Powered by Deep Web Technologies
Note: This page contains sample records for the topic "avg trip distance" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


1

Fact #612: March 1, 2010 The Distance of Trips to Work  

Energy.gov (U.S. Department of Energy (DOE))

The recently released Nationwide Household Travel Survey shows that nearly 60% of work trips are 10 miles or less in distance. Only 9% of work trips are over 30 miles. The average work trip...

2

Avg.salinity(ppt) Femalecrabnumber  

E-Print Network (OSTI)

NERR quarterly for 11 time periods at 9 stations across a salinity gradient in the Ashpoo (green0 5 10 15 20 25 0 50 100 150 200 250 300 Avg.salinity(ppt) Femalecrabnumber > 25 ppt 15-25 ppt ppt Salinity 0 5 10 15 20 25 0 50 100 150 200 250 300 Avg.salinity(ppt) Malecrabnumber > 25 ppt 15

Childress, Michael J.

3

AVG Koeln GmbH | Open Energy Information  

Open Energy Info (EERE)

AVG Koeln GmbH Jump to: navigation, search Name: AVG Koeln GmbH Place: Kln, Germany Zip: 50735 Product: Operating a Waste-to-Energy facility in Kln, Germany. References:...

4

Property:AvgAnnlGrossOpCpcty | Open Energy Information  

Open Energy Info (EERE)

AvgAnnlGrossOpCpcty AvgAnnlGrossOpCpcty Jump to: navigation, search Property Name AvgAnnlGrossOpCpcty Property Type Number Description Avg. Annual Gross Operating Capacity(MW). Pages using the property "AvgAnnlGrossOpCpcty" Showing 6 pages using this property. F Faulkner I Energy Generation Facility + 49.5 + N Navy I Geothermal Facility + 81.7 + Navy II Geothermal Facility + 86 + Neal Hot Springs Geothermal Power Plant + 22 + North Brawley Geothermal Power Plant + 50 + R Raft River Geothermal Facility + 11.5 + Retrieved from "http://en.openei.org/w/index.php?title=Property:AvgAnnlGrossOpCpcty&oldid=400186#SMWResults" Categories: Properties Geothermal Energy Generation Facilities properties What links here Related changes Special pages Printable version

5

EV Project Chevrolet Volt Vehicle Summary Report  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

42 Overall electrical energy consumption (AC Whmi) 231 Number of trips 676,414 Total distance traveled (mi) 5,753,009 Avg trip distance (mi) 8.3 Avg distance traveled per day...

6

EV Project Chevrolet Volt Vehicle Summary Report  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

fuel economy (mpg) 155 Overall electrical energy consumption (AC Whmi) 242 Number of trips 147,886 Total distance traveled (mi) 1,184,265 Avg trip distance (mi) 8.0 Avg distance...

7

EV Project Nissan Leaf Vehicle Summary Report  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

2011 through March 2011 Vehicle Usage Number of trips 3,364 Total distance traveled (mi) 21,706 Avg trip distance (mi) 5.8 Avg distance traveled per day when the vehicle was...

8

EV Project Nissan Leaf Vehicle Summary Report  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

through September 2012 Vehicle Usage Number of trips 813,430 Total distance traveled (mi) 5,837,173 Avg trip distance (mi) 7.2 Avg distance traveled per day when the vehicle was...

9

EV Project Nissan Leaf Vehicle Summary Report  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

2012 through June 2012 Vehicle Usage Number of trips 787,895 Total distance traveled (mi) 5,666,469 Avg trip distance (mi) 7.2 Avg distance traveled per day when the vehicle was...

10

EV Project Nissan Leaf Vehicle Summary Report  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

through December 2012 Vehicle Usage Number of trips 969,853 Total distance traveled (mi) 6,724,952 Avg trip distance (mi) 6.9 Avg distance traveled per day when the vehicle was...

11

EV Project NIssan Leaf Vehicle Summary Report-Reporting period...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

through September 2011 Vehicle Usage Number of trips 536,548 Total distance traveled (mi) 3,718,272 Avg trip distance (mi) 6.9 Avg distance traveled per day when the vehicle was...

12

EV Project NIssan Leaf Vehicle Summary Report  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

2012 through March 2012 Vehicle Usage Number of trips 773,602 Total distance traveled (mi) 5,558,155 Avg trip distance (mi) 7.2 Avg distance traveled per day when the vehicle was...

13

EV Project NIssan Leaf Vehicle Summary Report  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

through December 2011 Vehicle Usage Number of trips 707,330 Total distance traveled (mi) 4,878,735 Avg trip distance (mi) 6.9 Avg distance traveled per day when the vehicle was...

14

EV Project NIssan Leaf Vehicle Summary Report  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

2011 through June 2011 Vehicle Usage Number of trips 160,588 Total distance traveled (mi) 1,077,931 Avg trip distance (mi) 6.7 Avg distance traveled per day when the vehicle was...

15

EV Project Nissan Leaf Vehicle Summary Report  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

40 Reporting period: January 2013 through March 2013 Vehicle Usage Number of trips 1,075,251 Total distance traveled (mi) 7,563,354 Avg trip distance (mi) 7.0 Avg distance...

16

Property:AvgGeoFluidTemp | Open Energy Information  

Open Energy Info (EERE)

AvgGeoFluidTemp AvgGeoFluidTemp Jump to: navigation, search Property Name AvgGeoFluidTemp Property Type Temperature Description Average temperature of geofluid in a geothermal area. Subproperties This property has the following 15 subproperties: B Beowawe Hot Springs Geothermal Area Brady Hot Springs Geothermal Area C Chena Geothermal Area D Desert Peak Geothermal Area E East Mesa Geothermal Area G Geysers Geothermal Area H Heber Geothermal Area L Lightning Dock Geothermal Area R Roosevelt Hot Springs Geothermal Area S Salton Sea Geothermal Area San Emidio Desert Geothermal Area S cont. Soda Lake Geothermal Area Steamboat Springs Geothermal Area Stillwater Geothermal Area W Wabuska Hot Springs Geothermal Area Pages using the property "AvgGeoFluidTemp" Showing 10 pages using this property.

17

Property:AvgReservoirDepth | Open Energy Information  

Open Energy Info (EERE)

AvgReservoirDepth AvgReservoirDepth Jump to: navigation, search Property Name AvgReservoirDepth Property Type Quantity Description Average depth to reservoir Use this type to express a quantity of length. The default unit is the meter (m). Acceptable units (and their conversions) are: Meters - 1 m, meter, meters Meter, Meters, METER, METERS Kilometers - 0.001 km, kilometer, kilometers, Kilometer, Kilometers, KILOMETERS, KILOMETERS Miles - 0.000621371 mi, mile, miles, Mile, Miles, MILE, MILES Feet - 3.28084 ft, foot, feet, Foot, Feet, FOOT, FEET Yards - 1.09361 yd, yard, yards, Yard, Yards, YARD, YARDS Pages using the property "AvgReservoirDepth" Showing 24 pages using this property. A Amedee Geothermal Area + 213 m0.213 km 0.132 mi 698.819 ft 232.939 yd + B Beowawe Hot Springs Geothermal Area + 850 m0.85 km

18

Property:IndustrialAvgRate | Open Energy Information  

Open Energy Info (EERE)

IndustrialAvgRate IndustrialAvgRate Jump to: navigation, search Property Name IndustrialAvgRate Property Type Number Description Industrial Average Rate Subproperties This property has the following 279 subproperties: A AEP Generating Company AEP Texas Central Company AEP Texas North Company AES Eastern Energy LP APN Starfirst, L.P. Accent Energy Holdings, LLC Alabama Municipal Elec Authority Alaska Electric & Energy Coop Alaska Energy Authority Alaska Power and Telephone Co Allegheny Electric Coop Inc Alliant Energy Ameren Energy Marketing Ameren Illinois Company American Electric Power Co., Inc. American Mun Power-Ohio, Inc American Samoa Power Authority American Transmission Systems Inc Anoka Electric Coop Appalachian Power Co Aquila Inc Aquila Inc (Missouri) Arizona Electric Pwr Coop Inc

19

Property:CommercialAvgRate | Open Energy Information  

Open Energy Info (EERE)

CommercialAvgRate CommercialAvgRate Jump to: navigation, search Property Name CommercialAvgRate Property Type Number Description Commercial Average Rate Subproperties This property has the following 279 subproperties: A AEP Generating Company AEP Texas Central Company AEP Texas North Company AES Eastern Energy LP APN Starfirst, L.P. Accent Energy Holdings, LLC Alabama Municipal Elec Authority Alaska Electric & Energy Coop Alaska Energy Authority Alaska Power and Telephone Co Allegheny Electric Coop Inc Alliant Energy Ameren Energy Marketing Ameren Illinois Company American Electric Power Co., Inc. American Mun Power-Ohio, Inc American Samoa Power Authority American Transmission Systems Inc Anoka Electric Coop Appalachian Power Co Aquila Inc Aquila Inc (Missouri) Arizona Electric Pwr Coop Inc

20

_MainReport  

NLE Websites -- All DOE Office Websites (Extended Search)

Usage Usage Overall fuel economy (mpg) 139 Overall electrical energy consumption (AC Wh/mi) 293 Number of trips¹ 76,425 Total distance traveled (mi) 609,737 Avg trip distance (mi) 8.0 Avg distance traveled per day when the vehicle was driven (mi) 36.4 Avg number of trips between charging events 3.0 Avg distance traveled between charging events (mi) 24.1 Avg number of charging events per day when the vehicle was driven 1.5

Note: This page contains sample records for the topic "avg trip distance" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


21

A New Years Trip A New Years Trip  

E-Print Network (OSTI)

A New Years Trip A New Years Trip December 26, 2003 - January 3, 2004 By Saul Wilson #12;A New Years Trip 7 INTRODUCTION #12;A New Years Trip 8 rom December 26, 2003 to January 3, 2004 my dad and I

Wilson, W. Stephen

22

School Trips in Autumn  

NLE Websites -- All DOE Office Websites (Extended Search)

in Autumn in Autumn Nature Bulletin No. 465-A October 7, 1972 Forest Preserve District of Cook County George W. Dunne, President Roland F. Eisenbeis, Supt. of Conservation SCHOOL TRIPS IN AUTUMN Autumn is an ideal season for classrooms out-of-doors, when teachers and their pupils enjoy and learn from trips to convenient natural areas such as our forest preserves. The days are usually sunny, the air is cool and invigorating, the fields and woodlands are clothed with tapestries of rich colors, the birds are flocking southward, and it is harvest time in all the land. Field trips, now or at any time in the school year, make real and vivid those subjects studied in the classroom and its textbooks. On field trips, teachers and youngsters explore and discover together. They employ all five senses: they see, hear, smell, taste and feel. Such learning, by the most natural and enjoyable process, is rapid and sticks with them. Inevitably, a field trip will yield a fund of unforgettable experiences and a wealth of specimens for the classroom or pupils' own collections.

23

Groceries trip triclosan switch  

Science Journals Connector (OSTI)

... Triclosan interferes with an enzyme crucial to the growth of bacteria. But it also trips ... host of unwanted chemicals. "It's a bacterium's vomit response," explains Gilbert. Triclosan opponents such as Levy are unconvinced. "I don't see a health relevance to ...

Tom Clarke

2001-05-25T23:59:59.000Z

24

EV Project Chevrolet Volt Vehicle Summary Report  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

December 2011 Vehicle Usage Overall fuel economy (mpg) 131 Overall electrical energy consumption (AC Whmi) 271 Number of trips 13,819 Total distance traveled (mi) 108,115 Avg trip...

25

Gobble Up Fuel Savings on Your Next Road Trip with My Trip Calculator...  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

Gobble Up Fuel Savings on Your Next Road Trip with My Trip Calculator Gobble Up Fuel Savings on Your Next Road Trip with My Trip Calculator November 19, 2012 - 9:51am Addthis Save...

26

MonthlyReport  

NLE Websites -- All DOE Office Websites (Extended Search)

74 74 Number of trips 399 Distance traveled (mi) 148 Percent of total distance traveled (%) 73% Average Trip Distance (mi) 0.4 Average Driving Speed (mph) 6.3 Average Stops per mile 35.5 Percent of Regen Braking Energy Recovery (%) 11% City Trips ( < 5 stops/mile & <37 mph avg) DC electrical energy consumption (DC Wh/mi) 423 Number of trips 27 Distance traveled (mi) 54 Percent of total distance traveled (%) 27% Average Trip Distance (mi) 2.0 Average Driving Speed (mph) 20.7 Average Stops per mile 3.5 Percent of Regen Braking Energy Recovery (%) 15% Highway Trips ( 37 mph avg) DC electrical energy consumption (DC Wh/mi) 0 Number of trips 0 Distance traveled (mi) 0 Percent of total distance traveled (%) 0% Average Trip Distance (mi) 0.0 Average Driving Speed (mph)

27

MonthlyReport  

NLE Websites -- All DOE Office Websites (Extended Search)

0 0 Number of trips 493 Distance traveled (mi) 189 Percent of total distance traveled (%) 38% Average Trip Distance (mi) 0.4 Average Driving Speed (mph) 4.9 Average Stops per mile 28.7 Percent of Regen Braking Energy Recovery (%) 15% City Trips ( < 5 stops/mile & <37 mph avg) DC electrical energy consumption (DC Wh/mi) 377 Number of trips 67 Distance traveled (mi) 275 Percent of total distance traveled (%) 56% Average Trip Distance (mi) 4.1 Average Driving Speed (mph) 17.9 Average Stops per mile 3.7 Percent of Regen Braking Energy Recovery (%) 13% Highway Trips ( 37 mph avg) DC electrical energy consumption (DC Wh/mi) 438 Number of trips 1 Distance traveled (mi) 29 Percent of total distance traveled (%) 6% Average Trip Distance (mi) 28.7 Average Driving Speed (mph)

28

MonthlyReport  

NLE Websites -- All DOE Office Websites (Extended Search)

505 505 Number of trips 601 Distance traveled (mi) 245 Percent of total distance traveled (%) 62% Average Trip Distance (mi) 0.4 Average Driving Speed (mph) 5.4 Average Stops per mile 34.8 Percent of Regen Braking Energy Recovery (%) 15% City Trips ( < 5 stops/mile & <37 mph avg) DC electrical energy consumption (DC Wh/mi) 373 Number of trips 35 Distance traveled (mi) 124 Percent of total distance traveled (%) 31% Average Trip Distance (mi) 3.5 Average Driving Speed (mph) 23.0 Average Stops per mile 3.7 Percent of Regen Braking Energy Recovery (%) 13% Highway Trips ( 37 mph avg) DC electrical energy consumption (DC Wh/mi) 319 Number of trips 3 Distance traveled (mi) 25 Percent of total distance traveled (%) 6% Average Trip Distance (mi) 8.5 Average Driving Speed (mph)

29

MonthlyReport  

NLE Websites -- All DOE Office Websites (Extended Search)

613 613 Number of trips 89 Distance traveled (mi) 9 Percent of total distance traveled (%) 30% Average Trip Distance (mi) 0.1 Average Driving Speed (mph) 7.0 Average Stops per mile 44.5 Percent of Regen Braking Energy Recovery (%) 9% City Trips ( < 5 stops/mile & <37 mph avg) DC electrical energy consumption (DC Wh/mi) 487 Number of trips 8 Distance traveled (mi) 5 Percent of total distance traveled (%) 16% Average Trip Distance (mi) 0.6 Average Driving Speed (mph) 25.0 Average Stops per mile 3.8 Percent of Regen Braking Energy Recovery (%) 6% Highway Trips ( 37 mph avg) DC electrical energy consumption (DC Wh/mi) 487 Number of trips 7 Distance traveled (mi) 16 Percent of total distance traveled (%) 54% Average Trip Distance (mi) 2.3 Average Driving Speed (mph)

30

MonthlyReport  

NLE Websites -- All DOE Office Websites (Extended Search)

0 0 Number of trips 1,610 Distance traveled (mi) 372 Percent of total distance traveled (%) 72% Average Trip Distance (mi) 0.2 Average Driving Speed (mph) 5.2 Average Stops per mile 32.1 Percent of Regen Braking Energy Recovery (%) 13% City Trips ( < 5 stops/mile & <37 mph avg) DC electrical energy consumption (DC Wh/mi) 383 Number of trips 114 Distance traveled (mi) 144 Percent of total distance traveled (%) 28% Average Trip Distance (mi) 1.3 Average Driving Speed (mph) 18.3 Average Stops per mile 3.8 Percent of Regen Braking Energy Recovery (%) 16% Highway Trips ( 37 mph avg) DC electrical energy consumption (DC Wh/mi) 549 Number of trips 5 Distance traveled (mi) 2 Percent of total distance traveled (%) 0% Average Trip Distance (mi) 0.4 Average Driving Speed (mph)

31

MonthlyReport  

NLE Websites -- All DOE Office Websites (Extended Search)

530 530 Number of trips 1,308 Distance traveled (mi) 495 Percent of total distance traveled (%) 69% Average Trip Distance (mi) 0.4 Average Driving Speed (mph) 5.6 Average Stops per mile 31.4 Percent of Regen Braking Energy Recovery (%) 15% City Trips ( < 5 stops/mile & <37 mph avg) DC electrical energy consumption (DC Wh/mi) 471 Number of trips 91 Distance traveled (mi) 175 Percent of total distance traveled (%) 24% Average Trip Distance (mi) 1.9 Average Driving Speed (mph) 16.6 Average Stops per mile 3.8 Percent of Regen Braking Energy Recovery (%) 13% Highway Trips ( 37 mph avg) DC electrical energy consumption (DC Wh/mi) 357 Number of trips 2 Distance traveled (mi) 49 Percent of total distance traveled (%) 7% Average Trip Distance (mi) 24.7 Average Driving Speed (mph)

32

Trip rate comparison of workplace and household surveys  

E-Print Network (OSTI)

Available vs. Trip Rate) 14 El Paso Household Survey (Household Income vs. Trip Rate) . 15 El Paso Workplace Survey (Household Income vs. Trip Rate) . 52 52 53 53 54 54 16 BPA Household Survey (Household Size vs. Trip Rate) . . 17 BPA Workplace... Survey (Household Size vs. Trip Rate) . . 56 56 18 BPA Household Survey (No. of Employees vs. Trip Rate) . . 19 BPA Workplace Survey (No. of Employees vs. Trip Rate) . . 20 BPA Household Survey (Vehicles Available vs. Trip Rate) . . 21 BPA Workplace...

Endres, Stephen Michael

2012-06-07T23:59:59.000Z

33

Student Groups Abroad: Trip Leader Handbook Introduction  

E-Print Network (OSTI)

#12;1 Student Groups Abroad: Trip Leader Handbook Introduction This handbook is intended undergraduate and graduate students. The guidelines included in this handbook also apply to such trips. Examples Student club/organization events If you are leading a trip that does not fit any of the above models

34

EV Project Chevrolet Volt Vehicle Summary Report  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

2012 Vehicle Usage Overall fuel economy (mpg) 136 Overall electrical energy consumption (AC Whmi) 222 Number of trips 286,682 Total distance traveled (mi) 2,392,509 Avg...

35

EV Project Chevrolet Volt Vehicle Summary Report  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

March 2012 Vehicle Usage Overall fuel economy (mpg) 139 Overall electrical energy consumption (AC Whmi) 293 Number of trips 76,425 Total distance traveled (mi) 609,737 Avg...

36

Seeking Mountains Field Trip Jasper National Park  

E-Print Network (OSTI)

Seeking Mountains Field Trip Jasper National Park December 14-15, 2012 Jasper National Park of Jasper is one of only four communities located in a Canadian national park. We have arranged a special. The field trip includes as follows: a welcome reception at the Jasper Yellowhead Museum and Archives

MacMillan, Andrew

37

Workshops and Field Trips for Teachers  

NLE Websites -- All DOE Office Websites (Extended Search)

Workshops and Field Trips for Teachers Workshops and Field Trips for Teachers Nature Bulletin No. 534-A Septmeber 7, 1974 Forest Preserve District of Cook County George W. Dunne, President Roland F. Eisenbeis, Supt. of Conservation WORKSHOPS AND FIELD TRIPS FOR TEACHERS The Forest Preserve District, as a part of the educational program conducted by its Department of Conservation, again is offering a series of three-day workshops and another of one-day field trips, during this school year, for teachers in the schools of Chicago and suburban Cook County. Only a few decades ago, most Illinois people resided on farms or in small towns. They lived close to the soil. From childhood they had been so familiar with the out-of-doors that special schooling in ecology, plant life, wildlife and land management seemed superfluous.

38

My Trip to Mongolia | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

My Trip to Mongolia My Trip to Mongolia My Trip to Mongolia September 29, 2010 - 10:37am Addthis Deputy Secretary Poneman meets with Mongolia’s Foreign Minister to discuss energy issues. Deputy Secretary Poneman meets with Mongolia's Foreign Minister to discuss energy issues. Daniel B. Poneman Daniel B. Poneman Deputy Secretary of Energy Last week, I traveled to Mongolia to discuss our shared energy challenges and our shared energy opportunities. The United States and Mongolia enjoy a warm friendship and deepening ties in a number of areas, including energy. The United States is committed to supporting the government and people of Mongolia as they continue to democratize. Although half a world apart, the United States and Mongolia share some common energy features: both our

39

PIA - GovTrip (DOE data) | Department of Energy  

Office of Environmental Management (EM)

PIA - GovTrip (DOE data) PIA - GovTrip (DOE data) More Documents & Publications PIA - INL PeopleSoft - Human Resource System Manchester Software 1099 Reporting PIA, Idaho...

40

Fact #615: March 22, 2010 Average Vehicle Trip Length  

Energy.gov (U.S. Department of Energy (DOE))

According to the latest National Household Travel Survey, the average trip length grew to over 10 miles in 2009, just slightly over the 9.9 mile average in 2001. Trips to work in 2009 increased to...

