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":39.2320029,"lon":-84.3782734,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}

256

Blue Star Energy Services (Maryland) | Open Energy Information  

Open Energy Info (EERE)

Maryland) Maryland) Jump to: navigation, search Name Blue Star Energy Services Place Maryland Utility Id 55722 References EIA Form EIA-861 Final Data File for 2010 - File2_2010[1] LinkedIn Connections CrunchBase Profile No CrunchBase profile. Create one now! This article is a stub. You can help OpenEI by expanding it. Utility Rate Schedules Grid-background.png No rate schedules available. Average Rates Commercial: $0.0994/kWh References ↑ "EIA Form EIA-861 Final Data File for 2010 - File2_2010" Retrieved from "http://en.openei.org/w/index.php?title=Blue_Star_Energy_Services_(Maryland)&oldid=412437" Categories: EIA Utility Companies and Aliases Utility Companies Organizations Stubs What links here Related changes Special pages Printable version Permanent link

257

Aeromagnetic Survey At Blue Mountain Area (Fairbank Engineering, 2004) |  

Open Energy Info (EERE)

4) 4) Exploration Activity Details Location Blue Mountain Area Exploration Technique Aeromagnetic Survey Activity Date Usefulness not indicated DOE-funding Unknown Notes The airborne magnetometer and VLF-EM surveys carried out by Aerodat Limited, in 1988, covered the western flank of Blue Mountain including most of the geothermal lease area. The interpreted data (total field magnetic contours; calculated vertical magnetic gradient) indicate parallel sets of northerly, northeasterly, and northwesterly-trending structures that correspond well with the major fault sets identified from geologic mapping and interpreted drilling sections. Also, an elongate northerly-trending area of low magnetic gradient coincides closely with the area of intense hydrothermal alteration associated with the prominent north-south range

258

Blue Aquarius Fish Farms Aquaculture Low Temperature Geothermal Facility |  

Open Energy Info (EERE)

Aquarius Fish Farms Aquaculture Low Temperature Geothermal Facility Aquarius Fish Farms Aquaculture Low Temperature Geothermal Facility Jump to: navigation, search Name Blue Aquarius Fish Farms Aquaculture Low Temperature Geothermal Facility Facility Blue Aquarius Fish Farms Sector Geothermal energy Type Aquaculture Location Mecca, California Coordinates 33.571692°, -116.0772244° Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"ROADMAP","zoom":14,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"350px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[]}

259

FERN Blue Ribbon Wind Farm II* | Open Energy Information  

Open Energy Info (EERE)

II* II* Jump to: navigation, search Name FERN Blue Ribbon Wind Farm II* Facility FERN Blue Ribbon Wind Farm II* Sector Wind energy Facility Type Offshore Wind Facility Status Proposed Developer Fishermen's Energy Location Offshore from Atlantic City NJ Coordinates 39.183°, -74.428° Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"ROADMAP","zoom":14,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"350px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":39.183,"lon":-74.428,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}

260

Dehydrated Prussian Blues for CO2 Storage and Separation Applications  

SciTech Connect

Adsorption isotherms of pure gases present in flue and natural gas including CO2, N2, CH4 and water were studied using prussian blues of chemical formula M3[Co(CN)6]2 (M = Cu, Ni, Mn). These materials adsorbed 8-12 wt % of CO2 at room temperature and 1 bar of pressure with heats of adsorption ranging from 6 to 16 kcal/mol.

Motkuri, Radha K.; Thallapally, Praveen K.; McGrail, B. Peter; Ghorishi, Behrooz S.

2010-08-13T23:59:59.000Z

Note: This page contains sample records for the topic "blue ruthenium dimer" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


261

UHV and electrochemical studies of CO and methanol adsorbed at platinum/ruthenium surfaces, and reference to fuel cell catalysis  

Science Journals Connector (OSTI)

This paper reviews surface chemistry of carbon monoxide and methanol in ultra high vacuum (UHV) and in the electrochemical environment on clean and Ru modified Pt single crystal surfaces, and on Pt and Pt/Ru nanoparticles. The results show that CO behaves very similarly in UHV and in the electrochemical environment. Cyclic voltammetry (CV), temperature programmed desorption (TPD) and radioactive labeling all show similar behavior in terms of numbers of peaks, peak splitting etc. Both UHV and CV measurements show that there is about a 200-meV change in the potential for CO removal in the presence of ruthenium. Earlier 13C EC-NMR data indicated a 30% reduction in the Ef-LDOS of CO bound to Ru islands deposited on platinum, and 15% of CO bound to Pt sites, and TPD and CV also show that the binding of CO is modified. The present data confirm that Pt atoms away from Ru are only weakly affected, and the overall CO binding energy modification is quite moderate. We conclude that the changes in the CO binding energy only play a small role in enhancing methanol electrooxidation rates. Instead, the main effect of the ruthenium is to activate water to form OH. Quantitative estimates of the reduction in CO desorption barrier indicate that the effect of bifunctional mechanism is about four times larger than that of ligand effect. In contrast to the results for CO, methanol behaves quite differently in UHV and in an electrochemical environment. Pt(111) is unreactive at room temperature in UHV, while Pt(110) is quite reactive. Initially, clean Pt(111) is less reactive than clean Pt(110) even in the electrochemical environment. However, Pt(110) is quickly poisoned in the electrochemical environment, so at steady state, Pt(111) is more reactive than Pt(110). Another issue is that the mechanism of methanol decomposition is quite different in UHV and in the electrochemical environment. There are three pathways in UHV, a simple decomposition via a methoxonium (CH3O?(ad)) intermediate, an SN1 pathway via a methoxonium cation ([CH3OH2]+), and an SN2 pathway via a methoxonium intermediate. So far, none of these pathways have been observed in an electrochemical environment. Instead, the decomposition goes mainly through a hydroxymethyl (?CH2OH(ad)) intermediate. These results show that there are both similarities and differences in the behavior of simple molecules in UHV and in the electrochemical environment.

P. Waszczuk; G.-Q. Lu; A. Wieckowski; C. Lu; C. Rice; R.I. Masel

2002-01-01T23:59:59.000Z

262

Inconsistencies in air quality metrics: 'Blue Sky' days and  

Science Journals Connector (OSTI)

International attention is focused on Beijing's efforts to improve air quality. The number of days reported as attaining the daily Chinese National Ambient Air Quality Standard for cities, called 'Blue Sky' days, has increased yearly from 100 in 1998 to 246 in 2007. However, analysis of publicly reported daily air pollution index (API) values for fine particulate matter (diameter?10m, PM10), indicates a discrepancy between the reported 'Blue Sky' days (defined as API?100, PM10?150gm?3) and published monitoring station data. Here I show that reported improvements in air quality for 20062007 over 2002 levels can be attributed to (a)a shift in reported daily PM10 concentrations from just above to just below the national standard, and (b)a shift of monitoring stations in 2006 to less polluted areas. I found that calculating daily Beijing API for 2006 and 2007 using data from the original monitoring stations eliminates a bias in reported PM10 concentrations near the 'Blue Sky' boundary, and results in a number of 'Blue Sky' days and annual PM10 concentration near 2002 levels in 2006 and 2007 (203 days and ~167gm?3 calculated for 200638 days fewer and a PM10 concentration ~6gm?3 higher than reported; 191 'Blue Sky' days and ~161gm?3 calculated for 200755 days fewer and a PM10 concentration ~12gm?3 higher than reported; 203 days and 166gm?3 were reported in 2002). Furthermore, although different pollutants were monitored before daily reporting began and less stringent standards were implemented in June 2000, reported annual average concentrations of particulate (diameter?100m, TSP) and nitrogen dioxide (NO2) indicate no improvement between 1998 and 2002. This analysis highlights the sensitivity of monitoring data in the evaluation of air quality trends, and the potential for the misinterpretation or manipulation of these trends on the basis of inconsistent metrics.

Steven Q Andrews

2008-01-01T23:59:59.000Z

263

UV Radiation??Sensitive Norin 1 Rice Contains Defective Cyclobutane Pyrimidine Dimer Photolyase  

Science Journals Connector (OSTI)

...min under these conditions led to loss of function, perhaps...supplemental radiation from six UVB bulbs (model FL20SE Toshiba, Tokyo...was provided by cool white fluorescent lamps (Sylvania/GTE, Danvers...exposure to light from two blue fluorescent lamps (model 15T8/B North...

Jun Hidema; Tadashi Kumagai; Betsy M. Sutherland

264

Directed transport in equilibrium : analysis of the dimer model with inertial terms  

E-Print Network (OSTI)

We have previously shown an analysis of our dimer model in the over-damped regime to show directed transport in equilibrium. Here we analyze the full model with inertial terms present to establish the same result. First we derive the Fokker-Planck equation for the system following a Galilean transformation to show that a uniformly translating equilibrium distribution is possible. Then, we find out the velocity selection for the centre of mass motion using that distribution on our model. We suggest generalization of our calculations for soft collision potentials and indicate to interesting situation with possibility of oscillatory non-equilibrium state within equilibrium.

A. Bhattacharyay

2011-08-15T23:59:59.000Z

265

Hydrogen atom trapping in a self-organized one-dimensional dimer  

SciTech Connect

Metalorganic frameworks (MOFs) have attracted widespread attention owing to their unusual structure and properties produced by their nanospaces. However, many MOFs possess the similar three-dimensional frameworks, limiting their structural variety and operating capacity for hydrogen storage under ambient conditions. Here we report the synthesis and structural characterization of a single-crystal one-dimensional dimer whose structure, operating capacity, and physical mechanism contrast with those of existing MOFs. The hydrogen storage capacity of 2.6 wt.% is comparable to the highest capacity achieved by existing MOFs at room temperature. This exceptional storage capacity is realized by self-organization during crystal growth using a weak base.

Takami, Tsuyoshi, E-mail: takami@phys.sci.osaka-u.ac.jp [Department of Physics, Graduate School of Science, Osaka University, 1-1 Machikaneyama-cho, Toyonaka, Osaka 560-0043 (Japan); Kawamura, Kazushi [Analytical Measurement Room, Graduate School of Science, Osaka University, 1-1 Machikaneyama-cho, Toyonaka, Osaka 560-0043 (Japan)

2014-09-01T23:59:59.000Z

266

Structure of the Response Regulator PhoP from Mycobacterium tuberculosis Reveals a Dimer Through the Receiver Domain  

SciTech Connect

The PhoP protein from Mycobacterium tuberculosis is a response regulator of the OmpR/PhoB subfamily, whose structure consists of an N-terminal receiver domain and a C-terminal DNA-binding domain. How the DNA-binding activities are regulated by phosphorylation of the receiver domain remains unclear due to a lack of structural information on the full-length proteins. Here we report the crystal structure of the full-length PhoP of M. tuberculosis. Unlike other known structures of full-length proteins of the same subfamily, PhoP forms a dimer through its receiver domain with the dimer interface involving {alpha}4-{beta}5-{alpha}5, a common interface for activated receiver domain dimers. However, the switch residues, Thr99 and Tyr118, are in a conformation resembling those of nonactivated receiver domains. The Tyr118 side chain is involved in the dimer interface interactions. The receiver domain is tethered to the DNA-binding domain through a flexible linker and does not impose structural constraints on the DNA-binding domain. This structure suggests that phosphorylation likely facilitates/stabilizes receiver domain dimerization, bringing the DNA-binding domains to close proximity, thereby increasing their binding affinity for direct repeat DNA sequences.

S Menon; S Wang

2011-12-31T23:59:59.000Z

267

Electrochemical reductions of Hg(II), ruthenium-nitrosyl complex, chromate, and nitrate in a strong alkaline solution  

SciTech Connect

The electrochemistry of low-level nuclear wastes, the reductions of Hg(II), [RuNO(NO{sub 2}){sub 4}OH]{sup 2{minus}}, CrO{sub 4}{sup 2{minus}}, and NO{sub 3}{sup {minus}} in 1.33 M NaOH solution have been studied primarily at nickel electrodes for electrocatalytic advantages. Hg(II) was reduced to Hg metal [equilibrium potential of 0.099 V vs NHE (normal hydrogen electrode)]. The ruthenium-nitrosyl complex, [RuNO(NO{sub 2}){sub 4}OH]{sup 2{minus}}, was reduced to Ru metal (half-wave potential of {minus}0.38 V vs NHE). Chromate was reduced to chromic hydroxide (equilibrium potential of {minus}0.24 V vs NHE). Nitrate reduction has two different regions of Tafel behavior from which reduction mechanisms are proposed. The exchange current densities for the nitrate reduction at Ni, Pb, Fe, and graphite were measured and the competition of the nitrate reduction with the hydrogen evolution investigated.

Bockris, J.O`M.; Kim, J. [Texas A and M Univ., College Station, TX (United States)

1996-12-01T23:59:59.000Z

268

Contact Manufacturing Demonstration Facility Craig Blue, Ph.D.  

NLE Websites -- All DOE Office Websites (Extended Search)

Manufacturing Demonstration Facility Craig Blue, Ph.D. Director, Manufacturing Demonstration Facility (865) 574-4351 blueca@ornl.gov INNOVATIONS IN MANUFACTURING www.ornl.gov/manufacturing Advanced Manufacturing Next-Generation Manufacturing As the nation's premier research laboratory, Oak Ridge National Laboratory is one of the world's most capable resources for transforming the next generation of scientific discovery into solutions for rebuilding and revitalizing America's manufacturing industries. These industries call upon ORNL's expertise in materials synthesis, characterization, and process technology to reduce risk and accelerate the development and deployment of innovative energy-efficient manufacturing processes and materials targeting products of the future.

269

Evidence that the Yeast Desaturase Ole1p Exists as a Dimer In Vivo  

SciTech Connect

Desaturase enzymes are composed of two classes, the structurally well characterized soluble class found predominantly in the plastids of higher plants and the more widely distributed but poorly structurally defined integral membrane class. Despite their distinct evolutionary origins, the two classes both require an iron cofactor and molecular oxygen for activity and are inhibited by azide and cyanide, suggesting strong mechanistic similarities. The fact that the soluble desaturase is active as a homodimer prompted us test the hypothesis that an archetypal integral membrane desaturase from Saccharomyces cerevisiae, the {Delta}{sup o}-acyl-Co-A desaturase Ole1p, also exhibits a dimeric organization. Ole1p was chosen because it is one of the best characterized integral membrane desaturase and because it retains activity when fused with epitope tags. FLAG-Ole1p was detected by Western blotting of immunoprecipitates in which anti-Myc antibodies were used for capture from yeast extracts co-expressing Ole1p-Myc and Ole1p-FLAG. Interaction was confirmed by two independent bimolecular complementation assays (i.e. the split ubiquitin system and the split luciferase system). Co-expression of active and inactive Ole1p subunits resulted in an {approx}75% suppression of the accumulation of palmitoleic acid, demonstrating that the physiologically active form of Ole1p in vivo is the dimer in which both protomers must be functional.

Lou, Y.; Shanklin, J.

2010-06-18T23:59:59.000Z

270

Computational Mechanistic Studies of Acid-Catalyzed Lignin Model Dimers for Lignin Depolymerization  

SciTech Connect

Lignin is a heterogeneous alkyl-aromatic polymer that constitutes up to 30% of plant cell walls, and is used for water transport, structure, and defense. The highly irregular and heterogeneous structure of lignin presents a major obstacle in the development of strategies for its deconstruction and upgrading. Here we present mechanistic studies of the acid-catalyzed cleavage of lignin aryl-ether linkages, combining both experimental studies and quantum chemical calculations. Quantum mechanical calculations provide a detailed interpretation of reaction mechanisms including possible intermediates and transition states. Solvent effects on the hydrolysis reactions were incorporated through the use of a conductor-like polarizable continuum model (CPCM) and with cluster models including explicit water molecules in the first solvation shell. Reaction pathways were computed for four lignin model dimers including 2-phenoxy-phenylethanol (PPE), 1-(para-hydroxyphenyl)-2-phenoxy-ethanol (HPPE), 2-phenoxy-phenyl-1,3-propanediol (PPPD), and 1-(para-hydroxyphenyl)-2-phenoxy-1,3-propanediol (HPPPD). Lignin model dimers with a para-hydroxyphenyl ether (HPPE and HPPPD) show substantial differences in reactivity relative to the phenyl ether compound (PPE and PPPD) which have been clarified theoretically and experimentally. The significance of these results for acid deconstruction of lignin in plant cell walls will be discussed.

Kim, S.; Sturgeon, M. R.; Chmely, S. C.; Paton, R. S.; Beckham, G. T.

2013-01-01T23:59:59.000Z

271

Magnons and continua in a magnetized and dimerized spin-1/2 chain  

SciTech Connect

We examine the magnetic field dependent excitations of the dimerized spin-1/2 chain, copper nitrate, with antiferromagnetic intra-dimer exchange $J_1=0.44$ meV and exchange alternation $\\alpha=J_2/J_1=0.24$. Magnetic excitations in three distinct regimes of magnetization are probed through inelastic neutron scattering at low temperatures. At low and high fields there are three and two long-lived magnon-like modes, respectively. The number of modes and the anti-phase relationship between the wave-vector dependent energy and intensity of magnon scattering reflect the distinct ground states: A singlet ground state at low fields $\\mu_0H < \\mu_0H_{c1} = 2.8$~T and an $S_z=1/2$ product state at high fields $\\mu_0H > \\mu_0H_{c2} = 4.2$~T. In the intermediate field regime, a continuum of scattering for $\\hbar\\omega\\approx J_1$ is indicative of a strongly correlated gapless quantum state without coherent magnons.

Stone, Matthew B [ORNL; Chen, Y. [National Institute of Standards and Technology (NIST); Broholm, C. [Johns Hopkins University; Reich, D. H. [Johns Hopkins University; Xu, Guangyong [Brookhaven National Laboratory (BNL); Copley, John R. D. [National Institute of Standards and Technology (NIST), Gaithersburg, MD; Cook, Jeremy [National Institute of Standards and Technology (NIST)

2014-01-01T23:59:59.000Z

272

Relativistic calculations of $C_6$ and $C_8$ coefficients for strontium dimers  

E-Print Network (OSTI)

The electric dipole and quadrupole polarizabilities of the $5s5p~^3\\!P_1^o$ state and the $C_6$ and $C_8$ coefficients for the $^1\\!S_0 +\\, ^1\\!S_0$ and $^1\\!S_0 +\\, ^3\\!P_1^o$ dimers of strontium are calculated using a high-precision relativistic approach that combines configuration interaction and linearized coupled-cluster methods. Our recommended values of the long range dispersion coefficients for the $0_u$ and $1_u$ energy levels are $C_6(0_u)=3771(32)$ a.u. and $C_6(1_u)= 4001(33)$ a.u., respectively. They are in good agreement with recent results from experimental photoassociation data. We also calculate $C_8$ coefficients for Sr dimers, which are needed for precise determination of long-range interaction potential. We confirm the experimental value for the magic wavelength, where the Stark shift on the $^1\\!S_0$-$^3\\!P_1^o$ transition vanishes. The accuracy of calculations is analyzed and uncertainties are assigned to all quantities reported in this work.

S. G. Porsev; M. S. Safronova; Charles W. Clark

2014-09-21T23:59:59.000Z

273

Process for producing high purity isoolefins and dimers thereof by dissociation of ethers  

DOE Patents (OSTI)

Alkyl tertiary butyl ether or alkyl tertiary amyl ether is dissociated by vapor phase contact with a cation acidic exchange resin at temperatures in the range of 150 to 250 F at LHSV of 0.1 to 20 to produce a stream consisting of unreacted ether, isobutene or isoamylene and an alcohol corresponding to the alkyl radical. After the alcohol is removed, the ether/isoolefin stream may be fractionated to obtain a high purity isoolefin (99+%) or the ether/isoolefin stream can be contacted in liquid phase with a cation acidic exchange resin to selectively dimerize the isoolefin in a highly exothermic reaction, followed by fractionation of the dimerization product to produce high purity diisoolefin (97+%). In the case where the alkyl is C[sub 3] to C[sub 6] and the corresponding alcohol is produced on dissociation of the ether, combined dissociation-distillation may be carried out such that isoolefin is the overhead product and alcohol the bottom. 2 figs.

Smith, L.A. Jr.; Jones, E.M. Jr.; Hearn, D.

1984-05-08T23:59:59.000Z

274

T-713: Blue Coat Reporter Directory Traversal Flaw | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

3: Blue Coat Reporter Directory Traversal Flaw 3: Blue Coat Reporter Directory Traversal Flaw T-713: Blue Coat Reporter Directory Traversal Flaw September 9, 2011 - 10:47am Addthis PROBLEM: A vulnerability was reported in Blue Coat Reporter. A remote user can view files on the target system and gain full control of the target application. PLATFORM: All pre-9.3 versions of Reporter installed on a Windows server are vulnerable. ABSTRACT: Blue Coat Reporter Directory Traversal Flaw Lets Remote Users Gain Full Control. reference LINKS: Blue Coat Security Advisory ID: SA60 SecurityTracker Alert ID: 1026023 About Path Traversal IMPACT ASSESSMENT: High Discussion: Reporter installed on a Windows server is vulnerable to an HTTP directory traversal attack. An unauthenticated user can browse the file system and read any file. Data from these files can be used by an attacker to gain

275

STATEMENT OF BRIAN D. FAIRBANK Nevada Geothermal Power Inc.'s Blue Mountain  

Open Energy Info (EERE)

STATEMENT OF BRIAN D. FAIRBANK Nevada Geothermal Power Inc.'s Blue Mountain STATEMENT OF BRIAN D. FAIRBANK Nevada Geothermal Power Inc.'s Blue Mountain Geothermal Power Facility Jump to: navigation, search OpenEI Reference LibraryAdd to library General: STATEMENT OF BRIAN D. FAIRBANK Nevada Geothermal Power Inc.'s Blue Mountain Geothermal Power Facility Author BRIAN D. FAIRBANK Published Publisher Not Provided, 2012 DOI Not Provided Check for DOI availability: http://crossref.org Online Internet link for STATEMENT OF BRIAN D. FAIRBANK Nevada Geothermal Power Inc.'s Blue Mountain Geothermal Power Facility Citation BRIAN D. FAIRBANK. 2012. STATEMENT OF BRIAN D. FAIRBANK Nevada Geothermal Power Inc.'s Blue Mountain Geothermal Power Facility. N/Ap. Retrieved from "http://en.openei.org/w/index.php?title=STATEMENT_OF_BRIAN_D._FAIRBANK_Nevada_Geothermal_Power_Inc.%27s_Blue_Mountain_Geothermal_Power_Facility&oldid=682760

276

Blue Sky Green Field Wind Farm | Open Energy Information  

Open Energy Info (EERE)

Green Field Wind Farm Green Field Wind Farm Jump to: navigation, search Name Blue Sky Green Field Wind Farm Facility Blue Sky Green Field Wind Farm Sector Wind energy Facility Type Commercial Scale Wind Facility Status In Service Owner We Energies Developer We Energies Energy Purchaser We Energies Location Fond du Lac County WI Coordinates 43.908549°, -88.305384° Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"ROADMAP","zoom":14,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"350px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":43.908549,"lon":-88.305384,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}

277

The Neutral ISM in Nearby Luminous Compact Blue Galaxies  

E-Print Network (OSTI)

We observed 20 nearby Luminous Compact Blue Galaxies (LCBGs) in HI and CO(J=2-1) with the GBT and JCMT. These ~L^star galaxies are blue, high surface brightness, starbursting, high metallicity galaxies with an underlying older stellar population. They are common at z~1, but rare in the local Universe. It has been proposed that intermediate redshift LCBGs may be the progenitors of local dwarf ellipticals or low luminosity spirals, or that they may be more massive disks forming from the center outward to become L^star galaxies. To discriminate among various possible evolutionary scenarios, we have measured the dynamical masses and gas depletion time scales of this sample of nearby LCBGs. We find that local LCBGs span a wide range of dynamical masses, from 4 x 10^9 to 1 x 10^11 M_solar (measured within R_25). Molecular gas in local LCBGs is depleted quite quickly, in 30 to 200 million years. The molecular plus atomic gas is depleted in 30 million to 10 billion years; however, ~80% of the local LCBGs deplete their gas in less than 5 billion years. As LCBGs are heterogeneous in both dynamical mass and gas depletion time scales, they are not likely to evolve into one homogeneous galaxy class.

C. A. Garland; D. J. Pisano; J. P. Williams; R. Guzman; F. J. Castander

2003-10-30T23:59:59.000Z

278

Acoustically invisible feeding blue whales in Northern Icelandic waters  

Science Journals Connector (OSTI)

Fixed passive acoustic monitoring can be used for long-term recording of vocalizing cetaceans. Both presence monitoring and animal density estimation requires the call rates and sound source levels of vocalizations produced by single animals. In this study blue whale calls were recorded using acoustic bio-logging systems in Skjlfandi Bay off Hsavk Northeast Iceland in June 2012. An accelerometer was attached to individual whales to monitor diving behavior. During 21?h recording two individuals 8?h 45?min and 13?h 2?min respectively 105 and 104 lunge feeding events and four calls were recorded. All recorded calls were down-sweep calls ranging from 105 to 48?Hz. The sound duration was 12?s. The source level was estimated to be between 158 and 169?dB re 1?Pa rms assuming spherical sound propagation from the possible sound source location to the tag. The observed sound production rates and source levels of individual blue whales during feeding were extremely small compared with those observed previously in breeding grounds. The feeding whales were nearly acoustically invisible. The function of calls during feeding remains unknown.

Tomonari Akamatsu

2014-01-01T23:59:59.000Z

279

AN ECLIPSING BLUE STRAGGLER IN THE GLOBULAR CLUSTER {omega} CENTAURI  

SciTech Connect

{omega} Centauri is the largest globular cluster in the Milky Way and hence contains the largest number of variable stars within a single cluster. The results of photometric solutions are presented for the EA-type binary V239 in this cluster. According to our analysis, V239 is a typical Algol-type binary. We obtain M = 1.20 {+-} 0.10 M{sub Sun }, R = 1.21 {+-} 0.03 R{sub Sun }, and L = 13.68 {+-} 0.63 L{sub Sun} for the primary component. The secondary component has M = 0.07 {+-} 0.02 M{sub Sun }, R = 0.90 {+-} 0.03 R{sub Sun }, and L = 2.17 {+-} 0.14 L{sub Sun }. The binary system is located in the blue straggler region on the color-magnitude diagram of {omega} Centauri and the mass of the primary component exceeds the mass of a turnoff star. Therefore, we think that V239 is a blue straggler and that V239 was formed by mass transfer from the present secondary component to the present primary.

Li Kai; Qian Shengbang, E-mail: likai@ynao.ac.cn [National Astronomical Observatories/Yunnan Observatory, Chinese Academy of Sciences, P.O. Box 110, 650011 Kunming (China)

2012-12-01T23:59:59.000Z

280

On the Inner Structure and Topology of Clusters in Two-Component Lipid Bilayers. Comparison of Monomer and Dimer Ising Models  

Science Journals Connector (OSTI)

Comparison of Monomer and Dimer Ising Models ... Clusters of two-component phospholipid bilayers have been simulated by two Ising-type lattice models: the monomer and the dimer model. ... The first theoretical model of a collective system, the model of ferromagnets, was developed by Ernst Ising(17) in 1925. ...

Istvn P. Sugr

2008-08-26T23:59:59.000Z

Note: This page contains sample records for the topic "blue ruthenium dimer" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


281

Vibrations, Tunneling, and Transition Dipole Moments in the Water Dimer Michael J. Smit, Gerrit C. Groenenboom, Paul E. S. Wormer, and Ad van der Avoird*  

E-Print Network (OSTI)

shows that only the states of E( symmetry of the water dimer have a permanent dipole moment. A model dipole moment of the E( states. 1. Introduction Liquid water is the most important biological substanceVibrations, Tunneling, and Transition Dipole Moments in the Water Dimer Michael J. Smit, Gerrit C

282

Terahertz Vibration?Rotation?Tunneling Spectroscopy of the Ammonia Dimer. II. A?E States of an Out-of-Plane Vibration and an In-Plane Vibration  

Science Journals Connector (OSTI)

Terahertz Vibration?Rotation?Tunneling Spectroscopy of the Ammonia Dimer. ... In order to proceed toward the ultimate goal of determining an accurate intermolecular potential surface like what has been done for the water dimer, it is necessary to thoroughly characterize the intermolecular vibrations. ... The ab initio harmonic vibrational frequencies are known to be often too high for the weakly bound systems. ...

Wei Lin; Jia-xiang Han; Lynelle K. Takahashi; Jennifer G. Loeser; Richard J. Saykally

2007-09-07T23:59:59.000Z

283

EERE PowerPoint 2007 Template: Blue Version | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

for State and Local Grantees EERE PowerPoint 2007 Template: Blue Version State and Local Energy Savings Performance Contracting: Savings Measurement and Verification (M&V)...

284

Core Analysis At Blue Mountain Geothermal Area (U.S. Geological...  