Note: This page contains sample records for the topic "avg trip distance" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


41

September 17, 2010 SLIPS, TRIPS, FALLS PREVENTION  

E-Print Network (OSTI)

and in an effort to reduce slips, trips and falls we offer the following "best practices" to consider: Be aware Environmental Services for immediate assistance Routinely check for loose power cords and cables; make Environmental Health and Safety 734-3673 Environmental Services 734-3425 Employee Health Services 734

Leistikow, Bruce N.

42

_MainReport  

NLE Websites -- All DOE Office Websites (Extended Search)

26 26 Overall electrical energy consumption (AC Wh/mi) 253 Number of trips¹ 526,156 Total distance traveled (mi) 4,369,753 Avg trip distance (mi)² 8.2 Avg distance traveled per day when the vehicle was driven (mi) 39.4 Avg number of trips between charging events 3.4 Avg distance traveled between charging events (mi) 27.9 Avg number of charging events per day when the vehicle was driven 1.4 EV Project Chevrolet Volt Vehicle Summary Report Region: ALL Number of vehicles: 1766 Reporting period: January 2013 through March 2013 Charging Location Home charging location³ Away-from-home charging locations Unknown charging locations Total number of charging events 124,954 21,973 7,718 Percent of all charging events 81% 14% 5% 1 A trip is defined as all the driving done between consecutive "key-on" and "key-off" events when some distance was traveled.

43

_MainReport  

NLE Websites -- All DOE Office Websites (Extended Search)

26 26 Overall electrical energy consumption (AC Wh/mi) 229 Number of trips¹ 369,118 Total distance traveled (mi) 3,001,976 Avg trip distance (mi) 8.1 Avg distance traveled per day when the vehicle was driven (mi) 40.5 Avg number of trips between charging events 3.5 Avg distance traveled between charging events (mi) 28.2 Avg number of charging events per day when the vehicle was driven 1.4 EV Project Chevrolet Volt Vehicle Summary Report Region: ALL Number of vehicles: 1021 Reporting period: October 2012 through December 2012 Charging Location and Type Home charging location² Away-from- home charging locations³ Unknown charging locations Number of charging events 86,264 13,547 6,698 Percent of all charging events 81% 13% 6% 1 A trip is defined as all the driving done between consecutive "key-on" and "key-off" events when some distance was traveled.

44

_MainReport  

NLE Websites -- All DOE Office Websites (Extended Search)

55 55 Overall electrical energy consumption (AC Wh/mi) 242 Number of trips¹ 147,886 Total distance traveled (mi) 1,184,265 Avg trip distance (mi) 8.0 Avg distance traveled per day when the vehicle was driven (mi) 39.6 Avg number of trips between charging events 3.2 Avg distance traveled between charging events (mi) 26.0 Avg number of charging events per day when the vehicle was driven 1.5 EV Project Chevrolet Volt Vehicle Summary Report Region: ALL Number of vehicles: 408 Reporting period: April 2012 through June 2012 Charging Location and Type Home charging location² Away-from- home charging locations³ Unknown charging locations Number of charging events 36,015 6,374 3,179 Percent of all charging events 79% 14% 7% 1 A trip is defined as all the driving done between consecutive "key-on" and "key-off" events when some distance was traveled.

45

Hunton Group core workshop and field trip  

SciTech Connect

The Late Ordovician-Silurian-Devonian Hunton Group is a moderately thick sequence of shallow-marine carbonates deposited on the south edge of the North American craton. This rock unit is a major target for petroleum exploration and reservoir development in the southern Midcontinent. The workshop described here was held to display cores, outcrop samples, and other reservoir-characterization studies of the Hunton Group and equivalent strata throughout the region. A field trip was organized to complement the workshop by allowing examination of excellent outcrops of the Hunton Group of the Arbuckle Mountains.

Johnson, K.S. [ed.

1993-12-31T23:59:59.000Z

46

School Trips & Projects in Spring  

NLE Websites -- All DOE Office Websites (Extended Search)

& Projects in Spring & Projects in Spring Nature Bulletin No. 484 March 9, 1957 Forest Preserve District of Cook County Daniel Ryan, President Roberts Mann, Conservation Editor David H. Thompson, Senior Naturalist SCHOOL TRIPS & PROJECTS IN SPRINg Spring is the morning of the year when nature reawakens. The days become noticeably longer and warmer. We feel an urge to get out-of- doors and see green growing plants, early wildflowers, and swelling buds on trees and shrubs; see and hear birds returning from their winter homes; hear the mating songs of frogs and toads. The nearest forest preserve, park, meadow or hedgerow -- even a city street or weedy vacant lot -- will have a wealth of plant and animal life. March is a chancy month for field trips but spring can be perking in a classroom before many signs of it appear outdoors. One twig of a forsythia bush, placed in a bottle of water, will soon display its yellow flowers; willow and aspen twigs will develop fat fuzzy catkins; the end of branches from cottonwood, soft maple and elm trees will reveal how some of their winter buds produce flowers and others burst into leaves. The long reddish catkins on a male cottonwood are showy but the small flowers of a maple or an elm are no less beautiful, although seldom noticed on the trees.

47

Fact #728: May 21, 2012 Average Trip Length is Less Than Ten Miles  

Energy.gov (U.S. Department of Energy (DOE))

The average trip length (one-way) is 9.7 miles according to the 2009 Nationwide Personal Transportation Survey. Trip lengths vary by the purpose of the trip. Shopping and family/personal business...

48

Northwest Geological Society Society Field Trips in Pacific Northwest Geology  

E-Print Network (OSTI)

Through the Western Channeled Scablands June 21-22 2008 Bruce Bjornstad #12;This field trip guide has been - 22 2008 Bruce Bjornstad Dry Falls and the Lower Grand Coulee #12;Introduction Ice Age floods were Age flood features is repro- duced from a previous field trips (Bjornstad 2004; Kiver and Bjornstad

49

Dynamic Traffic Assignment Incorporating Commuters Trip Chaining Behavior  

E-Print Network (OSTI)

DYNAMIC TRAFFIC ASSIGNMENT INCORPORATING COMMUTERS TRIP CHAINING BEHAVIOR A Thesis by WEN WANG Submitted to the Office of Graduate Studies of Texas A&M University in partial fulfillment of the requirements for the degree... of MASTER OF SCIENCE August 2011 Major Subject: Civil Engineering Dynamic Traffic Assignment Incorporating Commuters Trip Chaining Behavior Copyright 2011 Wen Wang DYNAMIC TRAFFIC ASSIGNMENT...

Wang, Wen

2012-10-19T23:59:59.000Z

50

China Trip Report May 7-21, 2012  

E-Print Network (OSTI)

1 China Trip Report May 7-21, 2012 Dr. Cathy Meschievitz Director, Office of International Programs Dean of College of A&L) toured China on university business for two weeks May 7-21, 2012. The trip had three main purposes: (1) Visit selected universities and colleges in China to explore partnership

Fernandez, Eduardo

51

A novel fast distance relay for long transmission lines  

Science Journals Connector (OSTI)

Abstract The measuring accuracy and the measurement stability of conventional distance relay will be influenced by complex and remarkable harmonic components due to the large capacitance of the line when it is used for a long line. Correspondingly, the tripping speed will be delayed to some extent. To solve this problem, a fast distance relay for long transmission lines is presented, which is on the basis of the differential equation algorithm using ? transmission line model and the theory of Equal Transfer Process of Transmission Lines (ETPTL). The shortcomings of ? model differential equation algorithm due to the impact of high frequency components can be overcome by using a low-pass filter. The problem resulting from the difference between the transfer feature of the voltages used by the distance protection and that of the currents due to the transient characteristic of coupling capacitor voltage transformers (CCVT) can be solved by using virtual digital CCVT. Then, the new distance relay can trip quickly by re-structuring the voltage at the fault point and iterative calculations. A variety of ATP simulation tests show that the new relay has fast tripping speed and high reliability when applied to the long transmission lines.

Minghao Wen; Deshu Chen; Xianggen Yin

2014-01-01T23:59:59.000Z

52

Tacticycle A Tactile Display for Supporting Tourists on a Bicycle Trip  

E-Print Network (OSTI)

Tacticycle ­ A Tactile Display for Supporting Tourists on a Bicycle Trip Benjamin Poppinga, Martin, tourists, exploration, bicycle 1. BACKGROUND AND MOTIVATION Going on a bicycle trip is a common leisure for bicycles used in touristic trips. Figure 1: A group of tourists on a bicycle trip on an island. In order

Boll, Susanne

53

Energy Secretary Chu Trip to Kokomo, Indiana Cancelled | Department...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Kokomo, Indiana Cancelled Energy Secretary Chu Trip to Kokomo, Indiana Cancelled July 16, 2010 - 12:00am Addthis Washington D.C. - The event today on Friday, July 16 with Energy...

54

Join HERO for an overnight trip to Portland Oregon  

NLE Websites -- All DOE Office Websites (Extended Search)

no later than March 7. The discount code is HER for the HERO Basketball Trip Guestroom Block. Call or e-mail Fred Kelm, 372-1947or FredieRKelm@rl.gov to reserve and pay...

55

Gradient-Based Distance Estimation for Spatial Computers  

Science Journals Connector (OSTI)

......the reduced width area, the average gradient value Gout avg and the SMG value Gout si are shown using Equation (12) and (13). If...Gin si as shown using Equation (14) and (15). Gout avg = nl (a - 1) + nl a + nl (a + 1) nl = a......

Qingzhi Liu; Andrei Pruteanu; Stefan Dulman

2013-12-01T23:59:59.000Z

56

Causal models of trip replanning in TravTek  

SciTech Connect

The TravTek operational field test was conducted to evaluate the effectiveness of route planning, route guidance and various navigational aiding modalities for Advanced Traveler Information Systems in ground vehicles. A causal network was constructed in order to achieve a better understanding of the dependencies among variables implicated in the replanning process. Causal inferences were modeled using path analysis techniques. The original Yoked Driver study reported that addition of real-time navigation planning did not increase trip efficiency during initial trip planning. Data mining of the relatively complete database revealed that the incidence of dynamic trip replanning was only 0.51% or 1 out of every 198 trips. Nevertheless, the replanning acceptance rate was 92.8%, suggesting that less conservative criteria might have been acceptable to drivers. Several points can be made based upon the path analysis techniques. Drivers who rejected better route offers were more likely to be male renters; rejected routes were apparently offered at earlier times with a lower predicted time savings and fewer maneuvers. Failure to accept a better route also apparently resulted in fewer wrong-turn deviations. Contrary to expectations, wrong-turn count and time loss appeared as semi-independent hubs in the resultant causal network. Implications of the path analysis are discussed. Proposals for in-vehicle information systems are formulated to increase driver participation as co-planner, and increase the likelihood that trip replanning will positively impact trip efficiency.

Schryver, J.C.

1998-07-01T23:59:59.000Z

57

UVM Outing Club Trip Logistics Planner All leadership teams taking out Outing Club trips need to complete this form. This is a working  

E-Print Network (OSTI)

UVM Outing Club Trip Logistics Planner All leadership teams taking out Outing Club trips need. Completed and detailed trip logistics planner 2. Copies of all participant AND leader medical forms 3? Copies of medical forms nad logistics planner? Picked up Purchase Orders, Gas Card, and Petty Cash? Food

Hayden, Nancy J.

58

Vehicle Technologies Office: Fact #615: March 22, 2010 Average Vehicle Trip  

NLE Websites -- All DOE Office Websites (Extended Search)

5: March 22, 5: March 22, 2010 Average Vehicle Trip Length to someone by E-mail Share Vehicle Technologies Office: Fact #615: March 22, 2010 Average Vehicle Trip Length on Facebook Tweet about Vehicle Technologies Office: Fact #615: March 22, 2010 Average Vehicle Trip Length on Twitter Bookmark Vehicle Technologies Office: Fact #615: March 22, 2010 Average Vehicle Trip Length on Google Bookmark Vehicle Technologies Office: Fact #615: March 22, 2010 Average Vehicle Trip Length on Delicious Rank Vehicle Technologies Office: Fact #615: March 22, 2010 Average Vehicle Trip Length on Digg Find More places to share Vehicle Technologies Office: Fact #615: March 22, 2010 Average Vehicle Trip Length on AddThis.com... Fact #615: March 22, 2010 Average Vehicle Trip Length According to the latest National Household Travel Survey, the average trip

59

7Tracking a Sea Turtle from a Satellite Day Number Latitude Longitude Distance  

E-Print Network (OSTI)

7Tracking a Sea Turtle from a Satellite Day Number Latitude Longitude Distance (km) 1 0 +5o North in the table above to track the sea turtle from the start of its journey to its end. Use your map to answer these questions: Question 1 - In what part of the world did it begin its trip? Question 2 - Where did the turtle

Christian, Eric

60

Gov. Granholm, Administration Officials to Preview the President's Trip to  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Gov. Granholm, Administration Officials to Preview the President's Gov. Granholm, Administration Officials to Preview the President's Trip to Holland, Michigan Gov. Granholm, Administration Officials to Preview the President's Trip to Holland, Michigan July 14, 2010 - 12:00am Addthis WASHINGTON- Today at 4:00 p.m. EDT, Michigan Governor Jennifer Granholm, White House Communications Director Dan Pfeiffer, and Matt Rogers, Senior Advisor to Energy Secretary Chu, will hold a press conference call ahead of the President's trip to Holland, MI, for the official groundbreaking of the new Compact Power plant. As part of the call, they will preview a new Department of Energy report to be released on Thursday that details how Recovery Act investments are creating jobs and helping to build the domestic advanced battery and electric vehicle industry from the ground

Note: This page contains sample records for the topic "avg trip distance" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


61

Readout of Secretary Chu's Middle East trip: Thursday, February 25 |  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Readout of Secretary Chu's Middle East trip: Thursday, February 25 Readout of Secretary Chu's Middle East trip: Thursday, February 25 Readout of Secretary Chu's Middle East trip: Thursday, February 25 February 25, 2010 - 12:00am Addthis Today, Secretary Chu was in Doha, Qatar, where he began the day by signing a Memorandum of Understanding on Renewable and Alternative Energy with Deputy Prime Minister and Energy & Industry Minister Abdullah bin Hamad Al-Attiyah. The agreement provides a framework for bilateral cooperation with the Ministry and other Qatari institutions on clean energy innovation. He then met with Prime Minister Sheikh Hamad bin Jassim bin Jaber Al Thani. In the afternoon, the Secretary participated in a roundtable focused on renewable energy, hosted by the Qatar National Food Security Program. He then traveled to the Qatar Science and Technology Park (QSTP) where he

62

Assess Employee Awareness of Alternative Commuting and Trip-Reduction  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Assess Employee Awareness of Alternative Commuting and Assess Employee Awareness of Alternative Commuting and Trip-Reduction Programs for Greenhouse Gas Profile Assess Employee Awareness of Alternative Commuting and Trip-Reduction Programs for Greenhouse Gas Profile October 7, 2013 - 2:19pm Addthis YOU ARE HERE: Step 2 For evaluating a greenhouse gas (GHG) profile, success can be measured by employee awareness and use of commuting alternatives and trip-reduction efforts. Efforts include guaranteed ride home programs, and showers for walkers and bicyclists. Low use or awareness of an option, combined with a high willingness to use an option, such as teleworking, may suggest the need to improve communications about available alternatives. Next Steps For evaluating a GHG emissions profile for employee commuting, also learn

63

Logistic regression models for predicting trip reporting accuracy in GPS-enhanced household travel surveys  

E-Print Network (OSTI)

This thesis presents a methodology for conducting logistic regression modeling of trip and household information obtained from household travel surveys and vehicle trip information obtained from global positioning systems (GPS) to better understand...

Forrest, Timothy Lee

2007-04-25T23:59:59.000Z

64

A Computational-based Approach for the Design of Trip Steels  

E-Print Network (OSTI)

The purpose of this work is to optimize the chemical composition as well as the heat treatment for improving the mechanical performance of the TRIP steel by employing the theoretical models. TRIP steel consists of the microstructure with ferrite...

Li, Sheng-Yen

2013-08-06T23:59:59.000Z

65

Secretary Chu Postpones China Trip to Continue Work on BP Oil...  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

Postpones China Trip to Continue Work on BP Oil Spill Response Efforts Secretary Chu Postpones China Trip to Continue Work on BP Oil Spill Response Efforts May 21, 2010 - 12:00am...

66

SWAMP Project Trip report Quantification of Carbon Stocks and Emissions  

E-Print Network (OSTI)

1 SWAMP Project Trip report Quantification of Carbon Stocks and Emissions from the Mangrove Forests University Corvallis, Oregon, USA. #12;2 1. Introduction Funding for this project came from a grant, Washington DC. This intensive study is part of the Sustainable Wetlands Adaptation and Mitigation Program

Tullos, Desiree

67

Usage Codes Observer code Vessel code Trip ID  

E-Print Network (OSTI)

Usage Codes 1 5 2 6 3 7 4 8 Observer code Vessel code Trip ID Permit holder name/address Permit / N MMSI No. Y / N Present? Usage Water capacity (m3): Fuel capacity: m3 / tonnes Other: Other: Kw all that apply & note types of materials for each) Capacity: Usage Incinerator: Net mensuration Y / N

68

Usage Codes Observer code Vessel code Trip ID  

E-Print Network (OSTI)

Usage Codes 1 5 2 6 3 7 4 8 Sonar Observer code Vessel code Trip ID Additional Information KHz: RPM / Other _______________Global Registry ID:MMSI No. Permit expiration (dd-mm- yy): Y / N Present? Usage contact Diver / dive equipment Usage Manufacturer Hull mounted / towed Catch Y / N Other: Y / N Y / NOther

69

FALL 2012 TRIPS SEPT. 8 (Saturday) HIKE & SPLASH  

E-Print Network (OSTI)

County. We have reserved the whole campground, so it should be a fun time. We will get there in time (Saturday) ( Beginner ­ Advanced) CLIMBING Kings Bluff, TN $22 Sign-up by: Friday, Sept. 14 Pre-Trip Meeting: Wednesday, 9/19 at 5:00 PM Wall climbers, it's time to try the "real thing"! Kings Bluff is a great location

Bordenstein, Seth

70

SAFETY TRIP REPORT ON US-JAPAN EXCHANGE PROGRAM  

E-Print Network (OSTI)

SAFETY TRIP REPORT ON US-JAPAN EXCHANGE PROGRAM (FuY 2007) #12;Report on the 12th Meeting of the Joint Working Group of the U.S.-Japan Coordinating Committee of Fusion Energy on Safety in Inter-Institutional Collaborations (U.S.-Japan Safety Monitoring Program) Meeting in Japan, March 9-22, 2008 #12;A. PURPOSE

Princeton Plasma Physics Laboratory

71

Control #15421 In this paper we present a method of optimally scheduling trips travelling down  

E-Print Network (OSTI)

Control #15421 SUMMARY In this paper we present a method of optimally scheduling trips travelling of trips as parameters and generates a schedule that maximizes the number of trips and determines when each schedule in which human interactions are minimized. Starting with a mathematically derived upper bound

Morrow, James A.

72

Understanding tourists on a bicycle trip "in the wild" Martin Pielot, Benjamin Poppinga  

E-Print Network (OSTI)

Understanding tourists on a bicycle trip "in the wild" Martin Pielot, Benjamin Poppinga OFFIS the requirements analysis by con- ducting a survey and a field study to understand tourists on a bicycle trip. Both work we designed a pervasive navigation aid for tourists on a bicycle trip. At first, we aimed

Boll, Susanne

73

Vehicle Technologies Office: Fact #728: May 21, 2012 Average Trip Length is  

NLE Websites -- All DOE Office Websites (Extended Search)

8: May 21, 2012 8: May 21, 2012 Average Trip Length is Less Than Ten Miles to someone by E-mail Share Vehicle Technologies Office: Fact #728: May 21, 2012 Average Trip Length is Less Than Ten Miles on Facebook Tweet about Vehicle Technologies Office: Fact #728: May 21, 2012 Average Trip Length is Less Than Ten Miles on Twitter Bookmark Vehicle Technologies Office: Fact #728: May 21, 2012 Average Trip Length is Less Than Ten Miles on Google Bookmark Vehicle Technologies Office: Fact #728: May 21, 2012 Average Trip Length is Less Than Ten Miles on Delicious Rank Vehicle Technologies Office: Fact #728: May 21, 2012 Average Trip Length is Less Than Ten Miles on Digg Find More places to share Vehicle Technologies Office: Fact #728: May 21, 2012 Average Trip Length is Less Than Ten Miles on AddThis.com...

74

Focus on International Cooperation Continues, Secretary Chu Ends Trip with  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Focus on International Cooperation Continues, Secretary Chu Ends Focus on International Cooperation Continues, Secretary Chu Ends Trip with Visit to Russian 'Los Alamos' Focus on International Cooperation Continues, Secretary Chu Ends Trip with Visit to Russian 'Los Alamos' June 10, 2011 - 2:05pm Addthis Lindsey Geisler Lindsey Geisler Public Affairs Specialist, Office of Public Affairs Secretary Chu wrapped up his week-long visit in Russia today with a special visit to the All Russian Scientific Research Institute of Experimental Physics (VNIIEF). Many consider it to be the Russian equivalent of our Los Alamos National Laboratory. VNIIEF, located in Sarov, has a long scientific tradition in Russia, beginning when it was established in 1946 to design nuclear weapons. It's also where the first Soviet nuclear bomb, the "RDS-1," was created.

75

Focus on International Cooperation Continues, Secretary Chu Ends Trip with  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Focus on International Cooperation Continues, Secretary Chu Ends Focus on International Cooperation Continues, Secretary Chu Ends Trip with Visit to Russian 'Los Alamos' Focus on International Cooperation Continues, Secretary Chu Ends Trip with Visit to Russian 'Los Alamos' June 10, 2011 - 2:05pm Addthis Lindsey Geisler Lindsey Geisler Public Affairs Specialist, Office of Public Affairs Secretary Chu wrapped up his week-long visit in Russia today with a special visit to the All Russian Scientific Research Institute of Experimental Physics (VNIIEF). Many consider it to be the Russian equivalent of our Los Alamos National Laboratory. VNIIEF, located in Sarov, has a long scientific tradition in Russia, beginning when it was established in 1946 to design nuclear weapons. It's also where the first Soviet nuclear bomb, the "RDS-1," was created.