Open Energy Info (EERE)

Area Exploration Technique Core Analysis Activity Date 2008 - 2008 Usefulness useful DOE-funding Unknown Exploration Basis Core sample from the observation wells Deep Blue No....

285

Surface-emitting red, green, and blue colloidal quantum dot distributed feedback lasers  

Science Journals Connector (OSTI)

We demonstrate surface emitting distributed feedback (DFB) lasers across the red, green, and blue from densely packed colloidal quantum dot (CQD) films. The solid CQD films were...

Roh, Kwangdong; Dang, Cuong; Lee, Joonhee; Chen, Songtao; Steckel, Jonathan S; Coe-Sullivan, Seth; Nurmikko, Arto

2014-01-01T23:59:59.000Z

286

Chapeau Inc dba BluePoint Energy Inc | Open Energy Information  

Open Energy Info (EERE)

Nevada Zip: 89706 Product: Chapeau Inc. develops, assembles, and sells packaged Combined Heat and Power generation systems. References: Chapeau Inc (dba BluePoint Energy Inc)1...

287

2014 Race to Zero Student Design Competition: Auburn University Profile (Blue)  

Energy.gov (U.S. Department of Energy (DOE))

2014 Race to Zero Student Design Competition: Auburn University Profile (Blue), as posted on the U.S. Department of Energy website.

288

E-Print Network 3.0 - atlantic blue crab Sample Search Results  

NLE Websites -- All DOE Office Websites (Extended Search)

Effects on Microbiological Properties, Summary: Atlantic coaSI blue crab. Univ. Md. Seafood Processing Lab., Cri field, Md. SFDA 1978. Bacteriological... Efficiency, and Yield...

289

Triplet Energy Confinement Effect in Blue Phosphorescent Organic Light Emitting Devices  

Science Journals Connector (OSTI)

The Effects of triplet energy confinement and charge balance by hole and electron transport layers are investigated on blue phosphorescent organic light emitting devices (PHOLEDs).

Lee, Jaewon; Chopra, Neetu; So, Franky

290

Mutations That Hamper Dimerization of Foot-and-Mouth Disease Virus 3A Protein Are Detrimental for Infectivity  

Science Journals Connector (OSTI)

...non-structural proteins of foot-and-mouth disease virus...Donaldson. 2001. Outbreak of foot-and-mouth disease virus...and JM Matthews. 2004. The power of two: protein dimerization...cells: a comparative study with foot-and-mouth disease virus...

Mnica Gonzlez-Magaldi; Ral Postigo; Beatriz G. de la Torre; Yuri A. Vieira; Miguel Rodrguez-Pulido; Eduardo Lpez-Vias; Paulino Gmez-Puertas; David Andreu; Leonor Kremer; Mara F. Rosas; Francisco Sobrino

2012-07-11T23:59:59.000Z

291

A Two-site Kinetic Mechanism for ATP Binding and Hydrolysis by E. coli Rep Helicase Dimer Bound to a  

E-Print Network (OSTI)

A Two-site Kinetic Mechanism for ATP Binding and Hydrolysis by E. coli Rep Helicase Dimer Bound that are coupled to ATP binding and hydrolysis. We have investi- gated the kinetic mechanism of ATP binding 17(?2) s?1 ; KM 3 mM), pre-steady-state studies provide evidence for a two-ATP site mechanism

Lohman, Timothy M.

292

Copyright 01990 by the Genetics Society of America Synapsis-MediatedFusion of Free DNA Ends Forms Inverted Dimer  

E-Print Network (OSTI)

Inverted Dimer Plasmids in Yeast Sam Kunes, David Botstein' and Maurice S. Fox Department of Biology plasmid DNA and the endsof the plasmid do not share homology with the yeast genome, circular inverted of genetically marked plasmids, we show that two plasmid molecules are required to form an inverted dimerplasmid

Botstein, David

293

Mapping of the SecA Signal Peptide Binding Site and Dimeric Interface by Using the Substituted Cysteine Accessibility Method  

Science Journals Connector (OSTI)

...binding induces changes in the oligomeric state and conformation of Sec A in a lipid environment: a small-angle neutron-scattering study. J. Mol. Biol. 332 :23-30. 13. Or E , A Navon, and T Rapoport. 2002. Dissociation of the dimeric...

Meera K. Bhanu; Ping Zhao; Debra A. Kendall

2013-08-09T23:59:59.000Z

294

Quantum dimer model for the spin-12 kagome Z2 spin liquid  

Science Journals Connector (OSTI)

We revisit the description of the low-energy singlet sector of the spin-12 Heisenberg antiferromagnet on kagome in terms of an effective quantum dimer model. With the help of exact diagonalizations of appropriate finite-size clusters, we show that the embedding of a given process in its kagome environment leads to dramatic modifications of the amplitudes of the elementary loop processes, an effect not accessible to the standard approach based on the truncation of the Hamiltonian to the nearest-neighbor valence-bond basis. The resulting parameters are consistent with a Z2 spin liquid rather than with a valence-bond crystal, in agreement with the last density matrix renormalization group results.

Ioannis Rousochatzakis; Yuan Wan; Oleg Tchernyshyov; Frdric Mila

2014-09-15T23:59:59.000Z

295

Synthesis of a high molecular weight thyroglobulin dimer by two ovine thyroid cell lines: the OVNIS  

Science Journals Connector (OSTI)

The OVNIS 6H and 5H thyroid cells, 2 permanent cell lines isolated 3 years ago from ovine tissue, synthesize a high molecular weight glycosylated protein, immunologically related to ovine thyroglobulin, which is similar to the prothyroid hormone dimer (1719) S: thyroglobulin. Using sucrose gradient centrifugation and cell labelling with [14C]Leu or [3H]G1NH2, radioactivity was observed in proteins purified from cell layers and from cell culture media. Addition of thyrotropin to or removal from the media resulted respectively in an increase (+773%) or decrease (?1090%) of the total radioactivity detected in the (1719)S thyroglobulin fraction. Estimation of thyroglobulin by RIA gave similar though less pronounced effects. These experiments prove (1) that thyroglobulin is still expressed in these OVNIS thyroid cell lines even after 3 years of permanent culture, (2) that TSH modulates the level of this protein through a TSH-receptor functional system.

S. Hovspian; A. Aouani; G. Fayet

1986-01-01T23:59:59.000Z

296

Persistence of magnons in a site-diluted dimerized frustrated antiferromagnet  

SciTech Connect

We present inelastic neutron scattering and thermodynamic measurements characterizing the magnetic excitations in a disordered non-magnetic substituted spin-liquid antiferromagnet. The parent compound Ba3Mn2O8 is a dimerized, quasi-two-dimensional geometrically frustrated quantum disordered antiferromagnet. We substitute this compound with non-magnetic vanadium for the S = 1 manganese atoms, Ba3(Mn1-xVx)2O8, and find that the singlet-triplet excitations which dominate the spectrum of the parent compound persist for the full range of substitution examined, x = 0.02 to 0.3. We also observe additional low-energy magnetic fluctuations which are enhanced at the greatest substitution values. These excitations may be a precursor to a low-temperature random singlet phase which may exist in Ba3(Mn1-xVx)2O8.

Stone, Matthew B [ORNL; Podlesnyak, Andrey A [ORNL; Ehlers, Georg [ORNL; Huq, Ashfia [ORNL; Samulon, Eric C [Stanford University; Shapiro, Max C [Stanford University; Fisher, Ian R [Stanford University

2011-01-01T23:59:59.000Z

297

An Auxiliary-Field Quantum Monte Carlo Study of the Chromium Dimer  

E-Print Network (OSTI)

The chromium dimer (Cr2) presents an outstanding challenge for many-body electronic structure methods. Its complicated nature of binding, with a formal sextuple bond and an unusual potential energy curve, is emblematic of the competing tendencies and delicate balance found in many strongly correlated materials. We present a near-exact calculation of the potential energy curve (PEC) and ground state properties of Cr2, using the auxiliary-field quantum Monte Carlo (AFQMC) method. Unconstrained, exact AFQMC calculations are first carried out for a medium-sized but realistic basis set. Elimination of the remaining finite-basis errors and extrapolation to the complete basis set (CBS) limit is then achieved with a combination of phaseless and exact AFQMC calculations. Final results for the PEC and spectroscopic constants are in excellent agreement with experiment.

Purwanto, Wirawan; Krakauer, Henry

2014-01-01T23:59:59.000Z

298

Human Immunodeficiency Virus Type 1 Gag Polyprotein Multimerization Requires the Nucleocapsid Domain and RNA and Is Promoted by the Capsid-Dimer Interface and the Basic Region of Matrix Protein  

Science Journals Connector (OSTI)

...Analysis of the three-dimensional structure of a protein fragment...identified a hydrophobic dimer interface (). In the context of an...wild-type provirus, the dimer interface mutants are associated with...the affinity of the dimer interface is not very high (), and...

Mark T. Burniston; Andrea Cimarelli; John Colgan; Sean P. Curtis; Jeremy Luban

1999-10-01T23:59:59.000Z

299

Dimer Structure of an Interfacially Impaired Phosphatidylinositol-Specific Pholpholipase C  

SciTech Connect

The crystal structure of the W47A/W242A mutant of phosphatidylinositol-specific phospholipase C (PI-PLC) from Bacillus thuringiensis has been solved to 1.8{angstrom} resolution. The W47A/W242A mutant is an interfacially challenged enzyme, and it has been proposed that one or both tryptophan side chains serve as membrane interfacial anchors (Feng, J., Wehbi, H., and Roberts, M. F. (2002) J. Biol. Chem. 277, 19867-19875). The crystal structure supports this hypothesis. Relative to the crystal structure of the closely related (97% identity) wild-type PI-PLC from Bacillus cereus, significant conformational differences occur at the membrane-binding interfacial region rather than the active site. The Trp {yields} Ala mutations not only remove the membrane-partitioning aromatic side chains but also perturb the conformations of the so-called helix B and rim loop regions, both of which are implicated in interfacial binding. The crystal structure also reveals a homodimer, the first such observation for a bacterial PI-PLC, with pseudo-2-fold symmetry. The symmetric dimer interface is stabilized by hydrophobic and hydrogen-bonding interactions, contributed primarily by a central swath of aromatic residues arranged in a quasiherringbone pattern. Evidence that interfacially active wild-type PI-PLC enzymes may dimerize in the presence of phosphatidylcholine vesicles is provided by fluorescence quenching of PI-PLC mutants with pyrene-labeled cysteine residues. The combined data suggest that wild-type PI-PLC can form similar homodimers, anchored to the interface by the tryptophan and neighboring membrane-partitioning residues.

Shao,C.; Shi, X.; Wehbi, H.; Zambonelli, C.; Head, J.; Seaton, B.; Roberts, M,.

2007-01-01T23:59:59.000Z

300

Task Force for Strategic Developments to Blue Ribbon Commission Recommendations  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Ribbon Commission Report and Ribbon Commission Report and Transportation Program Corinne Macaluso National Transportation Stakeholders Forum Knoxville, Tennessee May 16, 2012 2  Formed at the direction of the President to Secretary Chu and included leading experts.  Purpose to conduct a comprehensive review of polices for managing the back end of the nuclear fuel cycle; i.e., recycle before storage and permanent disposal.  Detailed analysis, with eight major recommendations; also recommended near-term actions. Blue Ribbon Commission & Report MAY 2012 3 Scope of Commission's Recommendation and Internal Assessment 1. A new, consent-based approach to siting future nuclear waste management facilities. 2. A new organization dedicated solely to implementing the waste

Note: This page contains sample records for the topic "blue ruthenium dimer" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


301

Blue Grass Energy Coop Corp | Open Energy Information  

Open Energy Info (EERE)

Grass Energy Coop Corp Grass Energy Coop Corp Jump to: navigation, search Name Blue Grass Energy Coop Corp Place Kentucky Utility Id 1886 Utility Location Yes Ownership C NERC Location RFC NERC RFC Yes Activity Distribution Yes References EIA Form EIA-861 Final Data File for 2010 - File1_a[1] LinkedIn Connections CrunchBase Profile No CrunchBase profile. Create one now! This article is a stub. You can help OpenEI by expanding it. Utility Rate Schedules Grid-background.png 100 Watt HPS- Acorn Fixture Lighting 100 Watt HPS- Cobra Head Lighting 100 Watt HPS- Colonial Fixture Lighting 100 Watt HPS- Open Bottom Lighting 100 Watt HPS- Ornamental Lighting 100 Watt HPS- Shoe Box Fixture Lighting 175 Watt MV Lighting 200 Watt HPS-Cobra Head Lighting 250 Watt HPS- Open Bottom Lighting 250 Watt HPS- Ornamental Lighting

302

Blue Sky Energy Inc BSE | Open Energy Information  

Open Energy Info (EERE)

Energy Inc BSE Energy Inc BSE Jump to: navigation, search Name Blue Sky Energy Inc (BSE) Place Vista, California Zip 92081 Product MPPT (Maximum Power Point Tracking) technology. Own a patented technology allowing an increase of power from a PV array of up to 30% more than conventional controllers. Coordinates 37.989712°, -93.665689° Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"ROADMAP","zoom":14,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"350px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":37.989712,"lon":-93.665689,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}

303

A2 Processor User's Manual for Blue Gene/Q  

NLE Websites -- All DOE Office Websites (Extended Search)

A2 Processor A2 Processor User's Manual for Blue Gene/Q Note: This document and the information it contains are provided on an as-is basis. There is no plan for providing for future updates and corrections to this document. October 23, 2012 Version 1.3 Title Page ® Copyright and Disclaimer © Copyright International Business Machines Corporation 2010, 2012 Printed in the United States of America October 2012 IBM, the IBM logo, and ibm.com are trademarks or registered trademarks of International Business Machines Corp., registered in many jurisdictions worldwide. Other product and service names might be trademarks of IBM or other compa- nies. A current list of IBM trademarks is available on the Web at "Copyright and trademark information" at www.ibm.com/legal/copytrade.shtml.

304

Blue Ridge Mountain E M C | Open Energy Information  

Open Energy Info (EERE)

E M C E M C Jump to: navigation, search Name Blue Ridge Mountain E M C Place Georgia Utility Id 1891 Utility Location Yes Ownership C NERC Location SERC NERC SERC Yes Activity Distribution Yes References EIA Form EIA-861 Final Data File for 2010 - File1_a[1] LinkedIn Connections CrunchBase Profile No CrunchBase profile. Create one now! This article is a stub. You can help OpenEI by expanding it. Utility Rate Schedules Grid-background.png General Power Rate (GSA 1) Commercial General Power Rate (GSA 2)* Commercial General Power Rate (GSA 3)* Industrial Outdoor Lighting HPS 100 W Lighting Outdoor Lighting HPS 250 W Lighting Outdoor Lighting MV 175 W Lighting Outdoor Lighting MV 400 W Lighting Residential Residential Average Rates Residential: $0.1110/kWh Commercial: $0.1220/kWh

305

Blue Spark Technologies formerly Thin Battery Technologies Inc | Open  

Open Energy Info (EERE)

Spark Technologies formerly Thin Battery Technologies Inc Spark Technologies formerly Thin Battery Technologies Inc Jump to: navigation, search Name Blue Spark Technologies (formerly Thin Battery Technologies Inc.) Place Westlake, Ohio Zip 44130 Sector Carbon Product Developer and licensor of carbon-zinc battery technology. Coordinates 32.980007°, -97.168831° Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"ROADMAP","zoom":14,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"350px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":32.980007,"lon":-97.168831,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}

306

City of Blue Earth, Minnesota (Utility Company) | Open Energy Information  

Open Energy Info (EERE)

Earth, Minnesota (Utility Company) Earth, Minnesota (Utility Company) Jump to: navigation, search Name City of Blue Earth Place Minnesota Utility Id 1883 Utility Location Yes Ownership M NERC Location MRO NERC MRO Yes ISO MISO Yes Operates Generating Plant Yes Activity Generation Yes Activity Buying Transmission Yes Activity Distribution Yes Activity Retail Marketing Yes Activity Bundled Services Yes References EIA Form EIA-861 Final Data File for 2010 - File1_a[1] LinkedIn Connections CrunchBase Profile No CrunchBase profile. Create one now! This article is a stub. You can help OpenEI by expanding it. Utility Rate Schedules Grid-background.png Commercial Electric Commercial Industrial Electric Industrial Industrial Electric (No Rachet) Industrial Industrial Electric - Demand Credit Industrial

307

City of Blue Hill, Nebraska (Utility Company) | Open Energy Information  

Open Energy Info (EERE)

Nebraska (Utility Company) Nebraska (Utility Company) Jump to: navigation, search Name City of Blue Hill Place Nebraska Utility Id 20848 Utility Location Yes Ownership M NERC Location MRO Operates Generating Plant Yes Activity Distribution Yes References EIA Form EIA-861 Final Data File for 2010 - File1_a[1] LinkedIn Connections CrunchBase Profile No CrunchBase profile. Create one now! This article is a stub. You can help OpenEI by expanding it. Utility Rate Schedules Grid-background.png Industrial Electric Service Industrial Industrial Electric Service(Primary Service) Industrial Non-Residential Electric Rate- Single Phase Commercial Non-Residential Electric Rate- Single Phase(Primary Metering) Commercial Non-Residential Electric Rate- Three Phase Commercial Non-Residential Electric Rate- Three Phase(Primary Metering) Commercial

308

Blue fluorescent organic light emitting diodes with multilayered graphene anode  

SciTech Connect

As an innovative anode for organic light emitting devices (OLEDs), we have investigated graphene films. Graphene has importance due to its huge potential in flexible OLED applications. In this work, graphene films have been catalytically grown and transferred to the glass substrate for OLED fabrications. We have successfully fabricated 2 mm 2 mm device area blue fluorescent OLEDs with graphene anodes which showed 2.1% of external quantum efficiency at 1000 cd/m{sup 2}. This is the highest value reported among fluorescent OLEDs using graphene anodes. Oxygen plasma treatment on graphene has been found to improve hole injections in low voltage regime, which has been interpreted as oxygen plasma induced work function modification. However, plasma treatment also increases the sheet resistance of graphene, limiting the maximum luminance. In summary, our works demonstrate the practical possibility of graphene as an anode material for OLEDs and suggest a processing route which can be applied to various graphene related devices.

Hwang, Joohyun [OLED Lighting Research Team, Electronics and Telecommunications Research Institute (ETRI), Daejeon 305-700 (Korea, Republic of)] [OLED Lighting Research Team, Electronics and Telecommunications Research Institute (ETRI), Daejeon 305-700 (Korea, Republic of); Choi, Hong Kyw [Graphene Electronics Creative Research Section, Electronics and Telecommunications Research Institute (ETRI), Daejeon 305-700 (Korea, Republic of)] [Graphene Electronics Creative Research Section, Electronics and Telecommunications Research Institute (ETRI), Daejeon 305-700 (Korea, Republic of); Moon, Jaehyun; Shin, Jin-Wook; Joo, Chul Woong; Han, Jun-Han; Cho, Doo-Hee; Huh, Jin Woo [OLED Lighting Research Team, Electronics and Telecommunications Research Institute (ETRI), Daejeon 305-700 (Korea, Republic of)] [OLED Lighting Research Team, Electronics and Telecommunications Research Institute (ETRI), Daejeon 305-700 (Korea, Republic of); Choi, Sung-Yool [Graphene Electronics Creative Research Section, Electronics and Telecommunications Research Institute (ETRI), Daejeon 305-700 (Korea, Republic of)] [Graphene Electronics Creative Research Section, Electronics and Telecommunications Research Institute (ETRI), Daejeon 305-700 (Korea, Republic of); Lee, Jeong-Ik, E-mail: jiklee@etri.re.kr [OLED Lighting Research Team, Electronics and Telecommunications Research Institute (ETRI), Daejeon 305-700 (Korea, Republic of)] [OLED Lighting Research Team, Electronics and Telecommunications Research Institute (ETRI), Daejeon 305-700 (Korea, Republic of); Chu, Hye Yong [OLED Lighting Research Team, Electronics and Telecommunications Research Institute (ETRI), Daejeon 305-700 (Korea, Republic of)] [OLED Lighting Research Team, Electronics and Telecommunications Research Institute (ETRI), Daejeon 305-700 (Korea, Republic of)

2012-10-15T23:59:59.000Z

309

LAMMPS strong scaling performance optimization on Blue Gene/Q  

SciTech Connect

LAMMPS "Large-scale Atomic/Molecular Massively Parallel Simulator" is an open-source molecular dynamics package from Sandia National Laboratories. Significant performance improvements in strong-scaling and time-to-solution for this application on IBM's Blue Gene/Q have been achieved through computational optimizations of the OpenMP versions of the short-range Lennard-Jones term of the CHARMM force field and the long-range Coulombic interaction implemented with the PPPM (particle-particle-particle mesh) algorithm, enhanced by runtime parameter settings controlling thread utilization. Additionally, MPI communication performance improvements were made to the PPPM calculation by re-engineering the parallel 3D FFT to use MPICH collectives instead of point-to-point. Performance testing was done using an 8.4-million atom simulation scaling up to 16 racks on the Mira system at Argonne Leadership Computing Facility (ALCF). Speedups resulting from this effort were in some cases over 2x.

Coffman, Paul; Jiang, Wei; Romero, Nichols A.

2014-11-12T23:59:59.000Z

310

Diffusion of the Cu monomer and dimer on Ag(111): Molecular dynamics simulations and density functional theory calculations  

Science Journals Connector (OSTI)

We present results of molecular dynamics (MD) simulations and density functional theory (DFT) calculations of the diffusion of Cu adatom and dimer on Ag(111). We have used potentials generated by the embedded-atom method for the MD simulations and pseudopotentials derived from the projected-augmented-wave method for the DFT calculations. The MD simulations (at three different temperatures: 300, 500, and 700 K) show that the diffusivity has an Arrhenius behavior. The effective energy barriers obtained from the Arrhenius plots are in excellent agreement with those extracted from scanning tunneling microscopy experiments. While the diffusion barrier for Cu monomers on Ag(111) is higher than that reported (both in experiment and theory) for Cu(111), the reverse holds for dimers [which, for Cu(111), has so far only been theoretically assessed]. In comparing our MD result with those for Cu islets on Cu(111), we conclude that the higher barriers for Cu monomers on Ag(111) results from the comparatively large Ag-Ag bond length, whereas for Cu dimers on Ag(111) the diffusivity is taken over and boosted by the competition in optimization of the Cu-Cu dimer bond and the five nearest-neighbor Cu-Ag bonds. Our DFT calculations confirm the relatively large barriers for the Cu monomer on Ag(111)69 and 75 meVcompared to those on Cu(111) and hint a rationale for them. In the case of the Cu dimer, the relatively long Ag-Ag bond length makes available a diffusion route whose highest relevant energy barrier is only 72 meV and which is not favorable on Cu(111). This process, together with another involving an energy barrier of 83 meV, establishes the possibility of low-barrier intercell diffusion by purely zigzag mechanisms.

Sardar Sikandar Hayat; Marisol Alcntara Ortigoza; Muhammad A. Choudhry; Talat S. Rahman

2010-08-03T23:59:59.000Z

311

YSI Blue-Green Algae (BGA) Sensors Spatial Water Quality Mapping of the Potomac River Estuary  

E-Print Network (OSTI)

YSI Blue-Green Algae (BGA) Sensors Spatial Water Quality Mapping of the Potomac River Estuary Visit integrated Yellow Spring Instruments (YSI) blue- green algae (BGA) sensors into our system to evaluate of Microcystis aeruginosa. We compared interpolated results of traditional chlorophyll sensors with the BGA data

Boynton, Walter R.

312

ATLAS on the BlueGene/L Preliminary Results Keith Seymour Haihang You Jack Dongarra  

E-Print Network (OSTI)

ATLAS on the BlueGene/L ­ Preliminary Results Keith Seymour Haihang You Jack Dongarra Department The goal of this work is to use ATLAS to produce a tuned linear algebra library for the BlueGene/L, while of the machine present a few difficulties for a straightforward port of ATLAS. The compute nodes themselves

Dongarra, Jack

313

Changes in Soil Quality Due to Grazing and Oak Tree Removal in California Blue Oak  

E-Print Network (OSTI)

investigated (carbon, nitrogen, phosphorus, pH) within 5 to 15 years following tree removal. Following treeChanges in Soil Quality Due to Grazing and Oak Tree Removal in California Blue Oak Woodlands1 Trina of grazing and oak tree removal on soil quality and fertility were examined in a blue oak (Quercus douglasii

Standiford, Richard B.

314

Pink/White (ladies' only) Light Blue/White (ladies' only)  

E-Print Network (OSTI)

Pink/White (ladies' only) Light Blue/White (ladies' only) White/Stone Dill/Dark Green Slate Blue/Navy (men's only) Stone/Fawn Red/Black (men's only) Navy/White Black/Heather (men's only) Black/White with a delicate 4-button placket. Feminine fit that looks great tucked in or out. Ladies' Colors: Black/White

Wechsler, Risa H.

315

Depth of cure and compressive strength of dental composites cured with blue light emitting diodes (LEDs)  

E-Print Network (OSTI)

Depth of cure and compressive strength of dental composites cured with blue light emitting diodes with either a light emitting diode (LED) based light curing unit (LCU) or a conventional halogen LCU do reserved. Keywords: Blue light emitting diodes; Light curing unit; Composites; Irradiance; Spectrum; Depth

Ashworth, Stephen H.

316

New Glycolipid specific to Nitrogen-fixing Blue-green Algae  

Science Journals Connector (OSTI)

... layer chromatography on silica gel of chloroform-methanol extracts from three nitrogen-fixing blue-green algae (Anabaena cylindrica, Anabaena flos-aquae and Chlorogloea fritschii) has, however, indicated the ... Chromatographie studies on the corresponding lipid fractions from the two other nitrogen-fixing blue-green algae suggest that these are also heterogeneous, and it would seem that these organisms possibly ...

B. W. NICHOLS; B. J. B. WOOD

1968-02-24T23:59:59.000Z

317

Building on a Decade of Accomplishments Report of the 2010 Blue Ribbon Panel on Genomics  

E-Print Network (OSTI)

Building on a Decade of Accomplishments Report of the 2010 Blue Ribbon Panel on Genomics Division of Microbiology and Infectious Diseases, Genomics Programs National Institute of Allergy and Infectious Diseases Blue Ribbon Panel on Genomics Division of Microbiology and Infectious Diseases, Genomics Programs

Levin, Judith G.

318

Blue Star Memorial By-Way Dedication: Weldon Spring Interpretive Center |  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Blue Star Memorial By-Way Dedication: Weldon Spring Interpretive Blue Star Memorial By-Way Dedication: Weldon Spring Interpretive Center Blue Star Memorial By-Way Dedication: Weldon Spring Interpretive Center July 12, 2013 - 1:04pm Addthis Since 2003, the Lewis and Clark Garden Club (LCGC) of St. Charles County, Missouri, has held their monthly meetings in the Weldon Spring Interpretive Center (WSIC). The LCGC has 22 active members and takes care of 2 garden beds at the WSIC Native Plant Educational Garden under the site's Adopt-A-Garden program. In 2010 the LCGC contacted the U.S. Department of Energy (DOE), seeking approval to install a Blue Star Memorial By-Way Marker as a tribute to the nation's armed forces (see bottom of page for a history of the Blue Star Memorials). A 2,300-pound pink mica memorial marker was placed

319

Step-Out Drilling Results at Blue Mountain, Nevada | Open Energy  

Open Energy Info (EERE)

Step-Out Drilling Results at Blue Mountain, Nevada Step-Out Drilling Results at Blue Mountain, Nevada Jump to: navigation, search OpenEI Reference LibraryAdd to library Journal Article: Step-Out Drilling Results at Blue Mountain, Nevada Abstract Step-out drilling targets based on a detailed structural model at Blue Mt. Nevada have led to high permeability entries in a well offset 1.2 km west of the developing field at Blue Mountain,Nevada. This well, 58-15, targeted shallow and deep entries based on a model with faults in the hanging wall and in the underlying range front fault zone. Drilling results showed that both zones were permeable. The deep target showed up in several productive fractures at relatively high temperatures. This result supports the general conceptual model of upflow from depth on Piedmont faults. The purpose of

320

Blue Ribbon Commission on America's Nuclear Future to Hold First Meeting |  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Blue Ribbon Commission on America's Nuclear Future to Hold First Blue Ribbon Commission on America's Nuclear Future to Hold First Meeting Blue Ribbon Commission on America's Nuclear Future to Hold First Meeting March 3, 2010 - 12:00am Addthis Washington, D.C. - On Thursday, March 25th and Friday, March 26th, the Blue Ribbon Commission on America's Nuclear Future, co-chaired by former Congressman Lee Hamilton and former National Security Advisor General Brent Scowcroft, will hold its first meeting in Washington, D.C. At the direction of President Obama, Secretary of Energy Steven Chu established the Blue Ribbon Commission to conduct a comprehensive review of policies for managing the back end of the nuclear fuel cycle and to provide recommendations for developing a safe, long-term solution to managing the Nation's used nuclear fuel and nuclear waste.

Note: This page contains sample records for the topic "blue ruthenium dimer" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


321

The use of cotton blue stain to improve the efficiency of picking and identifying chironomid head capsules  

E-Print Network (OSTI)

NOTE The use of cotton blue stain to improve the efficiency of picking and identifying chironomid Cotton blue was added to sediment sam- ples at least 2 h before chironomid head capsules were picked during the picking process. Cotton blue has been used previously to stain chitin in fungal cell walls

Bern, Universität

322

Morpho blue Morpho blue  

E-Print Network (OSTI)

. Moreover, the forms of solar energy storage--whether hy- drocarbon fuels, food generated via photosynthesis

John, Sajeev

323

Concentrations of Heavy Metals in Selected Tissues of Blue  

E-Print Network (OSTI)

Abstract: Persian Gulf supports diverse ecosystems and biota in need of remediation and protection and metal data from this region is needed. The levels of heavy metals (Fe, Hg, Ni and Pb) in tissues (hepatopancreas, muscle and exoskeleton) of blue swimming crab, Portunus pelagicus and sediments in the Persian Gulf coasts, south Iran were investigated. Heavy metals analysis was performed by Atomic Absorption Spectrophotometer. The concentration of heavy metals in sediments at all sampling stations occurs in descending order of Fe> Ni> Hg> Pb during both seasons. The distribution pattern of heavy metals in the tissues of crab and sediments was as follows: sediment> hepatopancreasn> muscle> exoskeleton. Maximum concentration of the total heavy metals in sediments and all tissues of P. pelagicus observes in Bahrekan station (Pheavy metals in the tissues of the crab P. pelagicus. In present study recorded that there was negligible differences in heavy metals levels between different seasons. Differences in heavy metals concentrations among the species is likely to have resulted from metal bioavailability, hydrodynamics of the environment, changes in tissue composition, stations of collection and sources of pollution within Persian Gulf.

Mehdi Hosseini; Afshin Abdi Bastami; Javad Kazemzadeh Khoei; Maryam Esmailian; Elmira Janmohammadi Songhori; Mina Najafzadeh

324

Scalable Dynamic Instrumentation for BlueGene/L  

SciTech Connect

Dynamic binary instrumentation for performance analysis on new, large scale architectures such as the IBM Blue Gene/L system (BG/L) poses new challenges. Their scale--with potentially hundreds of thousands of compute nodes--requires new, more scalable mechanisms to deploy and to organize binary instrumentation and to collect the resulting data gathered by the inserted probes. Further, many of these new machines don't support full operating systems on the compute nodes; rather, they rely on light-weight custom compute kernels that do not support daemon-based implementations. We describe the design and current status of a new implementation of the DPCL (Dynamic Probe Class Library) API for BG/L. DPCL provides an easy to use layer for dynamic instrumentation on parallel MPI applications based on the DynInst dynamic instrumentation mechanism for sequential platforms. Our work includes modifying DynInst to control instrumentation from remote I/O nodes and porting DPCL's communication to use MRNet, a scalable data reduction network for collecting performance data. We describe extensions to the DPCL API that support instrumentation of task subsets and aggregation of collected performance data. Overall, our implementation provides a scalable infrastructure that provides efficient binary instrumentation on BG/L.

Schulz, M; Ahn, D; Bernat, A; de Supinski, B R; Ko, S Y; Lee, G; Rountree, B

2005-09-08T23:59:59.000Z

325

Blue Creek Winter Range : Wildlife Mitigation Project : Final Environmental Assessment.  

SciTech Connect

Bonneville Power Administration (BPA) proposes to fund that portion of the Washington Wildlife Agreement pertaining to the Blue Creek Winter Range Wildlife Mitigation Project (Project) in a cooperative effort with the Spokane Tribe, Upper Columbia United Tribes, and the Bureau of Indian Affairs (BIA). If fully implemented, the proposed action would allow the sponsors to protect and enhance 2,631 habitat units of big game winter range and riparian shrub habitat on 2,185 hectares (5,400 acres) of Spokane Tribal trust lands, and to conduct long term wildlife management activities within the Spokane Indian Reservation project area. This Final Environmental Assessment (EA) examines the potential environmental effects of securing land and conducting wildlife habitat enhancement and long term management activities within the boundaries of the Spokane Indian Reservation. Four proposed activities (habitat protection, habitat enhancement, operation and maintenance, and monitoring and evaluation) are analyzed. The proposed action is intended to meet the need for mitigation of wildlife and wildlife habitat adversely affected by the construction of Grand Coulee Dam and its reservoir.

United States. Bonneville Power Administration; United States. Bureau of Indian Affairs; Spokane Tribe of the Spokane Reservation, Washington

1994-11-01T23:59:59.000Z

326

EarlyExperienceOnBlueGeneQ.pptx  

NLE Websites -- All DOE Office Websites (Extended Search)

and Performance Engineering Team Early Experience on the Blue Gene/Q Supercomputing System Mira P erformance B oot C amp Argonne, M ay 2 1, 2 013 Argonne L eadership C ompuDng F acility Argonne N aDonal L aboratory, A rgonne, I L 2 Outline  Introduc+on - Argonne L eadership C ompu+ng F acility - From B G/P t o B G/Q  BG/Q S ystem C haracteris+cs - Memory S ubsystem - Computa+on C apabili+es - Interconnect a nd C ommunica+on P roper+es - Power C onsump+on a nd E fficiency  BG/Q S pecific F eatures - QPX --- 4 ---way S IMD V ector U nit - Prefetching U nit a nd L ist P refetching  Applica+on S tudies - GTC, G FMC, D NS3D ALCF @ Argonne 3 Produc'on S ystems: Mira - B G/Q s ystem - 49,152 nodes / 786,432 cores - 786 TB of memory - Peak fl op r ate: 1 0 P F - Linpack fl op r ate: 8 .1 P F Intrepid

327

Interatomic Coulombic Decay as a New Source of Low Energy Electrons in slow Ion-Dimer Collisions  

E-Print Network (OSTI)

We provide the experimental evidence that the single electron capture process in slow collisions between O$^{3+}$ ions and neon dimer targets leads to an unexpected production of low-energy electrons. This production results from the interatomic Coulombic decay process, subsequent to inner shell single electron capture from one site of the neon dimer. Although pure one-electron capture from inner shell is expected to be negligible in the low collision energy regime investigated here, the electron production due to this process overtakes by one order of magnitude the emission of Auger electrons by the scattered projectiles after double-electron capture. This feature is specific to low charge states of the projectile: similar studies with Xe$^{20+}$ and Ar$^{9+}$ projectiles show no evidence of inner shell single-electron capture. The dependence of the process on the projectile charge state is interpreted using simple calculations based on the classical over the barrier model.

Iskandar, W; Leredde, A; Flechard, X; Gervais, B; Guillous, S; Hennecart, D; Mery, A; Rangama, J; Zhou, C L; Shiromaru, H; Cassimi, A

2014-01-01T23:59:59.000Z

328

Assembly of the Alu domain of the signal recognition particle (SRP): dimerization of the two protein components is required for efficient binding to SRP RNA.  

Science Journals Connector (OSTI)

...domain of the signal recognition particle (SRP): dimerization of the two protein components is required for efficient binding to SRP RNA. K Strub P Walter Department of Biochemistry...94143-0448. The signal recognition particle (SRP), a cytoplasmic ribonucleoprotein, plays...

K Strub; P Walter

1990-02-01T23:59:59.000Z

329

Water addition for increased CO/H[sub 2] hydrocarbon synthesis activity over catalysts comprising cobalt, ruthenium and mixtures thereof which may include a promoter metal  

SciTech Connect

A once-through, fixed or slurry bed Fischer Tropsch process is described with enhanced CO conversion activity and C[sub 5] + liquid hydrocarbon selectivity comprising contacting a feed mixture of carbon monoxide and hydrogen in a reaction zone with about 1 Vol % to about 70 Vol % water based on the total volume of feed mixture, at a pressure above one atmosphere and a temperature ranging from about 150 C to about 300 C, with a catalyst selected from the group consisting of cobalt, ruthenium, and mixtures thereof on a titania support, wherein said titania support is less than 40 m[sup 2]/g, converting at least 90 Vol % of the carbon monoxide to liquid hydrocarbons, and in the substantial absence of CO[sub 2] formation.

Kim, C.J.

1993-07-13T23:59:59.000Z

330

Enzymatic synthesis of 3',4'-anhydrovinblastine: a precursor of the clinically important dimeric alkaloids of Catharanthus roseus  

E-Print Network (OSTI)

much work to be done to understand the enzymology and regulation involved from the earliest parts of the pathway to the synthesis of the dimers (McCaskill 1988). Only one of the enzymes which catalyze an early step in the pathway has been purified... to homogeneity. The rest of the enzymes have only been partially purified or remain undiscovered. The most characterized and highly purified enzyme is strictosidine synthase. This enzyme which catalyzes the condensation of tryptamine with secologanin to form...

Rinehart, Cara Louise

1989-01-01T23:59:59.000Z

331

Exact multipoint and multitime correlation functions of a one-dimensional model of adsorption and evaporation of dimers  

Science Journals Connector (OSTI)

In this work, we provide a method that allows us to compute exactly the multipoint and multitime correlation functions of a one-dimensional stochastic model of dimer adsorption evaporation with random (uncorrelated) initial states. In particular, explicit expressions of the two-point noninstantaneous/instantaneous correlation functions are obtained. The long-time behavior of these expressions is discussed in detail and in various physical regimes.

Mauro Mobilia

2002-04-04T23:59:59.000Z

332

Modulation of Bacillus thuringiensis Phosphatidylinositol-Specific Phospholipase C Activity by Mutations in the Putative Dimerization Interface  

SciTech Connect

Cleavage of phosphatidylinositol (PI) to inositol 1,2-(cyclic)-phosphate (cIP) and cIP hydrolysis to inositol 1-phosphate by Bacillus thuringiensis phosphatidylinositol-specific phospholipase C are activated by the enzyme binding to phosphatidylcholine (PC) surfaces. Part of this reflects improved binding of the protein to interfaces. However, crystallographic analysis of an interfacially impaired phosphatidylinositol-specific phospholipase (W47A/W242A) suggested protein dimerization might occur on the membrane. In the W47A/W242A dimer, four tyrosine residues from one monomer interact with the same tyrosine cluster of the other, forming a tight dimer interface close to the membrane binding regions. We have constructed mutant proteins in which two or more of these tyrosine residues have been replaced with serine. Phospholipid binding and enzymatic activity of these mutants have been examined to assess the importance of these residues to enzyme function. Replacing two tyrosines had small effects on enzyme activity. However, removal of three or four tyrosine residues weakened PC binding and reduced PI cleavage by the enzyme as well as PC activation of cIP hydrolysis. Crystal structures of Y247S/Y251S in the absence and presence of myo-inositol as well as Y246S/Y247S/Y248S/Y251S indicate that both mutant proteins crystallized as monomers, were very similar to one another, and had no change in the active site region. Kinetic assays, lipid binding, and structural results indicate that either (i) a specific PC binding site, critical for vesicle activities and cIP activation, has been impaired, or (ii) the reduced dimerization potential for Y246S/Y247S/Y248S and Y246S/Y247S/Y248S/Y251S is responsible for their reduced catalytic activity in all assay systems.

Shi, X.; Shao, C; Zhang, X; Zambonelli, C; Redfield, A; Head, J; Seaton, B; Roberts, M

2009-01-01T23:59:59.000Z

333

Universality of weakly bound dimers and Efimov trimers close to Li-Cs Feshbach resonances  

E-Print Network (OSTI)

We study the interspecies scattering properties of ultracold Li-Cs mixtures in their two energetically lowest spin channels in the magnetic field range between 800 G and 1000 G. Close to two broad Feshbach resonances we create weakly bound LiCs dimers by radio-frequency association and measure the dependence of the binding energy on the external magnetic field strength. Based on the binding energies and complementary atom loss spectroscopy of three other Li-Cs s-wave Feshbach resonances we construct precise molecular singlet and triplet electronic ground state potentials using a coupled-channels calculation. We extract the Li-Cs interspecies scattering length as a function of the external field and obtain almost a ten-fold improvement in the precision of the values for the pole positions and widths of the s-wave Li-Cs Feshbach resonances as compared to our previous work [Pires \\textit{et al.}, Phys. Rev. Lett. \\textbf{112}, 250404 (2014)]. We discuss implications on the Efimov scenario and the universal geome...

Ulmanis, J; Pires, R; Kuhnle, E D; Weidemller, M; Tiemann, E

2015-01-01T23:59:59.000Z

334

An unusual dimeric structure and assembly for TLR4 regulator RP105?MD-1  

SciTech Connect

RP105-MD-1 modulates the TLR4-MD-2-mediated, innate immune response against bacterial lipopolysaccharide (LPS). The crystal structure of the bovine 1:1 RP105-MD-1 complex bound to a putative endogenous lipid at 2.9 {angstrom} resolution shares a similar overall architecture to its homolog TLR4-MD-2 but assembles into an unusual 2:2 homodimer that differs from any other known TLR-ligand assembly. The homodimer is assembled in a head-to-head orientation that juxtaposes the N-terminal leucine-rich repeats (LRRs) of the two RP105 chains, rather than the usual tail-to-tail configuration of C-terminal LRRs in ligand-activated TLR dimers, such as TLR1-TRL2, TLR2-TLR6, TLR3-TLR3 and TLR4-TLR4. Another unusual interaction is mediated by an RP105-specific asparagine-linked glycan, which wedges MD-1 into the co-receptor binding concavity on RP105. This unique mode of assembly represents a new paradigm for TLR complexes and suggests a molecular mechanism for regulating LPS responses.

Yoon, Sung-il; Hong, Minsun; Wilson, Ian A (Scripps)

2011-11-16T23:59:59.000Z

335

Application of a modified generalized Flory dimer theory to normal alkanes  

SciTech Connect

The applicability of chain equations of state to real systems is discussed in this paper. For this purpose, the authors have compared four theories: the perturbed-hard-chain theory (PHCT) of Prausnitz and coworkers, the generalized Flory (GF) and generalized Flory dimer (GFD) theories of Hall and coworkers, and the statistical associating fluid theory (SAFT) of Radosz, Gubbins, and co-workers. In this comparison, the perturbation expansion in the attractive term was truncated after the first-order term for all theories. Comparison of these theories with Monte Carlo simulation data for hard chains and square-well chains showed that the GFD theory, which explicitly takes into account the effect of the formation of chains in both the repulsive and the attractive part of the equations, is in best agreement with the data. The GFD theory was further improved by using the simulations data directly to reevaluate the shape parameters c and q, which were found to be density dependent. The new simplified GFD theory gives a significantly better correlation of the properties of normal alkanes than the other four theories.

Bokis, C.P.; Donohue, M.D. (Johns Hopkins Univ., Baltimore, MD (United States). Dept. of Chemical Engineering); Hall, C.K. (North Carolina State Univ., Raleigh, NC (United States). Dept. of Chemical Engineering)

1994-05-01T23:59:59.000Z

336

Synthesis of Fluorescent C2-Bridged Teraryls and Quateraryls for Blue, Sky-Blue, and Green Color Light-Emitting Devices  

Science Journals Connector (OSTI)

Synthesis of Fluorescent C2-Bridged Teraryls and Quateraryls for Blue, Sky-Blue, and Green Color Light-Emitting Devices ... UVvis, fluorescence spectra, and cyclic voltammograms of 6ae and 9ac; atom coordinates and absolute energies and TGA plots of 6a, and 9a,b; X-ray data of 6b; NMR spectra of 3c,e, 4ac, 4e, 6ae, and 9ac. ...

Atul Goel; Ashutosh Sharma; Madhu Rawat; R. S. Anand; Ruchir Kant

2014-10-23T23:59:59.000Z

337

Slim Holes At Blue Mountain Area (Warpinski, Et Al., 2004) | Open Energy  

Open Energy Info (EERE)

Blue Mountain Area (Warpinski, Et Al., Blue Mountain Area (Warpinski, Et Al., 2004) Exploration Activity Details Location Blue Mountain Area Exploration Technique Slim Holes Activity Date Usefulness not indicated DOE-funding Unknown Notes Update to Warpinski, et al., 2002 References N. R. Warpinski, A. R. Sattler, R. Fortuna, D. A. Sanchez, J. Nathwani (2004) Geothermal Resource Exploration And Definition Projects Retrieved from "http://en.openei.org/w/index.php?title=Slim_Holes_At_Blue_Mountain_Area_(Warpinski,_Et_Al.,_2004)&oldid=387371" Categories: Exploration Activities DOE Funded Activities What links here Related changes Special pages Printable version Permanent link Browse properties About us Disclaimers Energy blogs Linked Data Developer services OpenEI partners with a broad range of international organizations to grow

338

T-651: Blue Coat ProxySG Discloses Potentially Sensitive Information in  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

51: Blue Coat ProxySG Discloses Potentially Sensitive 51: Blue Coat ProxySG Discloses Potentially Sensitive Information in Core Files T-651: Blue Coat ProxySG Discloses Potentially Sensitive Information in Core Files June 21, 2011 - 3:28pm Addthis PROBLEM: Core files produced by ProxySG include unencrypted sensitive data such as keys and end user authentication data. PLATFORM: Version(s): 6.1, 6.2 ABSTRACT: A vulnerability was reported in Blue Coat ProxySG. A local user can obtain potentially sensitive information. reference LINKS: SecurityTracker Alert ID: 1025679 Security Advisories ID: SA56 ProxySG SA56 TSL ID: TSL20110614-02 IM PACT ASSESSMENT: High Discussion: In version 6.1 and 6.2, the software includes information from the secure heap when writing core files. A user with access to the core file can obtain potentially sensitive information, including keys and HTTP

339

Universe in a (Blue) Bottle | U.S. DOE Office of Science (SC)  

Office of Science (SC) Website

Universe in a (Blue) Bottle Universe in a (Blue) Bottle High Energy Physics (HEP) HEP Home About Research Facilities Science Highlights Benefits of HEP Funding Opportunities Advisory Committees News & Resources Contact Information High Energy Physics U.S. Department of Energy SC-25/Germantown Building 1000 Independence Ave., SW Washington, DC 20585 P: (301) 903-3624 F: (301) 903-2597 E: sc.hep@science.doe.gov More Information » October 2012 Universe in a (Blue) Bottle Simulating the evolution of the universe on the Argonne Leadership Computing Facility's IBM Blue Gene/Q. Print Text Size: A A A Subscribe FeedbackShare Page Click to enlarge photo. Enlarge Photo Image courtesy of ANL Large-scale structures in the universe form over time in these stills from a supercomputer simulation of the evolution of the universe.

340

Universe in a (Blue) Bottle | U.S. DOE Office of Science (SC)  

Office of Science (SC) Website

Universe in a (Blue) Bottle Universe in a (Blue) Bottle Advanced Scientific Computing Research (ASCR) ASCR Home About Research Facilities Science Highlights Benefits of ASCR Funding Opportunities Advanced Scientific Computing Advisory Committee (ASCAC) News & Resources Contact Information Advanced Scientific Computing Research U.S. Department of Energy SC-21/Germantown Building 1000 Independence Ave., SW Washington, DC 20585 P: (301) 903-7486 F: (301) 903-4846 E: sc.ascr@science.doe.gov More Information » October 2012 Universe in a (Blue) Bottle Simulating the evolution of the universe on the Argonne Leadership Computing Facility's IBM Blue Gene/Q. Print Text Size: A A A Subscribe FeedbackShare Page Click to enlarge photo. Enlarge Photo Image courtesy of ANL Large-scale structures in the universe form over time in these stills from

Note: This page contains sample records for the topic "blue ruthenium dimer" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


341

Blue Ribbon Commission on America's Nuclear Future Report to the Secretary  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Blue Ribbon Commission on America's Nuclear Future Report to the Blue Ribbon Commission on America's Nuclear Future Report to the Secretary of Energy Blue Ribbon Commission on America's Nuclear Future Report to the Secretary of Energy The Blue Ribbon Commission on America's Nuclear Future (BRC) was formed by the Secretary of Energy at the request of the President to conduct a comprehensive review of policies for managing the back end of the nuclear fuel cycle and recommend a new strategy. It was cochaired by Rep. Lee H. Hamilton and Gen. Brent Scowcroft. Other Commissioners were Mr. Mark H. Ayers, the Hon. Vicky A. Bailey, Dr. Albert Carnesale, Sen. Pete Domenici, Ms. Susan Eisenhower, Sen. Chuck Hagel, Mr. Jonathan Lash, Dr. Allison M. Macfarlane, Dr. Richard A. Meserve, Dr. Ernest J. Moniz, Dr. Per Peterson, Mr. John Rowe, and Rep. Phil Sharp.

342

Geophysical Setting of the Blue Mountain Geothermal Area, North-Central  

Open Energy Info (EERE)

Setting of the Blue Mountain Geothermal Area, North-Central Setting of the Blue Mountain Geothermal Area, North-Central Nevada and Its Relationship to a Crustal-Scale Fracture Associated with the Inception of the Yellowstone Hotspot Jump to: navigation, search OpenEI Reference LibraryAdd to library Journal Article: Geophysical Setting of the Blue Mountain Geothermal Area, North-Central Nevada and Its Relationship to a Crustal-Scale Fracture Associated with the Inception of the Yellowstone Hotspot Abstract The Blue Mountain geothermal field, located about 35 km northwest of Winnemucca, Nevada, is situated along a prominent crustal-scale fracture interpreted from total intensity aeromagnetic and gravity data. Aeromagnetic data indicate that this feature is related to the intrusion of mafic dikes, similar to the Northern Nevada Rift (Zoback et al.,1994), and

343

Slim Holes At Blue Mountain Area (Fairbank Engineering, 2009) | Open Energy  

Open Energy Info (EERE)

Fairbank Engineering, 2009) Fairbank Engineering, 2009) Jump to: navigation, search GEOTHERMAL ENERGYGeothermal Home Exploration Activity: Slim Holes At Blue Mountain Area (Fairbank Engineering, 2009) Exploration Activity Details Location Blue Mountain Area Exploration Technique Slim Holes Activity Date Usefulness useful DOE-funding Unknown Notes DEEP BLUE No.1, the first slim geothermal observation test hole at Blue Mountain, was drilled under a cost-share program between the DOE and Noramex, under the DOE's Geothermal Resource Exploration and Definition (GRED) program, (Noramex Corp., 2002). The hole was sited to test an area of projected high temperature at depth from gradients measured in shallow holes drilled in the central part of the lease area (Figure 3.1), and to test an area of low apparent resistivity interpreted to reflect possible

344

Remarks by Rick McLeod Yucca Mountain Blue Ribbon Panel  

NLE Websites -- All DOE Office Websites (Extended Search)

Rick McLeod Yucca Mountain Blue Ribbon Panel Executive Director March 25, 2010 Savannah River Site Community Reuse Organization 1 GOOD MORNING. I AM RICK MCLEOD...EXECUTIVE...

345

A comparison of the behavior of intact and Resedimented Boston Blue Clay (BBC)  

E-Print Network (OSTI)

Resedimented Boston Blue Clay (RBBC) has been used as an analog test material for research at MIT for decades, due to local variability and the high cost of sampling. However, a comprehensive study of the differences in ...

House, Robert Donald

2012-01-01T23:59:59.000Z

346

An unusually large turtle barnacle (Chelonibia p. patula) on a blue crab from Delaware Bay  

Science Journals Connector (OSTI)

A turtle barnacle,Chelonibia patula patula (Ranzani) of unusually large size was found on a large female blue crab in Delaware Bay in September, 1954. This appears to be the largest known specimen ofC. p. patula....

Austin B. Williams; Hugh J. Portner

1964-01-01T23:59:59.000Z

347

E-Print Network 3.0 - adjustable red-green-blue led Sample Search...  

NLE Websites -- All DOE Office Websites (Extended Search)

Powered by Explorit Topic List Advanced Search Sample search results for: adjustable red-green-blue led Page: << < 1 2 3 4 5 > >> 1 The Spectrum of Clean Energy Innovationinnovati...

348

Reduced genetic diversity and sperm motility in the endangered Gran Canaria Blue Chaffinch Fringilla teydea polatzeki  

Science Journals Connector (OSTI)

The Blue Chaffinch (Fringilla teydea) is endemic to the Canary Islands and restricted to the pine forests on Tenerife (ssp. teydea) and Gran Canaria (ssp. polatzeki). While the teydea population is large and stab...

Eduardo Garcia-del-Rey; Gunnhild Marthinsen; Pascual Calabuig

2013-07-01T23:59:59.000Z

349

Enantioselectivities in electron-transfer and excited state quenching reactions of a chiral ruthenium complex possessing a helical structure  

SciTech Connect

The outer-sphere electron-transfer reactions between diastereomers of Ru(menbyp){sub 3}{sup {sm_bullet}+} (menbpy = 4,4{prime}-di{l_brace}(1R,2S,5R)-({minus})-menthoxycarbonyl{r_brace}-2,2{prime}-bipyridine) and enantiomers of Co(acac){sub 3} and Co(edta){sup {minus}} have been studied by pulse radiolysis. {Delta}-Ru(menbpy){sub 3}{sup {sm_bullet}+} rapidly reduces Co(acac){sub 3} in 85% EtOH/H{sub 2}O (1 mM NaH{sub 2}PO{sub 4}) with second-order rate constants of (2.1 {+-} 0.1) {times} 10{sup 7} and (7.8 {+-} 0.2) {times} 10{sup 6}/M s for the {Delta}- and {Gamma}-Co(acac){sub 3} enantiomers, respectively, and an enantioselectivity factor (EF) of 2.7. {Gamma}-Ru(menbyp){sub 3}{sup {sm_bullet}+} preferentially reduces {Gamma}-Co(acac){sub 3} with an enantioselectivity factor (EF) of 0.8. Activation volume data ({Delta}V{sup {double_dagger}}) suggest that the association between the {Delta}{single_bond}{Delta} isomers in the encounter complex allows closer interaction of the metal centers than between the other isomer combinations. The value of (EF) for the reaction of {Delta}- and {Gamma}-co(edta){sup {minus}} with {Delta}-Ru(menbpy){sub 3}{sup {sm_bullet}+} is 1.2. Electron-transfer reactions of seven racemic Ru(L){sub 3}{sup {sm_bullet}+} (L = substituted phenanthroline) complexes with Co(acac){sub 3} were also studied and gave rate constants of {approx}1.5 {times} 10{sup 9}/M s. The quenching of photoexcited {sup *}Ru(menbpy){sub 3}{sup 2+} by Co(acac){sub 3} and Co(edta){sup {minus}} exhibits small stereoselectivity: For Co(acac){sub 3} in 95 and 85% EtOH/H{sub 2}O the enantioselectivity factor is 1.2 and 1.1, respectively, barely outside the experimental error. For all other cases the selectivity was unity within the experimental error of the measurement. The quenching rate constants were {approx}1 {times} 10{sup 8} and 1.1 {times} 10{sup 9}/M s for Co(acac){sub 3} and Co(edta){sup {minus}}, respectively. Quenching reactions of seven racemic ruthenium(II) phenanthroline complexes with Co(acac){sub 3} were also studied and found to be faster than those of Ru(menbpy){sub 3}{sup 2+} by only a factor of {approx}3 despite an increase in the driving force of {approx}0.5 eV for electron-transfer quenching. The quenching of {sup *}Ru(menbpy){sub 3}{sup 2+} by Co(acac){sub 3} is dominated by an energy-transfer mechanism. This conclusion is supported by the magnitude of the quenching rate constants compared with the rate constants for reduction by Ru(menbpy){sub 3}{sup {sm_bullet}+}, the effect of driving-force changes on the quenching rate constant, the low quantum yield of Co(II) products observed in the CW photolysis, and the lack of long-lived products observed in the flash photolysis experiments. The factors responsible for the selectivity exhibited in the CW photolysis studies of Ru(menbpy){sub 3}{sup 2+} with Co(acac){sub 3} are discussed.

Hamada, Taisuke; Eifuku, Kenji; Sakaki, Shigeyoshi [Kumamoto Univ., Kurokami (Japan). Dept. of Applied Chemistry and Biochemistry] [Kumamoto Univ., Kurokami (Japan). Dept. of Applied Chemistry and Biochemistry; Brunschwig, B.S.; Fujita, E.; Wishart, J.F. [Brookhaven National Lab., Upton, NY (United States). Chemistry Dept.] [Brookhaven National Lab., Upton, NY (United States). Chemistry Dept.; Koerner, M.; Eldik, R. van [Univ. of Erlangen-Nuernberg (Germany). Inst. for Inorganic Chemistry] [Univ. of Erlangen-Nuernberg (Germany). Inst. for Inorganic Chemistry

1999-07-22T23:59:59.000Z

350

Achieving Record Efficiency for Blue OLEDs by Controlling the Charge Balance  

Energy.gov (U.S. Department of Energy (DOE))

Researchers at the University of Florida (UF) have demonstrated a blue phosphorescent organic light-emitting diode (OLED) with a peak power efficiency of 50 lm/W and an external quantum efficiency exceeding 20 percent at a luminance of 1,000 cd/m2, using no external light extraction techniques. This accomplishment is believed to be the world record in blue OLED efficiency.