76

E-Print Network 3.0 - america field trip Sample Search Results  

NLE Websites -- All DOE Office Websites (Extended Search)

Tour 2012 You have heard of the immense biodiversity of Central America... banding and ecotourism activities. After travel to Nicaragua, the trip will start off in Finca de...

77

Vehicle Technologies Office Merit Review 2014: Trip Prediction and Route-Based Vehicle Energy Management  

Energy.gov (U.S. Department of Energy (DOE))

Presentation given by Argonne National Laboratory at 2014 DOE Hydrogen and Fuel Cells Program and Vehicle Technologies Office Annual Merit Review and Peer Evaluation Meeting about trip prediction...

78

E-Print Network 3.0 - affect foraging-trip duration Sample Search...  

NLE Websites -- All DOE Office Websites (Extended Search)

with mean foraging... ;Thompson et al. 1045 1998 NRC Canada foraging-trip duration (Boyd et al. 1994), it is not clear whether... foraging within traditional foraging areas....

79

IMPROVING THE ROBUSTNESS OF FUZZY LOGIC ATM ABR RATE CONTROL FOR LARGE ROUND TRIP TIMES  

E-Print Network (OSTI)

IMPROVING THE ROBUSTNESS OF FUZZY LOGIC ATM ABR RATE CONTROL FOR LARGE ROUND TRIP TIMES Lachlan L in the presence of a large round trip time (RTT). A simple fuzzy logic controller was recently shown to perform. In recent years, fuzzy logic [4,5] has shown promise in the control of complex systems, and several fuzzy

Andrew, Lachlan

80

Danyi Wang and Dr. Lance Sherry 1 Trend Analysis of Airline Passenger Trip Delays  

E-Print Network (OSTI)

metrics. Researchers have shown that flight-based metrics do not accurately reflect the passenger trip by a combination of different factors such as traffic volume and weather condition, disruptions (flight delays shown that flight-based performance metrics do not accurately reflect the passenger trip experience [3

Note: This page contains sample records for the topic "avg trip distance" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


81

Learn more about the summer course which includes a 3 week trip to South Africa.  

E-Print Network (OSTI)

Learn more about the summer course which includes a 3 week trip to South Africa. The program an introduction to the historical and the con- temporary South Africa as well as at least one post trip meeting@binghamton.edu or Josephine Allen at jaallen@binghamton.edu. Destination South Africa - Summer Course 2012 February 28th

Suzuki, Masatsugu

82

Readout of Secretary Chu's Middle East trip: Thursday, February 25 |  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Thursday, February 25 Thursday, February 25 Readout of Secretary Chu's Middle East trip: Thursday, February 25 February 25, 2010 - 12:00am Addthis Today, Secretary Chu was in Doha, Qatar, where he began the day by signing a Memorandum of Understanding on Renewable and Alternative Energy with Deputy Prime Minister and Energy & Industry Minister Abdullah bin Hamad Al-Attiyah. The agreement provides a framework for bilateral cooperation with the Ministry and other Qatari institutions on clean energy innovation. He then met with Prime Minister Sheikh Hamad bin Jassim bin Jaber Al Thani. In the afternoon, the Secretary participated in a roundtable focused on renewable energy, hosted by the Qatar National Food Security Program. He then traveled to the Qatar Science and Technology Park (QSTP) where he

83

Readout of Secretary Chu's Middle East trip: Tuesday, February 23 |  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Tuesday, February 23 Tuesday, February 23 Readout of Secretary Chu's Middle East trip: Tuesday, February 23 February 23, 2010 - 12:00am Addthis Today, Secretary Chu visited King Abdullah University of Science and Technology (KAUST) in Thuwal, Saudi Arabia, on the Red Sea coast near Jeddah. His host was Saudi Minister of Petroleum and Minerals Ali Al Naimi, who is Chair of the KAUST Board of Trustees. KAUST is an international, graduate-level research university dedicated to science and technology that opened in September of 2009. The Secretary received a briefing on scientific work underway at the university from Professor Choon Fong Shih, President of KAUST, faculty members and students. Secretary Chu emphasized the Administration's commitment to science and to the development of renewable sources of energy. He quizzed members of the

84

Readout of Secretary Chu's Middle East trip: Wednesday, February 24 |  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Wednesday, February 24 Wednesday, February 24 Readout of Secretary Chu's Middle East trip: Wednesday, February 24 February 24, 2010 - 12:00am Addthis Today, Secretary Chu was in Abu Dhabi in the United Arab Emirates, where he affirmed the commitment of the United States to building a close relationship with the UAE on clean energy issues. He began the day with a meeting with the Minister of Energy for UAE, Mohammed bin Dha'en el Hamili. He then signed an Implementing Agreement on nuclear energy and nonproliferation with UAE Minister of State for Foreign Affairs Dr. Anwar Gargash. The Secretary traveled to the offices of the Masdar Initiative to discuss the work the initiative is doing to diversify the UAE economy and develop global leadership in alternative energy. He was hosted by Dr.

85

Visibility Distance of Pedestrians  

Science Journals Connector (OSTI)

... actual experiment the distance at which the driver of a motor vehicle can see a pedestrian who is walking along the side of a highway at night. The tests are ... Inst., March). The principal conclusions arrived at are that the visibility of a pedestrian walking along a highway at night is increased by roughly 50 per cent by showing ...

1935-07-13T23:59:59.000Z

86

Early embryonic lethality caused by targeted disruption of the TRAF-interacting protein (TRIP) gene  

SciTech Connect

Tumor necrosis factor receptor (TNFR)-associated factors (TRAFs) are key adaptor molecules in the TNFR-signaling complexes that promote a wide variety of signaling cascades including cell proliferation, activation, differentiation, and apoptosis. TRAF-interacting protein (TRIP) is required for the inhibitory regulation of TNF-induced NF-{kappa}B signaling via the TNFR/TRAF-signaling complexes in vitro. TRIP also directly interacts with the familial cylindromatosis tumor suppressor gene (CYLD) and negatively regulates NF-{kappa}B activation in vitro. However, although there appears to be a relationship between TRIP, the TRAFs and also CYLD as modulators of NF-{kappa}B signaling in vitro, the functional role of TRIP in vivo is still unclear. To identify the role of TRIP in vivo, we have generated TRIP-deficient mice. Homozygous mouse embryos were found to die shortly after implantation due to proliferation defects and excessive cell death. These results indicate that TRIP is an essential factor during early mouse embryonic development in vivo.

Park, Eui-Soon; Choi, Seunga [Department of Microbiology and BK21 BioBC, Chungnam National University, Daejeon 305-764 (Korea, Republic of); RCTCP, Chungnam National University, Daejeon 305-764 (Korea, Republic of); Kim, Jin-Man [Department of Pathology, Chungnam National University, Daejeon 305-764 (Korea, Republic of); Jeong, Yongsu [Department of Pathology and Laboratory Medicine, University of Pennsylvania School of Medicine, Philadelphia, PA 19104 (United States); Choe, Joonho [Department of Biological Sciences, KAIST, Daejeon 305-701 (Korea, Republic of); Park, Chang-Sik [RCTCP, Chungnam National University, Daejeon 305-764 (Korea, Republic of); Choi, Yongwon [Department of Pathology and Laboratory Medicine, University of Pennsylvania School of Medicine, Philadelphia, PA 19104 (United States); Rho, Jaerang [Department of Microbiology and BK21 BioBC, Chungnam National University, Daejeon 305-764 (Korea, Republic of); RCTCP, Chungnam National University, Daejeon 305-764 (Korea, Republic of)], E-mail: jrrho@cnu.ac.kr

2007-11-30T23:59:59.000Z

87

DOE Solar Decathlon: Tuskegee University: Going the Distance  

NLE Websites -- All DOE Office Websites (Extended Search)

Tuskegee University house on the National Mall in Washington, D.C., during Solar Decathlon 2002. Tuskegee University house on the National Mall in Washington, D.C., during Solar Decathlon 2002. Enlarge image The Tuskegee Solar Decathlon team got its inspiration from traditional Southern architecture, which relies on passive cooling strategies such as the dogtrot, a central shaded breezeway that runs through the house. (Credit: Paul Norton/U.S. Department of Energy Solar Decathlon) Who: Tuskegee University What: Solar house Where: Tuskegee University 1200 W. Montgomery Road Tuskegee, AL 36088 Map This House Public tours: Not available Solar Decathlon 2002 Tuskegee University: Going the Distance Tuskegee University students successfully overcame funding and time limitations to make the trip to Washington, D.C., for the U.S. Department of Energy Solar Decathlon 2002. Now, with time back on its side, the

88

Secretary Chu Postpones China Trip to Continue Work on BP Oil Spill  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Postpones China Trip to Continue Work on BP Oil Spill Postpones China Trip to Continue Work on BP Oil Spill Response Efforts Secretary Chu Postpones China Trip to Continue Work on BP Oil Spill Response Efforts May 21, 2010 - 12:00am Addthis Washington DC -- Energy Secretary Steven Chu will postpone a trip to China, scheduled for next week, at the request of President Obama and stay in the country to continue his work on response efforts to the BP oil spill. "Finding a solution to this crisis is a matter of national importance," Secretary Chu said. "I want to continue to play a role in assisting in the efforts and stopping this leak as soon as possible." Secretary Chu was originally scheduled to visit Beijing and Shanghai and discuss further progress on bilateral clean energy cooperation.

89

U.S. Energy Secretary Bodman Completes Middle East Trip | Department of  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Secretary Bodman Completes Middle East Trip Secretary Bodman Completes Middle East Trip U.S. Energy Secretary Bodman Completes Middle East Trip November 20, 2005 - 2:51pm Addthis WASHINGTON, DC - U.S. Secretary of Energy Samuel W. Bodman concluded his four-nation swing through the Middle East this weekend, by attending the inauguration of the New Permanent Headquarter Office Building of the International Energy Forum (IEF) Secretariat and participating in a number of bilateral meetings in Riyadh, Saudi Arabia. "This trip allowed me to meet face-to-face with leaders of energy-producing nations and discuss with them the energy goals and needs of the United States," Secretary Bodman said. "Especially in the aftermath of the hurricanes in the Gulf of Mexico this year, we recognize how important it

90

Microstructure-Based Computational Modeling of TRIP Steels with Dispersed Particles  

E-Print Network (OSTI)

in this study. The ideas surrounding the behavior of transformation induced plasticity (TRIP) steels and particle reinforced composites are combined and investigated. A finite element model (FEM) is created to investigate the effects of dispersed ceramic...

Diaz, Sara Cristina

2012-10-19T23:59:59.000Z

91

Field trip guide to selected outcrops, Arbuckle Mountains, Oklahoma  

SciTech Connect

The Arbuckle Mountains, named for Brigadier General Matthew Arbuckle, are located in south-central Oklahoma. The formations that comprise the Arbuckle Mountains have been extensively studied for hydrocarbon source rock and reservoir rock characteristics that can be applied to the subsurface in the adjacent Anadarko and Ardmore basins. Numerous reports and guidebooks have been written concerning the Arbuckle Mountains. A few important general publications are provided in the list of selected references. The purpose of this handout is to provide general information on the geology of the Arbuckle Mountains and specific information on the four field trip stops, adapted from the literature. The four stops were at: (1) Sooner Rock and Sand Quarry; (2) Woodford Shale; (3) Hunton Anticline and Hunton Quarry; and (4) Tar Sands of Sulfur Area. As part of this report, two papers are included for more detail: Paleomagnetic dating of basinal fluid migration, base-metal mineralization, and hydrocarbon maturation in the Arbuckle Mountains, Oklahoma and Laminated black shale-bedded chert cyclicity in the Woodford Formation, southern Oklahoma.

NONE

1991-11-17T23:59:59.000Z

92

DISTANCES TO DARK CLOUDS: COMPARING EXTINCTION DISTANCES TO MASER PARALLAX DISTANCES  

SciTech Connect

We test two different methods of using near-infrared extinction to estimate distances to dark clouds in the first quadrant of the Galaxy using large near-infrared (Two Micron All Sky Survey and UKIRT Infrared Deep Sky Survey) surveys. Very long baseline interferometry parallax measurements of masers around massive young stars provide the most direct and bias-free measurement of the distance to these dark clouds. We compare the extinction distance estimates to these maser parallax distances. We also compare these distances to kinematic distances, including recent re-calibrations of the Galactic rotation curve. The extinction distance methods agree with the maser parallax distances (within the errors) between 66% and 100% of the time (depending on method and input survey) and between 85% and 100% of the time outside of the crowded Galactic center. Although the sample size is small, extinction distance methods reproduce maser parallax distances better than kinematic distances; furthermore, extinction distance methods do not suffer from the kinematic distance ambiguity. This validation gives us confidence that these extinction methods may be extended to additional dark clouds where maser parallaxes are not available.

Foster, Jonathan B.; Jackson, James M. [Institute for Astrophysical Research, Boston University, Boston, MA 02215 (United States); Stead, Joseph J.; Hoare, Melvin G. [School of Physics and Astronomy, University of Leeds, Leeds LS2 9JT (United Kingdom); Benjamin, Robert A., E-mail: jbfoster@bu.edu, E-mail: jackson@bu.edu, E-mail: J.J.Stead@leeds.ac.uk, E-mail: mgh@ast.leeds.ac.uk, E-mail: benjamin@astro.wisc.edu [Physics Department, University of Wisconsin Whitewater, Whitewater, WI 53190 (United States)

2012-06-01T23:59:59.000Z

93

U.S. Secretary of Energy Concludes Successful Trip to Trinidad and Tobago |  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Successful Trip to Trinidad and Successful Trip to Trinidad and Tobago U.S. Secretary of Energy Concludes Successful Trip to Trinidad and Tobago May 13, 2008 - 12:00pm Addthis Visit continues bilateral efforts to advance energy security WASHINGTON, DC - U.S. Secretary of Energy Samuel W. Bodman today concluded a visit to the Republic of Trinidad and Tobago focused on strengthening and expanding the two nations' strategic energy and economic relationship. The United States is Trinidad and Tobago's largest market for liquefied natural gas (LNG), importing nearly 60 percent of the LNG exported from the country. As such, the country plays an integral role in advancing the Bush Administration's strategy to ensure safe, reliable, clean and diverse energy supplies in the United States. "The United States is proud of its relationship with a strong and open

94

Secretary Chu to Visit Google Headquarters During Trip to San Francisco |  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Google Headquarters During Trip to San Google Headquarters During Trip to San Francisco Secretary Chu to Visit Google Headquarters During Trip to San Francisco October 21, 2010 - 12:00am Addthis Washington, DC - During a visit to San Francisco tomorrow, Friday, Oct. 22, U.S. Energy Secretary Steven Chu will visit Google, Inc. headquarters to participate in a fireside chat with company employees to discuss the Obama Administration's vision for a clean and renewable energy economy. While at Google, Secretary Chu will also participate in a series of briefings with company researchers and scientists to learn more about the company's innovative ventures in the energy sector. WHAT: U.S. Energy Secretary Steven Chu to participate in fireside chat at Google, Inc. WHEN: Friday, October 22, 2010

95

Google+ virtual field trip: "Vehicle Electrification" (11/18/13) | Argonne  

NLE Websites -- All DOE Office Websites (Extended Search)

Google+ virtual field trip: "Vehicle Electrification" (11/18/13) Google+ virtual field trip: "Vehicle Electrification" (11/18/13) Share Topic Energy Energy efficiency Vehicles Electric drive technology Browse By - Any - Energy -Energy efficiency --Vehicles ---Alternative fuels ---Automotive engineering ---Diesel ---Electric drive technology ---Hybrid & electric vehicles ---Powertrain research --Building design ---Construction --Manufacturing -Energy sources --Renewable energy ---Bioenergy ---Solar energy --Fossil fuels ---Natural Gas --Nuclear energy ---Nuclear energy modeling & simulation ---Nuclear fuel cycle ---Reactors -Energy usage --Energy storage ---Batteries ----Lithium-ion batteries ----Lithium-air batteries --Electricity transmission --Smart Grid Environment -Biology --Computational biology --Environmental biology

96

Climbing the cosmological distance ladder  

Science Journals Connector (OSTI)

......knowledge of cosmological distance - towards redshift 1000! Humankind's efforts to measure the distances of the planets, stars...the epoch when matter and radiation finally decoupled at the end of the hot Big Bang phase. Apparently we have reached a precision......

Michael Rowan-Robinson

2008-06-01T23:59:59.000Z

97

2008 ITE Data Collection Project Proposal Project Type: Outdoor Sport Field Trip and Parking Generation Data Collection  

E-Print Network (OSTI)

2008 ITE Data Collection Project Proposal Project Type: Outdoor Sport Field Trip and Parking Generation Data Collection The Portland State University ITE Chapter proposes to collect multimodal trip and parking generation data for an outdoor school sport field. This effort is intended to complement

Bertini, Robert L.

98

PORT LIONS RURAL TRIP 2010, A. KAILING & L. WOOD Who are you? We are  

E-Print Network (OSTI)

PORT LIONS RURAL TRIP 2010, A. KAILING & L. WOOD Who are you? We are graduate students to and accommodate them. What did you learn? We learned that the Native population in Port Lions are Alutiiq visited Port Lions, a small village on the Northwest coast of Kodiak Island. What did you do? Amanda

Pantaleone, Jim

99

A Simulated Field Trip: "The Visual Aspects of Power Plant Sitings1"  

E-Print Network (OSTI)

A Simulated Field Trip: "The Visual Aspects of Power Plant Sitings1" Bill Bottom 2 Alex Young 3 of conventional thermal (fossil fuel and nuclear), geo- thermal, wind and solar power plants. There are several be dependent on conventional thermal power plants to generate electricity. These power plants are powered

Standiford, Richard B.

100

Performance of Fuzzy Logic ABR Rate Control with Large Round Trip Times  

E-Print Network (OSTI)

Performance of Fuzzy Logic ABR Rate Control with Large Round Trip Times KUAN Su-Hsien and Lachlan L hip times (R`ITs), which can cause instability in control algorithms. A brief review of fuzzy logic of B recently pm- posed funy logic controller for ABR with a simple thresholdbased scheme in this case

Andrew, Lachlan

Note: This page contains sample records for the topic "avg trip distance" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


101

Field Trips Biosphere 2 ~ Where Science Lives! (9:30--4:00)  

E-Print Network (OSTI)

) and their impacts on carbon, water, and energy cycling. The trip will continue to Oracle State Park (http, and sustainable ecosystem function provide additional topics for discussion. Traveling by van, our stops include), locations associated with the `virtual fence' SBInet, and the U.S. / Mexico border wall. We will also talk

102

Acceptance test procedure for removal of CS1K circuit switcher block and trip schemes  

SciTech Connect

This supporting document provides a detailed process to test the functions of the circuit switcher, protective relays, alarms, SCADA and 125VDC control logic of 115kV and 13.8kV systems at B3S4 substation following the removal of trip and blocking schemes to Transformer No.1 Circuit Switcher B594.

HACHE, J.M.

1999-08-25T23:59:59.000Z

103

Google+ Virtual Field Trip on Vehicle Electrification at Argonne National Laboratory  

Energy.gov (U.S. Department of Energy (DOE))

Don't miss this exclusive peek into the U.S. Department of Energy's Argonne National Laboratory. Attendees will meet three researchers who will explain a different phase of vehicle electrification research. This field trip is very similar to the tou

104

Two Trips to Gorilla Land and the Cataracts of the Congo  

Science Journals Connector (OSTI)

... the public for so long the narrative of his trips to the Gaboon and the Congo. Moreover, as he says himself, Africa moves so slowly, that ten years makes ... the region with which it is concerned; the German African Society have taken up the Congo district as a point de dpart for the interior, and although the expedition sent ...

1875-12-16T23:59:59.000Z

105

Sambhav Nepal On this trip, we will be working with Sambhav Nepal.  

E-Print Network (OSTI)

Sambhav Nepal On this trip, we will be working with Sambhav Nepal. Their current mission is to achieve grassroots reforms in educational and health infrastructure in the villages of Gorkha, Nepal, so is a government-run secondary school where you might be running classes. Sambhav Nepal has been running some

Blennerhassett, Peter

106

PERIODIC HEAT REPORT  

NLE Websites -- All DOE Office Websites (Extended Search)

186.00 TripHigh tc Date MO:DAY 1.00: 16.00 TripHigh tc Time HR:MIN 10.00: 9.00 Ports Temp: Avg, High, Low 19.00, 21.00, 17.00 Coils Temp: Avg, High, Low 19.00, 21.00,...

107

Commute trip reduction in Washington: Base year worksite characteristics and programs  

SciTech Connect

Employers in Washington`s eight most populous counties are engaged in an effort to reduce their employees` use of single occupant automobiles for commuting. This report documents the status of those employers at the beginning of the Commute Trip Reduction (CTR) program as a basis for evaluating the impacts of the program. The first section provides a brief exploration of the Washington CTR Law and a history of the first steps in its implementation. The second section presents a summary of the characteristics of the worksites affected by the law. The CTR Law calls for reductions in single occupant vehicle (SOV) commuting and in vehicle miles traveled (VMT). The third section of this report presents baseline measurements of SOV and VMT and goals for reducing them. The fourth section provides summary information on the first year of programs employers planned to implement. The final section very briefly outlines actions the Commute Trip Reduction law calls for between 1995 and 1999.

Dodds, D.

1995-02-01T23:59:59.000Z

108

PAYMENT INFORMATION There are several fees that are part of participating in the DOC First Year Trips Program for  

E-Print Network (OSTI)

, provide organic cotton t-shirts for our participants, and use bio-diesel fuel for busses during Trips organic food during the program, provide organic cotton t-shirts for our participants, and use bio-diesel

Lotko, William

109

Revealing cyclic hardening mechanism of a TRIP steel by real-time in situ neutron diffraction  

SciTech Connect

Real-time in situ neutron diffraction was performed on a transformation-induced plasticity (TRIP) steel under cyclic loading at room temperature. By Rietveld refinement and single peak analysis, the volume fraction and average stress estimates as well as dislocation density of individual phases (austenite and martensite phase) were derived. The results reveal that the volume fraction of martensite phase, instead of individual phase strengthening, should be accounted for the remarkable secondary cyclic hardening.