351

Procyanidin dimer B2-mediated IRAK-M induction negatively regulates TLR4 signaling in macrophages  

SciTech Connect

Highlights: Pro B2 elevated the expression of IRAK-M, a negative regulator of TLR signaling. LPS-induced expression of cell surface molecules was inhibited by Pro B2. LPS-induced production of pro-inflammatory cytokines was inhibited by Pro B2. Pro B2 inhibited LPS-induced activation of MAPKs and NF-?B through IRAK-M. Pro B2 inactivated nave T cells by inhibiting LPS-induced cytokines via IRAK-M. -- Abstract: Polyphenolic compounds have been found to possess a wide range of physiological activities that may contribute to their beneficial effects against inflammation-related diseases; however, the molecular mechanisms underlying this anti-inflammatory activity are not completely characterized, and many features remain to be elucidated. In this study, we investigated the molecular basis for the down-regulation of toll-like receptor 4 (TLR4) signal transduction by procyanidin dimer B2 (Pro B2) in macrophages. Pro B2 markedly elevated the expression of the interleukin (IL)-1 receptor-associated kinase (IRAK)-M protein, a negative regulator of TLR signaling. Lipopolysaccharide (LPS)-induced expression of cell surface molecules (CD80, CD86, and MHC class I/II) and production of pro-inflammatory cytokines (tumor necrosis factor-?, IL-1?, IL-6, and IL-12p70) were inhibited by Pro B2, and this action was prevented by IRAK-M silencing. In addition, Pro B2-treated macrophages inhibited LPS-induced activation of mitogen-activated protein kinases such as extracellular signal-regulated kinase 1/2, p38, and c-Jun N-terminal kinase and the translocation of nuclear factor ?B and p65 through IRAK-M. We also found that Pro B2-treated macrophages inactivated nave T cells by inhibiting LPS-induced interferon-? and IL-2 secretion through IRAK-M. These novel findings provide new insights into the understanding of negative regulatory mechanisms of the TLR4 signaling pathway and the immune-pharmacological role of Pro B2 in the immune response against the development and progression of many chronic diseases.

Sung, Nak-Yun [Advanced Radiation Technology Institute, Korea Atomic Energy Research Institute, Jeongeup 580-185 (Korea, Republic of)] [Advanced Radiation Technology Institute, Korea Atomic Energy Research Institute, Jeongeup 580-185 (Korea, Republic of); Yang, Mi-So [Department of Microbiology, Infection Signaling Network Research Center, College of Medicine, Chungnam National University, Daejeon (Korea, Republic of)] [Department of Microbiology, Infection Signaling Network Research Center, College of Medicine, Chungnam National University, Daejeon (Korea, Republic of); Song, Du-Sub [Advanced Radiation Technology Institute, Korea Atomic Energy Research Institute, Jeongeup 580-185 (Korea, Republic of) [Advanced Radiation Technology Institute, Korea Atomic Energy Research Institute, Jeongeup 580-185 (Korea, Republic of); School of life sciences and Biotechnology, Korea University 5-ka, Anam-Dong, Sungbuk-ku, Seoul 136-701 (Korea, Republic of); Kim, Jae-Kyung; Park, Jong-Heum; Song, Beom-Seok; Park, Sang-Hyun; Lee, Ju-Woon [Advanced Radiation Technology Institute, Korea Atomic Energy Research Institute, Jeongeup 580-185 (Korea, Republic of)] [Advanced Radiation Technology Institute, Korea Atomic Energy Research Institute, Jeongeup 580-185 (Korea, Republic of); Park, Hyun-Jin [School of life sciences and Biotechnology, Korea University 5-ka, Anam-Dong, Sungbuk-ku, Seoul 136-701 (Korea, Republic of)] [School of life sciences and Biotechnology, Korea University 5-ka, Anam-Dong, Sungbuk-ku, Seoul 136-701 (Korea, Republic of); Kim, Jae-Hun [Advanced Radiation Technology Institute, Korea Atomic Energy Research Institute, Jeongeup 580-185 (Korea, Republic of)] [Advanced Radiation Technology Institute, Korea Atomic Energy Research Institute, Jeongeup 580-185 (Korea, Republic of); Byun, Eui-Baek, E-mail: ebbyun80@kaeri.re.kr [Advanced Radiation Technology Institute, Korea Atomic Energy Research Institute, Jeongeup 580-185 (Korea, Republic of)] [Advanced Radiation Technology Institute, Korea Atomic Energy Research Institute, Jeongeup 580-185 (Korea, Republic of); Byun, Eui-Hong, E-mail: ehbyun80@kongju.ac.k [Department of Food Science and Technology, Kongju National University, Yesan 340-800 (Korea, Republic of)] [Department of Food Science and Technology, Kongju National University, Yesan 340-800 (Korea, Republic of)

2013-08-16T23:59:59.000Z

352

MotorWeek Video Transcript: BlueTec Clean Diesel and GM's Cylinder Cut-off  

NLE Websites -- All DOE Office Websites (Extended Search)

BlueTec Clean Diesel and GM's Cylinder Cut-off BlueTec Clean Diesel and GM's Cylinder Cut-off Jessica Shea Choksey:Mercedes-Benz has over 80 years of diesel experience. So it's no surprise they are on the cutting edge of making them environmentally friendly. The full-size seven-passenger 2007 Mercedes-Benz GL320 BlueTec is the cleanest diesel sport-utility vehicle in the world. Named after the color of the emission reducing urea fluid injected into the catalyst system, BlueTec is the technology that can ultimately make clean diesels the obvious choice for Americans. Using Mercedes latest 3.2 liter Turbo diesel V-6, the GL320 will also be the most efficient big SUV with an anticipated highway fuel economy of over 25 miles per gallon. The GL BlueTec goes on sale in January. Also making fuel-saving automotive news is General Motors. As part of

353

A Cure for the Valentine's Blues? Livermore Supercomputer Seeks to Mend  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

A Cure for the Valentine's Blues? Livermore Supercomputer Seeks to A Cure for the Valentine's Blues? Livermore Supercomputer Seeks to Mend Broken Hearts A Cure for the Valentine's Blues? Livermore Supercomputer Seeks to Mend Broken Hearts February 14, 2013 - 9:56am Addthis The Cardioid code developed by a team of Livermore and IBM scientists divides the heart into a large number of manageable pieces, or subdomains. The development team used two approaches, called Voronoi (left) and grid (right), to break the enormous computing challenge into much smaller individual tasks. | Photo from the Lawrence Livermore National Laboratory The Cardioid code developed by a team of Livermore and IBM scientists divides the heart into a large number of manageable pieces, or subdomains. The development team used two approaches, called Voronoi (left) and grid

354

STATEMENT OF CONSIDERATIONS New York Blue Supercomputer User Facility Class Waiver  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

New York Blue Supercomputer User Facility Class Waiver New York Blue Supercomputer User Facility Class Waiver for Non-Proprietary and Proprietary Research W(C)-2008-007 This class waiver is intended to provide for the disposition of intellectual property rights for public and private organizations (hereinafter, Users) that are using the New York Blue (NYBlue) Supercomputing facility for research and commercial use. It is also intended that this class waiver will follow the considerations and terms of the user agreements spelled out in the two recently issued Proprietary and Non-proprietary Class Waivers for designated user facilities at DOE laboratories, W(C)-2008-003 and 005. For the sake of economy, the considerations and user agreements contained in the 003 and 005 waivers will not be repeated verbatim in this class

355

DOE - Office of Legacy Management -- Blue Water AEC Ore Buying Station - NM  

NLE Websites -- All DOE Office Websites (Extended Search)

Blue Water AEC Ore Buying Station - Blue Water AEC Ore Buying Station - NM 0-02 FUSRAP Considered Sites Site: Blue Water AEC Ore Buying Station (NM.0-02 ) Designated Name: Alternate Name: Location: Evaluation Year: Site Operations: Site Disposition: Radioactive Materials Handled: Primary Radioactive Materials Handled: Radiological Survey(s): Site Status: The history of domestic uranium procurement under U.S. Atomic Energy Commission (AEC) contracts identifies a number of ore buying stations (sampling and storage sites) that were operated during the period late-1949 through the mid-1960s. During this period the AEC established ore-buying stations in new uranium producing areas where it appeared that ore production would be sufficient to support a uranium milling operation. The

356

Austin Using Green Innovation to Beat the Utility Blues | Department of  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Austin Using Green Innovation to Beat the Utility Blues Austin Using Green Innovation to Beat the Utility Blues Austin Using Green Innovation to Beat the Utility Blues January 17, 2012 - 1:03pm Addthis An aerial view of the Hornsby Bend Biosolids Management Plant in Austin, Texas. | Photo courtesy of Austin Water. An aerial view of the Hornsby Bend Biosolids Management Plant in Austin, Texas. | Photo courtesy of Austin Water. Todd G. Allen Project Officer, Golden Field Office What does this project do? New biogas generators harness the methane produced during the production of a soil conditioner called "Dillo Dirt" to power the entire production plant. Sewage treatment has always been a dirty business, dating back to the frontier days when "waste management" meant the guy who followed after the

357

Porting Charm++/NAMD to IBM Blue Gene/Q Wei Jiang Argonne Leadership Computing Facility  

NLE Websites -- All DOE Office Websites (Extended Search)

Porting Charm++/NAMD to IBM Blue Gene/Q Porting Charm++/NAMD to IBM Blue Gene/Q Wei Jiang Argonne Leadership Computing Facility 7 th , March NAMD_esp NAMD - Parallel molecular dynamics code designed for high-performance simulation of large biomolecular systems Portable to all popular supercomputing platforms Great scalability based on Charm++ parallel objects Scientific aims on Blue Gene/Q Ensemble run that launches large number of replicas concurrently - mainly for energetic simulation High throughput simulation for large scale systems ~100M atoms Requirements for charm++ New communication layer that supports parallel/parallel runs Enable charm++ programming paradigm on Parallel Active Messaging Interface (PAMI) Parallel Structure of NAMD Hybrid force/spatial decomposition Adaptive Overlap of Communication and Computation

358

Spin-gap opening accompanied by a strong magnetoelastic response in the S=1 magnetic dimer system Ba3BiRu2O9  

Science Journals Connector (OSTI)

Neutron diffraction, magnetization, resistivity, and heat-capacity measurements on the 6H-perovskite Ba3BiRu2O9 reveal simultaneous magnetic and structural dimerization driven by strong magnetoelastic coupling. An isostructural but strongly displacive first-order transition on cooling through T*=176 K is associated with a change in the nature of direct RuRu bonds within Ru2O9 face-sharing octahedra. Above T*, Ba3BiRu2O9 is an S=1 magnetic dimer system with intradimer exchange interactions J0/kB=320 K and interdimer exchange interactions J?/kB=?160 K. Below T*, a spin-gapped state emerges with ??220 K. Ab initio calculations confirm antiferromagnetic exchange within dimers, but the transition is not accompanied by long-range magnetic order.

Wojciech Miiller; Maxim Avdeev; Qingdi Zhou; Andrew J. Studer; Brendan J. Kennedy; Gordon J. Kearley; Chris D. Ling

2011-12-15T23:59:59.000Z

359

Blue Light Sensitive Dyes for Various Photopolymerization Reactions: Naphthalimide and Naphthalic Anhydride Derivatives.  

Science Journals Connector (OSTI)

Novel naphthalimide derivatives (or naphthalic anhydride derivatives) have been prepared and combined with an iodonium salt, N-vinylcarbazole, amines or 2,4,6-tris(trichloromethyl)-1,3,5-triazine to produce radicals and cations upon exposure to low intensity blue lights (e.g., a household blue LED bulb). ... The photochemical mechanisms are studied by electron spin resonance spin trapping, fluorescence, cyclic voltammetry, laser flash photolysis, and steady state photolysis techniques. ... Design of Novel Photoinitiators for Radical and Cationic Photopolymerizations under Near UV and Visible LEDs (385, 395, and 405 nm). ...

Pu Xiao; Frdric Dumur; Bernadette Graff; Didier Gigmes; Jean Pierre Fouassier; Jacques Laleve

2014-01-09T23:59:59.000Z

360

Gain analysis of blue nitride-based lasers by small signal modulation  

Science Journals Connector (OSTI)

With a small signal frequency-modulation of the driving current the resonance frequency and the damping factor of the optical output power response of blue nitride-based ridge lasers grown on [0001]-plane gallium-nitride substrates were investigated with a network analyzer setup. From the linear dependence of the squared resonance frequency on the driving current the gain coefficients of the logarithmic gain model could be extracted being 7680 ? cm ? 1 for blue nitride-based lasers. For this purpose additional parameters such as the carrier density and the confinement factor were assigned by carrier lifetime and quantum efficiencymeasurements and one dimensional transfer matrix simulations respectively.

J. Mller; M. Scheubeck; M. Sabathil; G. Brderl; D. Dini; S. Tautz; T. Lermer; A. Breidenassel; S. Lutgen

2010-01-01T23:59:59.000Z

Note: This page contains sample records for the topic "blue ruthenium dimer" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


361

Energy-Department Supported Scientist Receives Nobel Prize for Blue Light LED  

Office of Energy Efficiency and Renewable Energy (EERE)

This week, three scientiststwo from Japan and one from the United Statesreceived the Nobel Prize in physics for their work on the LED light. The trifecta, Isamu Akasaki, Hiroshi Amano and Shuji Nakamura, earned the prestigious award specifically for their invention of the blue light emitting diode, a game-changer in the history of LED lights. The American scientist, Shuji Nakamura, a pioneer in the lighting industry, is the founder of LED company Soraa, which has a history of working with the Department of Energyboth through EERE and our Advanced Research Projects Agency-Energy (ARPA-E)on the subject of blue light diodes.

362

Charge transfer from an adsorbed ruthenium-based photosensitizer through an ultra-thin aluminium oxide layer and into a metallic substrate  

E-Print Network (OSTI)

The interaction of the dye molecule N3 (cis-bis(isothiocyanato)bis(2,2-bipyridyl-4,4'-dicarboxylato)-ruthenium(II)) with the ultra-thin oxide layer on a AlNi(110) substrate, has been studied using synchrotron radiation based photoelectron spectroscopy, resonant photoemission spectroscopy (RPES) and near edge X-ray absorption fine structure spectroscopy (NEXAFS). Calibrated X-ray absorption and valence band spectra of the monolayer and multilayer coverages reveal that charge transfer is possible from the molecule to the AlNi(110) substrate via tunnelling through the ultra-thin oxide layer and into the conduction band edge of the substrate. This charge transfer mechanism is possible from the LUMO+2&3 in the excited state but not from the LUMO, therefore enabling core-hole clock analysis, which gives an upper limit of $6.0\\pm$2.5fs for the transfer time. This indicates that ultra-thin oxide layers are a viable material for use in dye-sensitized solar cells (DSSC), which may lead to reduced recombination effe...

Gibson, Andrew J; Handrup, Karsten; Weston, Matthew; Mayor, Louise C; O'Shea, James N

2014-01-01T23:59:59.000Z

363

01MK4032 R6/13 Your student health insurance coverage, offered by Blue Cross and  

E-Print Network (OSTI)

of Louisiana, may not meet the minimum standards required by the health care reform law for the restrictions01MK4032 R6/13 Your student health insurance coverage, offered by Blue Cross and Blue Shield and individual health insurance coverage are $1.25 million for policy years before September 23, 2012; and $2

364

MoS{sub 2} nanotube exfoliation as new synthesis pathway to molybdenum blue  

SciTech Connect

Graphical abstract: . Display Omitted Highlights: ? New synthesis approach to obtaining molybdenum blue via exfoliated MoS{sub 2} nanotubes. ? Material is prone to self assembly and is stable in high vacuum. ? Molecules are as small as 2 nm and their clusters are up to tens of nanometers. ? Change in absorption and oxidation states from the precursor MoS{sub 2}. -- Abstract: Molybdenum blue-type materials are usually obtained by partially reducing Mo{sup VI+} in acidic solutions, while in the presented method it is formed in ethanol solution of exfoliated MoS{sub 2} nanotubes, where the MoS{sub 2} flakes are the preferential location for their growth. Material was investigated by means of scanning electron and atomic force microscopy, showing the structure and self assembly, while also confirming that it is stable in high vacuum with molecules as small as 1.6 nm and the agglomerates of few tens of nanometres. The ultravioletvisible and photoelectron spectrometry show the change in absorption properties and oxidation states from MoS{sub 2} structure to molybdenum blue, while the presence of sulphur suggests that this is a new type of molybdenum blue material.

Visic, B., E-mail: bojana.visic@ijs.si [Jozef Stefan Institute, Jamova cesta 39, SI-1000 Ljubljana (Slovenia); Gunde, M. Klanjsek [National Institute of Chemistry, Hajdrihova 19, SI-1000 Ljubljana (Slovenia)] [National Institute of Chemistry, Hajdrihova 19, SI-1000 Ljubljana (Slovenia); Kovac, J.; Iskra, I. [Jozef Stefan Institute, Jamova cesta 39, SI-1000 Ljubljana (Slovenia)] [Jozef Stefan Institute, Jamova cesta 39, SI-1000 Ljubljana (Slovenia); Jelenc, J.; Remskar, M. [Jozef Stefan Institute, Jamova cesta 39, SI-1000 Ljubljana (Slovenia) [Jozef Stefan Institute, Jamova cesta 39, SI-1000 Ljubljana (Slovenia); Centre of Excellence Namaste, Jamova cesta 39, SI-1000 Ljubljana (Slovenia)

2013-02-15T23:59:59.000Z

365

Role of Epicellular Molecules in the Selection of Particles by the Blue Mussel, Mytilus edulis  

E-Print Network (OSTI)

Role of Epicellular Molecules in the Selection of Particles by the Blue Mussel, Mytilus edulis-BSA and mannopyranosyl- phenyl-BSA but rejected in pseudofeces microspheres coated with BSA alone. The positive selection for neogly- coprotein-coated microspheres was inhibited when mussels were pre-incubated in seawater

366

THEBLACKMARBLE In daylight our big blue marble is all land, oceans and  

E-Print Network (OSTI)

THEBLACKMARBLE #12;In daylight our big blue marble is all land, oceans and clouds. But the night ­ is electric. These views of Earth's city lights show brightly shining cities, connected by illuminated webs at night is a composite of data acquired over nine days in April and thirteen days in October 2012

367

Determination of Thermal Inactivation Kinetics of Hepatitis A Virus in Blue Mussel (Mytilus edulis) Homogenate  

Science Journals Connector (OSTI)

...Arrhenius activation energy for each model, and...calculated activation energies for the first-order...D-values) and activation energy for each model. MATERIALS...from a local seafood market. The blue mussels were...Waring Commercial, USA) at maximum speed...

Hayriye Bozkurt; Doris H. D'Souza; P. Michael Davidson

2014-03-14T23:59:59.000Z

368

Anaerobic and Aerobic Hydrogen Gas Formation by the Blue-Green Alga Anabaena cylindrica  

Science Journals Connector (OSTI)

...and in air, by the blue- green alga Anabaena cylindrica. The alga had not been previously adapted...consideration as a potential source of fuel, and hence there is considerable...known for many years that green algae such as Scenedesmus can evolve...

Arlene Daday; Rosalea A. Platz; Geoffrey D. Smith

1977-11-01T23:59:59.000Z

369

Bioelectricity generation and microcystins removal in a blue-green algae powered microbial fuel cell  

Science Journals Connector (OSTI)

Bioelectricity production from blue-green algae was examined in a single chamber tubular microbial fuel cell (MFC). The blue-green algae powered MFC produced a maximum power density of 114mW/m2 at a current density of 0.55mA/m2. Coupled with the bioenergy generation, high removal efficiencies of chemical oxygen demand (COD) and nitrogen were also achieved in MFCs. Over 78.9% of total chemical oxygen demand (TCOD), 80.0% of soluble chemical oxygen demand (SCOD), 91.0% of total nitrogen (total-N) and 96.8% ammoniumnitrogen (NH3N) were removed under closed circuit conditions in 12 days, which were much more effective than those under open circuit and anaerobic reactor conditions. Most importantly, the MFC showed great ability to remove microcystins released from blue-green algae. Over 90.7% of MC-RR and 91.1% of MC-LR were removed under closed circuit conditions (500?). This study showed that the MFC could provide a potential means for electricity production from blue-green algae coupling algae toxins removal.

Yong Yuan; Qing Chen; Shungui Zhou; Li Zhuang; Pei Hu

2011-01-01T23:59:59.000Z

370

City emergency "blue light" telephone (maintained by the city of Evanston)  

E-Print Network (OSTI)

Tennis Courts Tennis Courts City emergency "blue light" telephone (maintained by the city Football Center Byron S.Coon Sports Center ISABELLA STREET CENTRAL STREET ASHLANDAVENUE ASBURYAVENUE Gymnasium LINCOLN STREET COLFAX STREET DARTMOUTH PLACE NOYES STREET HAVEN STREET GARRETT PLACE LIBRARY PLACE

Reber, Paul J.

371

A. B.Severe declines in blue crabs have been occurring throughout their geographic  

E-Print Network (OSTI)

selected to monitor water quality, fishing effort and crab abundance along a salinity gradient from 35 to 0 landings are significantly correlated with annual precipitation, river discharge and average salinity salinity, crab abundance and fishing effort. The influence of salinity on blue crab, Callinectes sapidus

Childress, Michael J.

372

Student Release of Records Form Use Black or Blue Ink Only  

E-Print Network (OSTI)

Student Release of Records Form Use Black or Blue Ink Only STUDENT INFORMATION Name (Last, First, Middle) Student ID Number Telephone Number City Zip CodeHome Address State Student information from a student's educational record to a third party without the student's explicit written

Hart, Gus

373

A Reader's Guide to the Blue Book: Issues in California's Electric  

E-Print Network (OSTI)

and Regulatory Reform James Bushnell and Carl Blumstein June 1994 This paper is part of the working papers series BOOK: ISSUES IN CALIFORNIA'S ELECTRIC INDUSTRY RESTRUCTURING AND REGULATORY REFORM POWER Working Group on Electric Industry Restructuring and Regulatory Reform June, 1994 #12;2 PWP-021 A READERS GUIDE TO THE BLUE

California at Berkeley. University of

374

Z .Geoderma 97 2000 87101 Sorption of Brilliant Blue FCF in soils as affected  

E-Print Network (OSTI)

Z .Geoderma 97 2000 87­101 Sorption of Brilliant Blue FCF in soils as affected by pH and ionic phase. For an adequate interpretation of stained flow pathways, the sorption characteristics of the dye sorption to soils. Batch sorption studies were conducted with three different soils and different ionic

Flury, Markus

375

Group Work Support for the BlueJ IDE Kasper Fisker  

E-Print Network (OSTI)

@deakin.edu.au ABSTRACT Learning to work in teams is essential for every software professional. Developing softwareGroup Work Support for the BlueJ IDE Kasper Fisker fisker@fiskers.org Michael Kölling Computing. Starting effective group work practices early can lead to better acceptance of group work as a standard

Kent, University of

376

Reducing Energy Costs for IBM Blue Gene/P via Power-Aware Job Scheduling  

E-Print Network (OSTI)

Reducing Energy Costs for IBM Blue Gene/P via Power-Aware Job Scheduling Zhou Zhou1 , Zhiling Lan1 scheduling approach for HPC systems based on variable energy prices and job power profiles. In particular, we from produc- tion systems show that our power-aware job scheduling approach can reduce the energy cost

Feitelson, Dror

377

A Flavin Binding Cryptochrome Photoreceptor Responds to Both Blue and Red Light in Chlamydomonas reinhardtii  

Science Journals Connector (OSTI)

...TCEP, Tris(2-carboxyethyl)phosphine|LED, light-emitting diode|qPCR, quantitative PCR|FWHM, full width at...The samples were exposed to blue light from a light-emitting diode (LED) with an output at 455 nm (Figure 5A...

Benedikt Beel; Katja Prager; Meike Spexard; Severin Sasso; Daniel Weiss; Nico Müller; Mark Heinnickel; David Dewez; Danielle Ikoma; Arthur R. Grossman; Tilman Kottke; Maria Mittag

2012-07-06T23:59:59.000Z

378

The 2dF Galaxy Redshift Survey: The blue galaxy fraction and implications for the Butcher-Oemler effect  

E-Print Network (OSTI)

We derive the fraction of blue galaxies in a sample of clusters at z < 0.11 and the general field at the same redshift. The value of the blue fraction is observed to depend on the luminosity limit adopted, cluster-centric radius and, more generally, local galaxy density, but it does not depend on cluster properties. Changes in the blue fraction are due to variations in the relative proportions of red and blue galaxies but the star formation rate for these two galaxy groups remains unchanged. Our results are most consistent with a model where the star formation rate declines rapidly and the blue galaxies tend to be dwarfs and do not favour mechanisms where the Butcher-Oemler effect is caused by processes specific to the cluster environment.

Roberto De Propris; Matthew Colless; John Peacock; Warrick Couch; Simon Driver; Michael Balogh; Ivan Baldry; Carlton Baugh; Joss Bland-Hawthorn; Terry Bridges; Russell Cannon; Shaun Cole; Chris Collins; Nicholas Cross; Gavin Dalton; George Efstathiou; Richard Ellis; Carlos Frenk; Karl Glazebrook; Edward Hawkins; Carole Jackson; Ofer Lahav; Ian Lewis; Stuart Lumsden; Steve Maddox; Darren Madgwick; Peder Norberg; Will Percival; Bruce Peterson; Will Sutherland; Keith Taylor

2004-02-26T23:59:59.000Z

379

Nuclear Factor-KB Dimer Exchange Promotes a p21waf1/cip1 Superinduction Response in Human T Leukemic Cells  

E-Print Network (OSTI)

Nuclear Factor-KB Dimer Exchange Promotes a p21waf1/cip1 Superinduction Response in Human ability to induce p21waf1/cip1 . Here, we provide evidence that sequential NF-KB-activating signals induce heightened NF-KB DNA binding and p21waf1/cip1 induction in CEM and additional T leukemic cell lines

Miyamoto, Shigeki

380

THE JOURNAL OF CHEMICAL PHYSICS VOLUME 58, NUMBER 2 15 JANUARY 1973 Internal state distribution of alkali dimers in supersonic nozzle beams*  

E-Print Network (OSTI)

of alkali dimers in supersonic nozzle beams* M. P. Sinha, A. Schultzt, and R. N. Zare Department o the white light and laser-induced fluorescence excited in a nozzle beam of Na2 molecules, we have measured beams with various stagnation pressures (50-240 torr) of alkali metal and with nozzles of different

Zare, Richard N.

Note: This page contains sample records for the topic "blue ruthenium dimer" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


381

Low-temperature emission spectra of 9-alkylanthracene esters: Dimer photodecomposition and monomer pair interactions in polymer hosts  

SciTech Connect

Effects due to variation in the alkyl chain length of photodimers of 9-alkylanthracene esters on their photodecomposition efficiencies at 12 K and, by implication, the photoproduct migration as a function of temperature within polymer hosts are investigated. It is shown that dimers with longer alkyl chains have a lower photodecomposition efficiency. The extent of photoproduct migration within the polymer following photodecomposition was also studied as a function of alkyl chain length. This migration and its modulation of the interaction between the separating monomers is shown to affect the emission spectrum. Thus, monomer migration was studied in temperature cycling experiments. It was also found, for the polymer hosts investigated - poly(methyl methacrylate), poly(vinyl chloride), and polystyrene - that these properties are host dependent. This result is probably due to the void space differences that exist among these polymers. 17 refs., 10 figs.

Salt, K.; Scott, G.W. (Univ. of California, Riverside, CA (United States))

1994-10-06T23:59:59.000Z

382

Preliminary Crystallography Confirms that the Archaeal DNA-binding and Tryptophan-sensing Regulator TrpY is a Dimer  

SciTech Connect

TrpY regulates the transcription of the metabolically expensive tryptophan-biosynthetic operon in the thermophilic archaeon Methanothermobacter thermautotrophicus. TrpY was crystallized using the hanging-drop method with ammonium sulfate as the precipitant. The crystals belonged to the tetragonal space group P4{sub 3}2{sub 1}2 or P4{sub 1}2{sub 1}2, with unit-cell parameters a = b = 87, c = 147 {angstrom}, and diffracted to 2.9 {angstrom} resolution. The possible packing of molecules within the cell based on the values of the Matthews coefficient (V{sub M}) and analysis of the self-rotation function are consistent with the asymmetric unit being a dimer. Determining the structure of TrpY in detail will provide insight into the mechanisms of DNA binding, tryptophan sensing and transcription regulation at high temperature by this novel archaeal protein.