Yu, Dunji [ORNL; An, Ke [ORNL; Chen, Yan [ORNL; Chen, Xu [Tianjin UNiversity, China

2014-01-01T23:59:59.000Z

110

Assess Employee Awareness of Alternative Commuting and Trip-Reduction Programs for Greenhouse Gas Profile  

Energy.gov (U.S. Department of Energy (DOE))

For evaluating a greenhouse gas (GHG) profile, success can be measured by employee awareness and use of commuting alternatives and trip-reduction efforts. Efforts include guaranteed ride home programs, and showers for walkers and bicyclists. Low use or awareness of an option, combined with a high willingness to use an option, such as teleworking, may suggest the need to improve communications about available alternatives.

111

Trip Report  

Office of Legacy Management (LM)

Department of Energy 2013 Annual Inspection - Piqua, OH, Decommissioned Reactor Site Department of Energy 2013 Annual Inspection - Piqua, OH, Decommissioned Reactor Site June 2013 Page 1 2013 Annual Inspection and Radiological Survey Results for the Piqua, Ohio, Decommissioned Reactor Site Summary The former Piqua Nuclear Power Facility (PNPF), a decommissioned nuclear power demonstration facility, was inspected on April 18, 2013. The site, located on the east bank of the Great Miami River in Piqua, Ohio, is in good physical condition. There is no requirement for a

112

Trip Report  

Office of Legacy Management (LM)

Site A/Plot M, Cook County, Illinois Site A/Plot M, Cook County, Illinois May 2013 Page 1 2013 Inspection and Annual Site Status Report for the Site A/Plot M, Cook County, Illinois Decontamination and Decommissioning Program Site Summary Site A/Plot M was inspected on April 10, 2013. The site, located within a county forest preserve with significant tree and grass cover, was in good condition. No cause for a follow-up inspection was identified. Erosion on top of the grass covered mound at Plot M continues to be a concern. Bike traffic produces ruts which if left unfixed grow and threaten the protectiveness of the soil cover on top of the mound. In 2010 ANL personnel repaired two areas at Plot M by filling in the ruts with clean top soil and re-seeding. In 2012, additional repairs were made by ANL personnel. Three-

113

Trip Report  

Office of Legacy Management (LM)

to be used to improve the efficiency and effectiveness of site maintenance activities. Oil and gas exploration activity around the site continues to increase. A new drilling pad...

114

Toxics Release Inventory Expansion Rule Phase 3 (TRI-P3)  

SciTech Connect

The ORR [East Tennessee Technology Park (ETTP), Y-12 Plant, and Oak Ridge National Laboratory (ORNL)] is considered a single facility for reporting by the DOE prime contractors. The processing, manufacturing, or "otherwise use" Section313 chemicals are combined to determine TRI reportability. Such is the case with lead metal, which is one of two chemicals for which reportin~ forms were prepared in this pilot study (Task 2;1. The lead shop at ORNL exceeded the reporting threshold, causing a lead activity at a Y-1 2 machine shop and lead in waste at ETTP to be reportable. TRI-P3 report preparation time for lead totaled 36.5 hours. The second chemical investigated and reported (chromium) also required nearly a man-week for report preparation and documentation by experienced TRI personnel. The ORR TRI report typically includes about six chemicals, so an estimate of the TRI-P3 incremental reporting burden for ORR would be six weeks for experienced personnel axI d two/three man-months for first-time ORR preparers.

Evans, R.A.; Saunders, A.D.; Worley, G.G.

1998-09-01T23:59:59.000Z

115

"Climate change in Massachusetts: What would Henry say?" A field trip-based course for Fall 2011  

E-Print Network (OSTI)

1 Syllabus "Climate change in Massachusetts: What would Henry say?" A field trip-based course and animals of Massachusetts, and his records are now being used to document the reality of climate change. If Thoreau were alive today, he could readily observe the impacts of climate change and other human

Guenther, Frank

116

Engineering Student YouTube Contest! Enter to win a trip to Ottawa to meet the leaders of the  

E-Print Network (OSTI)

clearly: "Why I want to be a Consulting Engineer". Creativity and presentation skills will be taken1 Engineering Student YouTube Contest! Enter to win a trip to Ottawa to meet the leaders of the Canadian consulting engineering industry! How It Works 1. Become a fan of the Association of Consulting

Thompson, Michael

117

Scattering theory without large-distance asymptotics  

E-Print Network (OSTI)

In conventional scattering theory, to obtain an explicit result, one imposes a precondition that the distance between target and observer is infinite. With the help of this precondition, one can asymptotically replace the Hankel function and the Bessel function with the sine functions so that one can achieve an explicit result. Nevertheless, after such a treatment, the information of the distance between target and observer is inevitably lost. In this paper, we show that such a precondition is not necessary: without losing any information of distance, one can still obtain an explicit result of a scattering rigorously. In other words, we give an rigorous explicit scattering result which contains the information of distance between target and observer. We show that at a finite distance, a modification factor --- the Bessel polynomial --- appears in the scattering amplitude, and, consequently, the cross section depends on the distance, the outgoing wave-front surface is no longer a sphere, and, besides the phase...

Liu, Tong; Dai, Wu-Sheng

2014-01-01T23:59:59.000Z

118

Optical distance measurement device and method thereof  

DOE Patents (OSTI)

A system and method of efficiently obtaining distance measurements of a target. A modulated optical beam may be used to determine the distance to the target. A first beam splitter may be used to split the optical beam and a second beam splitter may be used to recombine a reference beam with a return ranging beam. An optical mixing detector may be used in a receiver to efficiently detect distance measurement information.

Bowers, Mark W. (Patterson, CA)

2003-05-27T23:59:59.000Z

119

11-08-10 7:28 AMSouth Africa trip gives students hope -Canstar Page 1 of 3http://www.printthis.clickability.com/pt/cpt?expire=&title=South+Afric...es%2Fsouwester%2FSouth-Africa-trip-gives-students-hope-127332108.html  

E-Print Network (OSTI)

11-08-10 7:28 AMSouth Africa trip gives students hope - Canstar Page 1 of 3http://www.printthis.clickability.com/pt/cpt?expire=&title=South right) are among the students pictured during a recent visit to South Africa. A police officer's desire for social justice!prompted a recent trip to South Africa to learn about racial segregation and living

Martin, Jeff

120

Scattering theory without large-distance asymptotics  

E-Print Network (OSTI)

In conventional scattering theory, to obtain an explicit result, one imposes a precondition that the distance between target and observer is infinite. With the help of this precondition, one can asymptotically replace the Hankel function and the Bessel function with the sine functions so that one can achieve an explicit result. Nevertheless, after such a treatment, the information of the distance between target and observer is inevitably lost. In this paper, we show that such a precondition is not necessary: without losing any information of distance, one can still obtain an explicit result of a scattering rigorously. In other words, we give an rigorous explicit scattering result which contains the information of distance between target and observer. We show that at a finite distance, a modification factor --- the Bessel polynomial --- appears in the scattering amplitude, and, consequently, the cross section depends on the distance, the outgoing wave-front surface is no longer a sphere, and, besides the phase shift, there is an additional phase (the argument of the Bessel polynomial) appears in the scattering wave function.

Tong Liu; Wen-Du Li; Wu-Sheng Dai

2014-03-22T23:59:59.000Z

Note: This page contains sample records for the topic "avg trip distance" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


121

Distance transforms on anisotropic surfaces for surface roughness measurement  

Science Journals Connector (OSTI)

The Distance Transform on Curved Space (DTOCS) calculates distances along a gray-level height map surface In this article, the DTOCS is generalized for surfaces represented as real altitude data in an anisotropic grid The distance transform combined ...

Leena Ikonen; Toni Kuparinen; Eduardo Villanueva; Pekka Toivanen

2006-10-01T23:59:59.000Z

122

Geodesic distances in Liouville quantum gravity  

E-Print Network (OSTI)

In order to study the quantum geometry of random surfaces in Liouville gravity, we propose a definition of geodesic distance associated to a Gaussian free field on a regular lattice. This geodesic distance is used to numerically determine the Hausdorff dimension associated to shortest cycles of 2d quantum gravity on the torus coupled to conformal matter fields, showing agreement with a conjectured formula by Y. Watabiki. Finally, the numerical tools are put to test by quantitatively comparing the distribution of lengths of shortest cycles to the corresponding distribution in large random triangulations.

Jan Ambjorn; Timothy Budd

2014-11-12T23:59:59.000Z

123

The Luminosity Distance in Perturbed FLRW Spacetimes  

E-Print Network (OSTI)

We derive an expression for the luminosity distance in FLRW spacetimes affected by scalar perturbations. Our expression is complete to linear order and is expressed entirely in terms of standard cosmological parameters and observational quantities. We illustrate the result by calculating the RMS scatter in the usual luminosity distance in flat (Omega_m,Omega_Lambda) = (1.0,0.0) and (0.3,0.7) cosmologies. In both cases the scatter is appreciable at high redshifts, and rises above 11% at z = 2, where it may be the dominant noise term in the Hubble diagram based on SN Ia.

Ted Pyne; Mark Birkinshaw

2003-10-29T23:59:59.000Z

124

Distances toDistances to HVCsHVCs usingusing blue horizontal branch starsblue horizontal branch stars  

E-Print Network (OSTI)

)(Wisconsin) ElseElse StarkenburgStarkenburg ((KapteynKapteyn Lab)Lab) Lucy Frey (Case)Lucy Frey (Case) andand)Mario Mateo (Michigan) Heather Morrison (Case)Heather Morrison (Case) John Norris (MSSSO)John Norris (MSSSODan OravetzOravetz, Lucy Frey (Case), Lucy Frey (Case) #12;Distances are important:Distances are important

Peletier, Reynier

125

TRANSFORMATIONAL LEADERSHIP AND ALTRUISM: ROLE OF POWER DISTANCE IN A HIGH POWER DISTANCE CULTURE  

E-Print Network (OSTI)

Using a sample of 105 manager-subordinate dyads from a high power distance culture, the effects of power distance and transformational leadership on follower altruism were studied. Findings show a significant positive relationship between power distance and transformational leadership and between transformational leadership and follower altruism. The dimensions on which cultures differ have been identified earlier (Hofstede, 1980). The objective of this study is to look at the effect of a dimension on other variables, in a culture that is high on that dimension. Our contention is that in cultures that score high on the power distance dimension of Hofstede (1980) model, if managers maintain a high power distance between themselves and their followers, their transformational leadership would be enhanced, and transformational leadership in turn will enhance altruistic behavior of followers. Merely knowing the dimensions on which cultures differ is not enough. That knowledge has to be used to predict how an alignment with that dimension would affect other variables.

Ankush Punj; Venkat R. Krishnan

126

The Protection of Pharmaceutical Patents and Data under TRIPS and US-Jordan FTA: Exploring the Limits of Obligations and Flexibilities: A Study of the Impacts on the Pharmaceutical Sector in Jordan.  

E-Print Network (OSTI)

??In 2000, Jordan signed the Agreement on Trade-related Aspects of Intellectual Property Rights (the TRIPS Agreement) and a free trade agreement with the US (USJFTA). (more)

Abughanm, Saad

2012-01-01T23:59:59.000Z

127

Sensor Network Localization, Euclidean Distance Matrix ...  

E-Print Network (OSTI)

paper is to view SNL as a (nearest) Euclidean Distance Matrix, EDM, completion problem that ... simply corresponds to a given fixed clique for the graph of the EDM problem. We next ...... The tests were done using MATLAB 7.4. The method for...

2008-11-17T23:59:59.000Z

128

Nucleon - Nucleon Interactions at Short Distances  

E-Print Network (OSTI)

Despite the progress made in understanding the NN interactions at long distances based on effective field theories, the understanding of the dynamics of short range NN interactions remains as elusive as ever. One of the most fascinating properties of short range interaction is its repulsive nature which is responsible for the stability of strongly interacting matter. The relevant distances, $\\le 0.5$ fm, in this case are such that one expects the onset of quark-gluon degrees of freedom with interaction being dominated by QCD dynamics. We review the current status of the understanding of the QCD dynamics of NN interactions at short distances, highlight outstanding questions and outline the theoretical foundation of QCD description of hard NN processes. We present examples of how the study of the hard elastic NN interaction can reveal the symmetry structure of valence quark component of the nucleon wave function and how the onset of pQCD regime is correlated with the onset of color transparency phenomena in hard $pp$ scattering in the nuclear medium. The discussions show how the new experimental facilities can help to advance the knowledge about the QCD nature of nuclear forces at short distances.

Misak M Sargsian

2014-03-04T23:59:59.000Z

129

Fuzzy prototype model and semantic distance  

Science Journals Connector (OSTI)

It is a challenge to provide an intelligent product suggestion for these new customers without previous shopping records in the supermarket application. To solve such a problem, we design a hybrid fuzzy expert system for recommendation using the improved ... Keywords: Fuzzy c means, Fuzzy decision tree, Fuzzy prototype, Recommendation system, Semantic coordinate, Semantic distance

Dong (Walter) Xie; Jim F. Baldwin

2007-11-01T23:59:59.000Z

130

Earth Mover's Distance Based Local Discriminant Basis  

E-Print Network (OSTI)

Earth Mover's Distance Based Local Discriminant Basis Bradley Marchand and Naoki Saito Abstract in time and frequency. Its goal, given Bradley Marchand Naval Surface Warfare Center, Panama City Division, e-mail: bradley.marchand@navy.mil Naoki Saito Department of Mathematics, University of California

Saito, Naoki

131

EUCLIDEAN DISTANCE MATRIX COMPLETION PROBLEMS June ...  

E-Print Network (OSTI)

Jun 6, 2010 ... This is sometimes called the energy function (e.g., [6, 7]). Note that ... the specified entries are from the measurement of interatomic distances, mostly the ..... If hij = 1 for i, j = 1,...,n (i.e., unit weights), then (5.3) simplifies to n. ?.

2010-06-06T23:59:59.000Z

132

Distance Education Graduate Program in Environmental Science  

E-Print Network (OSTI)

management, related to water quality, climate change, ecosystem restoration, and public health. Research Remediation 3) Carbon Dynamics and Ecosystem Services 4) Wetlands and Aquatic Ecosystems 5) Landscape Analysis, range lands, urban lands, wetlands or aquatic systems. This distance education track is designed

Ma, Lena

133

Long working distance incoherent interference microscope  

DOE Patents (OSTI)

A full-field imaging, long working distance, incoherent interference microscope suitable for three-dimensional imaging and metrology of MEMS devices and test structures on a standard microelectronics probe station. A long working distance greater than 10 mm allows standard probes or probe cards to be used. This enables nanometer-scale 3-dimensional height profiles of MEMS test structures to be acquired across an entire wafer while being actively probed, and, optionally, through a transparent window. An optically identical pair of sample and reference arm objectives is not required, which reduces the overall system cost, and also the cost and time required to change sample magnifications. Using a LED source, high magnification (e.g., 50.times.) can be obtained having excellent image quality, straight fringes, and high fringe contrast.

Sinclair, Michael B. (Albuquerque, NM); De Boer, Maarten P. (Albuquerque, NM)

2006-04-25T23:59:59.000Z

134

Cosmic equation of state from combined angular diameter distances: Does the tension with luminosity distances exist?  

E-Print Network (OSTI)

Using a relatively complete observational data concerning four angular diameter distance (ADD) measurements and %synthetic combined SN+GRB observations representing current luminosity distance (LD) data, this paper investigates the %tension between compatibility of these two cosmological distances considering three classes of dark energy equation of state (EoS) reconstruction. In particular, we use strongly gravitationally lensed systems from various large systematic gravitational lens surveys and galaxy clusters, which yield the Hubble constant independent ratio between two angular diameter distances $D_{ls}/D_s$ data. Our results demonstrate that, with more general categories of standard ruler data, ADD and LD data are compatible at $1\\sigma$ level. Secondly, we note that consistency between ADD and LD data %are blind is maintained irrespective of the EoS parameterizations: there is a good match between the universally explored CPL model and other formulations of cosmic equation of state. Especially for the...

Cao, Shuo

2014-01-01T23:59:59.000Z

135

OFA2013_Storage@Distance.pptx  

NLE Websites -- All DOE Office Websites (Extended Search)

NERSC Storage Systems Group NERSC Storage Systems Group Storage at a Distance --- 1 --- Open F abrics A lliance U ser D ay What is storage at a distance? * Data i s n ot l ocal t o t he u ser/resource * Processing a nd w orkflow n eeds a re n ear r eal---7me - Don't w ant t o w ait u n9l d ata t ransfer i s c omplete - Need t o s ee r esults, m ake a djustments, a nd t ry a gain * Network w ill b ecome p art o f t he i nstruments - Telescopes a nd t heir d ata - Sequencers a nd t heir g enome d ata - Light s ources a nd t heir d ata * Is t here a n a rchitecture/protocol t hat i s n ecessary today for successfully providing storage at a distance? - Ethernet v s. I B - ROCE v s. R DMA v s. I P --- 2 --- Open F abrics A lliance U ser D ay Use case 1: Instruments (beam lines) * ShiB w ork ( 24hr c overage) - Scien9sts fl y i n a nd u se t he i nstrument

136

Flow Distances on Open Flow Networks  

E-Print Network (OSTI)

Open flow network is a weighted directed graph with a source and a sink, depicting flux distributions on networks in the steady state of an open flow system. Energetic food webs, economic input-output networks, and international trade networks, are open flow network models of energy flows between species, money or value flows between industrial sectors, and goods flows between countries, respectively. Flow distances (first-passage or total) between any given two nodes $i$ and $j$ are defined as the average number of transition steps of a random walker along the network from $i$ to $j$ under some conditions. They apparently deviate from the conventional random walk distance on a closed directed graph because they consider the openness of the flow network. Flow distances are explicitly expressed by underlying Markov matrix of a flow system in this paper. With this novel theoretical conception, we can visualize open flow networks, calculating centrality of each node, and clustering nodes into groups. We apply fl...

Guo, Liangzhu; Shi, Peiteng; Wang, Jun; Huang, Xiaohan; Zhang, Jiang

2015-01-01T23:59:59.000Z

137

DEMOGRAPHIC PROFILE CLARKE CO. GEORGIA TOTAL Avg. Co. in GA  

E-Print Network (OSTI)

Median household income, 2010 model-based estimate $34,000 $46,252 $39,196 Persons below poverty level,633,596 9,450 % Black 53.9 38.4 35.1 % White 18.6 43.1 53.7 % Hispanic 21.6 12.0 7.3 % students absent > 15

Teskey, Robert O.

138

Rank Distance Bicodes and their Generalization  

E-Print Network (OSTI)

This book has four chapters. In chapter one we just recall the notion of RD codes, MRD codes, circulant rank codes and constant rank codes and describe their properties. In chapter two we introduce few new classes of codes and study some of their properties. In this chapter we introduce the notion of fuzzy RD codes and fuzzy RD bicodes. Rank distance m-codes are introduced in chapter three and the property of m-covering radius is analysed. Chapter four indicates some applications of these new classes of codes.

W. B. Vasantha Kandasamy; Florentin Smarandache; N. Suresh Babu; R. S. Selvaraj

2010-04-16T23:59:59.000Z

139

Trip report to Stockholm, Sweden, 1-3 September 2008 Background. Sweden has a rich tradition of military and technological (for instance, one  

E-Print Network (OSTI)

Trip report to Stockholm, Sweden, 1-3 September 2008 Background. Sweden has a rich tradition and execution of peacekeeping and other non classified operations (indeed, Sweden has troops in Afghanistan and The Congo today; they lead the Baltic MDA effort). Sweden's relatively small size makes them forward leaning

140

SUMMER FUN & DAY TRIP IDEAS (2011 VERSION) SUMMER in New Haven is a great season with festivals, concerts, events on the Green,  

E-Print Network (OSTI)

, concerts, events on the Green, sports, outdoor activities and day trip opportunities in the area. Here and ticketed events, family events; ask for student tix discounts. Music on the New Haven Green bring a blanket & picnic for Free big name concerts on the Green.Saturday nights. Performers TBA in July. Norfolk Summer

Note: This page contains sample records for the topic "avg trip distance" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


141

Preliminaries Conserved Interval Distance between Non-trivial  

E-Print Network (OSTI)

Outline Preliminaries Results Conclusion Conserved Interval Distance between Non-trivial Genomes.Rizzi@unitn.it August the 16th Guillaume Blin, Romeo Rizzi Conserved Interval Distance between Non-trivial Genomes #12 Guillaume Blin, Romeo Rizzi Conserved Interval Distance between Non-trivial Genomes #12;Outline

Blin, Guillaume

142

GEODESIC FRCHET DISTANCE WITH POLYGONAL OBSTACLES Atlas F. Cook IV  

E-Print Network (OSTI)

GEODESIC FR?CHET DISTANCE WITH POLYGONAL OBSTACLES Atlas F. Cook IV Carola Wenk Abstract We present the first algorithm to compute the geodesic Fréchet distance between two polygonal curves in a plane of from a point source). This shortest path map supports geodesic distance queries from any point s ab

Texas at San Antonio, University of

143

Testing the consistency between cosmological measurements of distance and age  

E-Print Network (OSTI)

We present a model independent method to test the consistency between cosmological measurements of distance and age, assuming the distance duality relation. We use type Ia supernovae, baryon acoustic oscillations, and observational Hubble data, to reconstruct the luminosity distance D_L(z), the angle averaged distance D_V(z) and the Hubble rate H(z), using Gaussian processes regression technique. We obtain estimate of the distance duality relation in the redshift range 0.1

Nair, Remya; Jain, Deepak

2015-01-01T23:59:59.000Z

144

A NEW COSMOLOGICAL DISTANCE MEASURE USING ACTIVE GALACTIC NUCLEI  

SciTech Connect

Accurate distances to celestial objects are key to establishing the age and energy density of the universe and the nature of dark energy. A distance measure using active galactic nuclei (AGNs) has been sought for more than 40 years, as they are extremely luminous and can be observed at very large distances. We report here the discovery of an accurate luminosity distance measure using AGNs. We use the tight relationship between the luminosity of an AGN and the radius of its broad-line region established via reverberation mapping to determine the luminosity distances to a sample of 38 AGNs. All reliable distance measures up to now have been limited to moderate redshift-AGNs will, for the first time, allow distances to be estimated to z {approx} 4, where variations of dark energy and alternate gravity theories can be probed.

Watson, D.; Denney, K. D.; Vestergaard, M. [Dark Cosmology Centre, Niels Bohr Institute, University of Copenhagen, Juliane Maries Vej 30, DK-2100 Copenhagen Oe (Denmark); Davis, T. M. [School of Mathematics and Physics, University of Queensland, Brisbane, QLD 4072 (Australia)

2011-10-20T23:59:59.000Z

145

Sensitivity analysis on the effect of software-induced common cause failure probability in the computer-based reactor trip system unavailability  

Science Journals Connector (OSTI)

The reactor trip system has been digitized in advanced nuclear power plants, since the programmable nature of computer based systems has a number of advantages over non-programmable systems. However, software is still vulnerable to common cause failure (CCF). Residual software faults represent a CCF concern, which threat the implemented achievements. This study attempts to assess the effectiveness of so-called defensive strategies against software CCF with respect to reliability. Sensitivity analysis has been performed by re-quantifying the models upon changing the software failure probability. Importance measures then have been estimated in order to reveal the specific contribution of software CCF in the trip failure probability. The results reveal the importance and effectiveness of signal and software diversity as applicable strategies to ameliorate inefficiencies due to software CCF in the reactor trip system (RTS). No significant change has been observed in the rate of RTS failure probability for the basic software CCF greater than 1נ10?4. However, the related FussellVesley has been greater than 0.005, for the lower values. The study concludes that consideration of risk associated with the software based systems is a multi-variant function which requires compromising among them in more precise and comprehensive studies.

Shahabeddin Kamyab; Mohammadreza Nematollahi; Golnoush Shafiee

2013-01-01T23:59:59.000Z

146

Hazardous Waste Minimum Distance Requirements (Connecticut) | Department of  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Minimum Distance Requirements (Connecticut) Minimum Distance Requirements (Connecticut) Hazardous Waste Minimum Distance Requirements (Connecticut) < Back Eligibility Agricultural Commercial Construction Fed. Government Fuel Distributor General Public/Consumer Industrial Installer/Contractor Institutional Investor-Owned Utility Local Government Low-Income Residential Multi-Family Residential Municipal/Public Utility Nonprofit Residential Retail Supplier Rural Electric Cooperative Schools State/Provincial Govt Systems Integrator Transportation Tribal Government Utility Program Info State Connecticut Program Type Siting and Permitting Provider Department of Energy and Environmental Protection These regulations set minimum distance requirements between certain types of facilities that generate, process, store, and dispose of hazardous waste

147

Geodesic Distance in Fisher Information Space and Holographic Entropy Formula  

E-Print Network (OSTI)

In this short note, we examine geodesic distance in Fisher information space in which the metric is defined by the entanglement entropy in CFT_(1+1). It is obvious in this case that the geodesic distance at a constant time is a function of the entropy data embedded into the information space. In a special case, the geodesic equation can be solved analytically, and we find that the distance agrees well with the Ryu-Takayanagi formula. Then, we can understand how the distance looks at the embeded quantum information. The result suggests that the Fisher metric is an efficient tool for constructing the holographic spacetime.

Hiroaki Matsueda

2014-08-28T23:59:59.000Z

148

Geodesic Distance in Planar Graphs: An Integrable Approach  

E-Print Network (OSTI)

We discuss the enumeration of planar graphs using bijections with suitably decorated trees, which allow for keeping track of the geodesic distances between faces of the graph. The corresponding generating functions obey non-linear recursion relations on the geodesic distance. These are solved by use of stationary multi-soliton tau-functions of suitable reductions of the KP hierarchy. We obtain a unified formulation of the (multi-) critical continuum limit describing large graphs with marked points at large geodesic distances, and obtain integrable differential equations for the corresponding scaling functions. This provides a continuum formulation of two-dimensional quantum gravity, in terms of the geodesic distance.

P. Di Francesco

2005-06-27T23:59:59.000Z

149

Distance and overcurrent protection of feeders at distribution substation.  

E-Print Network (OSTI)

??The ???Distance and Overcurrent Protection of Feeders at Distribution Substation??? report will discuss protection of distribution feeders at a substation. The paper will discuss the (more)

Chedid, Youssef Pierre

2014-01-01T23:59:59.000Z

150

WIPP site and vicinity geological field trip. A report of a field trip to the proposed Waste Isolation Pilot Plant project in Southeastern New Mexico, June 16 to 18, 1980  

SciTech Connect

The Environmental Evaluation Group is conducting an assessment of the radiological health risks to people from the Waste Isolation Pilot Plant. As a part of this work, EEG is making an effort to improve the understanding of those geological issues concerning the WIPP site which may affect the radiological consequences of the proposed repository. One of the important geological issues to be resolved is the timing and the nature of the dissolution processes which may have affected the WIPP site. EEG organized a two-day conference of geological scientists, on January 17-18, 1980. On the basis of the January conference and the June field trip, EEG has formed the following conclusions: (1) it has not been clearly established that the site or the surrounding area has been attacked by deep dissolution to render it unsuitable for the nuclear waste pilot repository; (2) the existence of an isolated breccia pipe at the site unaccompanied by a deep dissolution wedge, is a very remote possibility; (3) more specific information about the origin and the nature of the brine reservoirs is needed. An important question that should be resolved is whether each encounter with artesian brine represents a separate pocket or whether these occurrences are interconnected; (4) Anderson has postulated a major tectonic fault or a fracture system at the Basin margin along the San Simon Swale; (5) the area in the northern part of the WIPP site, identified from geophysical and bore hole data as the disturbed zone, should be further investigated to cleary understand the nature and significance of this structural anomaly; and (6) a major drawback encountered during the discussions of geological issues related to the WIPP site is the absence of published material that brings together all the known information related to a particular issue.

Chaturvedi, L.

1980-10-01T23:59:59.000Z

151

Introduction The median problem for the reversal distance in  

E-Print Network (OSTI)

genomes E. Ohlebusch, M.I. Abouelhoda, K. Hockel, J. Stallkamp University of Ulm, Germany CPM 2005 The median problem for the reversal distance in circular bacterial genomes #12;Introduction Methods Conclusion General Problem Distances Specific Problem Median Problem Given 3 genomes G1, G2, and G3, find

Lonardi, Stefano

152

Estimating Distances Using Least Cost Path Algorithms Rodney J. Dyer  

E-Print Network (OSTI)

Estimating Distances Using Least Cost Path Algorithms Rodney J. Dyer February 27, 2012 Overview This vignette covers the methods necessary to take a raster and estimate the least cost path distance between points. In doing so, this will cover: 1. Load in a 'raster blank' 2. Modify the raster to change relative

Dyer, Rodney J.

153

Ris-R-1518(EN) The necessary distance between large  

E-Print Network (OSTI)

Risø-R-1518(EN) The necessary distance between large wind farms offshore - study Sten Frandsen. As it is often the need for offshore wind farms, the model handles a regular array-geometry with straight rows distance between large wind farms in the offshore environment. The main results are given in Section 1

154

How to project `circular' manifolds using geodesic distances?  

E-Print Network (OSTI)

How to project `circular' manifolds using geodesic distances? John Aldo Lee, Michel Verleysen,verleysen}@dice.ucl.ac.be Abstract. Recent papers have clearly shown the advantage of using the geodesic distance instead strongly crumpled manifolds have to be un- folded. Nevertheless, neither the Euclidean nor the geodesic

Verleysen, Michel

155

Parallel algorithms for approximation of distance maps on parametric surfaces  

E-Print Network (OSTI)

results demonstrate up to four orders of magnitude improvement in execution time compared to the state(n) numerical algorithm for first-order approximation of geodesic distances on geometry images, where n charts, parallel algorithms, GPU, SIMD 1. INTRODUCTION Approximation of geodesic distances on curved

Kimmel, Ron

156

RESEARCH NOTE DISTANCE CHEMORECEPTION AND THE DETECTION OF  

E-Print Network (OSTI)

RESEARCH NOTE DISTANCE CHEMORECEPTION AND THE DETECTION OF CONSPECIFICS IN OCTOPUS BIMACULOIDES. They detect odours on contact using chemosensory cells on their lips and suckers (Budelmann, 1996). They can also detect water-borne odours (distance chemoreception) using receptors in their olfactory organs

Boal, Jean

157

Keep Your Enemies Close: Distance Bounding Against Smartcard Relay Attacks  

E-Print Network (OSTI)

Keep Your Enemies Close: Distance Bounding Against Smartcard Relay Attacks Saar Drimer and Steven J by an implementation of the relay attack that has been tested on live systems. Once designers appreciate the risk to the smartcard standard, based on a distance bounding protocol, which provides adequate resistance to the relay

Xu, Wenyuan

158

Solar Decathlon 2013: Going the Distance | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Going the Distance Going the Distance Solar Decathlon 2013: Going the Distance September 17, 2013 - 4:26pm Addthis Toggle Routes on/off Return to map → Solar Decathlon Journeys Visualizing the distances that each Solar Decathlon house travelled Click competitors to toggle their journeys on and off. All routes and distances are approximate. Rebecca Matulka Rebecca Matulka Digital Communications Specialist, Office of Public Affairs Solar Decathlon 2013: In our new blog series, we're going behind the scenes to show you what it takes to compete in the Solar Decathlon. First up: Meet the teams competing this year and learn how they were selected. Part two looks at how the teams must master the art of fundraising. What does it take to design an energy-efficient, solar-powered house? Part three looks at creating a winning design.

159

Jordan Thayer and Wheeler Ruml (UNH) Distance Estimates For Search 1 / 40 Using Distance Estimates In Heuristic Search  

E-Print Network (OSTI)

Jordan Thayer and Wheeler Ruml (UNH) Distance Estimates For Search ­ 1 / 40 Using Distance Estimates In Heuristic Search Jordan T. Thayer and Wheeler Ruml jtd7, ruml at cs.unh.edu slides at: http Search Bounded Suboptimal Anytime Search Summary Backup Slides Jordan Thayer and Wheeler Ruml (UNH

Ruml, Wheeler

160

Image Segmentation Using Active Contours and Evidential Distance  

Science Journals Connector (OSTI)

We proposed a new segmentation based on Active Contours (AC) for vector-valued image that incorporates evidential distance. The proposed method combine both Belief Functions (BFs) and probability functions in ...

Foued Derraz; Antonio Pinti

2013-01-01T23:59:59.000Z

Note: This page contains sample records for the topic "avg trip distance" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


161

Verification of speckle contrast measurement interrelation with observation distance  

Science Journals Connector (OSTI)

The speckle contrasts of two types of laser projectors were measured at various observation distances and observation lens pinhole diameters using a quantitative measurement technique. We found that the speckl...

Koji Suzuki; Tatsuo Fukui; Shigeo Kubota; Yasunori Furukawa

2014-01-01T23:59:59.000Z

162

Cepheid Variables and their Application to the Cosmological Distance Scale  

E-Print Network (OSTI)

In the current era of precision cosmology, measuring the expansion rate of the Universe (Hubble constant, or H0) more accurately and precisely helps to better constrain the properties of dark energy. Cepheid-based distances are a critical step...

Hoffmann, Samantha L

2013-05-02T23:59:59.000Z

163

TOWARD THE MINIMUM INNER EDGE DISTANCE OF THE HABITABLE ZONE  

E-Print Network (OSTI)

We explore the minimum distance from a host star where an exoplanet could potentially be habitable in order not to discard close-in rocky exoplanets for follow-up observations. We find that the inner edge of the Habitable ...

Zsom, Andras

164

A Trip to Canada  

Science Journals Connector (OSTI)

... her way to-a finishing school in London, said ' Don't you think the electric cars in Ottawa are better than anywhere else?' Of course they are, one cannot ... they are, one cannot but reply, quite bond-fide. Would not she brighten an electric car, wherever she was?"

1898-02-10T23:59:59.000Z

165

Propagation of Audio-Frequency Radio Waves to Great Distances  

Science Journals Connector (OSTI)

... distances from the source clearly showed that the main concentration of energy lay in the audio-frequency band below 10 kc./s. and that the higher-frequency components moved forward ... selective absorption, which, together with the low attenuation at the extreme ends of the audio-frequency range, accounts for the observed long-distance propagation characteristics of atmospherics1. As is ...

F. W. CHAPMAN; R. C. V. MACARIO

1956-05-19T23:59:59.000Z

166

The location of two-hand trip devices on full revolution mechanical power presses with regard to operator safety  

E-Print Network (OSTI)

, , Point of operation. Flywheel dl ive and single geared trans- m1 8'-' lo l 12 Accepted safe openings between the bottom edg of. a guard and feed table at various distances from the point of operation. . . . . . . 21 Timing arrangemen't used by Lobl...' cal presses I s I, h(l conversion of rotary motion of a flywheel to rcl i J)F oca. ? ting motion of the pre. , s ram by means of an eccentric. The most common form of eccentricity used on mech;)ni. cal 2 presses is the crankshaf*. Other forms...

Masters, Randall Wayne

2012-06-07T23:59:59.000Z

167

FastMeasure Distance Measuring Tools | Open Energy Information  

Open Energy Info (EERE)

FastMeasure Distance Measuring Tools FastMeasure Distance Measuring Tools Jump to: navigation, search Logo: FastMeasure Distance Measuring Tools Name FastMeasure Distance Measuring Tools Address 2890 Cherokee Lane Place Riverwoods, Illinois Zip 60015 Sector Vehicles Product Distance Measuring Instrument Year founded 2008 Number of employees 11-50 Phone number (888) 876-6050 Website http://www.fast-measure.com Coordinates 42.181686°, -87.898862° Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"ROADMAP","zoom":14,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"350px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":42.181686,"lon":-87.898862,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}

168

CAKE Goes 'The Distance' with Solar | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

CAKE Goes 'The Distance' with Solar CAKE Goes 'The Distance' with Solar CAKE Goes 'The Distance' with Solar February 2, 2011 - 10:00am Addthis April Saylor April Saylor Former Digital Outreach Strategist, Office of Public Affairs CAKE. Whether it takes the form of cupcakes, birthday cake, the ever-popular cheesecake or even gluten-free - it unfailingly brightens up almost anyone's day. CAKE the band, however, has taken the sweetness to another level with their newest album Showroom of Compassion, which was produced using 100 percent solar energy. The group formed in 1991 and took the Northern California music scene by storm in the mid-nineties. Since then, they've become internationally renowned headliners. Earlier this month, CAKE released their sixth album, recorded in a studio in Sacramento powered entirely by solar power.

169

Determination of the Solar Galactocentric distance from masers kinemics  

E-Print Network (OSTI)

We have determined the Galactic rotation parameters and the solar Galactocentric distance $R_0$ by simultaneously solving Bottlinger's kinematic equations using data on masers with known line-of-sight velocities and highly accurate trigonometric parallaxes and proper motions measured by VLBI. Our sample includes 93 masers spanning the range of Galactocentric distances R from 3 to 15 kpc. The solutions found are \\Omega_0 = 29.7+/-0.5 km s^{-1} kpc^{-1}, \\Omega'_0 = -4.20+/-0.11 km s^{-1} kpc^{-2}, \\Omega"_0 =0.730+/-0.029 km s^{-1} kpc^{-3}, and R_0=8.03+/-0.12 kpc. In this case, the linear rotation velocity at the solar distance R_0 is V_0=238+/-6 km s^{-1}.

Bajkova, A T

2014-01-01T23:59:59.000Z

170

Choosing good distance metrics and local planners for probabilistic roadmap motion planning methods  

E-Print Network (OSTI)

, particularly probabilistic roadmap methods. Our study of distance metrics showed that the importance of the translational distance increased relative to the rotational distance as the environment become more crowded. We find that each local planner makes some...

Bayazit, Osman Burchan

2012-06-07T23:59:59.000Z

171

Evidence against correlations between nuclear decay rates and Earth-Sun distance  

E-Print Network (OSTI)

distance of the source to the Sun. This work was supportedNuclear Decay Rates and Earth-Sun Distance Eric B. Normanand 241 Am and the Earth-Sun distance. We find no evidence

Norman, Eric B.

2009-01-01T23:59:59.000Z

172

Small distance expansion for radiative heat transfer between curved objects  

E-Print Network (OSTI)

We develop a small distance expansion for the radiative heat transfer between gently curved objects, in terms of the ratio of distance to radius of curvature. A gradient expansion allows us to go beyond the lowest order proximity transfer approximation. The range of validity of such expansion depends on temperature as well as material properties. Generally, the expansion converges faster for the derivative of the transfer than for the transfer itself, which we use by introducing a near-field adjusted plot. For the case of a sphere and a plate, the logarithmic correction to the leading term has a very small prefactor for all materials investigated.

Vladyslav A. Golyk; Matthias Krger; Alexander P. McCauley; Mehran Kardar

2012-10-12T23:59:59.000Z

173

Distance relay application testing using a digital simulator  

SciTech Connect

This paper reports on distance relay application testing using simulated transient waveforms. Power system modeling and test procedure for using modern digital simulators are presented. Extensive study of five commercial relays comparing the application for a 345kV transmission line is carried out by performing thousands of one-terminal and synchronized two-terminal transient tests. The approach using digital simulators has proved to be an efficient technique. This paper presents a methodology for evaluating distance relay transient performance based on extensive laboratory testing. Important issues regarding application testing, such as CT and CCVT effects and selection of prefault waveform length, are also addressed and investigated in this paper.

Kezunovic, M.; Xia, Y.Q.; Guo, Y. [Texas A and M Univ., College Station, TX (United States)] [Texas A and M Univ., College Station, TX (United States); Fromen, C.W.; Sevcik, D.R. [Houston Lighting and Power Co., TX (United States)] [Houston Lighting and Power Co., TX (United States)

1997-01-01T23:59:59.000Z

174

Development of the table of initial isolation distances and protective action distances for the 2004 emergency response guidebook.  

SciTech Connect

This report provides technical documentation for values in the Table of Initial Isolation and Protective Action Distances (PADs) in the 2004 Emergency Response Guidebook (ERG2004). The objective for choosing the PADs specified in the ERG2004 is to balance the need to adequately protect the public from exposure to potentially harmful substances against the risks and expenses that could result from overreacting to a spill. To quantify this balance, a statistical approach is adopted, whereby the best available information is used to conduct an accident scenario analysis and develop a set of up to 1,000,000 hypothetical incidents. The set accounts for differences in containers types, incident types, accident severity (i.e., amounts released), locations, times of day, times of year, and meteorological conditions. Each scenario is analyzed using detailed emission rate and atmospheric dispersion models to calculate the downwind chemical concentrations from which a 'safe distance' is determined. The safe distance is defined as the distance downwind from the source at which the chemical concentration falls below health protection criteria. The American Industrial Hygiene Association's Emergency Response Planning Guideline Level 2 (ERPG-2) or equivalent is the health criteria used. The statistical sample of safe distance values for all incidents considered in the analysis are separated into four categories: small spill/daytime release, small spill/nighttime release, large spill/daytime release, and large spill/nighttime release. The 90th-percentile safe distance values for each of these groups became the PADs that appear in the ERG2004.

Brown, D. F.; Freeman, W. A.; Carhart, R. A.; Krumpolc, M.; Decision and Information Sciences; Univ. of Illinois at Chicago

2005-09-23T23:59:59.000Z

175

The Exemplar Breakpoint Distance for nontrivial genomes cannot be approximated  

E-Print Network (OSTI)

The Exemplar Breakpoint Distance for non­trivial genomes cannot be approximated Guillaume Blin 1 ­ France guillaume.fertin@univ­nantes.fr Abstract. A promising and active field of comparative genomics con­ sists in comparing two genomes by establishing a one­to­one correspon­ dence (i.e., a matching) between

Fertin, Guillaume

176

Of mice and men: Algorithms for evolutionary distances  

E-Print Network (OSTI)

Of mice and men: Algorithms for evolutionary distances between genomes with translocation \\Lambda is combinatorial algorithms for genome rear­ rangement. In the course of its evolution, the genome of an organism is to determine the minimum number of such events that transform one genome to another. This number is called

Kececioglu, John

177

A Formal Approach to Distance-Bounding RFID Protocols  

E-Print Network (OSTI)

Kasper2 Cristina Onete1 1 Darmstadt University of Technology & CASED, Germany www.minicrypt.de 2 Fraunhofer Institute for Secure Information Technology (SIT) and CASED, Germany Abstract. Distance one or two such threats, but no rigorous cryptographic security models --nor clean security proofs

178

Labeling trees with a condition at distance two  

Science Journals Connector (OSTI)

For positive integers j ? k, an L(j, k)-labeling of graph G is an integer labeling of V(G) such that adjacent vertices receive labels which differ by at least j, and vertices that are distance two apart receive ... Keywords: ?j,k-labeling, infinite regular tree, vertex labeling

John P. Georges; David W. Mauro

2003-07-01T23:59:59.000Z

179

Defense from a distance ORNL robotics sensors detect underwater  

E-Print Network (OSTI)

SCIENCE Defense from a distance ORNL robotics sensors detect underwater explosive ordnance Modern of the future are not human oriented, but robotics oriented. For robots to perform their mission of safety at the forefront of robotics design, these are the droids we are looking for. ­Dylan Platz Karnowski analyzes

Pennycook, Steve

180

SMART DISTANCE KEEPING: MODELING AND PERSPECTIVES FOR EMBEDDED DIAGNOSIS  

E-Print Network (OSTI)

on a Renault-Volvo Trucks vehicle. One of the main differences between this new system, which is called is the distance between the vehicle (with the ACC or the SDK system) and the front obstacle (which may of a detection and isolation strategy for some of the possible faults that may be produced on the system

Paris-Sud XI, Université de

Note: This page contains sample records for the topic "avg trip distance" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


181

1 Introduction The Euclidean distance map (EDM) of a black  

E-Print Network (OSTI)

and the near­ est black pixel. The EDM plays an important role in machine vision, pattern recognitionTitle page 1 #12; 1 Introduction The Euclidean distance map (EDM) of a black and white n 2 n binary, and robotics[9]. Many algorithms have been proposed for com­ puting the EDM. Yamada[10] presented an EDM

Fujiwara, Akihiro

182

GIS IN SOIL & WATER SCIENCE Distance Education Sections  

E-Print Network (OSTI)

is and what it can do. Work with and create GIS maps in ArcMap. Access and query a GIS database. Describe a dataset. Query and analyze GIS data. Create presentation-quality maps and graphs DELIVERY MODE: · CourseSWS 4720C GIS IN SOIL & WATER SCIENCE Distance Education Sections Fall 2013 Instructor Susan Curry

Ma, Lena

183

Computing the edit-distance between unrooted ordered trees  

E-Print Network (OSTI)

. In B, contract the edge x, and then change labels u; v; w;y; z to f; h; a; c; e. On the topComputing the edit-distance between unrooted ordered trees Philip N. Klein ? Department of Computer

Klein, Philip N.