J Cafasso; B Manjasetty; E Karr; K Sandman; M Chance; J Reeve

2011-12-31T23:59:59.000Z

383

Mysteries of the Deep: What happens inside of MPI on Blue Gene/Q and why it matters  

NLE Websites -- All DOE Office Websites (Extended Search)

Mysteries Mysteries of the Deep: What happens inside of MPI on Blue Gene/Q and why it matters Jeff Hammond Leadership Computing Facility Argonne National Laboratory March 5, 2013 Jeff Hammond PAMI and MPI on BGQ The view from the boat Jeff Hammond PAMI and MPI on BGQ A reason to dive Jeff Hammond PAMI and MPI on BGQ But not too deep Jeff Hammond PAMI and MPI on BGQ Blue Gene/P Communication architecture Jeff Hammond PAMI and MPI on BGQ Blue Gene/Q Communication architecture Jeff Hammond PAMI and MPI on BGQ MPI-3 on Blue Gene/Q There is no official plan to support MPI-3 on Blue Gene/Q but a subset of these features may be available at some point in the future. I have build MPICH-3.0.x on Blue Gene/Q and many things pass while others are completely broken, but this is not a supported usage and you should not do it unless you are l33t h4xz0r. Jeff Hammond PAMI and MPI on BGQ MPI-3 on Blue Gene/Q A portable implementation

384

Highly efficient greenish-blue platinum-based phosphorescent organic light-emitting diodes on a high triplet energy platform  

SciTech Connect

We have demonstrated high-efficiency greenish-blue phosphorescent organic light-emitting diodes (PHOLEDs) based on a dimesitylboryl-functionalized C^N chelate Pt(II) phosphor, Pt(m-Bptrz)(t-Bu-pytrz-Me). Using a high triplet energy platform and optimized double emissive zone device architecture results in greenish-blue PHOLEDs that exhibit an external quantum efficiency of 24.0% and a power efficiency of 55.8?lm/W. This record high performance is comparable with that of the state-of-the-art Ir-based sky-blue organic light-emitting diodes.

Chang, Y. L., E-mail: yilu.chang@mail.utoronto.ca; Gong, S., E-mail: sgong@chem.utoronto.ca; White, R.; Lu, Z. H., E-mail: zhenghong.lu@utoronto.ca [Department of Materials Science and Engineering, University of Toronto, 184 College St., Toronto, Ontario M5S 3E4 (Canada); Wang, X.; Wang, S., E-mail: wangs@chem.queensu.ca [Department of Chemistry, Queen's University, 90 Bader Lane, Kingston, Ontario K7L 3N6 (Canada); Yang, C. [Department of Chemistry, Wuhan University, Wuhan 430072 (China)

2014-04-28T23:59:59.000Z

385

Blue Mountain Hot Spring Guest Ranch Pool & Spa Low Temperature Geothermal  

Open Energy Info (EERE)

Guest Ranch Pool & Spa Low Temperature Geothermal Guest Ranch Pool & Spa Low Temperature Geothermal Facility Jump to: navigation, search Name Blue Mountain Hot Spring Guest Ranch Pool & Spa Low Temperature Geothermal Facility Facility Blue Mountain Hot Spring Guest Ranch Sector Geothermal energy Type Pool and Spa Location Prairie City, Oregon Coordinates 44.4632135°, -118.7099477° Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"ROADMAP","zoom":14,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"350px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[]}

386

Faint Blue Objects in the Hubble Deep Field South Revealed: White Dwarfs, Subdwarfs, and Quasars  

E-Print Network (OSTI)

We explore the nature of the faint blue objects in the Hubble Deep Field South. We have derived proper motions for the point sources in the Hubble Deep Field South using a 3 year baseline. Combining our proper motion measurements with spectral energy distribution fitting enabled us to identify 4 quasars and 42 stars, including 3 white dwarf candidates. Two of these white dwarf candidates, HDFS 1444 and 895, are found to display significant proper motion, 21.1 $\\pm$ 7.9 mas/yr and 34.9 $\\pm$ 8.0 mas/yr, and are consistent with being thick disk or halo white dwarfs located at ~2 kpc. The other faint blue objects analyzed by Mendez & Minniti do not show any significant proper motion and are inconsistent with being halo white dwarfs; they do not contribute to the Galactic dark matter. The observed population of stars and white dwarfs is consistent with standard Galactic models.

Mukremin Kilic; R. A. Mendez; Ted von Hippel; D. E. Winget

2005-07-22T23:59:59.000Z

387

Efficient Charge Balance in Blue Phosphorescent Organic Light Emitting Diodes by Two Types of Mixed Layer  

Science Journals Connector (OSTI)

Abstract The authors have demonstrated a highly efficient and long-lifetime blue phosphorescent organic light emitting diode (PHOLED) that uses two types of mixed layers. The mixed layers play the role of carrier injection control and exciton generation zone extension. One of the layers is applied for mixing the hole transport layer (HTL) and host material at the HTL side for carrier injection control. The other works as a mixed electron transporting layer (ETL) and host material at the ETL side. The optimized blue PHOLED has been shown to achieve high performance owing to the mixed layer effects. It gave a maximum luminous efficiency of 25.55cd/A, maximum external quantum efficiency of 13.05%, and lifetime of 7.24h under 500cd/m2. These results indicate that applying mixed layers is a simple and efficient method that does not require significant structural change.

Hyung Jin Yang; Ho Won Lee; Song Eun Lee; Yong Sun; Kyo Min Hwang; Han Kyu Yoo; Sung Kyu Lee; Woo Young Kim; Young Kwan Kim

2014-01-01T23:59:59.000Z

388

Purification and characterization of phycocyanin from the blue-green alga Aphanizomenon flos-aquae  

Science Journals Connector (OSTI)

Aphanizomenon flos-aquae (AFA) is a blue-green alga and represents a nutrient-dense food source. In this study the presence of phycocyanin (PC), a blue protein belonging to the photosynthetic apparatus, has been demonstrated in AFA. An efficient method for its separation has been set up: PC can be purified by a simple single step chromatographic run using a hydroxyapatite column (ratio A620/A280 of 4.78), allowing its usage for health-enhancing properties while eliminating other aspecific algal components. Proteomic investigation and HPLC analysis of purified AFA phycobilisomes revealed that, contrary to the well-characterized Synechocystis and Spirulina spp., only one type of biliprotein is present in phycobilisomes: phycocyanins with no allo-phycocyanins. Two subunit polypeptides of PC were also separated: the ? subunit containing two bilins as chromophore and the ? subunit containing only one.

Serena Benedetti; Sara Rinalducci; Francesca Benvenuti; Sonia Francogli; Silvia Pagliarani; Luca Giorgi; Mauro Micheloni; Gian Maria DAmici; Lello Zolla; Franco Canestrari

2006-01-01T23:59:59.000Z

389

Core Holes At Blue Mountain Area (Fairbank & Neggemann, 2004) | Open Energy  

Open Energy Info (EERE)

Fairbank & Neggemann, 2004) Fairbank & Neggemann, 2004) Jump to: navigation, search GEOTHERMAL ENERGYGeothermal Home Exploration Activity: Core Holes At Blue Mountain Area (Fairbank & Neggemann, 2004) Exploration Activity Details Location Blue Mountain Area Exploration Technique Core Holes Activity Date Usefulness useful DOE-funding Unknown Notes Drilling took longer than scheduled due to severe losses of circulation in the shallow subsurface causing considerable disruptions with the drilling and difficulty with cementing the 7 inch and 4.5 inch casing. An artesian flow of hot water was encountered at 163ft (49.7m) but efforts to obtain an uncontaminated sample of the water were frustrated by unstable hole conditions. In contrast, the 3.782" HQ interval of the well, continuously

390

Application of the Modified Methylene Blue Test to Detect Clay Minerals in Coarse Aggregate Fines  

E-Print Network (OSTI)

APPLICATION OF THE MODIFIED METHYLENE BLUE TEST TO DETECT CLAY MINERALS IN COARSE AGGREGATE FINES A Thesis by BRANDON THOMAS PITRE Submitted to the Office of Graduate Studies of Texas A&M University in partial fulfillment...: Civil Engineering Copyright 2012 Brandon Thomas Pitre ii ABSTRACT The purpose of this study was to implement a new, rapid field method to effectively and accurately detect harmful clay minerals in aggregate fines by using the modified...

Pitre, Brandon

2012-12-04T23:59:59.000Z

391

The effect of an employee educational program on the bacteriological quality of blue crab meat  

E-Print Network (OSTI)

University Chairman of Advisory Committee: Dr. R. Nickelson II Employee educational programs were used in various food processing plants to improve the plant sanitation. Little 1;terature had been reported on the effect of sanitation workshops... on the sanitation prac- tices of employees, productivity of the plant, product. yields, and microbiological quality of the finished product. Two different blue crab processing plants along the Texas coast were monitored for aerobic plate counts (APC), coliforms...

Biediger, Catherine M

1978-01-01T23:59:59.000Z

392

Open Data, Open Source and Open Standards in chemistry: The Blue Obelisk five years on  

E-Print Network (OSTI)

,20], an evolutionary algorithm for crystal structure prediction. XtalOpt provides a graphical interface using Avogadro and submits calculations using a range of solid-state simulation software to predict stable polymorphs. A final example of second-generation Blue... that can monitors the progress of SCF and geometry convergences, and can plot predicted UV/Vis absorption and infrared spectra from appropriate logfiles containing energies and oscillator strengths for easy comparison to experimental data. QMForge [27...

O'Boyle, Noel M; Guha, Rajarshi; Willighagen, Egon L; Adams, Samuel E; Alvarsson, Jonathan; Apodaca, Richard L; Bradley, Jean-Claude; Filippov, Igor V; Hanson, Robert M; Hanwell, Marcus D; Hutchison, Geoffrey R; James, Craig A; Jeliazkova, Nina; Lang, Andrew S I D; Langner, Karol M; Lonie, David C; Lowe, Daniel M; Pansanel, Jerome; Pavlov, Dmitry; Spjuth, Ola; Steinbeck, Christoph; Tenderholt, Adam L; Theisen, Kevin J; Murray-Rust, Peter

2011-06-04T23:59:59.000Z

393

Calibration of Cangaroo II Telescope Using a Fast Blue LED Light Flasher  

E-Print Network (OSTI)

Calibration of Cangaroo II Telescope Using a Fast Blue LED Light Flasher John R. Patterson, David L;=460 nm) LED type Nichia (NSPB 510S), which has a temperature stable light output and a risetime of #24; 1.physics.adelaide.edu.au/astrophysics/cangaroo.html #12; FIGURE 1. The LED asher/telescope with the Ramsden eyepiece #12;tted and a previous LED holder

Enomoto, Ryoji

394

Heavy metals in blue mussels (mytilus edulis) in the Bergen Harbor area, Western Norway  

SciTech Connect

Heavy metal discharges to the marine environment are of great concern all over the world. Both essential (e.g., Fe, Zn, Cu) and non essential (e.g., Hg, Cd, Pb) metals are toxic to living organism when subjected to high concentration. Many heavy metals accumulate in organisms and some also accumulate in the food chain. The anthropogenic heavy metal outlets can in this way both reduce marine species diversity and ecosystem. Further, by consuming seafood, humans will be exposed to the metals with a potential danger to human health. Goldberg proposed to use marine mussels to monitor contamination levels of coastal waters. Since then marine mussels, especially the blue mussel (Mytilus edulis), has been used widely as a surveillance organism. The blue mussel is regarded a suitable species for this purpose because it accumulates metals, it sessile, has a relatively long life span, is large enough for individual analysis, can tolerate a relatively wide range of temperature and salinity regimes, and can also synthesize the metal-binding protein, metallothionein, for metal detoxification. Furthermore, the blue mussel is a popular and tasteful food source and is suitable for culturing. The world-wide annual yield of mussels during the period 1988 to 1992 was about 1.3 million tons, of which about 0.5 million tons was Mytilus edulis. In Norway, the annual production was 77 tons in 1990. The interest of culturing mussels has increased in recent years, but the consumption of mussels has been hampered both by toxic algae and high levels of heavy metals. The latter is of special concern to those close to urban or industrial areas. This study investigated whether blue mussels in the Bergen Harbor area were contaminated with the heavy metals zinc, copper, lead, cadmium, and mercury, evaluating whether humans could eat them. 21 refs., 6 figs.

Andersen, V.; Johannessen, P.J. [Univ. of Bergen (Norway)] [Univ. of Bergen (Norway); Maage, A. [Directorate of Fisheries, Bergen (Norway)] [Directorate of Fisheries, Bergen (Norway)

1996-12-31T23:59:59.000Z

395

Stellar Populations Found in the Central kpc of Four Luminous Compact Blue Galaxies at Intermediate Redshift  

E-Print Network (OSTI)

We investigate the star formation history of the central regions of four Luminous Compact Blue Galaxies (LCBGs). LCBGs are blue (B-V<0.6), compact (MU_B<21.5 mag arcsec^-2) galaxies with absolute magnitudes M_B brighter than -17.5. The LCBGs analyzed here are located at 0.436blue (B-V < 0.4) and high surface brightness (MU_B < 19.0 mag arcsec^-2) of this population. The observational data used were obtained with the HST/STIS spectrograph, the HST/WF/PC-2 camera and the HST/NICMOS first camera. We find evidence for multiple stellar populations. One of them is identified as the ionizing population, and the other one corresponds to the underlying stellar generation. The estimated masses of the inferred populations are compatible with the dynamical masses, which are typically 2--10x 10^9 M_sun. Our models also indicate that the first episodes of star formation the presented LCBGs underwent happened between 5 and 7 Gyr ago. We compare the stellar populations found in LCBGs with the stellar populations present in bright, local HII galaxies, nearby spheroidal systems and Blue Compact Dwarf Galaxies. It turns out that the underlying stellar populations of LCBGs are similar yet bluer to those of local HII galaxies. It is also the case that the passive color evolution of the LCBGs could convert them into local Spheroidal galaxies if no further episode of star formation takes place. Our results help to impose constraints on evolutionary scenarios for the population of LCBGs found commonly at intermediate redshifts.

C. Hoyos; R. Guzman; A. I. Diaz; D. C. Koo; M. A. Bershady; .

2007-09-28T23:59:59.000Z

396

I Have Seen the Light and It's Green...or Pink, or Blue, or Purple. Shucks,  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

I Have Seen the Light and It's Green...or Pink, or Blue, or Purple. I Have Seen the Light and It's Green...or Pink, or Blue, or Purple. Shucks, it's LED Solid-State Lighting. I Have Seen the Light and It's Green...or Pink, or Blue, or Purple. Shucks, it's LED Solid-State Lighting. May 5, 2009 - 5:00am Addthis John Lippert When it comes to lighting, light-emitting diodes (LEDs) are the new kid on the block. LEDs are a form of solid-state lighting. As such, they are following the example of their siblings in the computer industry, improving in performance at an astonishing pace. In this blog I'm going to cover my personal experiences with LED lighting. I'll go over LED lighting in general, providing consumer buying tips, in a future blog. You may already be using LED lighting. They have become a popular holiday lighting option around Christmas time since they consume a fraction of the

397

I Have Seen the Light and It's Green...or Pink, or Blue, or Purple. Shucks,  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Have Seen the Light and It's Green...or Pink, or Blue, or Purple. Have Seen the Light and It's Green...or Pink, or Blue, or Purple. Shucks, it's LED Solid-State Lighting. I Have Seen the Light and It's Green...or Pink, or Blue, or Purple. Shucks, it's LED Solid-State Lighting. May 5, 2009 - 5:00am Addthis John Lippert When it comes to lighting, light-emitting diodes (LEDs) are the new kid on the block. LEDs are a form of solid-state lighting. As such, they are following the example of their siblings in the computer industry, improving in performance at an astonishing pace. In this blog I'm going to cover my personal experiences with LED lighting. I'll go over LED lighting in general, providing consumer buying tips, in a future blog. You may already be using LED lighting. They have become a popular holiday lighting option around Christmas time since they consume a fraction of the

398

Ionization-induced blue shift of KrF laser pulses in an underdense plasma  

Science Journals Connector (OSTI)

The ionization-induced blue-shifted spectra for helium, neon, and nitrogen have been measured at various gas densities up to 51020 cm-3 at a vacuum intensity of 81016 W/cm2 for picosecond KrF laser pulses at 248 nm. A 1-mm diameter gas jet target was used in the experiment to minimize the refraction of the laser beam and thus higher laser intensities were obtained in the gas than in previously reported experiments. For helium, a distinct shifted peak was observed at intermediate densities which was not seen before. For helium and nitrogen, spectra were also measured of the light scattered outside of the original focal cone angle. In this region there was little signal for electron densities below 21020 cm-3 consistent with limited refraction at lower densities and at higher densities the spectra were predominantly blue shifted. These results indicate the importance of refraction in the correct interpretation of ionization blue-shifted spectra. 1996 The American Physical Society.

Y. M. Li and R. Fedosejevs

1996-08-01T23:59:59.000Z

399

Optical and structural stability of blue SrO:Eu{sup 2+} phosphor  

SciTech Connect

Chemical stability of 6-coodinated SrO is a fundamental problem when this is used for various applications. In this study, optical and chemical stabilities of 8-coordinated SrO:Eu{sup 2+} phosphor were investigated. SrO:Eu{sup 2+} phosphor was synthesized from thermal treatment of SrO:Eu powder located on a single crystalline MgO at 1500 C under reduction atmosphere. Obtained 8-coordinated SrO:Eu{sup 2+} phosphor exhibit strong blue luminescence and chemical stability in distilled water for 3 days. Our findings prove that obtained 8-coordinated SrO:Eu{sup 2+} possesses relative optical and chemical stabilities in water. - Graphical abstract: Obtained 8-coordinated SrO:Eu{sup 2+} phosphor exhibit strong blue luminescence in distilled water. Highlights: We investigated optical and chemical stabilities of 8-coordinated SrO:Eu{sup 2+} phosphor in water. Obtained 8-coordinated SrO:Eu{sup 2+} phosphor exhibit strong blue luminescence and chemical stability in distilled water for 3 days. We found that the 8-coodrodinated SrO crystal structure changed to SrCO{sub 3} crystal structure after the 5 days immersion. The obtained SrO:Eu{sup 2+} phosphor possesses high chemical stability under water, compared with commercial (6-coordinated) SrO.

Komatsu, Keiji, E-mail: Keiji_Komatsu@mst.nagaokaut.ac.jp [Department of Material Science and Technology, Nagaoka University of Technology, 1603-1 Kamitomioka, Nagaoka, Niigata 940-2188 (Japan); Nakamura, Atsushi [Department of Material Science and Technology, Nagaoka University of Technology, 1603-1 Kamitomioka, Nagaoka, Niigata 940-2188 (Japan); Chubu Chelest Co. Ltd., 3-3-3 Hinagahigashi, Yokkaichi, Mie 510-0886 (Japan); Ohshio, Shigeo; Toda, Ikumi; Muramatsu, Hiroyuki; Saitoh, Hidetoshi [Department of Material Science and Technology, Nagaoka University of Technology, 1603-1 Kamitomioka, Nagaoka, Niigata 940-2188 (Japan)

2013-08-15T23:59:59.000Z

400

The Use of Geographic Information Systems to Model Habitat for Puma concolor cougar in the Northern Blue Ridge of Virginia  

E-Print Network (OSTI)

Geographic Information Systems (GIS) was used to predict suitable habitat for the eastern cougar (Puma concolor cougar) in the Northern Blue Ridge of Virginia. Two areas were studied, a primary area nested inside a secondary area. Objectives were...

Houser, Rhonda

2002-05-18T23:59:59.000Z

Note: This page contains sample records for the topic "blue ruthenium dimer" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


401

Characterization of chemical bath deposited CdS thin films doped with methylene blue and Er3+  

Science Journals Connector (OSTI)

The optical, electrical, and structural properties of CdS thin films grown by chemical bath deposition and simultaneously doped with methylene blue (MB) and Er3+ were studied. Doping was achieved by adding a c...

S. A. Toms; R. Lozada-Morales; O. Portillo

2008-01-01T23:59:59.000Z

402

Surface deacidification of ZSM5 by SiCl4 treatment: Assessment of surface specificity by methylene blue adsorption  

Science Journals Connector (OSTI)

A study has been made of ZSM5 zeolite deacidification (dealumination) by high temperature treatment in SiCl4 vapour, monitoring total acidity by Na+-exchange, and external surface acidity by methylene blue adsorp...

J. R. Anderson; Y. -F. Chang; A. E. Hughes

1989-01-01T23:59:59.000Z

403

The effect of nocturnal blue light exposure from light-emitting diodes on wakefulness and energy metabolism the following morning  

Science Journals Connector (OSTI)

The control of sleep/wakefulness is associated with the regulation of energy metabolism. The present experiment was designed to assess the effect of nocturnal blue light exposure on the control of sleep/wakefulne...

Momoko Kayaba; Kaito Iwayama; Hitomi Ogata

2014-09-01T23:59:59.000Z

404

Is blue optical filter necessary in high speed phosphor-based white light LED visible light communications?  

Science Journals Connector (OSTI)

Optical blue filter is usually regarded as a critical optical component for high speed phosphor-based white light emitting diode (LED) visible-light-communication (VLC). However, the...

Sung, Jiun-Yu; Chow, Chi-Wai; Yeh, Chien-Hung

2014-01-01T23:59:59.000Z

405

Three-body recombination of two-component cold atomic gases into deep dimers in an optical model  

E-Print Network (OSTI)

We consider three-body recombination into deep dimers in a mass-imbalanced two-component atomic gas. We use an optical model where a phenomenological imaginary potential is added to the lowest adiabatic hyper-spherical potential. The consequent imaginary part of the energy eigenvalue corresponds to the decay rate or recombination probability of the three-body system. The method is formulated in details and the relevant qualitative features are discussed as functions of scattering lengths and masses. We use zero-range model in analyses of recent recombination data. The dominating scattering length is usually related to the non-equal two-body systems. We account for temperature smearing which tends to wipe out the higher-lying Efimov peaks. The range and the strength of the imaginary potential determine positions and shapes of the Efimov peaks as well as the absolute value of the recombination rate. The Efimov scaling between recombination peaks is calculated and shown to depend on both scattering lengths. Reco...

Mikkelsen, M; Fedorov, D V; Zinner, N T

2015-01-01T23:59:59.000Z

406

A Twist-Bend Chiral Helix of 8nm Pitch in a Nematic Liquid Crystal of Achiral Molecular Dimers  

E-Print Network (OSTI)

Freeze Fracture Transmission Electron Microscopy (FFTEM) study of the nanoscale structure of the so-called "twist-bend" nematic (NX) phase of the cyanobiphenyl (CB) dimer molecule CB(CH2)7CB reveals a stripe texture of fluid layers periodically arrayed with a bulk spacing of d ~ 8.3 nm. Fluidity and a rigorously maintained spacing produce long-range-ordered fluid layered focal conic domains. Absence of a lamellar x-ray reflection at wavevector q ~ 2{\\pi}/8 nm-1 or its harmonics in synchrotron-based scattering experiments indicates that this periodic structure is achieved with no detectable associated modulation of the electron density, and thus has nematic molecular ordering. A search for periodic ordering with d ~ 8nm in CB(CH2)7CB using atomistic molecular dynamic computer simulation yielded equilibration of a conical twist-bend helixed nematic ground state, of the sort first proposed by Meyer, and envisioned in systems of bent molecules by Dozov and Memmer, We identify {\\theta} ~ 33 degree as the cone angle, and p ~ 8nm as the full pitch of the helix, the shortest ever found in a nematic fluid.

Dong Chen; Jan H. Porada; Justin B. Hooper; Arthur Klittnick; Yongqiang Shen; Eva Korblova; Dmitry Bedrov; David M. Walba; Matthew A. Glaser; Joseph E. Maclennan; Noel A. Clark

2013-06-24T23:59:59.000Z

407

Blue Cover  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Personnel Security and Access Control Information Systems DOE/IG-0651 June 2004 REPORT ON MANAGEMENT OF THE DEPARTMENT'S PERSONNEL SECURITY AND ACCESS CONTROL INFORMATION SYSTEMS TABLE OF CONTENTS Personnel Security and Physical Access Systems Details of Finding ............................................................ 1 Recommendations .......................................................... 4 Comments....................................................................... 5 Appendices 1. Objective, Scope, and Methodology .......................... 8 2. Prior Reports ........................................................... 10 3. Management Comments ......................................... 11 PERSONNEL SECURITY AND PHYSICAL ACCESS SYSTEMS

408

Blue Cover  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Retention and Management of Retention and Management of the Department's Records DOE/IG-0685 April 2005 REPORT ON THE RETENTION AND MANAGEMENT OF THE DEPARTMENT'S RECORDS_______ TABLE OF CONTENTS Retention and Management of the Department's Records Details of Finding............................................................. 1 Recommendations and Comments ................................. 6 Comments ....................................................................... 7 Appendices 1. Objective, Scope, and Methodology ........................ 11 2. Prior Reports............................................................ 13 3. Management Comments.......................................... 14 RETENTION AND MANAGEMENT OF THE DEPARTMENT'S RECORDS ________________________________________________________________

409

Blue - fern  

NLE Websites -- All DOE Office Websites (Extended Search)

fireplace, space heater, or free standing stove. A home with multiple electric heating systems A home with multiple heating systems and fuel types Extensive use of...

410

Blue Pork  

E-Print Network (OSTI)

Broadcast Transcript: The Chinese have a centuries-old love affair with pork. It constitutes 70% of the meat in their diet. Mao Zedong even called pork a "national treasure." However, that pork was the "the other white ...

Hacker, Randi; Boyd, David

2011-05-29T23:59:59.000Z

411

Calculation of two-centre two-electron integrals over Slater-type orbitals revisited. III. Case study of the beryllium dimer  

E-Print Network (OSTI)

In this paper we present results of ab-initio calculations for the beryllium dimer with basis set of Slater-type orbitals (STOs). Nonrelativistic interaction energy of the system is determined using the frozen-core full configuration interaction calculations combined with high-level coupled cluster correction for inner-shell effects. Newly developed STOs basis sets, ranging in quality from double to sextuple zeta, are used in these computations. Principles of their construction are discussed and several atomic benchmarks are presented. Relativistic effects of order ${\\alpha}^2$ are calculated perturbatively by using the Breit-Pauli Hamiltonian and are found to be significant. We also estimate the leading-order QED effects. Influence of the adiabatic correction is found to be negligible. Finally, the interaction energy of the beryllium dimer is determined to be 929.0$\\,\\pm\\,$1.9 $cm^{-1}$, in a very good agreement with the recent experimental value. The results presented here appear to be the most accurate ab-initio calculations for the beryllium dimer available in the literature up to date and probably also one of the most accurate calculations for molecular systems containing more than four electrons.

Micha? Lesiuk; Micha? Przybytek; Monika Musia?; Bogumi? Jeziorski; Robert Moszynski

2014-10-22T23:59:59.000Z

412

Lattice Boltzmann simulations of liquid crystalline fluids: active gels and blue phases  

E-Print Network (OSTI)

Lattice Boltzmann simulations have become a method of choice to solve the hydrodynamic equations of motion of a number of complex fluids. Here we review some recent applications of lattice Boltzmann to study the hydrodynamics of liquid crystalline materials. In particular, we focus on the study of (a) the exotic blue phases of cholesteric liquid crystals, and (b) active gels - a model system for actin plus myosin solutions or bacterial suspensions. In both cases lattice Boltzmann studies have proved useful to provide new insights into these complex materials.

M. E. Cates; O. Henrich; D. Marenduzzo; K. Stratford

2010-09-06T23:59:59.000Z

413

Blue photoluminescence in ZnGa{sub 2}O{sub 4} thin-film phosphors  

SciTech Connect

The growth and properties of luminescent ZnGa{sub 2}O{sub 4} thin films using pulsed laser ablation has been investigated. As-deposited films on glass and (100) MgO substrates exhibit blue-white photoluminescence with a broad emission band under ultraviolet excitation. In situ epitaxial films obtained on single crystal (100) MgO substrates possess enhanced luminescent intensity as compared to polycrystalline films on glass substrates. The enhanced luminescence in epitaxial films presumably reflects lower defect densities due to growth on low energy surfaces.

Lee, Yong Eui; Norton, David P.; Park, Chan; Rouleau, Christopher M.

2001-02-01T23:59:59.000Z

414

Variations on the Benzophenone Skeleton: Novel High Performance Blue Light Sensitive Photoinitiating Systems  

Science Journals Connector (OSTI)

One of them (BPD5) is particularly efficient for the cationic and radical photopolymerization of an epoxide/acrylate blend in a one-step hybrid cure and leads to the formation of an interpenetrated polymer network IPN upon the house hold blue LED bulb exposure (1 min for getting tack free coatings). ... The photochemical mechanisms are studied by molecular orbital calculations, fluorescence, cyclic voltammetry, laser flash photolysis, electron spin resonance spin trapping, and steady state photolysis techniques. ... Copper Complexes in Radical Photoinitiating Systems: Applications to Free Radical and Cationic Polymerization upon Visible LEDs ...

Pu Xiao; Frdric Dumur; Bernadette Graff; Didier Gigmes; Jean Pierre Fouassier; Jacques Laleve

2013-09-24T23:59:59.000Z

415

WiggleZ Dark Energy Survey: Cosmological neutrino mass constraint from blue high-redshift galaxies  

Science Journals Connector (OSTI)

The absolute neutrino mass scale is currently unknown, but can be constrained by cosmology. The WiggleZ high redshift, star-forming, and blue galaxy sample offers a complementary data set to previous surveys for performing these measurements, with potentially different systematics from nonlinear structure formation, redshift-space distortions, and galaxy bias. We obtain a limit of ?m?<0.60??eV (95% confidence) for WiggleZ+Wilkinson?Microwave?Anisotropy?Probe. Combining with priors on the Hubble parameter and the baryon acoustic oscillation scale gives ?m?<0.29??eV, which is the strongest neutrino mass constraint derived from spectroscopic galaxy redshift surveys.

Signe RiemerSrensen et al.

2012-04-23T23:59:59.000Z

416

New Family of Tiny Crystals Glow Bright in LED Lights | Advanced Photon  

NLE Websites -- All DOE Office Websites (Extended Search)

How Serotonin Receptors Can Shape Drug Effects, from LSD to Migraine How Serotonin Receptors Can Shape Drug Effects, from LSD to Migraine Medication X-rays Paint a Picture of Picasso's Pigments Antibody Evolution Could Guide HIV Vaccine Development Blue Ruthenium Dimer Catalysis for Hydrogen Generation A High-Pressure Nano-imaging Breakthrough Science Highlights Archives: 2013 | 2012 | 2011 | 2010 2009 | 2008 | 2007 | 2006 2005 | 2004 | 2003 | 2002 2001 | 2000 | 1998 | Subscribe to APS Science Highlights rss feed New Family of Tiny Crystals Glow Bright in LED Lights JUNE 7, 2013 Bookmark and Share Laue microdiffraction pattern acquired from a nanoribbon in experiments at the APS. Minuscule crystals that glow different colors may be the missing ingredient for white light-emitting diode (LED) lighting that illuminates homes and

417

Electronic structure and reactivity in water splitting of the iron oxide dimers and their hexacarbonyls: A density functional study  

SciTech Connect

The iron oxide dimers (FeO){sub 2} and their peroxide isomers are studied with the B3LYP density functional as bare clusters and as hexacarbonyls. Among the bare clusters the planar four-member ring structures are more stable than the non-planar ones and the rhombic dioxide Fe{sub 2}O{sub 2} with antiferromagnetically ordered electrons on iron centers is the global minimum. Water adsorption on the bare diiron dioxide is exothermic, but dissociation does not occur. Carbonylation favors a non-planar Fe{sub 2}O{sub 2} ring for both the dioxides and the peroxides and high electron density at the Fe centers is induced, evidenced by the natural charge distribution, the high proton affinity, and the values of global electronegativity and hardness. The iron dioxide hexacarbonyl Fe{sub 2}O{sub 2}(CO){sub 6} is diamagnetic in the state of the global minimum. It is separated from the next low-lying triplet state by a small energy gap of 0.22 eV. Time-dependent density functional theory methods were applied to examine electron excitations from the ground state to the low-lying triplet states in the hexacarbonyls and their adsorption complexes with water. Singlet-to-triplet state excitations occur via ligand-to-metal charge transfer in the hexacarbonyls; in the adsorption complexes excitations from the oxygen lone pairs to the adsorption center also occur and they appear in the IR-visible region. The lowest energy singlet and triplet state reaction paths for water splitting were followed. On the singlet potential energy surface (PES), water splitting is spontaneous, while for the triplet PES an activation barrier of 14.1 kJ mol{sup ?1} was determined.

Uzunova, Ellie L., E-mail: ellie@svr.igic.bas.bg [Institute of General and Inorganic Chemistry, Bulgarian Academy of Sciences, Sofia 1113 (Bulgaria); Mikosch, Hans [Institute for Chemical Technologies and Analytics, Vienna University of Technology, Getreidemarkt 9/E164-EC, 1060 Vienna (Austria)] [Institute for Chemical Technologies and Analytics, Vienna University of Technology, Getreidemarkt 9/E164-EC, 1060 Vienna (Austria)

2014-01-14T23:59:59.000Z

418

Preliminary investigation of mixed adsorbents for the removal of copper and methylene blue from aqueous solutions  

Science Journals Connector (OSTI)

Abstract With most recent studies being focused on the development of advanced chemical adsorbents, this paper investigates the possibility of using two natural low-cost materials for selective adsorption. Multi-adsorbent systems containing tea waste (TW) and dolomite (DO) have been tested for their effectiveness in the removal of copper and methylene blue from aqueous solutions. The effects of contact time, solution pH and adsorption isotherms on the sorption behaviour were investigated. The Langmuir and Freundlich isotherms adequately described the adsorption of copper ions and methylene blue by both materials in different systems. The highest adsorption capacities for Cu and MB were calculated as 237.7mg/g at pH 4.5 and 150.4mg/g at pH 7 for DO and TW:DO respectively. Tea waste and dolomite were characterised by Fourier transform infrared spectroscopy, scanning electron microscopy and Energy dispersive X-ray analysis. The removal of Cu and MB by dolomite was mainly via surface complexation while physisorption was responsible for most of the Cu and MB adsorption onto tea waste. Identifying the fundamental mechanisms and behaviour is a key to the development of practical multi-adsorbent packed columns.

Ahmad B. Albadarin; Jiabin Mo; Yoann Glocheux; Stephen Allen; Gavin Walker; Chirangano Mangwandi

2014-01-01T23:59:59.000Z

419

Radio--Far infrared correlation in "blue cloud" galaxies with 0  

E-Print Network (OSTI)

We study the radio--far infrared (FIR) correlation in "blue cloud" galaxies chosen from the PRism MUltiobject Survey (PRIMUS) up to redshift ($z$) of 1.2 in the XMM-LSS field. We use rest-frame emission at 1.4 GHz in the radio and both monochromatic (at 70$\\mu$m) and bolometric (between $8-1000~\\mu$m) emission in the FIR. To probe the nature of the correlation up to $z\\sim1.2$, where direct detection of blue star-forming galaxies is impossible with current technology, we employ the technique of image stacking at 0.325 and 1.4 GHz in the radio and in six infrared bands, viz. 24, 70, 160, 250, 350 and $500~\\mu$m. For comparison, we also study the correlation for more luminous galaxies that are directly detected. The stacking analysis allows us to probe the radio--FIR correlation for galaxies that are up to 2 orders of magnitude fainter than the ones detected directly. The $k-$correction in the infrared wavebands is obtained by fitting the observed spectral energy distribution (SED) with a composite mid-IR power...

Basu, Aritra; Beelen, Alexandre; Singh, Veeresh; Archana, K N; Sirothia, Sandeep; Ishwara-Chandra, C H

2015-01-01T23:59:59.000Z

420

Phosphine Oxide Based Electron Transporting and Hole Blocking Materials for Blue Electrophosphorescent Organic Light Emitting Devices  

SciTech Connect

We report the design, synthesis, thermal, and photophysical properties of two phosphine oxide based electron transport/hole blocking materials, 2,6-bis(4-(diphenylphosphoryl)phenyl)pyridine (BM-A11) and 2,4-bis(4-(diphenyl-phosphoryl)phenyl)pyridine (BM-A10) for blue electrophosphorescent organic light emitting devices (OLEDs). The use of these materials in blue OLED with iridium (III) bis[(4,6-difluorophenyl)-pyridinato-N,C2]picolinate (Firpic) as the phosphor was demonstrated. Using the dual host device architecture with BM-A10 as the ETM yields a maximum EQE of 8.9% with a power efficiency of 21.5 lm/W (4.0V and 35 cd/m2). When BM-A11 is used as the ETM, the maximum EQE and power efficiency improves to 14.9% and 48.4 lm/W, respectively (3.0V and 40 cd/m2).

Von Ruden, Amber L.; Cosimbescu, Lelia; Polikarpov, Evgueni; Koech, Phillip K.; Swensen, James S.; Wang, Liang; Darsell, Jens T.; Padmaperuma, Asanga B.

2010-10-26T23:59:59.000Z

Note: This page contains sample records for the topic "blue ruthenium dimer" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


421

Highly efficient blue OLEDs based on diphenylaminofluorenylstyrenes end-capped with heterocyclic aromatics  

SciTech Connect

In this paper, we have designed four diphenylaminofluorenylstyrene derivatives end-capped with heterocyclic aromatic groups, such as 9-phenylcabazole, 4-dibenzofuran, 2-benzoxazole, 2-quinoxaline, respectively. These materials showed blue to red fluorescence with maximum emission wavelengths of 476611 nm, respectively, which were dependent on the structural and electronic nature of end-capping groups. To explore the electroluminescent properties of these materials, multilayer OLEDs were fabricated in the following sequence: ITO/DNTPD (40 nm)/NPB (20 nm)/2% doped in MADN (20 nm)/Alq{sub 3} (40 nm)/Liq. (1 nm)/Al. Among those, a device exhibited a highly efficient blue emission with the maximum luminance of 14,480 cd/m{sup 2} at 9 V, the luminous efficiency of 5.38 cd/A at 20 mA/cm{sup 2}, power efficiency of 2.77 lm/W at 20 mA/cm{sup 2}, and CIE{sub x,y} coordinates of (0.147, 0.152) at 8 V, respectively.

Oh, Suhyun [Department of Chemistry, Sungkyunkwan University, Suwon 440-746 (Korea, Republic of)] [Department of Chemistry, Sungkyunkwan University, Suwon 440-746 (Korea, Republic of); Lee, Kum Hee; Kim, Young Kwan [Department of Information Display, Hongik University, Seoul 121-791 (Korea, Republic of)] [Department of Information Display, Hongik University, Seoul 121-791 (Korea, Republic of); Yoon, Seung Soo, E-mail: ssyoon@skku.edu [Department of Chemistry, Sungkyunkwan University, Suwon 440-746 (Korea, Republic of)

2012-10-15T23:59:59.000Z

422

THE CHEMICAL COMPOSITIONS OF NON-VARIABLE RED AND BLUE FIELD HORIZONTAL BRANCH STARS  

SciTech Connect

We present a new detailed abundance study of field red horizontal branch (RHB) and blue horizontal branch (BHB) non-variable stars. High resolution and high signal-to-noise ratio echelle spectra of 11 RHB and 12 BHB were obtained with the McDonald 2.7 m telescope, and the RHB sample was augmented by reanalysis of spectra of 25 stars from a recent survey. We derived stellar atmospheric parameters based on spectroscopic constraints and computed relative abundance ratios for 24 species of 19 elements. The species include Si II and Ca II, which have not been previously studied in RHB and BHB (T{sub eff} < 9000 K) stars. The abundance ratios are generally consistent with those of similar-metallicity field stars in different evolutionary stages. We estimated the masses of the RHB and BHB stars by comparing their T{sub eff}-log g positions with HB model evolutionary tracks. The mass distribution suggests that our program stars possess masses of {approx}0.5 M{sub sun}. Finally, we compared the temperature distributions of field RHB and BHB stars with field RR Lyraes in the metallicity range -0.8{approx}> [Fe/H] {approx}>-2.5. This yielded effective temperature estimates of 5900 K and 7400 K for the red and blue edges of the RR Lyrae instability strip.

For Biqing; Sneden, Christopher, E-mail: biqing@astro.as.utexas.ed [Department of Astronomy, University of Texas, Austin, TX 78712 (United States)

2010-12-15T23:59:59.000Z

423

Early mucosal responses in blue catfish (Ictalurus furcatus) skin to Aeromonas hydrophila infection  

Science Journals Connector (OSTI)

Bacterial pathogens are well-equipped to detect, adhere to, and initiate infection in their finfish hosts. The mucosal surfaces of fish, such as the skin, function as the front line of defense against such bacterial insults that are routinely encountered in the aquatic environment. While recent progress has been made, and despite the obvious importance of mucosal surfaces, the precise molecular events that occur soon after encountering bacterial pathogens remain unclear. Indeed, these early events are critical in mounting appropriate responses that ultimately determine host survival or death. In the present study, we investigated the transcriptional consequences of a virulent Aeromonas hydrophila challenge in the skin of blue catfish, Ictalurus furcatus. We utilized an 860K Agilent microarray to examine gene expression profiles at key early timepoints following challenge (2h, 12h, and 24h). A total of 1155 unique genes were significantly altered during at least one timepoint. We observed dysregulation in a number of genes involved in diverse pathways including those involved in antioxidant responses, apoptosis, cytoskeletal rearrangement, immunity, and extracellular matrix protein diversity and regulation. Taken together, A.hydrophila coordinately modulates mucosal factors across numerous cellular pathways in a manner predicted to enhance its ability to adhere to and infect the blue catfish host.

Chao Li; Benjamin Beck; Baofeng Su; Jeffery Terhune; Eric Peatman

2013-01-01T23:59:59.000Z

424

The Nature of Nearby Counterparts to Intermediate Redshift Luminous Compact Blue Galaxies II. CO Observations  

E-Print Network (OSTI)

We present the results of a single-dish beam-matched survey of the three lowest rotational transitions of CO in a sample of 20 local (D < 70 Mpc) Luminous Compact Blue Galaxies (LCBGs). These ~L*, blue, high surface brightness, starbursting galaxies were selected with the same criteria used to define LCBGs at higher redshifts. Our detection rate was 70%, with those galaxies having Lblue<7e9 Lsun no detected. We find the H2 masses of local LCBGs range from 6.6e6 to 2.7e9 Msun, assuming a Galactic CO-to-H2 conversion factor. Combining these results with our earlier HI survey of the same sample, we find that the ratio of molecular to atomic gas mass is low, typically 5-10%. Using a Large Velocity Gradient model, we find that the average gas conditions of the entire ISM in local LCBGs are similar to those found in the centers of star forming regions in our Galaxy, and nuclear regions of other galaxies. Star formation rates, determined from IRAS fluxes, are a few solar masses per year, much higher per unit dynamical mass than normal spirals. If this rate remains constant, the molecular hydrogen depletion time scales are short, 10-200 Myr.

C. A. Garland; J. P. Williams; D. J. Pisano; R. Guzman; F. J. Castander; J. Brinkmann

2005-02-03T23:59:59.000Z

425

Microsoft Word - BlueMountainGeotherm_FONSI_FinalDrft v3 Clean_4-26-10 Clean  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

BLUE MOUNTAIN BLUE MOUNTAIN GEOTHERMAL DEVELOPMENT PROJECT HUMBOLDT COUNTY, NEVADA PERSHING COUNTY, NEVADA DECEMBER 2007 EA NUMBER: NV-020-08-01 Lead Agency: BUREAU OF LAND MANAGEMENT Winnemucca Field Office 5100 E. Winnemucca Blvd. Winnemucca, Nevada 89445 Project Applicant: NEVADA GEOTHERMAL POWER COMPANY 900-409 Granville Street Vancouver, BC V6C 1T2 It is the mission of the Bureau of Land Management to sustain the health, diversity, and productivity of the public lands for the use and enjoyment of present and future generations. BLM·NV·WN·ES·OB·01·1310 NV·020-08-EA-Ol ENVIRONMENTAL ASSESSMENT BLUE MOUNTAIN GEOTHERMAL DEVELOPMENT PROJECT TABLE OF CONTENTS Page LIST OF TABLES ........................................................................................................................ IV

426

Carbazolyldibenzofuran-type high-triplet-energy bipolar host material for blue phosphorescent organic light-emitting diodes  

Science Journals Connector (OSTI)

Abstract A high-triplet-energy material, 9?-(4,4?-(phenylphosphoryl)bis(dibenzo[b,d]furan-6,2-diyl))bis(9H-carbazole) (44DFCzPO), was synthesized as a bipolar host material for blue phosphorescent organic light-emitting diodes (PHOLEDs). 44DFCzPO was synthesized by the selective lithiation of the 4-position of a carbazole-modified dibenzofuran, followed by phosphorylation. 44DFCzPO showed a high triplet energy of 2.91eV for energy transfer to a blue phosphorescent dopant, and bipolar charge transport properties for balanced hole and electron density in the emitting layer. A high quantum efficiency of 16.7% at a low doping concentration of 3% was obtained using 44DFCzPO as the host in blue PHOLEDs.

Sook Hee Jeong; Jun Yeob Lee

2014-01-01T23:59:59.000Z

427

High triplet energy Al complex as a host material for blue phosphorescent organic light-emitting diodes  

Science Journals Connector (OSTI)

Abstract An Al complex, tris((2-(pyrazol-1-yl)pyridin-3-yl)oxy)aluminum (Al(pypy)3), was synthesized as a high triplet energy host material for blue phosphorescent organic light-emitting diodes. A high triplet energy ligand, 2-(1H-pyrazol-1-yl)pyridin-3-ol, was coordinated to the Al to develop the high triplet energy host material derived from Al. The Al(pypy)3 host showed a high triplet energy of 2.86eV for efficient energy transfer to blue triplet emitter. A maximum quantum efficiency of 20.5% was achieved in blue device using the Al(pypy)3 host material.

Chan Seok Oh; Jun Yeob Lee

2014-01-01T23:59:59.000Z

428

An indole derivative as a high triplet energy hole transport material for blue phosphorescent organic light-emitting diodes  

Science Journals Connector (OSTI)

Abstract A thermally stable high triplet energy material derived from an indoloacridine core and indole hole transport units, 8,8-bis(4-(1H-indol-1-yl)phenyl)-8H-indolo[3,2,1-de]acridine (BIPIA), was synthesized as the hole transport material for deep blue phosphorescent organic light-emitting diodes. The BIPIA hole transport material showed a high triplet energy of 2.95eV and high glass transition temperature of 142C. A high quantum efficiency of 19.3% was obtained in the deep blue device using BIPIA as the high triplet energy hole transport material.

Min Su Park; Jun Yeob Lee

2013-01-01T23:59:59.000Z

429

Design of an efficient single photon source from a metallic nanorod dimer: a quasinormal mode finite-difference time-domain approach  

E-Print Network (OSTI)

We describe how the finite-difference time-domain (FDTD) technique can be used to compute the quasinormal mode (QNM) for metallic nano-resonators, which is important for describing and understanding light-matter interactions in nanoplasmonics. We use the QNM to model the enhanced spontaneous emission rate for dipole emitters near a gold nanorod dimer structure using a newly developed QNM expansion technique. Significant enhanced photon emission factors of around 1500 are obtained with large output $\\beta$-factors of about $60\\%$.

Ge, Rong-Chun

2015-01-01T23:59:59.000Z

430

PSI # Date Time Location Incident Description Disposition 4705 4/1/2012 14:20 Blue Ridge Theft By Unlawful Taking Blue Northwoods Bel Aire bicycle stolen BPD Notified  

E-Print Network (OSTI)

By Unlawful Taking Blue Northwoods Bel Aire bicycle stolen BPD Notified 4706 4/2/2012 9:52 Kentucky Hall/2/2012 12:33 Dana Hall Theft By Unlawful Taking Red and silver bicycle stolen BPD Notified 4708 4/2/2012 17

Baltisberger, Jay H.

431

Blue Ridge Mountain E M C (North Carolina) | Open Energy Information  

Open Energy Info (EERE)

Mountain E M C (North Carolina) Mountain E M C (North Carolina) Jump to: navigation, search Name Blue Ridge Mountain E M C Place North Carolina Utility Id 1891 References EIA Form EIA-861 Final Data File for 2010 - File2_2010[1] LinkedIn Connections CrunchBase Profile No CrunchBase profile. Create one now! This article is a stub. You can help OpenEI by expanding it. Utility Rate Schedules Grid-background.png General Power Rate (GSA 1) Commercial General Power Rate (GSA 2)* Commercial General Power Rate (GSA 3)* Industrial Outdoor Lighting HPS 100 W Lighting Outdoor Lighting HPS 250 W Lighting Outdoor Lighting MV 175 W Lighting Outdoor Lighting MV 400 W Lighting Residential Residential Average Rates Residential: $0.1100/kWh Commercial: $0.1340/kWh References ↑ "EIA Form EIA-861 Final Data File for 2010 - File2_2010"

432

The Time Needed to Implement the Blue Ribbon Commission Recommendation on Interim Storage - 13124  

SciTech Connect

The report of the Blue Ribbon Commission on America's Nuclear Future [1] makes a number of important recommendations to be considered if Congress elects to redirect U.S. high-level radioactive waste disposal policy. Setting aside for the purposes of this discussion any issues related to political forces leading to stopping progress on the Yucca Mountain project and driving the creation of the Commission, an important recommendation of the Commission was to institute prompt efforts to develop one or more consolidated storage facilities. The Blue Ribbon Commission noted that this recommended strategy for future storage and disposal facilities and operations should be implemented regardless of what happens with Yucca Mountain. It is too easy, however, to focus on interim storage as an alternative to geologic disposal. The Blue Ribbon Commission report does not go far enough in addressing the magnitude of the contentious problems associated with reopening the issues of relative authorities of the states and federal government with which Congress wrestled in crafting the Nuclear Waste Policy Act [2]. The Blue Ribbon Commission recommendation for prompt adoption of an interim storage program does not appear to be fully informed about the actions that must be taken, the relative cost of the effort, or the realistic time line that would be involved. In essence, the recommendation leaves to others the details of the systems engineering analyses needed to understand the nature and details of all the operations required to reach an operational interim storage facility without derailing forever the true end goal of geologic disposal. The material presented identifies a number of impediments that must be overcome before the country could develop a centralized federal interim storage facility. In summary, and in the order presented, they are: 1. Change the law, HJR 87, PL 107-200, designating Yucca Mountain for the development of a repository. 2. Bring new nuclear waste legislation to the floor of the Senate, overcoming existing House support for Yucca Mountain; 3. Change the longstanding focus of Congress from disposal to storage; 4. Change the funding concepts embodied in the Nuclear Waste Policy Act to allow the Nuclear Waste fund to be used to pay for interim storage; 5. Reverse the Congressional policy not to give states or tribes veto or consent authority, and to reserve to Congress the authority to override a state or tribal disapproval; 6. Promulgate interim storage facility siting regulations to reflect the new policies after such changes to policy and law; 7. Complete already underway changes to storage and transportation regulations, possibly incorporating changes to reflect changes to waste disposal law; 8. Promulgate new repository siting regulations if the interim storage facility is to support repository development; 9. Identify volunteer sites, negotiate agreements, and get Congressional approval for negotiated benefits packages; 10. Design, License and develop the interim storage facility. The time required to accomplish these ten items depends on many factors. The estimate developed assumes that certain of the items must be completed before other items are started; given past criticisms of the current program, such an assumption appears appropriate. Estimated times for completion of individual items are based on historical precedent. (authors)

Voegele, Michael D. [Consultant, Nye County Nuclear Waste Repository Project Office, 7404 Oak Grove Ave, Las Vegas, NV 89117 (United States)] [Consultant, Nye County Nuclear Waste Repository Project Office, 7404 Oak Grove Ave, Las Vegas, NV 89117 (United States); Vieth, Donald [1154 Chelttenham Place, Maineville, OH 45039 (United States)] [1154 Chelttenham Place, Maineville, OH 45039 (United States)

2013-07-01T23:59:59.000Z

433

Blue-enhanced thin-film photodiode for dual-screen x-ray imaging  

SciTech Connect

This article reports on a-Si:H-based low-leakage blue-enhanced photodiodes for dual-screen x-ray imaging detectors. Doped nanocrystalline silicon was incorporated in both the n- and p-type regions to reduce absorption losses for light incoming from the top and bottom screens. The photodiode exhibits a dark current density of 900 pA/cm{sup 2} and an external quantum efficiency up to 90% at a reverse bias of 5 V. In the case of illumination through the tailored p-layer, the quantum efficiency of 60% at a 400 nm wavelength is almost double that for the conventional a-Si:H n-i-p photodiode.

Vygranenko, Y.; Vieira, M. [Department of Electronics, Telecommunications and Computer Engineering, ISEL, Lisbon 1949-014 (Portugal); Sazonov, A. [Electrical and Computer Engineering, University of Waterloo, Waterloo N2L 3G1 (Canada); Heiler, G.; Tredwell, T. [Carestream Health, Inc., Rochester, New York 14652-3487 (United States); Nathan, A. [London Centre for Nanotechnology, University College London, London WC1H 0AH (United Kingdom)

2009-12-28T23:59:59.000Z

434

Striking Photospheric Abundance Anomalies in Blue Horizontal-Branch Stars in Globular Cluster M13  

E-Print Network (OSTI)

High-resolution optical spectra of thirteen blue horizontal-branch (BHB) stars in the globular cluster M13 show enormous deviations in element abundances from the expected cluster metallicity. In the hotter stars (T_eff > 12000 K), helium is depleted by factors of 10 to 100 below solar, while iron is enhanced to three times the solar abundance, two orders of magnitude above the canonical metallicity [Fe/H] ~= -1.5 dex for this globular cluster. Nitrogen, phosphorus, and chromium exhibit even more pronounced enhancements, and other metals are also mildly overabundant, with the exception of magnesium, which stays very near the expected cluster metallicity. These photospheric anomalies are most likely due to diffusion --- gravitational settling of helium, and radiative levitation of the other elements --- in the stable radiative atmospheres of these hot stars. The effects of these mechanisms may have some impact on the photometric morphology of the cluster's horizontal branch and on estimates of its age and distance.

Bradford B. Behr; Judith G. Cohen; James K. McCarthy; S. George Djorgovski

1999-03-29T23:59:59.000Z

435

Clover Action for Blue Gene-Q and Iterative solvers for DWF  

E-Print Network (OSTI)

In Lattice QCD, a major challenge in simulating physical quarks is the computational complexity of these simulations. In this proceeding, we describe the optimisation of Clover fermion action for Blue gene-Q architecture and how different iterative solvers behave for Domain Wall Fermion action. We find that the optimised Clover term achieved a maximum efficiency of 29.1% and 20.2% for single and double precision respectively for iterative Conjugate Gradient solver. For Domain Wall Fermion action (DWF) we found that Modified Conjugate Residual(MCR) as the most efficient solver compared to CG and GCR. We have developed a new multi-shift MCR algorithm that is 18.5% faster compared to multi-shift CG for the evaluation of rational functions in RHMC.

Karthee Sivalingam; Peter Boyle

2014-08-28T23:59:59.000Z

436

Stacked white OLED having separate red, green and blue sub-elements  

DOE Patents (OSTI)

The present invention relates to efficient organic light emitting devices (OLEDs). The devices employ three emissive sub-elements, typically emitting red, green and blue, to sufficiently cover the visible spectrum. Thus, the devices may be white-emitting OLEDs, or WOLEDs. Each sub-element comprises at least one organic layer which is an emissive layer--i.e., the layer is capable of emitting light when a voltage is applied across the stacked device. The sub-elements are vertically stacked and are separated by charge generating layers. The charge-generating layers are layers that inject charge carriers into the adjacent layer(s) but do not have a direct external connection.

Forrest, Stephen; Qi, Xiangfei; Slootsky, Michael

2014-07-01T23:59:59.000Z

437

Responses of supplemental blue light on flowering and stem extension growth of cut chrysanthemum  

Science Journals Connector (OSTI)

Abstract To determine the effects of blue (B) spectrum supplemental lighting on flower bud formation and stem elongation growth of cut chrysanthemum, plants of Zembla cultivar were grown for 42 days under 4 different light treatments. Treatments comprised: RB (11h of mixed red and blue [RB] light), RB+B (11h of mixed RB light and then 4h of supplemental B light), LRB+B (15h of mixed RB light and then 4h of supplemental B light) and RB+LB (11h of mixed RB light and then 13h of B light) by using light-emitting diodes. Diurnal patterns in the net assimilation rate were observed, depending on light-quality combinations. Under mixed RB light, the net assimilation rate increased rapidly, then slightly decreased under B light, and finally dropped to negative values during darkness. Final stem length was the highest in plants grown under RB+LB, followed by LRB+B, RB+B and then RB treatment. The stem lengths under RB+B, LRB+B and RB+LB were 1.3, 1.5 and 1.7 times longer than that of RB treatment, respectively. However, fully developed flower buds were formed under RB and RB+B treatments only. The extended final stem length of RB+B plants was determined by internode extension. Overall, our results indicate that supplemental B light, at least in part, may promote stem and internode elongation growth without any inhibitory effect on flower bud formation. The results of this study present a useful practical technique for optimizing cut chrysanthemum production in greenhouse horticulture.