184

Native 10Gigabit Ethernet experiments over long distances  

Science Journals Connector (OSTI)

The current solutions for transmitting data over Wide Area Networks (WANs) are expensive and require protocol translation at layer 1. The IEEE recently standardized the 10Gigabit Ethernet (10GE) WAN PHY as a native gateway from the Local Area Networks ... Keywords: 10Gigabit Ethernet, Long-distance TCP, SONET/SDH, WAN PHY

Catalin Meirosu; Piotr Golonka; Andreas Hirstius; Stefan Stancu; Bob Dobinson; Erik Radius; Antony Antony; Freek Dijkstra; Johan Blom; Cees de Laat

2005-04-01T23:59:59.000Z

185

Weierstrass Pairs and Minimum Distance of Goppa Codes  

Science Journals Connector (OSTI)

We prove that elements of the Weierstrass gap set of a pair of points may be used to define a geometric Goppa code which has minimum distance greater than the usual lower bound. We determine the Weierstrass gap set of a pair of any two Weierstrass ... Keywords: Hermitian code, Weierstrass pair, Weierstrass point

Gretchen L. Matthews

2001-03-01T23:59:59.000Z

186

Technology Enhanced Learning and Distance Learning February 21, 2008  

E-Print Network (OSTI)

Technology Enhanced Learning and Distance Learning February 21, 2008 Call for Nominations: Provost's Prize for Teaching with Technology Eligibility: Candidates must be a tenure-track or non's Prize for Teaching with Technology will be awarded to up to two recipients. Each recipient will receive

Southern California, University of

187

Collaborative Distance Education: The Iowa Chemistry Education Alliance  

Science Journals Connector (OSTI)

Collaborative Distance Education: The Iowa Chemistry Education Alliance ... The Iowa Chemistry Education Alliance is a consortium of four chemistry instructors from central Iowa high schools, several members of the Iowa State University faculty, and consultants from an Iowa Area Education Agency. ...

K. A. Burke; Thomas J. Greenbowe

1998-10-01T23:59:59.000Z

188

Modelling long-distance seed dispersal in heterogeneous landscapes.  

SciTech Connect

1. Long-distance seed dispersal is difficult to measure, yet key to understanding plant population dynamics and community composition. 2. We used a spatially explicit model to predict the distribution of seeds dispersed long distances by birds into habitat patches of different shapes. All patches were the same type of habitat and size, but varied in shape. They occurred in eight experimental landscapes, each with five patches of four different shapes, 150 m apart in a matrix of mature forest. The model was parameterized with smallscale movement data collected from field observations of birds. In a previous study we validated the model by testing its predictions against observed patterns of seed dispersal in real landscapes with the same types and spatial configuration of patches as in the model. 3. Here we apply the model more broadly, examining how patch shape influences the probability of seed deposition by birds into patches, how dispersal kernels (distributions of dispersal distances) vary with patch shape and starting location, and how movement of seeds between patches is affected by patch shape. 4. The model predicts that patches with corridors or other narrow extensions receive higher numbers of seeds than patches without corridors or extensions. This pattern is explained by edgefollowing behaviour of birds. Dispersal distances are generally shorter in heterogeneous landscapes (containing patchy habitat) than in homogeneous landscapes, suggesting that patches divert the movement of seed dispersers, holding them long enough to increase the probability of seed defecation in the patches. Dispersal kernels for seeds in homogeneous landscapes were smooth, whereas those in heterogenous landscapes were irregular. In both cases, long-distance (> 150 m) dispersal was surprisingly common, usually comprising approximately 50% of all dispersal events. 5. Synthesis . Landscape heterogeneity has a large influence on patterns of long-distance seed dispersal. Our results suggest that long-distance dispersal events can be predicted using spatially explicit modelling to scale-up local movements, placing them in a landscape context. Similar techniques are commonly used by landscape ecologists to model other types of movement; they offer much promise to the study of seed dispersal.

Levey, Douglas, J.; Tewlsbury, Joshua, J.; Bolker, Benjamin, M.

2008-01-01T23:59:59.000Z

189

Distance-dependent electron transfer in DNA hairpins  

SciTech Connect

The distance dependence of photoinduced electron transfer in duplex DNA was determined for a family of synthetic DNA hairpins in which a stilbene dicarboxamide forms a bridge connecting two oligonucleotide arms. Investigation of the fluorescence and transient absorption spectra of these hairpins established that no photoinduced electron transfer occurs for a hairpin that has six deoxyadenosine-deoxythymidine base pairs. However, the introduction of a single deoxyguanosine-deoxycytidine base pair resulted in distance-dependent fluorescence quenching and the formation of the stilbene anion radical. Kinetic analysis suggests that duplex DNA is somewhat more effective than proteins as a medium for electron transfer but that it does not function as a molecular wire.

Lewis, F.D.; Wu, T.; Zhang, Y. [Northwestern Univ., Evanston, IL (United States)] [and others] [Northwestern Univ., Evanston, IL (United States); and others

1997-08-01T23:59:59.000Z

190

Distance-redshift relations in an anisotropic cosmological model  

SciTech Connect

In this paper we study an anisotropic model generated from a particular Bianchi type-III metric, which is a generalization of Gdel's metric and an exact solution of Einstein's field equations. We analyse type Ia supernova data, namely the SDSS sample calibrated with the MLCS2k2 fitter, and we verify in which ranges of distances and redshifts the anisotropy could be observed. We also consider, in a joint analysis, the position of the first peak in the CMB anisotropy spectrum, as well as current observational constraints on the Hubble constant. We conclude that a small anisotropy is permitted by the data, and that more accurate measurements of supernova distances above z = 2 might indicate the existence of such anisotropy in the universe.

Menezes, R. S. Jr. [Instituto Federal da Bahia, Salvador, BA (Brazil); Pigozzo, C.; Carneiro, S., E-mail: rsmjr@ifba.edu.br, E-mail: cpigozzo@ufba.br, E-mail: saulo.carneiro.ufba@gmail.com [Instituto de Fsica, Universidade Federal da Bahia, Salvador, Bahia (Brazil)

2013-03-01T23:59:59.000Z

191

Long-distance distribution of genuine energy-time entanglement  

E-Print Network (OSTI)

Any practical realization of entanglement-based quantum communication must be intrinsically secure and able to span long distances avoiding the need of a straight line between the communicating parties. The violation of Bell's inequality offers a method for the certification of quantum links without knowing the inner workings of the devices. Energy-time entanglement quantum communication satisfies all these requirements. However, currently there is a fundamental obstacle with the standard configuration adopted: an intrinsic geometrical loophole that can be exploited to break the security of the communication, in addition to other loopholes. Here we show the first experimental Bell violation with energy-time entanglement distributed over 1 km of optical fibers that is free of this geometrical loophole. This is achieved by adopting a new experimental design, and by using an actively stabilized fiber-based long interferometer. Our results represent an important step towards long-distance secure quantum communication in optical fibers.

A. Cuevas; G. Carvacho; G. Saavedra; J. Carie; W. A. T. Nogueira; M. Figueroa; A. Cabello; P. Mataloni; G. Lima; G. B. Xavier

2014-06-03T23:59:59.000Z

192

Application of Mutual Information Methods in Time-Distance Helioseismology  

E-Print Network (OSTI)

We apply a new technique, the mutual information (MI) from information theory, to time-distance helioseismology, and demonstrate that it can successfully reproduce several classic results based on the widely used cross-covariance method. MI quantifies the deviation of two random variables from complete independence, and represents a more general method for detecting dependencies in time series than the cross-covariance function, which only detects linear relationships. We provide a brief description of the MI-based technique and discuss the results of the application of MI to derive the solar differential profile, a travel-time deviation map for a sunspot and a time-distance diagram from quiet Sun measurements.

Keys, Dustin; Pevtsov, Alexei

2015-01-01T23:59:59.000Z

193

Electrical probe diagnostics for the laminar flame quenching distance  

SciTech Connect

A simplified theory, previously developed for the general case of weakly ionized gas flow, is used to predict electrical probe response when the flame is quenched on the probe surface. This theory is based on the planar model of space charge sheaths around the measuring electrode. For the flame quenching case, by assuming that the sheath thickness is comparable with the thermal boundary layer thickness, probe current can be related to flame quenching distance. The theoretical assumptions made to obtain the analytical formulation of probe current were experimentally proved by using direct visualization and high-frequency PIV. The direct visualization method was also used to validate the results of flame quenching distance values obtained with electrical probe. The electrical probe diagnostics have been verified for both head-on and sidewall flame quenching regimes and for stoichiometric methane/air and propane/air mixtures in a pressure range of 0.05-0.6 MPa. (author)

Karrer, Maxime; Makarov, Maxime [Renault Technocentre, 78288 Guyancourt Cedex (France); Bellenoue, Marc; Labuda, Sergei; Sotton, Julien [Laboratoire de Combustion et de Detonique, CNRS, 86961 Futuroscope Chasseneuil (France)

2010-02-15T23:59:59.000Z

194

Type Ia Supernovae Yielding Distances with 3-4% Precision  

E-Print Network (OSTI)

The luminosities of Type Ia supernovae (SN), the thermonuclear explosions of white dwarf stars, vary systematically with their intrinsic color and light-curve decline rate. These relationships have been used to calibrate their luminosities to within ~0.14-0.20 mag from broadband optical light curves, yielding individual distances accurate to ~7-10%. Here we identify a subset of SN Ia that erupt in environments having high ultraviolet surface brightness and star-formation surface density. When we apply a steep model extinction law, these SN can be calibrated to within ~0.065-0.075 mag, corresponding to ~3-4% in distance -- the best yet with SN Ia by a substantial margin. The small scatter suggests that variations in only one or two progenitor properties account for their light-curve-width/color/luminosity relation.

Kelly, Patrick L; Burke, David L; Hicken, Malcolm; Ganeshalingam, Mohan; Zheng, Weikang

2014-01-01T23:59:59.000Z

195

Curvature dark energy reconstruction through different cosmographic distance definitions  

E-Print Network (OSTI)

In the context of $f(\\mathcal{R})$ gravity, dark energy is a geometrical fluid with negative equation of state. Since the function $f(\\mathcal{R})$ is not known \\emph{a priori}, the need of a model independent reconstruction of its shape represents a relevant technique to determine which $f(\\mathcal{R})$ model is really favored with respect to others. To this aim, we relate cosmography to a generic $f(\\mathcal R)$ and its derivatives in order to provide a model independent investigation at redshift $z \\sim 0$. Our analysis is based on the use of three different cosmological distance definitions, in order to alleviate the duality problem, i.e. the problem of which cosmological distance to use with specific cosmic data sets. We therefore consider the luminosity, $d_L$, flux, $d_F$, and angular, $d_A$, distances and we find numerical constraints by the Union 2.1 supernovae compilation and measurement of baryonic acoustic oscillations, at $z_{BAO}=0.35$. We notice that all distances reduce to the same expression, i.e. $d_{L;F;A}\\sim\\frac{1}{\\mathcal H_0}z$, at first order. Thus, to fix the cosmographic series of observables, we impose the initial value of $H_0$ by fitting $\\mathcal H_0$ through supernovae only, in the redshift regime $ztheoretical bounds, while its variation, namely the jerk parameter, is compatible with $j_0>1$. Finally, we infer the functional form of $f(\\mathcal{R})$ by means of a truncated polynomial approximation, in terms of fourth order scale factor $a(t)$.

Salvatore Capozziello; Mariafelicia De Laurentis; Orlando Luongo

2014-06-26T23:59:59.000Z

196

Time, Distance, Velocity, Redshift: a personal guided tour  

E-Print Network (OSTI)

An attempt to answer the question 'Can we observe galaxies that recede faster than light ?' led to a re-examination of the notions of time, distance, velocity and redshift as they occur in newtonian physics, special relativity, general relativity and cosmology. A number of misconceptions were uncovered. It was found that, once freed of special relativity preconceptions, the above question is easily and unequivocally answered

T. Kiang

2003-08-01T23:59:59.000Z

197

An Improved Method to Test the Distance-Duality Relation  

Science Journals Connector (OSTI)

Many researchers have performed cosmological-model-independent tests for the distance-duality (DD) relation. Theoretical work has been conducted based on the results of these tests. However, we find that almost all of these tests were perhaps not cosmological-model-independent after all, because the distance moduli taken from a given type Ia supernovae (SNe Ia) compilation are dependent on a given cosmological model and Hubble constant. In this Letter, we overcome these defects and by creating a new cosmological-model-independent test for the DD relation. We use the original data from the Union2 SNe Ia compilation and the angular diameter distances from two galaxy cluster samples compiled by De Filippis et al. and Bonamente et al. to test the DD relation. Our results suggest that the DD relation is compatible with observations, and the spherical model is slightly better than the elliptical model at describing the intrinsic shape of galaxy clusters if the DD relation is valid. However, these results are different from those of previous work.

Xi Yang; Hao-Ran Yu; Zhi-Song Zhang; Tong-Jie Zhang

2013-01-01T23:59:59.000Z

198

A quantum theory of distance along a curve  

E-Print Network (OSTI)

We present a quantum theory of distances along a curve, based on a linear line element that is equal to the operator square root of the quadratic metric of Riemannian geometry. Since the linear line element is an operator, we treat it according to the rules of quantum mechanics and interpret its eigenvalues as physically observable distances; the distance eigenvalues are naturally quantized. There are both positive and negative eigenvalues, which requires interpretation. Multi-element curves are defined as direct sums of line elements, and behave much like systems of spin half electrons in a magnetic field. For a curve of many elements an entropy and energy and temperature are quite naturally defined, leading via standard statistical thermodynamics to a relation between the most probable curve length and temperature. That relation may be viewed as a universal heat-shrinking property of curves. At this stage of the theory we do not include bodies or particles in the mix, do not suggest field equations for the quantum geometry, and questions of interpretation remain. The theory might conceivably be testable using observations of the early Universe, when the temperature of space was presumably quite high. In particular cosmogenesis may be thought of as time stopping at an infinite temperature as we go backwards in time to the beginning.

Ronald J. Adler

2014-02-13T23:59:59.000Z

199

A Hybrid Long-Distance Entanglement Distribution Protocol  

E-Print Network (OSTI)

We propose a hybrid (continuous-discrete variable) quantum repeater protocol for distribution of entanglement over long distances. Starting from entangled states created by means of single-photon detection, we show how entangled coherent state superpositions, also known as `Schr\\"odinger cat states', can be generated by means of homodyne detection of light. We show that near-deterministic entanglement swapping with such states is possible using only linear optics and homodyne detectors, and we evaluate the performance of our protocol combining these elements.

Jonatan B. Brask; Ioannes Rigas; Eugene S. Polzik; Ulrik L. Andersen; Anders S. Sorensen

2010-04-01T23:59:59.000Z

200

Gamma ray burst distances and the timescape cosmology  

E-Print Network (OSTI)

Gamma ray bursts can potentially be used as distance indicators, providing the possibility of extending the Hubble diagram to redshifts ~7. Here we follow the analysis of Schaefer (2007), with the aim of distinguishing the timescape cosmological model from the \\LambdaCDM model by means of the additional leverage provided by GRBs in the range 2 < z < 7. We find that the timescape model fits the GRB sample slightly better than the \\LambdaCDM model, but that the systematic uncertainties are still too little understood to distinguish the models.

Peter R. Smale

2011-08-22T23:59:59.000Z

Note: This page contains sample records for the topic "avg trip distance" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


201

An advanced method for testing of distance relay operating characteristics  

SciTech Connect

This paper describes a test method for distance relays using an advanced open-loop digital simulator. Derivation of test signals during prefault and fault, and test procedure are introduced. It is demonstrated that the method of generating test signals and the procedure of applying them to a relay under test directly affect test results. Prefault voltage and current are also a very important factor. The decaying dc offset is considered as well. Test results for five different relays using this new method are presented in this paper. The results demonstrate practical benefits of the test method.

Kezunovic, M.; Xia, Y.Q. [Texas A and M Univ., College Station, TX (United States)] [Texas A and M Univ., College Station, TX (United States); Fromen, C.W.; Sevcik, D.R. [Houston Lighting and Power Co., TX (United States)] [Houston Lighting and Power Co., TX (United States)

1996-01-01T23:59:59.000Z

202

Investigation of main coolant pump trip problem in case of SB LOCA for Kozloduy Nuclear Power Plant, WWER-440/V230  

Science Journals Connector (OSTI)

Abstract This paper presents the results of thermal-hydraulic calculation of accident scenarios that involve the trip of main coolant pump (MCP) in case of Small break loss of coolant accident (SB LOCA) for WWER-440/V230 units at Kozloduy Nuclear Power Plant (KNPP), done in support of the development of Symptom Based Emergency Operating Procedures (SB EOPs) for this plant. The main purpose of these analyses is to show how the different time of MCP switching off results in primary inventory depletion in case of SB LOCA and it is reflect on peak cladding temperature. According to this, the SB LOCA scenario is regarded from the point of view of an inadequate core cooling. Therefore, the primary concern is Critical Safety Function (CSF) Core cooling and Primary inventory. High core residual heat, minimal safety injection flow and other initial conditions challenging the mentioned \\{CSFs\\} are the main particularities of the accepted scenarios. The RELAP5/MOD3.2 computer code has been used to perform the analyses in a WWER-440 Nuclear Power Plant (NPP) model. A model of WWER-440 based on Unit 4 of Kozloduy NPP has been developed for the systems thermal-hydraulics code RELAP5/MOD3.2 at the Institute for Nuclear Research and Nuclear Energy Bulgarian Academy of Sciences (INRNE-BAS), Sofia.

Pavlin Groudev; Marina Andreeva; Malinka Pavlova

2015-01-01T23:59:59.000Z

203

Research article Effects of patch attributes, barriers, and distance between patches on the  

E-Print Network (OSTI)

Research article Effects of patch attributes, barriers, and distance between patches, Isolation, Lagidium, Matrix, Metapopulation, Mountain vizcacha, Patagonia, Patch size Abstract We tested whether size of habitat patches and distance between patches are sufficient to predict the distribution

Branch, Lyn C.

204

Accurate Computation of Geodesic Distance Fields for Polygonal Curves on Triangle Meshes  

E-Print Network (OSTI)

Accurate Computation of Geodesic Distance Fields for Polygonal Curves on Triangle Meshes David,kobbelt}@cs.rwth-aachen.de Abstract We present an algorithm for the efficient and accu- rate computation of geodesic distance fields the original algorithm is able to compute geodesic distances to isolated points on the mesh only, our

Frey, Pascal

205

Does Distance Still Matter? Revisiting the CSCW Fundamentals on Distributed Collaboration  

Science Journals Connector (OSTI)

Does distance still matter? Reporting on a comparative analysis of four ethnographic studies of global software development, this article analyzes the fundamental aspects of distance as depicted in the famous paper Distance Matters. ... Keywords: Common ground, closely coupled work, collaboration readiness, collaboration technology readiness, coupling of work

Pernille Bjrn, Morten Esbensen, Rasmus Eskild Jensen, Stina Matthiesen

2014-11-01T23:59:59.000Z

206

Modelling Ad hoc On-demand Distance Vector (AODV) Protocol with Timed Automata  

E-Print Network (OSTI)

protocols using Ad hoc On-demand Distance Vector AODV [DPR02] as our test protocol. AODV is one of mobile adModelling Ad hoc On-demand Distance Vector (AODV) Protocol with Timed Automata Sibusisiwe Chiyangwa On-demand Distance Vector protocol (AODV). Keywords: automatic veri#12;cation, model checking, real

Oxford, University of

207

Variability Analysis of Complex Networks Measures based on Stochastic Distances  

E-Print Network (OSTI)

Complex networks can model the structure and dynamics of different types of systems. It has been shown that they are characterized by a set of measures. In this work, we evaluate the variability of complex networks measures face to perturbations and, for this purpose, we impose controlled perturbations and quantify their effect. We analyze theoretical models (random, small-world and scale-free) and real networks (a collaboration network and a metabolic networks) along with the shortest path length, vertex degree, local cluster coefficient and betweenness centrality measures. In such analysis, we propose the use of three stochastic quantifiers: the Kullback-Leibler divergence and the Jensen-Shannon and Hellinger distances. The sensitivity of these measures was analyzed with respect to the following perturbations: edge addition, edge removal, edge rewiring and node removal, all of them applied at different intensities. The results reveal that the evaluated measures are influenced by these perturbations. Additio...