Sung Woo Jeong; Sander W. Hogewoning; Wim van Ieperen

2014-01-01T23:59:59.000Z

438

A study on full color organic light emitting diodes with blue common layer under the patterned emission layer  

Science Journals Connector (OSTI)

Abstract Color patterning steps for red, green, and blue emission layers (EMLs) are crucial for the production of full color organic light-emitting diodes (OLEDs). The most common method to form individually patterned \\{EMLs\\} is to use a shadow mask as the key component for patterning. However, most pixel defects are caused by such kinds of patterning steps. Therefore, skipping certain color patterning steps could significantly improve the production yield during the fine metal masking process in the OLED fabrication. A representative example of such approach is the top blue common layer (TBCL) structure with a non-patterned BCL on top of both green and red EMLs. However, this structure could cause blue color mixing in green or red devices. To prevent this effect, we propose a newly devised bottom BCL (BBCL) structure with the BCL that is totally separated from both green and red EMLs. In particular, we utilized 1,4,5,8,9,11-hexaazatriphenylene-hexacarbonitrile interlayer (7nm) between the underlying BCL and the hole injection layer to completely extinguish blue emission. As a result, both green and red devices with the BBCL structure showed relatively better efficiencies compared to those with the TBCL structure without any color mixing.

Hee Young Shin; Min Chul Suh

2014-01-01T23:59:59.000Z

439

De novo design and spectroscopic characterization of Cu(II)-binding peptides based upon the blue copper protein plastocyanin  

E-Print Network (OSTI)

-Cu(II) reduction potentials have been measured to be + 62 mV vs. NHE for BCP-A-Cu(II) and -11 mV vs. NHE for BCP-B-Cu(II). The observed redox potentials fit a trend observed for the blue copper proteins, as the axial interactions are increased the reduction...

Daugherty, Roxanne Gail

2002-01-01T23:59:59.000Z

440

The WiggleZ Dark Energy Survey: direct constraints on blue galaxy intrinsic alignments at intermediate redshifts  

Science Journals Connector (OSTI)

......research-article Papers The WiggleZ Dark Energy Survey: direct constraints on blue...spectroscopic redshifts from the WiggleZ Dark Energy Survey. Our null detection allows...shape measurements, the WiggleZ Dark Energy Survey (Drinkwater et al. 2010......

Rachel Mandelbaum; Chris Blake; Sarah Bridle; Filipe B. Abdalla; Sarah Brough; Matthew Colless; Warrick Couch; Scott Croom; Tamara Davis; Michael J. Drinkwater; Karl Forster; Karl Glazebrook; Ben Jelliffe; Russell J. Jurek; I-hui Li; Barry Madore; Chris Martin; Kevin Pimbblet; Gregory B. Poole; Michael Pracy; Rob Sharp; Emily Wisnioski; David Woods; Ted Wyder

2011-01-11T23:59:59.000Z

Note: This page contains sample records for the topic "blue ruthenium dimer" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


441

Synthesis and properties of Sr2CeO4 blue emission powder phosphor for field emission displays  

E-Print Network (OSTI)

for publication 19 January 1999 A blue emission powder phosphor Sr2CeO4 for field emission displays was preparedV. The emission peak of this phosphor is at 470 nm and Commission International de l'Eclairage coordinates are x 0

Wang, Zhong L.

442

High power single-crystal fiber CW 946 nm laser and blue generation based on Rubidium-doped PPKTP  

E-Print Network (OSTI)

for high power, continuous wave and polarized laser at 946 nm (fig1.c). We demonstrate a polarized laser. Laurell, "High-power, continous-wave, second harmonic generation at 532 nm in periodically poled KTiOPO4(b)(a) (c) High power single-crystal fiber CW 946 nm laser and blue generation based on Rubidium

Boyer, Edmond

443

Large-Scale Electronic Structure Calculations of High-Z Metals on the BlueGene/L Platform  

E-Print Network (OSTI)

Large-Scale Electronic Structure Calculations of High-Z Metals on the BlueGene/L Platform Francois-accuracy electronic structure calculations needed to evaluate the energy of isolated defects. Such calculations cell. This in turn implies that a large number of valence electrons must be included in the calculation

Franchetti, Franz

444

Calculation of two-centre two-electron integrals over Slater-type orbitals revisited. III. Case study of the beryllium dimer  

E-Print Network (OSTI)

In this paper we present results of ab-initio calculations for the beryllium dimer with basis set of Slater-type orbitals (STOs). Nonrelativistic interaction energy of the system is determined using the frozen-core full configuration interaction calculations combined with high-level coupled cluster correction for inner-shell effects. Newly developed STOs basis sets, ranging in quality from double to sextuple zeta, are used in these computations. Principles of their construction are discussed and several atomic benchmarks are presented. Relativistic effects of order ${\\alpha}^2$ are calculated perturbatively by using the Breit-Pauli Hamiltonian and are found to be significant. We also estimate the leading-order QED effects. Influence of the adiabatic correction is found to be negligible. Finally, the interaction energy of the beryllium dimer is determined to be 929.0$\\,\\pm\\,$1.9 $cm^{-1}$, in a very good agreement with the recent experimental value. The results presented here appear to be the most accurate ab-...

Lesiuk, Micha?; Musia?, Monika; Jeziorski, Bogumi?; Moszynski, Robert

2014-01-01T23:59:59.000Z

445

-stacking and C-XD (X = H, NO2; D = O, ) interactions in the crystal network of both C-HN and -stacked dimers of 1,2-bis(4-bromophenyl)-1H-benzimidazole and 2-(4-bromophenyl)-1-(4-nitrophenyl)-1H-benzimidazole  

Science Journals Connector (OSTI)

Molecules of two substituted 1H-benzimidazoles are arranged in dimeric units through C-HN and parallel-displaced -stacking interactions. The molecular packing of the dimers arises by the concurrence of a diverse set of weak intermolecular C-XD (X = H, NO2; D = O, ) interactions.

Gonz?lez-Padilla, J.E.

2013-12-21T23:59:59.000Z

446

In Vivo Flow Cytometry: A New Method for Enumerating Circulating Cancer Cells  

Science Journals Connector (OSTI)

...250-300 mum in diameter) has Ruthenium-III-(Tris)-chloride embedded in silicone polymer. It has a blue light-emitting diode that generates light pulses to induce fluorescence from the ruthenium luminophor. The oximetry is based on the...

Irene Georgakoudi; Nicolas Solban; John Novak; William L. Rice; Xunbin Wei; Tayyaba Hasan; Charles P. Lin

2004-08-01T23:59:59.000Z

447

Mechanistic Investigation and Implications of Photodynamic Therapy Induction of Vascular Endothelial Growth Factor in Prostate Cancer  

Science Journals Connector (OSTI)

...250-300 mum in diameter) has Ruthenium-III-(Tris)-chloride embedded in silicone polymer. It has a blue light-emitting diode that generates light pulses to induce fluorescence from the ruthenium luminophor. The oximetry is based on the...

Nicolas Solban; Selbo K. Pl; Sinha K. Alok; Chang K. Sung; Tayyaba Hasan

2006-06-01T23:59:59.000Z

448

Electron Paramagnetic Resonance Oxygen Images Correlate Spatially and Quantitatively with Oxylite Oxygen Measurements  

Science Journals Connector (OSTI)

...250-300 mum in diameter) has Ruthenium-III-(Tris)-chloride embedded in silicone polymer. It has a blue light-emitting diode that generates light pulses to induce fluorescence from the ruthenium luminophor. The oximetry is based on the...

Martyna Elas; Kang-Hyun Ahn; Adrian Parasca; Eugene D. Barth; David Lee; Chad Haney; Howard J. Halpern

2006-07-15T23:59:59.000Z

449

PCB and mercury contamination in great blue heron chicks associated with the Oak Ridge Reservation  

SciTech Connect

The great blue heron (Ardea herodias) has been selected as an environmental indicator by the Oak Ridge National Laboratory as a component of remedial investigation. Chicks were collected from four colonies from 1992 through 1994. Tissues from these chicks were analyzed to determine if PCB and mercury concentrations differed between colonies located on the Oak Ridge Reservation (ORR) and colonies located off the ORR. Chicks on the ORR contained significantly greater concentrations of PCBs in liver (P = 0.015), muscle (P = 0.060), and fat (P = 0.011) tissue compared to those collected off the ORR. Mercury concentrations also were significantly greater in liver (P = 0.025) and feather (P = 0.001) tissue collected from on-ORR chicks compared to concentrations in chicks collected off the ORR. The K-25 colony, located adjacent to the K-25 Gaseous Diffusion Plant, had significantly greater concentrations of PCBs in fat and mercury in feathers (P < 0.05) compared to the Melton Hill colony also located on the ORR. These results suggest that herons nesting adjacent to K-25 are exposed to elevated concentrations of PCBs and mercury, however, preliminary analysis of reproductive data suggests that these contaminant concentrations do not effect fecundity. The authors feel that further monitoring of these colonies is warranted in order to determine the effectiveness of remedial action.

Brewer, R.; Buehler, D. [Univ. of Tennessee, Knoxville, TN (United States); Halbrook, R. [Oak Ridge National Lab., TN (United States)

1995-12-31T23:59:59.000Z

450

Internal Alignments of Red Versus Blue Discs in Dark Matter Halos  

E-Print Network (OSTI)

Large surveys have shown that red galaxies are preferentially aligned with their halos while blue galaxies have a more isotropic distribution. Since halos generally align with their filaments this introduces a bias in the measurement of the cosmic shear from weak lensing. It is therefore vitally important to understand why this difference arises. We explore the stability of different disc orientations within triaxial halos. We show that, in the absence of gas, the disc orientation is most stable when its spin is along the minor axis of the halo. Instead when gas cools onto a disc it is able to form in almost arbitrary orientation, including off the main planes of the halo (but avoiding an orientation perpendicular to the halo's intermediate axis). Substructure helps gasless galaxies reach alignment with the halo faster, but have less effect on galaxies when gas is cooling onto the disc. Our results provide a novel and natural interpretation for why red, gas poor galaxies are preferentially aligned with their ...

Debattista, Victor P; Roskar, Rok; Quinn, Thomas; Moore, Ben; Cole, David R

2015-01-01T23:59:59.000Z

451

Blue energy: Current technologies for sustainable power generation from water salinity gradient  

Science Journals Connector (OSTI)

Abstract Salinity energy stored as the salinity difference between seawater and freshwater is a large-scale renewable resource that can be harvested and converted to electricity, but extracting it efficiently as a form of useful energy remains a challenge. With the development of membrane science and technology, membrane-based techniques for energy extraction from water salinity, such as pressure-retarded osmosis and reverse electro-dialysis, have seen tremendous development in recent years. Meanwhile, many other novel methods for harvesting exergy from water mixing processes, such as electrochemical capacitor and nano-fluidic energy harvesting systems, have been proposed. In this work, an overview and state-of-the-art of the current technologies for sustainable power generation from the water salinity gradient are presented. Characteristics of these technologies are analyzed and compared for this particular application. Based on these entropic energy extracting methods, the water salinity, as the blue energy, will be another source of renewable energy to satisfy the ever-growing energy demand of human society.

Zhijun Jia; Baoguo Wang; Shiqiang Song; Yongsheng Fan

2014-01-01T23:59:59.000Z

452

NANOSTRUCTURED HIGH PERFORMANCE ULTRAVIOLET AND BLUE LIGHT EMITTING DIODES FOR SOLID STATE LIGHTING  

SciTech Connect

We report on research results in this project which synergize advanced material science approaches with fundamental optical physics concepts pertaining to light-matter interaction, with the goal of solving seminal problems for the development of very high performance light emitting diodes (LEDs) in the blue and near ultraviolet for Solid State Lighting applications. Accomplishments in the first 12 month contract period include (1) new means of synthesizing zero- and one-dimensional GaN nanostructures, (2) establishment of the building blocks for making GaN-based microcavity devices, and (3) demonstration of top-down approach to nano-scale photonic devices for enhanced spontaneous emission and light extraction. These include a demonstration of eight-fold enhancement of the external emission efficiency in new InGaN QW photonic crystal structures. The body of results is presented in this report shows how a solid foundation has been laid, with several noticeable accomplishments, for innovative research, consistent with the stated milestones.

Arto V. Nurmikko; Jung Han

2004-10-01T23:59:59.000Z

453

Stellar Masses of Luminous Compact Blue Galaxies at Redshifts z=0.4-1.2  

E-Print Network (OSTI)

We present stellar mass measurements for a sample of 36 Luminous Compact Blue Galaxies (LCBGs) at redshifts z = 0.4-1.2 in the Flanking Fields around the Hubble Deep Field North. The technique is based on fitting a two-component galaxy population model to multi-broadband photometry. Best-fit models are found to be largely independent on the assumed values for the IMF and the metallicity of the stellar populations, but are sensitive to the amount of extinction and the extinction law adopted. On average, the best-fit model corresponds to a LMC extinction law with E(B-V)=0.5. Stellar mass estimates, however, are remarkably independent on the final model choice. Using a Salpeter IMF, the derived median stellar mass for this sample is 5 x 10^9 Mo, i.e., ~2 times smaller than previous virial mass estimates. Despite uncertainties of a factor 2-3, our results strengthen prior claims that L* CBGs at intermediate redshifts are, on average, about 10 times less massive than a typical L* galaxy today.

R. Guzman; G. Ostlin; D. Kunth; M. Bershady; D. Koo; M. Pahre

2003-02-12T23:59:59.000Z

454

A luminous, blue progenitor system for a type-Iax supernova  

E-Print Network (OSTI)

Type-Iax supernovae (SN Iax) are stellar explosions that are spectroscopically similar to some type-Ia supernovae (SN Ia) at maximum light, except with lower ejecta velocities. They are also distinguished by lower luminosities. At late times, their spectroscopic properties diverge from other SN, but their composition (dominated by iron-group and intermediate-mass elements) suggests a physical connection to normal SN Ia. These are not rare; SN Iax occur at a rate between 5 and 30% of the normal SN Ia rate. The leading models for SN Iax are thermonuclear explosions of accreting carbon-oxygen white dwarfs that do not completely unbind the star, implying they are "less successful" cousins of normal SN Ia, where complete disruption is observed. Here we report the detection of the luminous, blue progenitor system of the type-Iax SN 2012Z in deep pre-explosion imaging. Its luminosity, colors, environment, and similarity to the progenitor of the Galactic helium nova V445 Puppis, suggest that SN 2012Z was the explosio...

McCully, Curtis; Foley, Ryan J; Bildsten, Lars; Fong, Wen-fai; Kirshner, Robert P; Marion, G H; Riess, Adam G; Stritzinger, Maximilian D

2014-01-01T23:59:59.000Z

455

Exciton correlations in coupled quantum wells and their luminescence blue shift  

Science Journals Connector (OSTI)

In this paper we present a study of an exciton system where electrons and holes are confined in double quantum well structures. The dominating interaction between excitons in such systems is a dipole-dipole repulsion. We show that the tail of this interaction leads to a strong correlation between excitons and substantially affects the behavior of the system. Making use of qualitative arguments and estimates we develop a picture of the exciton-exciton correlations in the whole region of temperature and concentration where excitons exist. It appears that at low concentration degeneracy of the excitons is accompanied with strong multiparticle correlation so that the system cannot be considered as a gas. At high concentration the dipole-dipole repulsion suppresses the quantum degeneracy. As a result there exists a temperature region where the system behaves a classical liquid; such a region does not exist in case of contact interaction. We calculate the blue shift of the exciton luminescence line which is a sensitive tool to observe the exciton-exciton correlations.

B. Laikhtman and R. Rapaport

2009-11-13T23:59:59.000Z

456

Long-term spectroscopic monitoring of the Luminous Blue Variable HD160529  

E-Print Network (OSTI)

We have spectroscopically monitored the galactic Luminous Blue Variable HD 160529 and obtained an extensive high-resolution data set that covers the years 1991 to 2002. During this period, the star evolved from an extended photometric minimum phase towards a new visual maximum. In several observing seasons, we covered up to four months with almost daily spectra. Our spectra typically cover most of the visual spectral range with a high spectral resolution (about 20,000 or more). This allows us to investigate the variability in many lines and on many time scales from days to years. We find a correlation between the photospheric HeI lines and the brightness of the star, both on a time scale of months and on a time scale of years. The short-term variations are smaller and do not follow the long-term trend, strongly suggesting different physical mechanisms. Metal lines also show both short-term and long-term variations in strength and also a long-term trend in radial velocity. Most of the line-profile variations can be attributed to changing strengths of lines. Propagating features in the line profiles are rarely observed. We find that the mass-loss rate of HD 160529 is almost independent of temperature, i.e. visual brightness.

Otmar Stahl; Thomas Gaeng; Chris Sterken; Andreas Kaufer; Thomas Rivinius; Thomas Szeifert; Bernhard Wolf

2002-12-20T23:59:59.000Z

457

Tubular structured hierarchical mesoporous titania material derived from natural cellulosic substances and application as photocatalyst for degradation of methylene blue  

SciTech Connect

Graphical abstract: Bio-inspired, tubular structured hierarchical mesoporous titania material with high photocatalytic activity under UV light was fabricated employing natural cellulosic substance (cotton) as hard template and cetyltrimethylammonium bromide (CTAB) surfactant as soft template using a one-pot sol-gel method. Highlights: {yields} Tubular structured mesoporous titania material was fabricated by sol-gel method. {yields} The titania material faithfully recorded the hierarchical structure of the template substrate (cotton). {yields} The titania material exhibited high photocatalytic activity in decomposition of methylene blue. -- Abstract: Bio-inspired, tubular structured hierarchical mesoporous titania material was designed and fabricated employing natural cellulosic substance (cotton) as hard template and cetyltrimethylammonium bromide (CTAB) surfactant as soft template by one-pot sol-gel method. The tubular structured hierarchical mesoporous titania material processes large specific surface area (40.23 m{sup 2}/g) and shows high photocatalytic activity in the photodegradation of methylene blue under UV light irradiation.

Huang, Haiqing [Key Laboratory of Radioactive Geology and Exploration Technology Fundamental Science for National Defense, East China Institute of Technology, Fuzhou, Jiangxi 344000 (China)] [Key Laboratory of Radioactive Geology and Exploration Technology Fundamental Science for National Defense, East China Institute of Technology, Fuzhou, Jiangxi 344000 (China); Liu, Xiaoyan [Department of Chemistry, Zhejiang University, Hangzhou, Zhejiang 310027 (China)] [Department of Chemistry, Zhejiang University, Hangzhou, Zhejiang 310027 (China); Huang, Jianguo, E-mail: jghuang@zju.edu.cn [Department of Chemistry, Zhejiang University, Hangzhou, Zhejiang 310027 (China)] [Department of Chemistry, Zhejiang University, Hangzhou, Zhejiang 310027 (China)

2011-11-15T23:59:59.000Z

458

An ambipolar phosphine oxide-based host for high power efficiency blue phosphorescent organic light emitting devices  

SciTech Connect

We report blue electrophosphorescent organic light emitting devices (OLEDs) with a new ambipolar host material, 4-(diphenylphosphoryl)-N,N-diphenylaniline (HM-A1), doped with the blue phosphor iridium (III) bis[(4,6-difluorophenyl)-pyridinato-N,C2]picolinate (FIrpic). The ambipolar nature of the host was verified using single carrier devices. The power efficiency of devices that employed 2,8-bis(diphenylphosphoryl)dibenzothiophene (PO15) as the electron transport layer showed optimized device performance when the electron transport layer thickness was 500 , giving a peak power efficiency of 46 lm/W (corresponding external quantum efficiency of 17.1%). The external quantum efficiency and power efficiency at the brightness of 800 Cd/m2 were measured with no light outcoupling enhancement and found to be 15.4% and 26 lm/W, respectively.

Polikarpov, Evgueni; Swensen, James S.; Chopra, Neetu; So, Franky; Padmaperuma, Asanga B.

2009-06-01T23:59:59.000Z

459

Polarization-multiplexed 22 phosphor-LED wireless light communication without using analog equalization and optical blue filter  

Science Journals Connector (OSTI)

Abstract We propose and experimentally demonstrate a 380 (2190)Mbps phosphor-light-emitting-diode (LED) based visible light communication (VLC) system by using 22 polarization-multiplexing design for in-building access applications. To the best of our knowledge, this is the first time of employing polarization-multiplexing to achieve a high VLC transmission capacity by using phosphor-based white-LED without optical blue filter. Besides, utilizing the optimum resistorinductorcapacity (RLC) bias-tee design, it can not only perform the function of combining the direct-current (DC) and the electrical data signal, but also act as a simple LED-Tx circuit. No optical blue filter and complicated post-equalization are required at the Rx. Here, the orthogonal-frequency-division-multiplexing (OFDM) quadrature-amplitude-modulation (QAM) with bit-loading is employed to enhance the transmission data rate.

C.H. Yeh; H.Y. Chen; Y.L. Liu; C.W. Chow

2015-01-01T23:59:59.000Z

460

Carbazole modified terphenyl based high triplet energy host materials for blue phosphorescent organic light-emitting diodes  

Science Journals Connector (OSTI)

Abstract Carbazole modified terphenyl based high triplet energy host materials were developed for application as host materials for blue phosphorescent organic light-emitting diodes. Two terphenyl based materials, 9-(5?-phenyl-[1,1?:2?,1?:3?,1???-quaterphenyl]-3-yl)-9H-carbazole (CzTPPh) and 9-(3?,5?-di(pyridin-3-yl)-[1,1:2?,1?-terphenyl]-3-yl)-9H-carbazole (CzTPPy), were synthesized as the host materials with high triplet energies of 2.75eV and 2.73eV, respectively. The two host materials were evaluated as the host materials for blue phosphorescent organic light-emitting diodes and high quantum efficiencies of 20.2% and 15.7% were obtained in the CzTPPh and CzTPPy devices, respectively.

Chil Won Lee; Jun Yeob Lee

2014-01-01T23:59:59.000Z

Note: This page contains sample records for the topic "blue ruthenium dimer" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


461

Lineshape of the singlet-triplet excitations in the dimer system Sr3Cr2O8 to first order in the high-density 1/z expansion  

Science Journals Connector (OSTI)

The Cr5+ ions in Sr3Cr2O8 constitute a strongly correlated spin-1/2 dimer system. Experiments show that the collective singlet-triplet excitations in this system are well defined in the zero-temperature limit, but, when heated, the inelastic neutron scattering peaks decrease rapidly in intensity and acquire a nonzero line width. When including the fluctuations to leading order in 1/z, where z is the coordination number, the diagrammatic high-density expansion is found to offer an accurate description of the singlet-triplet excitations. The theory explains not only the temperature dependencies of the intensities and line widths, but also that strong correlation causes the lineshapes to become asymmetric at temperatures comparable to the excitation energies.

J. Jensen; D. L. Quintero-Castro; A. T. M. N. Islam; K. C. Rule; M. Mnsson; B. Lake

2014-04-11T23:59:59.000Z

462

TM Pacific Blue Cross, the registered trade-name of PBC Health Benefits Society, is an independent licensee of the Canadian Association of Blue Cross Plans. BC Life is the registered trade-name of British Columbia Life & Casualty Company, a wholly-owned s  

E-Print Network (OSTI)

. This includes health care professionals, institutions, investigative agencies, insurers/re-insurers, governmentTM� Pacific Blue Cross, the registered trade-name of PBC Health Benefits Society, is an independent Cross Plans, and is used under license to Pacific Blue Cross. My Good Health is a trade-mark owned

463

Global Structure of a Three-Way Junction in a Phi29 Packaging RNA Dimer Determined Using Site-Directed Spin Labeling  

SciTech Connect

The condensation of bacteriophage phi29 genomic DNA into its preformed procapsid requires the DNA packaging motor, which is the strongest known biological motor. The packaging motor is an intricate ring-shaped protein/RNA complex, and its function requires an RNA component called packaging RNA (pRNA). Current structural information on pRNA is limited, which hinders studies of motor function. Here, we used site-directed spin labeling to map the conformation of a pRNA three-way junction that bridges binding sites for the motor ATPase and the procapsid. The studies were carried out on a pRNA dimer, which is the simplest ring-shaped pRNA complex and serves as a functional intermediate during motor assembly. Using a nucleotide-independent labeling scheme, stable nitroxide radicals were attached to eight specific pRNA sites without perturbing RNA folding and dimer formation, and a total of 17 internitroxide distances spanning the three-way junction were measured using Double Electron-Electron Resonance spectroscopy. The measured distances, together with steric chemical constraints, were used to select 3662 viable three-way junction models from a pool of 65 billion. The results reveal a similar conformation among the viable models, with two of the helices (HT and HL) adopting an acute bend. This is in contrast to a recently reported pRNA tetramer crystal structure, in which HT and HL stack onto each other linearly. The studies establish a new method for mapping global structures of complex RNA molecules, and provide information on pRNA conformation that aids investigations of phi29 packaging motor and developments of pRNA-based nanomedicine and nanomaterial.

Zhang, Xiaojun; Tung, Chang-Shung; Sowa, Glenna; Hatmal, Ma'mon M.; Haworth, Ian S.; Qin, Peter Z.

2012-02-08T23:59:59.000Z

464

The Ultraviolet-Optical Color-Magnitude Diagram III: Constraints on Evolution from the Blue to Red Sequence  

E-Print Network (OSTI)

We introduce a new quantity, the mass flux density of galaxies evolving from the blue sequence to the red sequence. We propose a simple technique for constraining this mass flux using the volume corrected number density in the extinction-corrected UV-optical color magnitude distribution, the stellar age indexes H-delta-a and D_n(4000), and a simple prescription for spectral evolution using a quenched star formation history. We exploit the excellent separation of red and blue sequences in the NUV-r band color-magnitude diagram. The final value we measure, 0.033 M_sun yr^-1 Mpc^-3, is strictly speaking an upper limit due to the possible contributions of bursting, composite, and extincted galaxies. However, it compares favorably with estimates of the average mass flux that we make based on the red luminosity function evolution derived from the DEEPII and COMBO-17 surveys (Bell et al 2004; Faber et al. 2005), 0.034 M_sun yr^-1 Mpc^-3. We find that the blue sequence mass has remained roughly constant since z=1 (mass flux 0.01 M_sun yr^-1 Mpc^-3) but the average on-going star formation of 0.037$ M_sun yr^-1 Mpc^-3 over 0blue sequence. We explore the nature of the galaxies in the transition zone with particular attention to the frequency and impact of AGNs. The AGN fraction peaks in the transition zone. We find circumstantial, albeit weak evidence that the quench rates are higher in higher luminosity AGNs.

D. Christopher Martin; Ted K. Wyder; David Schiminovich; Tom A. Barlow; Karl Forster; Peter G. Friedman; Patrick Morrissey; Susan G. Neff; Mark Seibert; Todd Small; Barry Y. Welsh; Luciana Bianchi; Jose Donas; Timothy M. Heckman; Young-Wook Lee; Barry F. Madore; Bruno Milliard; R. Michael Rich; Alex S. Szalay; Sukyoung K. Yi

2007-03-12T23:59:59.000Z

465

High-efficiency turquoise-blue electrophosphorescence from a Pt(II)-pyridyltriazolate complex in phosphine oxide host  

SciTech Connect

We have demonstrated high-efficiency turquoise-blue electrophosphorescence from the complex Pt(ptp)2 = bis[3,5bis(2pyridyl)1,2,4triazolato]platinum(II) doped in the wide band-gap, ambipolar phosphine oxide host HM-A1 = 4-(diphenylphosphoryl)-N,N-diphenylaniline. For devices with 5% Pt(ptp)2 doping in HM-A1, we have achieved a peak external quantum efficiency and power efficiency of (11.8 0.6) % and (61.2 5.9) lm/W with high-pixel values of 13.1 % and 70.6 lm/W, respectively. These parameters maintained (10.6 0.2) % and (40.3 1.2) lm/W at a brightness of 1000 cd/m2 with high-pixel values of 10.8 % and 41.6 lm/W. Examination of several device structures suggests that the high performance is due to improved charge transport and exciton confinement in the emissive region. Devices with 1-10% doping concentration exhibit turquoise-blue emissions (?max ~ 480 nm) with a monotonic decrease in monomer/excimer intensity ratio upon increasing the doping concentration. Devices with 5% doping exhibit sufficient blue contribution to attain white light upon combination with highly-doped or neat emissive layers of the same phosphor; the work herein represents a significant backdrop toward optimizing such white OLEDs given the performance metrics above, which to our knowledge represent the highest performance for OLEDs that exhibit blue emission maxima.

Bhansali, Unnat S.; Polikarpov, Evgueni; Swensen, James S.; Chen, Wei; Jia, Huiping; Gaspar, Daniel J.; Gnade, Bruce E.; Padmaperuma, Asanga B.; Omary, Mohammad A.