Cabral, Raquel; Ramrez, Jaime

2014-01-01T23:59:59.000Z

208

Spectro-photometric distances to stars: a general-purpose Bayesian approach  

E-Print Network (OSTI)

We have developed a procedure that estimates distances to stars using measured spectroscopic and photometric quantities. It employs a Bayesian approach to build the probability distribution function over stellar evolutionary models given the data, delivering estimates of expected distance for each star individually. Our method provides several alternative distance estimates for each star in the output, along with their associated uncertainties. The code was first tested on simulations, successfully recovering input distances to mock stars with errors that scale with the uncertainties in the adopted spectro-photometric parameters, as expected. The code was then validated by comparing our distance estimates to parallax measurements from the Hipparcos mission for nearby stars (< 60 pc), to asteroseismic distances of CoRoT red giant stars, and to known distances of well-studied open and globular clusters. The photometric data of these reference samples cover both the optical and near infra-red wavelengths. The...

Santiago, Baslio X; Anders, Friedrich; Chiappini, Cristina; Girardi, Lo; Rocha-Pinto, Helio J; Balbinot, Eduardo; da Costa, Luiz N; Maia, Marcio A G; Schultheis, Mathias; Steinmetz, Matthias; Miglio, Andrea; Montalbn, Josefina; Schneider, Donald P; Beers, Timothy C; Frinchaboy, Peter M; Lee, Young Sun; Zasowski, Gail

2015-01-01T23:59:59.000Z

209

_MainReportPerVehicle  

NLE Websites -- All DOE Office Websites (Extended Search)

45 45 Overall DC electrical energy consumption (DC Wh/mi)² 29 Total number of trips 1,839 Total distance traveled (mi) 21,089 Trips in Charge Depleting (CD) mode³ Gasoline fuel economy (mpg) 39 DC electrical energy consumption (DC Wh/mi) 61 Number of trips 654 Percent of trips city | highway 66% | 34% Distance traveled (mi) 5,717 Percent of total distance traveled 27% Trips in both Charge Depleting & Charge Sustaining (CD/CS) modes Gasoline fuel economy (mpg) 38 DC electrical energy consumption (DC Wh/mi) 57 Number of trips 117 Percent of trips city | highway 39% | 62% Distance traveled (mi) 3,683 Percent of total distance traveled 17% Trips in Charge Sustaining (CS) mode Gasoline fuel economy (mpg) 33 Number of trips 1,068 Percent of trips city | highway 71% | 30% Distance traveled (mi)

210

_MainReportPerVehicle  

NLE Websites -- All DOE Office Websites (Extended Search)

36 36 Overall DC electrical energy consumption (DC Wh/mi)² 18 Total number of trips 1,290 Total distance traveled (mi) 13,023 Trips in Charge Depleting (CD) mode³ Gasoline fuel economy (mpg) 39 DC electrical energy consumption (DC Wh/mi) 58 Number of trips 432 Percent of trips city | highway 75% | 25% Distance traveled (mi) 2,835 Percent of total distance traveled 22% Trips in both Charge Depleting & Charge Sustaining (CD/CS) modes Gasoline fuel economy (mpg) 41 DC electrical energy consumption (DC Wh/mi) 48 Number of trips 52 Percent of trips city | highway 31% | 69% Distance traveled (mi) 1,613 Percent of total distance traveled 12% Trips in Charge Sustaining (CS) mode Gasoline fuel economy (mpg) 34 Number of trips 806 Percent of trips city | highway 73% | 27% Distance traveled (mi)

211

_MainReportPerVehicle  

NLE Websites -- All DOE Office Websites (Extended Search)

49 49 Overall DC electrical energy consumption (DC Wh/mi)² 27 Total number of trips 927 Total distance traveled (mi) 9,301 Trips in Charge Depleting (CD) mode³ Gasoline fuel economy (mpg) 39 DC electrical energy consumption (DC Wh/mi) 66 Number of trips 313 Percent of trips city | highway 68% | 32% Distance traveled (mi) 2,138 Percent of total distance traveled 23% Trips in both Charge Depleting & Charge Sustaining (CD/CS) modes Gasoline fuel economy (mpg) 41 DC electrical energy consumption (DC Wh/mi) 63 Number of trips 46 Percent of trips city | highway 30% | 70% Distance traveled (mi) 1,462 Percent of total distance traveled 16% Trips in Charge Sustaining (CS) mode Gasoline fuel economy (mpg) 34 Number of trips 568 Percent of trips city | highway 75% | 25% Distance traveled (mi)

212

_MainReportPerVehicle  

NLE Websites -- All DOE Office Websites (Extended Search)

50 50 Overall DC electrical energy consumption (DC Wh/mi)² 22 Total number of trips 730 Total distance traveled (mi) 9,164 Trips in Charge Depleting (CD) mode³ Gasoline fuel economy (mpg) 40 DC electrical energy consumption (DC Wh/mi) 61 Number of trips 225 Percent of trips city | highway 68% | 32% Distance traveled (mi) 1,768 Percent of total distance traveled 19% Trips in both Charge Depleting & Charge Sustaining (CD/CS) modes Gasoline fuel economy (mpg) 36 DC electrical energy consumption (DC Wh/mi) 53 Number of trips 40 Percent of trips city | highway 23% | 78% Distance traveled (mi) 1,638 Percent of total distance traveled 18% Trips in Charge Sustaining (CS) mode Gasoline fuel economy (mpg) 35 Number of trips 465 Percent of trips city | highway 70% | 30% Distance traveled (mi)

213

_MainReportPerVehicle  

NLE Websites -- All DOE Office Websites (Extended Search)

53 53 Overall DC electrical energy consumption (DC Wh/mi)² 34 Total number of trips 1,515 Total distance traveled (mi) 15,617 Trips in Charge Depleting (CD) mode³ Gasoline fuel economy (mpg) 37 DC electrical energy consumption (DC Wh/mi) 65 Number of trips 739 Percent of trips city | highway 74% | 26% Distance traveled (mi) 4,915 Percent of total distance traveled 31% Trips in both Charge Depleting & Charge Sustaining (CD/CS) modes Gasoline fuel economy (mpg) 38 DC electrical energy consumption (DC Wh/mi) 58 Number of trips 93 Percent of trips city | highway 38% | 62% Distance traveled (mi) 2,842 Percent of total distance traveled 18% Trips in Charge Sustaining (CS) mode Gasoline fuel economy (mpg) 33 Number of trips 683 Percent of trips city | highway 72% | 28% Distance traveled (mi)

214

Distance measurements from supernovae and dark energy constraints  

Science Journals Connector (OSTI)

Constraints on dark energy from current observational data are sensitive to how distances are measured from TypeIa supernova (SNIa) data. We find that flux averaging of SNeIa can be used to test the presence of unknown systematic uncertainties, and yield more robust distance measurements from SNeIa. We have applied this approach to the nearby+SDSS+ESSENCE+SNLS+HST set of 288 SNeIa, and the Constitution set of 397 SNeIa. Combining the SNIa data with cosmic microwave background anisotropy data from Wilkinson Microwave Anisotropy Probe 5yr observations, the Sloan Digital Sky Survey baryon acoustic oscillation measurements, the data of 69 gamma-ray bursts (GRBs) , and the Hubble constant measurement from the Hubble Space Telescope project SHOES, we measure the dark energy density function X(z)??X(z)/?X(0) as a free function of redshift (assumed to be a constant at z>1 or z>1.5). Without the flux averaging of SNeIa, the combined data using the Constitution set of SNeIa seem to indicate a deviation from a cosmological constant at ?95% confidence level at 0?z?0.8; they are consistent with a cosmological constant at ?68% confidence level when SNeIa are flux averaged. The combined data using the nearby+SDSS+ESSENCE+SNLS+HST data set of SNeIa are consistent with a cosmological constant at 68% confidence level with or without flux averaging of SNeIa, and give dark energy constraints that are significantly more stringent than that using the Constitution set of SNeIa. Assuming a flat Universe, dark energy is detected at >98% confidence level for z?0.75 using the combined data with 288 SNeIa from nearby+SDSS+ESSENCE+SNLS+HST, independent of the assumptions about X(z?1). We quantify dark energy constraints without assuming a flat Universe using the dark energy figure of merit for both X(z) and a dark energy equation-of-state linear in the cosmic scale factor.

Yun Wang

2009-12-21T23:59:59.000Z

215

Fast Transients at Cosmological Distances with the SKA  

E-Print Network (OSTI)

Impulsive radio bursts that are detectable across cosmological distances constitute extremely powerful probes of the ionized Inter-Galactic Medium (IGM), intergalactic magnetic fields, and the properties of space-time itself. Their dispersion measures (DMs) will enable us to detect the "missing" baryons in the low-redshift Universe and make the first measurements of the mean galaxy halo profile, a key parameter in models of galaxy formation and feedback. Impulsive bursts can be used as cosmic rulers at redshifts exceeding 2, and constrain the dark energy equation-of-state parameter, $w(z)$ at redshifts beyond those readily accessible by Type Ia SNe. Both of these goals are realisable with a sample of $\\sim 10^4$ fast radio bursts (FRBs) whose positions are localized to within one arcsecond, sufficient to obtain host galaxy redshifts via optical follow-up. It is also hypothesised that gravitational wave events may emit coherent emission at frequencies probed by SKA1-LOW, and the localization of such events at ...

Macquart, J -P; Grainge, K; McQuinn, M; Fender, R P; Hessels, J; Deller, A; Bhat, R; Breton, R; Chatterjee, S; Law, C; Lorimer, D; Ofek, E O; Pietka, M; Spitler, L; Stappers, B; Trott, C

2015-01-01T23:59:59.000Z

216

The Open Cluster Distance Scale: A New Empirical Approach  

E-Print Network (OSTI)

We present new BVRI photometry for a sample of 54 local G and K stars with accurate Hipparcos parallaxes in the metallicity range -0.4 solar abundance determined from spectroscopy, we find significant disagreement at a level similar to that found by other MS-fitting studies. However, the colour-colour relationship for both these clusters suggests that their metallicity is significantly subsolar. Since the MS-fitting method relies on matching the cluster colours to a template MS, we argue that, when applying this method, the appropriate metallicity to adopt is the photometric subsolar one, not the solar abundance indicated by spectroscopy. Adopting photometric metallicities for all 4 clusters, we find complete agreement with the Hipparcos results and hence we conclude that the mismatch between the spectroscopic and photometric abundances for the Pleiades and NGC 2516 is responsible for the discrepancies in distance estimates found by previous studies. The origin of this mismatch in abundance scales remains an unsolved problem and some possible causes are discussed.

Susan M. Percival; Maurizio Salaris; David Kilkenny

2003-01-13T23:59:59.000Z

217

DISTANCE AND KINEMATICS OF THE TW HYDRAE ASSOCIATION FROM PARALLAXES  

SciTech Connect

From common proper motion and signatures of youth, researchers have identified about 30 members of a putative TW Hydrae Association. Only four of these had parallactic distances from Hipparcos. We have measured parallaxes and proper motions for 14 primary members. We combine these with literature values of radial velocities to show that the Galactic space motions of the stars, with the exception of TWA 9 and 22, are parallel and do not indicate convergence at a common formation point sometime in the last few million years. The space motions of TWA 9 and 22 do not agree with the others and indicate that they are not TWA members. The median parallax is 18 mas or 56 pc. We further analyze the stars' absolute magnitudes on pre-main-sequence evolutionary tracks and find a range of ages with a median of 10.1 Myr and no correlation between age and Galactic location. The TWA stars may have formed from an extended and filamentary molecular cloud but are not necessarily precisely coeval.

Weinberger, Alycia J.; Boss, Alan P. [Department of Terrestrial Magnetism, Carnegie Institution of Washington, 5241 Broad Branch Road NW, Washington, DC 20015 (United States)] [Department of Terrestrial Magnetism, Carnegie Institution of Washington, 5241 Broad Branch Road NW, Washington, DC 20015 (United States); Anglada-Escude, Guillem, E-mail: weinberger@dtm.ciw.edu [Institut fuer Astrophysik, Universitaet Goettingen, Friedrich-Hund-Platz 1, 37077 Goettingen (Germany)] [Institut fuer Astrophysik, Universitaet Goettingen, Friedrich-Hund-Platz 1, 37077 Goettingen (Germany)

2013-01-10T23:59:59.000Z

218

The Hubble constant and dark energy from cosmological distance measures  

E-Print Network (OSTI)

We study how the determination of the Hubble constant from cosmological distance measures is affected by models of dark energy and vice versa. For this purpose, constraints on the Hubble constant and dark energy are investigated using the cosmological observations of cosmic microwave background, baryon acoustic oscillations and type Ia suprenovae. When one investigates dark energy, the Hubble constant is often a nuisance parameter, thus it is usually marginalized over. On the other hand, when one focuses on the Hubble constant, simple dark energy models such as a cosmological constant and a constant equation of state are usually assumed. Since we do not know the nature of dark energy yet, it is interesting to investigate the Hubble constant assuming some types of dark energy and see to what extent the constraint on the Hubble constant is affected by the assumption concerning dark energy. We show that the constraint on the Hubble constant is not affected much by the assumption for dark energy. We furthermore show that this holds true even if we remove the assumption that the universe is flat. We also discuss how the prior on the Hubble constant affects the constraints on dark energy and/or the curvature of the universe.

Kazuhide Ichikawa; Tomo Takahashi

2007-10-22T23:59:59.000Z

219

A Test of Tully-Fisher Distance Estimates Using Cepheids and Type Ia Supernovae  

E-Print Network (OSTI)

We update and extend the results of Shanks (1997, MNRAS, 290, L77) by making a direct test of Tully-Fisher distance estimates to thirteen spiral galaxies with HST Cepheid distances and to ten spiral galaxies with Type Ia supernova (SNIa) distances. The results show that the Tully-Fisher distance moduli are too short with respect to the Cepheid distances by 0.46+-0.11mag and too short with respect to the SNIa distances by 0.49+-0.18mag. Combining the HST Cepheid and the best SNIa data suggests that, overall, previous Tully-Fisher distances at v~1000 kms-1 were too short by 0.43+-0.09mag, a result which is significant at the 4.6 sigma level. These data therefore indicate that previous Tully-Fisher distances should be revised upwards by 22+-5% implying, for example, a Virgo distance of 19.0+-1.8Mpc. The value of Ho from Tully-Fisher estimates is correspondingly revised downwards from Ho=84+-10kms-1Mpc-1 to Ho=69+-8kms-1Mpc-1. There is evidence that the Tully-Fisher relation at large distances is affected by Malmquist bias. In this case, we argue that Ho<50kms-1Mpc-1 cannot be ruled out by Tully-Fisher considerations.

T. Shanks

1999-01-24T23:59:59.000Z

220

Error compensation in distance relays caused by wind power plants in the power grid  

Science Journals Connector (OSTI)

Abstract This article presents the Prony method as a filtering technique for distance relays. First, the effect of non-filtered frequency components generated by wind power plants in distance relays is evaluated in a simplified model of a doubly fed induction generator, resulting in an error of apparent impedance measurement. Then, the effects of non-filtered frequency components for typical distance relay are presented. The error in apparent impedance measurement is evaluated in reach and operation time of the relay; a distorted characteristic of the mho distance relay is shown in the impedance plane. Finally, Prony method as a filtering technique is implemented as a solution of the apparent impedance measurement error, and the simulated case and a real fault event are evaluated to validate the proposed distance relay algorithm. Thus the asynchronous frequency components of voltage and current signals are identified and filtered, as a result the performance of the distance relay is enhanced.

L.A. Trujillo Guajardo; A. Conde Enrquez; Z. Leonowicz

2014-01-01T23:59:59.000Z

Note: This page contains sample records for the topic "avg trip distance" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


221

High-precision absolute distance and vibration measurement with frequency scanned interferometry  

SciTech Connect

We report high-precision absolute distance and vibration measurements performed with frequency scanned interferometry using a pair of single-mode optical fibers. Absolute distance was determined by counting the interference fringes produced while scanning the laser frequency. A high-finesse Fabry-Perot interferometer was used to determine frequency changes during scanning. Two multiple-distance-measurement analysis techniques were developed to improve distance precision and to extract the amplitude and frequency of vibrations. Under laboratory conditions, measurement precision of {approx}50 nm was achieved for absolute distances ranging from 0.1 to 0.7 m by use of the first multiple-distance-measurement technique. The second analysis technique has the capability to measure vibration frequencies ranging from 0.1 to 100 Hz with an amplitude as small as a few nanometers without a priori knowledge.

Yang, H.-J.; Deibel, Jason; Nyberg, Sven; Riles, Keith

2005-07-01T23:59:59.000Z

222

Long distance symmetries for nuclear forces and the similarity renormalization group  

SciTech Connect

In this work we study the emergence of long distance symmetries for nuclear forces within the framework of the similarity renormalization group approach.

Szpigel, S. [Faculdade de Computacao e Informatica, Universidade Presbiteriana Mackenzie, 01302-907, Sao Paulo - SP (Brazil); Timoteo, V. S. [Faculdade de Tecnologia, Universidade Estadual de Campinas, 13484-332, Limeira - SP (Brazil); Arriola, E. R. [Departamento de Fisica Atomica, Molecular y Nuclear and Instituto Carlos I de Fisica Teorica y Computacional, Universidad de Granada, E-18071, Granada (Spain)

2013-03-25T23:59:59.000Z

223

Long distance transmission of SC-FDMA signals by directly-modulated OIL-VCSEL  

Science Journals Connector (OSTI)

We demonstrate the long distance transmission of single-carrier frequency division multiple address signals by directly-modulated optically injection-locked ...

Guo, Peng; Zhang, Cheng; Li, Juhao; Yang, Weijian; Parekh, Devang; Chang-Hasnain, Connie J; Hu, Weiwei; Xu, Anshi; Chen, Zhangyuan

2012-01-01T23:59:59.000Z

224

Electronics Based Innovation In A Niche Market: Distances Measured By The Speed Of Light.  

E-Print Network (OSTI)

??The purpose of this study is to document the development of an accurate, affordable, reliable machine to perform the relatively long distance measurements routinely made (more)

Murphy, James S.

2004-01-01T23:59:59.000Z

225

Trips in planning: January 2012  

E-Print Network (OSTI)

: A Photographic Adventure September 1­9, 2011 (9 days) Study leader: Dr. David Foster Price: $5,550 · Single

Wood, Robert

226

Training Centres : An Architecture for the Realisation of Open and Distance Learning Environments using Telematics.  

E-Print Network (OSTI)

-based distance education software. The TRENDS Project The TRENDS Project aims at the development and efficientTraining Centres : An Architecture for the Realisation of Open and Distance Learning Environments) Environments using Telematics. The approach of using Training Centres as dedicated education services providers

Bouras, Christos

227

Design and Implementation of a Terrorist Fraud Resilient Distance Bounding System  

E-Print Network (OSTI)

Design and Implementation of a Terrorist Fraud Resilient Distance Bounding System Aanjhan, existing analog implementations do not support resilience against Terrorist Fraud attacks; they protect only against Distance Fraud and Mafia Fraud attacks. We address this problem and propose a new, hy

Capkun, Srdjan

228

Distance Estimation by Constructing The Virtual Ruler in Anisotropic Sensor Networks  

E-Print Network (OSTI)

fields, such as industrial sensing and scheduling, critical construction protection, environmentalDistance Estimation by Constructing The Virtual Ruler in Anisotropic Sensor Networks Yun Wang Kai. Furthermore, we develop an approach to construct a virtual ruler for distance estimation between any pair

Wu, Jie

229

AN INTEGRATION TECHNOLOGY FOR LONG DISTANCE LOGISTICS AND SUPPLY CHAIN MANAGEMENT  

E-Print Network (OSTI)

1 AN INTEGRATION TECHNOLOGY FOR LONG DISTANCE LOGISTICS AND SUPPLY CHAIN MANAGEMENT Hyunbo Cho will continue to grow. That trade depends on many intercontinental, long-distance, logistics partners. Those) ensure interoperability among logistics applications; (2) provide shipment visibility to all trading

Peng, Yun

230

An optimal parallel algorithm for the Euclidean distance maps of 2D binary images  

E-Print Network (OSTI)

The Euclidean distance map (EDM) of a black and white n 2 n binary image is the n 2 n map where each element has the Euclidean distance between the corresponding pixel and the nearest black pixel. The EDM plays an important role in machine vision, pattern recognition, and robotics[9]. Many algorithms have been proposed

Fujiwara, Akihiro

231

Pedagogical Issues in webMathematica Applications In Distance Learning Mathematics  

E-Print Network (OSTI)

organizational and administrative arrangements [1]. The growth of Internet-based distance learning will havePedagogical Issues in webMathematica Applications In Distance Learning Mathematics M. F. Abdul learning and good teaching. The learning experiences must be well organized and integrated

Spagnolo, Filippo

232

Perfect Passion at a Distance how to win at Polish poker : use quantum dice  

E-Print Network (OSTI)

to satellites in space, so they could theoretically be relayed anywhere on the planet. To test their systemPerfect Passion at a Distance how to win at Polish poker : use quantum dice Richard Gill the money thanks to Marek ukowski, Gdansk 5 #12;Distance no worries for spooky particles Stephen Pincock ABC

Gill, Richard D.

233

An Approximate Analytical Algorithm for Evaluating the Distances in a Dark Energy Dominated Universe  

E-Print Network (OSTI)

The most recent cosmological observations indicate that the present universe is flat and vacuum dominated. In such a universe, the distance measurements are always difficult and involve numerical computations. In this paper, it is shown that the most fundamental distance measurement of cosmology, the luminosity distance, for such a universe can be obtained in an approximate analytical way with very small errors of less than 0.02% up to %z = 5$ for any value of vacuum energy. The analytical calculation is shown to be exceedingly efficient, as compared to the traditional numerical methods.

T. Wickramasinghe

2007-12-05T23:59:59.000Z

234

The jet kinetic power, distance and inclination of GRS 1915+105  

E-Print Network (OSTI)

We apply a recently developed technique of calculating the minimum jet kinetic power to the major mass ejections of the black-hole binary GRS 1915+105 observed in radio wavelengths in 1994 and 1997. We derive for them the distance-dependent minimum power, the mass flow rate, the total energy content and the total mass. We find that a very fast increase of the jet power with the increasing distance combined with a known relation between the jet kinetic power and luminosity imply the source distance is 9 kpc.