2009-12-10T23:59:59.000Z

466

The photocatalysis of Bi{sub 2}MoO{sub 6} under the irradiation of blue LED  

SciTech Connect

Graphical abstract: - Highlights: OH trap and hole sink were involved to investigate the active radicals. Holes play a more important role in the degradation of RhB. The OH were related to the decomposition of phenol. The O{sub 2}-played a leading role in the photodegradation of phenol. Blue LED is competitive and promising alternative for the future application. - Abstract: Bi{sub 2}MoO{sub 6} has been reported as a promising photocatalyst in wastewater treatment. The active radicals generated over the Bi{sub 2}MoO{sub 6} during the photocatalytic process were thought to be hydroxyl radical (OH) but have not been proved. Herein, Bi{sub 2}MoO{sub 6} with nanoplate like morphology was synthesized and its photocatalytic performances in the degradation of rhodamine B (RhB) and phenol as colored and colorless model pollutants respectively were evaluated under the irradiation of blue light emitting diode (LED). The tert-butyl alcohol (TBA) as a OH trap and ethylene diamine tetraacetic acid (EDTA) as a hole sink were involved to investigate the main active groups that are generated on Bi{sub 2}MoO{sub 6} and function during the photodegradation of RhB and phenol. In addition, it is a competitive and promising alternative plan to use blue LED as light source for the future practical application in environmental remediation.

Sun, Yuanyuan; Wang, Wenzhong, E-mail: wzwang@mail.sic.ac.cn; Zhang, Ling; Sun, Songmei

2013-10-15T23:59:59.000Z

467

Structurally Similar Woodchuck and Human Hepadnavirus Core Proteins Have Distinctly Different Temperature Dependences of Assembly  

Science Journals Connector (OSTI)

...passes a narrow band of ion energies into an ion trap for mass analysis...subunits are shown in red, green, blue, and yellow, respectively...overlays, the AB dimers are red-green and the CD dimers are yellow-blue...See reference 18. The contact energy between two dimers, deltaG...

Alexander A. Kukreja; Joseph C.-Y. Wang; Elizabeth Pierson; David Z. Keifer; Lisa Selzer; Zhenning Tan; Bogdan Dragnea; Martin F. Jarrold; Adam Zlotnick

2014-09-24T23:59:59.000Z

468

Spectral optimization of the color temperature tunable white light-emitting diode (LED) cluster consisting of direct-emission blue and red LEDs and a diphosphor conversion LED  

Science Journals Connector (OSTI)

The correlated color temperature (CCT) tunable white-light LED cluster, which consists of direct-emission blue and red LEDs as well as phosphor-conversion (PC) LEDs packaged by...

Zhong, Ping; He, Guoxing; Zhang, Minhao

2012-01-01T23:59:59.000Z

469

The Role of Surfactants in Photogalvanics: Solar Energy Conversion and Storage in the Sodium Lauryl SulphateThymol BlueMannose System  

Science Journals Connector (OSTI)

Sodium lauryl sulphate (SLS) was used as a surfactant, thymol blue as a photosensitizer and mannose as a reductant in a photogalvanic cell to improve the conversion efficiency and storage capacity of such cell...

Prem Prakash Solanki; K. M. Gangotri

2012-01-01T23:59:59.000Z

470

Study on PCB 101, PCB 153, mercury and methyl mercury content in blue crab Portunus Pelagicus from Khuzestan shore (Persian Gulf)  

Science Journals Connector (OSTI)

Distribution of polychlorinated biphenyl (PCB 101, PCB 153), Mercury (Hg) and methyl mercury (MMHg) in muscle, gill and hepatopancreas of blue swimming crab Portunus segnis from Persian Gulf were investigated. In...

Abdolah Raeisi Sarasiab; Mehdi Hosseini

2014-06-01T23:59:59.000Z

471

Screening of Antifungal Azole Drugs and Agrochemicals with an Adapted alamarBlue-Based Assay Demonstrates Antibacterial Activity of Croconazole against Mycobacterium ulcerans  

Science Journals Connector (OSTI)

...Screening of Antifungal Azole Drugs and Agrochemicals with an Adapted alamarBlue-Based...commonly available, but registered agrochemicals have also been broadly examined for...fungicides, commercialized as drugs or agrochemicals. These compounds are cytochrome P450...

Nicole Scherr; Katharina Rltgen; Matthias Witschel; Gerd Pluschke

2012-09-24T23:59:59.000Z

472

Bilirubin phototransformation in vitro using a battery-powered, solar-charged, high-intensity blue light-emitting diode phototherapy blanket  

Science Journals Connector (OSTI)

The availability of new, higher intensity Blue Light-Emitting Diodes (LEDs), as used in the development of our LED phototherapy blanket, led us to hypothesise that our blue LED phototherapy system would phototransform bilirubin more rapidly, in vitro, than the current commercially available, state-of-the-art phototherapy system. Furthermore, we theorised that increasing light intensity, beyond levels previously studied, would lead to increasing rates of bilirubin phototransformation.

Harel Rosen; Jerome J. Hric; Arye Rosen; Danielle Rosen; Shalom Komornik; Kathy Zaleski; Susan Yaron

2014-01-01T23:59:59.000Z

473

Blue Ribbon Commission on America's Nuclear Future: Report to the Secretary of Energy  

SciTech Connect

Preamble The Blue Ribbon Commission on Americas Nuclear Future (BRC) was formed by the Secretary of Energy at the request of the President to conduct a comprehensive review of policies for managing the back end of the nuclear fuel cycle and recommend a new strategy. It was co-chaired by Rep. Lee H. Hamilton and Gen. Brent Scowcroft. Other Commissioners are Mr. Mark H. Ayers, the Hon. Vicky A. Bailey, Dr. Albert Carnesale, Sen. Pete Domenici, Ms. Susan Eisenhower, Sen. Chuck Hagel, Mr. Jonathan Lash, Dr. Allison M. Macfarlane, Dr. Richard A. Meserve, Dr. Ernest J. Moniz, Dr. Per Peterson, Mr. John Rowe, and Rep. Phil Sharp. The Commission and its subcommittees met more than two dozen times between March 2010 and January 2012 to hear testimony from experts and stakeholders, to visit nuclear waste management facilities in the United States and abroad, and to discuss the issues identified in its Charter. Additionally, in September and October 2011, the Commission held five public meetings, in different regions of the country, to hear feedback on its draft report. A wide variety of organizations, interest groups, and individuals provided input to the Commission at these meetings and through the submission of written materials. Copies of all of these submissions, along with records and transcripts of past meetings, are available at the BRC website (www.brc.gov). This report highlights the Commissions findings and conclusions and presents recommendations for consideration by the Administration and Congress, as well as interested state, tribal and local governments, other stakeholders, and the public.

none,

2012-01-01T23:59:59.000Z

474

A novel polythreading Ag(I) coordination polymer with blue photoluminescence  

SciTech Connect

One new compound, [Ag(p-bix)]{sub 3}[Ag(Hbtc){sub 2}]2H{sub 2}O (H{sub 3}btc=1,2,4-benzenetricarboxylate, p-bix=1,4-bis(imidazol-1-ylmethyl)-benzene), has been synthesized under hydrothermal conditions and characterized by elemental analysis, IR, PXRD, luminescent analysis, and single-crystal X-ray diffraction. X-ray structural analysis revealed that 0-D unit [Ag(Hbtc){sub 2}]{sup 3?} and two kinds of 1-D linear chain [Ag(p-bix)]{sub ?}{sup +}, can be found within the crystal structure. The combination of 0-D [Ag(Hbtc){sub 2}]{sup 3?} unit and 1-D undulated chain [Ag1(p{sub 1}-bix)]{sub ?}{sup +} through weak AgO bond gave rise to 2-D anionic supramolecular doublelayer. Then the grids of the 2-D layer are threaded by 1-D linear cationic chain [Ag2(p{sub 2}-bix)]{sub ?}{sup +} to generate entangled 3-D architecture with unusual poly(pseudo-rotaxane)-type arrangements. Luminescent properties of the title complex were also studied in this paper. - Graphical abstract: Novel 3D polythreading supramolecular architecture was constructed, in which 1D linear cationic chains [Ag(p{sub 2}-bix)]{sub ?}{sup +} threaded into the grid of weak AgO bonded anionic 2D sheet. Highlights: ? Novel 1D{sup +}+2D{sup ?}?3D polythreading coordination complex was reported. ? Diverse conformations of p-bix result in different 1D [Ag(p-bix)]{sub ?}{sup +} chains. ? The title complex displayed blue photoluminescence at room temperature.

Duan, Xian-Ying, E-mail: dxynumber@163.com [State Key Laboratory of Coordination Chemistry, Nanjing University, Nanjing 210093 (China); Institute of Chemistry, Henan Academy of Sciences, Zhengzhou 450002 (China); Yao, Jing; Lu, Chang-Sheng [State Key Laboratory of Coordination Chemistry, Nanjing University, Nanjing 210093 (China); Meng, Qing-Jin, E-mail: mengqj@nju.edu.cn [State Key Laboratory of Coordination Chemistry, Nanjing University, Nanjing 210093 (China)

2013-04-15T23:59:59.000Z

475

SDSS J141624.08+134826.7: A NEARBY BLUE L DWARF FROM THE SLOAN DIGITAL SKY SURVEY  

SciTech Connect

We present the discovery of a bright (J = 13.1 mag) nearby L6 dwarf found in a search for L-type ultracool subdwarfs in the Sloan Digital Sky Survey (SDSS) Data Release 7. SDSS J141624.08+134826.7 exhibits blue near-infrared colors compared to other optically typed L6 objects, but its optical and near-infrared spectra do not show metal-poor features characteristic of known L-type ultracool subdwarfs. Instead, SDSS J141624.08+134826.7 is probably a nearby example of the class of L dwarfs with low condensate opacities that exhibit unusually blue near-infrared colors for a given spectral type. Its deep 1.4 and 1.9 {mu}m H{sub 2}O absorption bands, weak 2.3 {mu}m CO feature, strong 0.99 {mu}m FeH band, and shallow optical TiO and CaH bands resemble the spectra of other blue L dwarfs which are believed to have unusually thin or large-grained cloud structure. The luminosity of SDSS J141624.08+134826.7 implies that it is either a high-mass brown dwarf or a low-mass star, depending on its age, and its UVW space motion suggests a thin-disk membership. With a spectrophotometric distance of 8.4 +- 1.9 pc, SDSS J141624.08+134826.7 is one of the nearest L dwarfs to the Sun and is therefore an excellent target for high resolution imaging, spectroscopic, and astrometric follow-up observations.

Bowler, Brendan P. [Infrared Telescope Facility, National Aeronautics and Space Administration, Science Mission Directorate, Planetary Astronomy Program (United States); Liu, Michael C.; Dupuy, Trent J., E-mail: bpbowler@ifa.hawaii.ed [Institute for Astronomy, University of Hawaii, 2680 Woodlawn Drive, Honolulu, HI 96822 (United States)

2010-02-10T23:59:59.000Z

476

The effects of histidine on the uptake of cadmium from the digestive system of the blue crab (Callinectes sapidus, Rathbun)  

E-Print Network (OSTI)

)ectes snpidr)s. Histidine concentration in the hemo- lymph of the individual crabs used in treatment 100:l. . . . 31 11. Cal)ineotes sapidus. Total hemolymph volume determined by H-inulin. 56 j2. CaLLdnsctes sapf)fus, The structures of the histidine... fulfillment of the requirement for the deSree of MASTER OF SCIENCE May 1980 Major Sub;ect: Oceanography THE EI'1'ECTS 01' HISTIDIJJE OIJ 'I'. !L' UPTAKE OI' CADMIUM I'ROM THE DIGESTIyi. SYSTIJM OF THE BLUE CRAB (CALLINFCTJ, S SAPIDUS, RATHBLR1) A Thesi...

Pecon, Jill Maureen

1980-01-01T23:59:59.000Z

477

Solvent Dependence on Bond Length Alternation and Charge Distribution in Phenol Blue: A Car?Parrinello Molecular Dynamics Investigation  

Science Journals Connector (OSTI)

Solvent Dependence on Bond Length Alternation and Charge Distribution in Phenol Blue: A Car?Parrinello Molecular Dynamics Investigation ... (4) The probing nature of these molecules is due to the effect of the polarity of the solvation shell in changing the electron excitation energy of the indicator dye. ... (23) The usual theoretical approach to tune the bond length alternation was to apply a static electric field(20, 25) or to optimize the structure by placing sparkles (negative or positive ions) close to the donor or acceptor groups of these conjugated systems. ...

N. Arul Murugan; Zilvinas Rinkevicius; Hans gren

2009-04-02T23:59:59.000Z

478

The WiggleZ Dark Energy Survey: Cosmological neutrino mass constraint from blue high-redshift galaxies  

E-Print Network (OSTI)

The absolute neutrino mass scale is currently unknown, but can be constrained from cosmology. The WiggleZ high redshift star-forming blue galaxy sample is less sensitive to systematics from non-linear structure formation, redshift-space distortions and galaxy bias than previous surveys. We obtain a upper limit on the sum of neutrino masses of 0.60eV (95% confidence) for WiggleZ+Wilkinson Microwave Anisotropy Probe. Combining with priors on the Hubble Parameter and the baryon acoustic oscillation scale gives an upper limit of 0.29eV, which is the strongest neutrino mass constraint derived from spectroscopic galaxy redshift surveys.

Signe Riemer-Srensen; Chris Blake; David Parkinson; Tamara M. Davis; Sarah Brough; Matthew Colless; Carlos Contreras; Warrick Couch; Scott Croom; Darren Croton; Michael J. Drinkwater; Karl Forster; David Gilbank; Mike Gladders; Karl Glazebrook; Ben Jelliffe; Russell J. Jurek; I-hui Li; Barry Madore; D. Christopher Martin; Kevin Pimbblet; Gregory B. Poole; Michael Pracy; Rob Sharp; Emily Wisnioski; David Woods; Ted K. Wyder; H. K. C. Yee

2011-12-21T23:59:59.000Z

479

Effects of a reduction of blue tilapia Oreochromis aureus on the ichthyofauna of a power-plant reservoir  

E-Print Network (OSTI)

Administration 1986). Thus, the number of thermally altered habitats is substantial and increasing. This will mean more suitable habitat will be created for exotic species such as the blue tilapia Oreochromis (= ~T'I i = S tb d ) ~ . 7i1 pt b-t p' 4 fishes.... Mean depth of the reservoir is 6. 5 m. A 586 ha lease to the Texas Parks and Wildlife Department (TPWD) resulted in the establishment of Fairfield Lake State Recreation Area, located at the south end of' the reservoir. Data were obtained at seven...

Starling, Scott Michael

1986-01-01T23:59:59.000Z

480

Effects of {pi}-stacking interactions on the near carbon K-edge x-ray absorption fine structure: A theoretical study of the ethylene pentamer and the phthalocyanine dimer  

SciTech Connect

X-ray absorption spectra have been determined for ethylene and free base phthalocyanine at the carbon K-edge with use of the complex polarization propagator method combined with Kohn-Sham density functional theory and the Coulomb attenuated method B3LYP exchange-correlation functional. Apart from isolated molecules, the study includes {pi}-stacked systems of the phthalocyanine dimer and the ethylene dimer, trimer, tetramer, and pentamer. For ethylene, {pi}-stacking involves a reduction in transition energy of the valence {pi}*-band by some 70 meV and large spectral changes (regarding also shape and intensity) of the Rydberg bands. For phthalocyanine, there are large spectral changes in the entire valence {pi}*-part of the spectrum.

Linares, Mathieu; Stafstroem, Sven; Norman, Patrick [Department of Physics, Chemistry and Biology, Linkoeping University, SE-581 83 Linkoeping (Sweden)

2009-03-14T23:59:59.000Z

Note: This page contains sample records for the topic "blue ruthenium dimer" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


481

Global-to-local incompatibility, monogamy of entanglement, and ground-state dimerization: Theory and observability of quantum frustration in systems with competing interactions  

E-Print Network (OSTI)

Frustration in quantum many body systems is quantified by the degree of incompatibility between the local and global orders associated, respectively, to the ground states of the local interaction terms and the global ground state of the total many-body Hamiltonian. This universal measure is bounded from below by the ground-state bipartite block entanglement. For many-body Hamiltonians that are sums of two-body interaction terms, a further inequality relates quantum frustration to the pairwise entanglement between the constituents of the local interaction terms. This additional bound is a consequence of the limits imposed by monogamy on entanglement shareability. We investigate the behavior of local pair frustration in quantum spin models with competing interactions on different length scales and show that valence bond solids associated to exact ground-state dimerization correspond to a transition from generic frustration, i.e. geometric, common to classical and quantum systems alike, to genuine quantum frustration, i.e. solely due to the non-commutativity of the different local interaction terms. We discuss how such frustration transitions separating genuinely quantum orders from classical-like ones are detected by observable quantities such as the static structure factor and the interferometric visibility.

S. M. Giampaolo; B. C. Hiesmayr; F. Illuminati

2015-01-25T23:59:59.000Z

482

Extra sub-Doppler lines in the vicinity of the third-resonance 6S-8P transition of atomic Cs attributed to optically induced Cs dimers  

SciTech Connect

We report on the observation of additional sub-Doppler lines in a saturated absorption experiment when exploring the vicinity of the 6S{sub 1/2}-8P{sub 3/2} transition of Cs ({lambda}=388 nm). These additional lines are observed only under a relatively strong irradiation of both the pump and the probe beams. Extra narrow lines are also observed in copropagating nonlinear spectroscopy, and around the lines of the V-type three-level system 8P{sub 3/2}-6S{sub 1/2}-8P{sub 1/2} ({lambda}{sub 1}=388 nm, {lambda}{sub 2}=389 nm). We attribute theses additional lines to a probing of high-lying molecular cesium, produced as a result of the optical excitation of Cs atoms, as the low Cs atom density ({<=}10{sup 12}cm{sup -3}) is unable to populate significantly the dimer states in the condition of thermal equilibrium.

Passerat de Silans, Thierry; Maurin, Isabelle; Laliotis, Athanasios; Segundo, Pedro Chaves de Souza; Bloch, Daniel [Laboratoire de Physique des Lasers, Institut Galilee, Universite Paris 13, Villetaneuse, UMR 7538 du CNRS, 99 AvenueJ.B. Clement, F-93430 Villetaneuse (France)

2011-04-15T23:59:59.000Z

483

Solution structure of a fragment of the dimerization domain of DP-1 determined by 1H-nuclear magnetic resonance and distance geometry  

Science Journals Connector (OSTI)

The structure of a synthesized peptide with the sequence of NHILPNESAYDQKNIRRRVYDALNVLMAMNIISK that corresponds to residues 151184 of transcription factor DP-1 (Girling et al., Nature 362 (1993) 8387) was determined by 1H-nuclear magnetic resonance in water and 40% d3-trifluoroethanol/water, respectively. Nuclear Overhauser effect cross peaks, ?H chemical shifts and J-coupling constants of ?HNH show that the peptide consists a helix from Ser-8 to Ser-33 in solution. Fifty structures were constructed with 288 upper distance limits and 21 angle constraints by DIANA (Guntert et al., J. Mol. Biol. 217 (1991) 517530). Although the N-terminal of the peptide exhibits a random conformation, the 20 best structures show a root mean square deviation of 0.890.36 for backbone atoms and 1.800.34 for heavy atoms from residue Ser-8 to Ser-33. This result supports the proposal that DP-1 and E2F-1 may dimerize with a coiled-coil type interaction.

Shouhong Guang; Jihui Wu; Tianning Yu; Youlin Xia; Yunyu Shi

1998-01-01T23:59:59.000Z

484

Solution structure of a fragment of the dimerization domain of E2F-1 determined by circular dichroism, 1H nuclear magnetic resonance and distance geometry  

Science Journals Connector (OSTI)

The structure of a synthesized peptide with the sequence GVVDLNWAAEVLKVQKRRIYDITNVLEGIQ which corresponds to residues 149178 of transcription factor E2F-1 was determined by 1H nuclear magnetic resonance in 40% d3-TFE/water. NOE cross peaks and ?H chemical shifts indicate that the peptide consists of a helix from Ala-8 to Leu-26 in this solution. Circular dichroism measurements confirm the presence of nearly 45% helix in TFE/water solution but show no evidence of helicity in water solution of this peptide. Fifty structures were constructed with 329 upper distance limits by DIANA. The 20 best conformers show a RMSD of 0.78 for backbone atoms and 1.78 for heavy atoms from residue Ala-8 to Leu-26. This result, together with our previous work on the solution structure of a fragment of DP-1, supports the proposal that E2F-1 and DP-1 may dimerize with a coiled-coil type interaction.

Shouhong Guang; Jihui Wu; Limei Tao; Youlin Xia; Yunyu Shi

1998-01-01T23:59:59.000Z

485

Acoustic detection and long-term monitoring of pygmy blue whales over the continental slope in southwest Australia  

Science Journals Connector (OSTI)

A 9-yr dataset of continuous sea noise recording made at the Cape Leeuwin station of the Comprehensive Nuclear-Test-Ban Treaty hydroacoustic network in 20022010 was processed to detect calls from pygmy blue whales and to analyze diel seasonal and interannual variations in their vocal activity. Because the conventional spectrogram correlation method for recognizing whale calls in sea noise resulted in a too high false detection rate alternative algorithms were tested and the most robust one applied to the multi-year dataset. The detection method was based on multivariate classification using two spectrogram features of transients in sea noise and Fisher's linear discriminant which provided a misclassification rate of approximately 1% for missed and false detections at moderate sensitivity settings. An analysis of the detection results revealed a consistent seasonal pattern in the whale presence and considerable interannual changes with a steady increase in the number of calls detected in 20022006. An apparent diel pattern of whales' vocal activity was also observed. The acoustic detection range for pygmy blue whales was estimated to vary from about 50?km to nearly 200?km from the Cape Leeuwin station depending on the ambient noise level source level and azimuth to a vocalizing whale.

Alexander N. Gavrilov; Robert D. McCauley

2013-01-01T23:59:59.000Z

486

The red and blue galaxy populations in the GOODS field: evidence for an excess of red dwarfs  

E-Print Network (OSTI)

We study the evolution of the galaxy population up to z\\sim3 as a function of its colour properties. In particular, luminosity functions and luminosity densities have been derived as a function of redshift for the blue/late and red/early populations. We use data from the GOODS-MUSIC catalogue which have typical magnitude limits zred/early subsamples. The LFs of the blue/late and total samples are well represented by steep Schechter functions evolving in luminosity with increasing redshifts. The volume density of the LFs of the red/early populations decreases with increasing redshift. The shape of the red/early LFs shows an excess of faint red dwarfs with respect to the extrapolation of a flat Schechter function and can be represented by the sum of two Schechter functions. Our model for galaxy formation in the hierarchical clustering scenario, which also includes external feedback due to a diffuse UV background, shows a general broad agreement with the LFs of both populations, the larger discrepancies being present at the faint end for the red population. Hints on the nature of the red dwarf population are given on the basis of their stellar mass and spatial distributions.

S. Salimbeni; E. Giallongo; N. Menci; M. Castellano; A. Fontana; A. Grazian; L. Pentericci; D. Trevese; S. Cristiani; M. Nonino; E. Vanzella

2007-10-19T23:59:59.000Z

487

Improved power efficiency in blue phosphorescent organic light-emitting diodes using diphenylmethyl linkage based high triplet energy hole transport materials  

Science Journals Connector (OSTI)

Improved power efficiency in blue phosphorescent organic light-emitting diodes (PHOLEDs) was demonstrated by using new high triplet energy hole-transport materials based on the diphenylmethyl linkage. Two high triplet energy hole-transport materials with diphenylamine or ditolyamine moieties linked through a diphenylmethyl linkage, 4,4?-(diphenylmethylene)bis(N,N-diphenylaniline) (TCBPA) and 4,4?-(diphenylmethylene)bis(N,N-di-p-tolylaniline), were synthesized and evaluated as hole-transport materials for blue PHOLEDs. The power efficiency of TCBPA was superior to that of standard 1,1-bis[4-[N,N?-di(p-tolyl)amino]phenyl]cyclohexane.

Chil Won Lee; Jun Yeob Lee

2013-01-01T23:59:59.000Z

488

The Gas Content and Kinematics of Nearby Blue Compact Galaxies: Implications for Studies at Intermediate and High Redshift  

E-Print Network (OSTI)

We present Arecibo 21 cm spectroscopy, Keck HIRES Hb spectroscopy, and WIYN R-band images of 11 nearby blue compact galaxies selected to be similar to blue compact star-forming galaxies at intermediate redshifts (0.1blue compact galaxies into NGC-type spheroidals is a viable evolutionary scenario for the least massive, most gas-poor objects. The most consistent characteristic of our sample is that the ratio, R, of HII linewidth to HI 21 cm linewidth (W_20) are systematically less than unity. The simplest explanation is that the ionized gas is more centrally concentrated than the neutral gas within the gravitational potential. On average R=0.66 +/- 0.16, similar to findings for local HII galaxies. We find R is also a function of linewidth; smaller linewidth galaxies have smaller values of R. Correcting optical linewidths by this factor raises derived masses and places these galaxies on the local luminosity--linewidth (Tully-Fisher) relation. If this ratio applies to intermediate-redshift galaxies, then the proposed luminosity evolution of the Tully-Fisher relation is much smaller and more gradual than suggested by studies using optical emission-linewidth measurements.

D. J. Pisano; Henry A. Kobulnicky; Rafael Guzman; Jesus Gallego; Matthew A. Bershady; ;

2001-06-21T23:59:59.000Z

489

Fundamental measure theory for the electric double layer: applications to blue-energy harvesting and water desalination  

E-Print Network (OSTI)

Capacitive mixing (CAPMIX) and capacitive deionization (CDI) are promising candidates for harvesting clean, renewable energy and for the energy efficient production of potable water, respectively. Both CAPMIX and CDI involve water-immersed porous carbon electrodes at voltages of the order of hundreds of millivolts, such that counter-ionic packing is important. We propose a density functional theory (DFT) to model the electric double layer which forms near the surfaces of these porous materials. The White-Bear mark II fundamental measure theory (FMT) functional is combined with a mean-field Coulombic and a MSA-type correction to describe the interplay between dense packing and electrostatics, in good agreement with MD simulations. Compared to less elaborate mean-field models our DFT calculations reveal a higher work output for blue-energy cycles and a higher energy demand for desalination cycles.

Andreas Hrtel; Mathijs Janssen; Sela Samin; Ren van Roij

2014-11-20T23:59:59.000Z

490

The ACS LCID project VII: the blue stragglers population in the isolated dSph galaxies Cetus and Tucana  

E-Print Network (OSTI)

We present the first investigation of the Blue Straggler star (BSS) population in two isolated dwarf spheroidal galaxies of the Local Group, Cetus and Tucana. Deep HST/ACS photometry allowed us to identify samples of 940 and 1214 candidates, respectively. The analysis of the star formation histories of the two galaxies suggests that both host a population of BSSs. Specifically, if the BSS candidates are interpreted as young main sequence stars, they do not conform to their galaxy's age-metallicity relationship. The analysis of the luminosity function and the radial distributions support this conclusion, and suggest a non-collisional mechanism for the BSS formation, from the evolution of primordial binaries. This scenario is also supported by the results of new dynamical simulations presented here. Both galaxies coincide with the relationship between the BSS frequency and the absolute visual magnitude Mv found by Momany et al (2007). If this relationship is confirmed by larger sample, then it could be a valuab...

Monelli, M; Mapelli, M; Bernard, E J; Aparicio, A; Skillman, E D; Stetson, P B; Gallart, C; Hidalgo, S L; Mayer, L; Tolstoy, E

2011-01-01T23:59:59.000Z

491

Toxicity of ozonated estuarine water to juvenile blue crabs (Callinectes sapidus) and Juvenile Atlantic menhaden (Brevoortia tyrannus)  

SciTech Connect

Large quantitites of estuarine and marine water are treated with chlorine to prevent condenser system fouling at power plants. Chlorine and its residual by-products, however, are toxic to many forms of aquatic life. Ozone is one alternative oxidant which has proven to be an effective biocide and disinfectant in many fresh water applications. Ozonation of estuarine and marine waters, however, may produce residual compounds similar to those produced by chlorination. This study was initiated to provide baseline information on the toxicity of ozonated estuarine water to two representative estuarine species. The blue crab, Callinectes sapidus Rathbun, and the Atlantic menhaden, Brevoortia tyrannus Latrobe, were selected because of their wide distribution and commercial importance. The toxicity of ozone has been compared with chlorine toxicity data from the literature in an effort to examine possible similarities in toxicity.

Richardson, L.B.; Burton, D.T.

1981-02-01T23:59:59.000Z

492

Tunable bluegreen emission phosphor Ca2PO4Cl:Ce3+, Tb3+: Luminescence and energy transfer  

Science Journals Connector (OSTI)

Abstract A series of tunable emission phosphors Ca2PO4Cl:Ce3+, Tb3+ are synthesized by a high temperature solid-state method. The emitting color of Ca2PO4Cl:Ce3+, Tb3+ can be adjusted from blue to green with increasing the Tb3+ doping content. The energy transfer from Ce3+ to Tb3+ in Ca2PO4Cl has been validated, and proved to be