Zdziarski, Andrzej A

2014-01-01T23:59:59.000Z

235

MonthlyReport  

NLE Websites -- All DOE Office Websites (Extended Search)

8 8 Overall AC electrical energy consumption (AC Wh/mi)¹ 148 Overall DC electrical energy consumption (DC Wh/mi)² 104 Total number of trips 1,212 Total distance traveled (mi) 11,846 Trips in Charge Depleting (CD) mode³ Gasoline fuel economy (mpg) 58 DC electrical energy consumption (DC Wh/mi) 160 Number of trips 823 Percent of trips city | highway 81% | 19% Distance traveled (mi) 5,559 Percent of total distance traveled 47% Trips in both Charge Depleting & Charge Sustaining (CD/CS) modes Gasoline fuel economy (mpg) 46 DC electrical energy consumption (DC Wh/mi) 85 Number of trips 195 Percent of trips city | highway 40% | 61% Distance traveled (mi) 4,217 Percent of total distance traveled 36% Trips in Charge Sustaining (CS) mode Gasoline fuel economy (mpg) 34 Number of trips

236

Phase Insensitive Frequency Modulation Sensor for Long Distance CO2 Monitoring  

Science Journals Connector (OSTI)

We report a long distance CO2 monitoring LIDAR using phase insensitive Two-Tone Frequency Modulation (TTFM) over 1.4km. We could detect 1ppm single pass CO2...

Wu, Sheng; Deev, Andrei

237

Political risk, cultural distance, and outward foreign direct investment: Empirical evidence from large Chinese firms  

Science Journals Connector (OSTI)

The internationalization of Chinese enterprises is a subject that is receiving increasing attention in international business research. This paper analyzes the influence of political risk and cultural distance on...

Diego Quer; Enrique Claver; Laura Rienda

2012-12-01T23:59:59.000Z

238

Dissemination of Evidence-Based Practice: Can We Train Therapists from a Distance?  

E-Print Network (OSTI)

K. M. (2005). We dont train in vain: A dissemination trialBased Practice: Can We Train Therapists from a Distance?both implement the model and to train parents; (b) didactic

Vismara, Laurie A.; Young, Gregory S.; Stahmer, Aubyn C.; Griffith, Elizabeth McMahon; Rogers, Sally J.

2009-01-01T23:59:59.000Z

239

A New Class of RC4 Colliding Key Pairs with Greater Hamming Distance  

Science Journals Connector (OSTI)

In this paper, we discovered a new class of colliding key pairs of RC4, namely ... discovery of RC4 colliding keys with hamming distance greater than one, that is, the colliding ... the probability of the existen...

Jiageng Chen; Atsuko Miyaji

2010-01-01T23:59:59.000Z

240

Perceptions of Administrators on the Use of Distance Education in Texas Public Schools  

E-Print Network (OSTI)

The purpose of this study was to determine the perceptions of school administrators about the use of distance education in Texas public schools. A mixed-method research design was used to determine if these administrators' perceptions were barriers...

Rabroker, Raymond Bernard Jr.

2012-02-14T23:59:59.000Z

Note: This page contains sample records for the topic "avg trip distance" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


241

Foraging distances and forager population sizes of the desert termite Gnathamitermes tubiformans (Buckley) (Isoptera: Termitidae)  

E-Print Network (OSTI)

. Analyses showed no significant correlations between distances moved and abundance or type of vegetation. Movement of marked termites did not favor any compass directions. The second experiment used a mark-recapture estimation model to predict G...

Narayanan, Anne Michelle

2005-11-01T23:59:59.000Z

242

Data transformation techniques for preserving privacy in distance-based mining algorithms  

Science Journals Connector (OSTI)

Dissimilarity calculation between two objects is one of the important knowledge gathering methods in cognition science. Many data mining algorithms explore dissimilarity computation to cluster the data in order to know intra-relations, inter-relations, and outliers in the data. Majority of these algorithms use Euclidean distance as the dissimilarity criterion. In this paper, signal transformation functions, with their orthogonal property and energy compaction features are explored in transforming the data. The data transformation scheme considers entire data as a single entity. The proposed scheme is designed such that it can be used even for the non-Euclidean space by using the distance mapping algorithm. The existing randomisation approaches for data transformation maintain only the distributions and do not maintain the Euclidean distance between the records. The proposed methods are superior to the existing methods in terms of run time complexity O(n) and preservation of distance between individual data points.

Mohammad Ali Kadampur; D.V.L.N. Somayajulu

2014-01-01T23:59:59.000Z

243

Distance-learning receptivity differences between American and Korean graduate students  

E-Print Network (OSTI)

The purposes of this study were to determine if differences exist in distance-learning receptivity and perceived technology usefulness between American and Korean graduate students as well as Individualists and Collectivists. Results indicated...

Kim, Jung Il

2005-08-29T23:59:59.000Z

244

Accident causation study on roadways with limited sight distance crest vertical curves  

E-Print Network (OSTI)

reflect the driver and vehicle population currently on the transportation network. An accident causation study was conducted to determine if roadways with limited stopping sight distance present a safety hazard for the transportation network. Rural two...

Stoddard, Angela May

2012-06-07T23:59:59.000Z

245

Regularization and improved interpretation of linear data mappings and adaptive distance measures  

E-Print Network (OSTI)

Regularization and improved interpretation of linear data mappings and adaptive distance measures dimensional data sets linear transformations are not necessarily uniquely determined, though, and alternative learning algorithms. Principal component analysis (PCA) is a good example of a standard technique

Biehl, Michael

246

The development of an instrument to assess student opinions of the quality of distance education  

E-Print Network (OSTI)

coursework and degrees are of high quality? The purpose of this study is threefold: (1) to identify quality indicators of distance education; (2) to provide implications of the identified quality indicators for health education researchers and practitioners...

Chaney, Elizabeth Hensleigh

2009-05-15T23:59:59.000Z

247

Long-Distance FBG Sensor System Using High-Speed Swept-Wavelength Light Source  

Science Journals Connector (OSTI)

A long-distance FBG sensor system using a power controlled high-speed swept-wavelength light source is proposed and demonstrated. This system can measure FBGs reflection wavelengths...

Saitoh, Takanori; Nakamura, Kenichi; Takahashi, Yoshifumi; Iida, Hiroyuki; Iki, Yoshimitsu; Miyagi, Koichiro

248

Too close for comfort: Stimulus valence moderates the influence of motivational orientation on distance perception  

E-Print Network (OSTI)

approach and avoidance (Elliot, 2006, 1999; Elliot & Covington, 2001). Ap- proach is a preparedness to attain a stimulus in the environment, whereas avoidance is a preparedness to move away from it (Strack & Deutsch, 2004). According to the compatibility hypothesis... , it can also be defined as a preparedness to decrease the distance between a person and a stimulus (Strack & Deutsch, 2004). Given that positive stimuli are compatible with approach, decrease of physical distance usually occurs in relation to positive...

Krpan, Dario; Schnall, Simone

2014-12-04T23:59:59.000Z

249

Factors affecting the adoption of distance education technology by Cooperative Extension Agents in the State of Texas  

E-Print Network (OSTI)

on distance education. There was a definite need to increase the amount of information and technology support available. Gender, rank/level, and age played little to no role in perceptions of distance education. The belief that learning requires face...

Jones, Edmund Theodore

2012-06-07T23:59:59.000Z

250

A NEW DISTANCE TO M33 USING BLUE SUPERGIANTS AND THE FGLR METHOD  

SciTech Connect

The quantitative spectral analysis of medium resolution optical spectra of A and B supergiants obtained with DEIMOS and ESI at the Keck Telescopes is used to determine a distance modulus of 24.93 +- 0.11 mag (968 +- 50 kpc) for the Triangulum Galaxy M33. The analysis yields stellar effective temperatures, gravities, interstellar reddening, and extinction, the combination of which provides a distance estimate via the flux-weighted gravity-luminosity relationship (FGLR). This result is based on an FGLR calibration that is continually being polished. An average reddening of (E(B - V)) approx 0.08 mag is found, with a large variation ranging from 0.01 to 0.16 mag, however, demonstrating the importance of accurate individual reddening measurements for stellar distance indicators in galaxies with evident signatures of interstellar absorption. The large-distance modulus found is in good agreement with recent work on eclipsing binaries, planetary nebulae, long-period variables, RR Lyrae stars, and also with Hubble Space Telescope (HST) observations of Cepheids, if reasonable reddening assumptions are made for the Cepheids. Since distances based on the tip of the red giant branch (TRGB) method found in the literature give conflicting results, we have used HST Advanced Camera for Surveys V- and I-band images of outer regions of M33 to determine a TRGB distance of 24.84 +- 0.10 mag, in basic agreement with the FGLR result. We have also determined stellar metallicities and discussed the metallicity gradient in the disk of M33. We find metallicity of Z {sub sun} at the center and 0.3 Z {sub sun} in the outskirts at a distance of one isophotal radius. The average logarithmic metallicity gradient is -0.07 +- 0.01 dex kpc{sup -1}. However, there is a large scatter around this average value, very similar to what has been found for the H II regions in M33.

U, Vivian; Urbaneja, Miguel A.; Kudritzki, Rolf-Peter; Jacobs, Bradley A.; Bresolin, Fabio [Institute for Astronomy, University of Hawaii, 2680 Woodlawn Drive, Honolulu, HI 96822 (United States); Przybilla, Norbert, E-mail: vivian@ifa.hawaii.ed, E-mail: urbaneja@ifa.hawaii.ed, E-mail: kud@ifa.hawaii.ed, E-mail: bjacobs@ifa.hawaii.ed, E-mail: bresolin@ifa.hawaii.ed, E-mail: przybilla@sternwarte.uni-erlangen.d [Dr. Remeis-Sternwarte Bamberg, Sternwartstrasse 7, D-96049 Bamberg (Germany)

2009-10-20T23:59:59.000Z

251

Pursuing the M.Eng. in acoustics through distance education from Penn State  

Science Journals Connector (OSTI)

Since 1987 the Graduate Program in Acoustics at Penn State has been providing remote access to graduate level education leading to the M.Eng. degree in Acoustics. Course lecture content is currently broadcast as a live-stream via Adobe Connect to distance students scattered throughout North America and around the world while archived recordings allow distance students to access lecture material at their convenience. Distance Education students earn the M.Eng. in Acoustics degree by completing 30 credits of coursework (six required core courses and four electives) and writing a capstone paper. Courses offered for distance education students include: fundamentals of acoustics and vibration electroacoustic transducers signal processing acoustics in fluid media sound and structure interaction digital signal processing aerodynamic noise acoustic measurements and data analysis ocean acoustics architectural acoustics noise control engineering nonlinear acoustics outdoor sound propagation computational acoustics flow induced noise spatial sound and 3D audio marine bioacoustics and acoustics of musical instruments. This poster will summarize the distance education experience leading to the M.Eng. degree in Acoustics from Penn State showcasing student demographics capstone paper topics enrollment statistics and trends and the success of our graduates.

2014-01-01T23:59:59.000Z

252

_MainReportPerVehicle  

NLE Websites -- All DOE Office Websites (Extended Search)

4 4 Overall AC electrical energy consumption (AC Wh/mi)¹ 64 Overall DC electrical energy consumption (DC Wh/mi)² 31 Total number of trips 831 Total distance traveled (mi) 7,559 Trips in Charge Depleting (CD) mode³ Gasoline fuel economy (mpg) 35 DC electrical energy consumption (DC Wh/mi) 54 Number of trips 541 Percent of trips city | highway 79% | 21% Distance traveled (mi) 3,402 Percent of total distance traveled 45%

253

_MainReportPerVehicle  

NLE Websites -- All DOE Office Websites (Extended Search)

2 2 Overall AC electrical energy consumption (AC Wh/mi)¹ 45 Overall DC electrical energy consumption (DC Wh/mi)² 22 Total number of trips 1,585 Total distance traveled (mi) 14,910 Trips in Charge Depleting (CD) mode³ Gasoline fuel economy (mpg) 34 DC electrical energy consumption (DC Wh/mi) 49 Number of trips 883 Percent of trips city | highway 81% | 19% Distance traveled (mi) 4,778 Percent of total distance traveled 32%

254

Relevant distance between two different instances of the same potential energy in protein folding  

E-Print Network (OSTI)

In the context of complex systems and, particularly, of protein folding, a physically meaningful distance is defined which allows to make useful statistical statements about the way in which energy differences are modified when two different instances of the same potential-energy function are used. When the two instances arise from the fact that different algorithms or different approximations are used, the distance herein defined may be used to evaluate the relative accuracy of the two methods. When the difference is due to a change in the free parameters of which the potential depends on, the distance can be used to quantify, in each region of parameter space, the robustness of the modeling to such a change and this, in turn, may be used to assess the significance of a parameters' fit. Both cases are illustrated with a practical example: the study of the Poisson-based solvation energy in the Trp-Cage protein (PDB code 1L2Y).

Jose Luis Alonso; Pablo Echenique

2005-04-21T23:59:59.000Z

255

Structural Interpretation of Paramagnetic Relaxation Enhancement-Derived Distances for Disordered Protein States  

Science Journals Connector (OSTI)

Paramagnetic relaxation enhancement (PRE) is a powerful technique for studying transient tertiary organizations of unfolded and partially folded proteins. The heterogeneous and dynamic nature of disordered protein states, together with the r?6 dependence of PRE, presents significant challenges for reliable structural interpretation of PRE-derived distances. Without additional knowledge of accessible conformational substates, ensemble-simulation-based protocols have been used to calculate structure ensembles that appear to be consistent with the PRE distance restraints imposed on the ensemble level with the proper r?6 weighting. However, rigorous assessment of the reliability of such protocols has been difficult without intimate knowledge of the true nature of disordered protein states. Here we utilize sets of theoretical PRE distances derived from simulated structure ensembles that represent the folded, partially folded and unfolded states of a small protein to investigate the efficacy of ensemble-simulation-based structural interpretation of PRE distances. The results confirm a critical limitation that, due to r?6 weighting, only one or a few members need to satisfy the distance restraints and the rest of the ensemble are essentially unrestrained. Consequently, calculated structure ensembles will appear artificially heterogeneous no matter whether the PRE distances are derived from the folded, partially unfolded or unfolded state. Furthermore, the nature of the heterogeneous ensembles is largely determined by the protein model employed in structure calculation and reflects little on the true nature of the underlying disordered state. These findings suggest that PRE measurements on disordered protein states alone generally do not contain enough information for a reliable structural interpretation and that the latter will require additional knowledge of accessible conformational substates. Interestingly, when a very large number of PRE measurements is available, faithful structural interpretation might be possible with intermediate ensemble sizes under ideal conditions.

Debabani Ganguly; Jianhan Chen

2009-01-01T23:59:59.000Z

256

Low red-shift formula for the luminosity distance in a LTB model with cosmological constant  

E-Print Network (OSTI)

We calculate the low red-shift Taylor expansion for the luminosity distance for an observer at the center of a spherically symmetric matter inhomogeneity with a non vanishing cosmological constant. We then test the accuracy of the formulas comparing them to the numerical calculation for different cases for both the luminosity distance and the radial coordinate. The formulas can be used as a starting point to understand the general non linear effects of a local inhomogeneity in presence of a cosmological constant, without making any special assumption about the inhomogeneity profile.

Antonio Enea Romano; Pisin Chen

2014-05-08T23:59:59.000Z

257

The Exemplar Breakpoint Distance for Non-trivial Genomes Cannot Be Approximated  

E-Print Network (OSTI)

The Exemplar Breakpoint Distance for Non-trivial Genomes Cannot Be Approximated Guillaume Blin1 - France guillaume.fertin@univ-nantes.fr Abstract. A promising and active field of comparative genomics con- sists in comparing two genomes by establishing a one-to-one correspon- dence (i.e., a matching) between

Blin, Guillaume

258

Of Mice and Men: Algorithms for Evolutionary Distances Between Genomes with Translocation  

E-Print Network (OSTI)

Chapter 66 Of Mice and Men: Algorithms for Evolutionary Distances Between Genomes is combinatorial algorithms for genome rear- rangement. In the course of its evolution, the genome of an organism is to determine the minimum number of such events that transform one genome to another. This number is called

Ravi, R.

259

The Exemplar Breakpoint Distance for non-trivial genomes cannot be approximated  

E-Print Network (OSTI)

The Exemplar Breakpoint Distance for non-trivial genomes cannot be approximated Guillaume Blin1 - France guillaume.fertin@univ-nantes.fr Abstract. A promising and active field of comparative genomics con- sists in comparing two genomes by establishing a one-to-one correspon- dence (i.e., a matching) between

Boyer, Edmond

260

Approximating the True Evolutionary Distance Between Two Genomes Krister M. Swenson  

E-Print Network (OSTI)

Approximating the True Evolutionary Distance Between Two Genomes Krister M. Swenson Mark Marron Joel V. Earnest-DeYoung Bernard M.E. Moret Abstract As more and more genomes are sequenced, evolutionary bi- ologists are becoming increasingly interested in evolution at the level of whole genomes

Moret, Bernard

Note: This page contains sample records for the topic "avg trip distance" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


261

Scaffold Filling Under the Breakpoint Distance Haitao Jiang1,2  

E-Print Network (OSTI)

of genome sequencing without completing the sequence of the whole genomes, Mu~noz et al. recently studied the problem of filling an incomplete multichromosomal genome (or scaffold) I with respect to a complete target genome G such that the resulting genomic distance between I and G is minimized, where I

Zhu, Binhai

262

Reducing the Plagiarism Detection Search Space on the Basis of the Kullback-Leibler Distance  

E-Print Network (OSTI)

Reducing the Plagiarism Detection Search Space on the Basis of the Kullback-Leibler Distance, jbenedi}@dsic.upv.es http://www.dsic.upv.es/grupos/nle/ Abstract. Automatic plagiarism detection the plagiarised fragments to their potential source. Publications on this task often assume that the search space

Rosso, Paolo

263

Testing the DistanceDuality Relation with Galaxy Clusters and Type Ia Supernovae  

Science Journals Connector (OSTI)

In this Letter, we propose a new and model-independent cosmological test for the distance-duality (DD) relation, ? = DL (z)(1 + z)2/DA (z) = 1, where DL and DA are, respectively, the luminosity and angular diameter distances. For DL we consider two sub-samples of Type Ia supernovae (SNe Ia) taken from Constitution data whereas DA distances are provided by two samples of galaxy clusters compiled by De Filippis etal. and Bonamente etal. by combining Sunyaev-Zeldovich effect and X-ray surface brightness. The SNe Ia redshifts of each sub-sample were carefully chosen to coincide with the ones of the associated galaxy cluster sample (?z DA (z) ? DL (z), we have tested the DD relation by assuming that ? is a function of the redshift parameterized by two different expressions: ?(z) = 1 + ?0 z and ?(z) = 1 + ?0 z/(1 + z), where ?0 is a constant parameter quantifying a possible departure from the strict validity of the reciprocity relation (?0 = 0). In the best scenario (linear parameterization), we obtain ?0 = 0.28+0.44 0.44 (2?, statistical + systematic errors) for the De Filippis etal. sample (elliptical geometry), a result only marginally compatible with the DD relation. However, for the Bonamente etal. sample (spherical geometry) the constraint is ?0 = 0.42+0.34 0.34 (3?, statistical + systematic errors), which is clearly incompatible with the duality-distance relation.

R. F. L. Holanda; J. A. S. Lima; M. B. Ribeiro

2010-01-01T23:59:59.000Z

264

On Regular Graphs Optimally Labeled with a Condition at Distance Two  

Science Journals Connector (OSTI)

For positive integers $j \\geq k$, the $\\lambda_{j,k}$-number of graph G is the smallest span among all integer labelings of V(G) such that vertices at distance two receive labels which differ by at least k and adjacent vertices ... Keywords: $L(j, k)$-labeling, prism, regular graph

John P. Georges; David W. Mauro

2004-02-01T23:59:59.000Z

265

Labeling Products of Complete Graphs with a Condition at Distance Two  

Science Journals Connector (OSTI)

For integers $j \\geq k$, an L(j,k)-labeling of a graph G is an integer labeling of the vertices in V(G) such that adjacent vertices receive integers which differ by at least j, and vertices which are distance ... Keywords: $\\lambda^j_k$-labeling, Cayley graph, product of complete graphs, vertex labeling

John P. Georges; David W. Mauro; Melanie I. Stein

2001-01-01T23:59:59.000Z

266

On generalized Petersen graphs labeled with a condition at distance two  

Science Journals Connector (OSTI)

An L(2, 1)-labeling of graph G is an integer labeling of the vertices in V(G) such that adjacent vertices receive labels which differ by at least two, and vertices which are distance two apart receive labels which differ by at least ... Keywords: ?-number, 3-regular graphs, L(2,1)-labeling, generalized Petersen graph

John P. Georges; David W. Mauro

2002-12-01T23:59:59.000Z

267

Magnetic Injection of Nanoparticles into Rat Inner Ears at a Human Head Working Distance  

E-Print Network (OSTI)

t57 1 Magnetic Injection of Nanoparticles into Rat Inner Ears at a Human Head Working Distance: azeem@umd.edu Due to the physics of magnetic fields and forces, any single magnet will always attract or pull-in magnetically-responsive particles. However, there are a variety of clinical needs where

Shapiro, Benjamin

268

A Performance Study of Kullback-Leibler Distance-based Spectrum Sensing Algorithm  

E-Print Network (OSTI)

-day spectrum allocation and spectrum use suggests that radio spectrum shortage could be overcome by allowing immediate local spectrum availability. A new class of radios that is able to reliably sense the spectral1 A Performance Study of Kullback-Leibler Distance-based Spectrum Sensing Algorithm Bassem Zayen

Gesbert, David

269

MIMO Ad Hoc Networks: Medium Access Control, Saturation Throughput and Optimal Hop Distance  

E-Print Network (OSTI)

1 MIMO Ad Hoc Networks: Medium Access Control, Saturation Throughput and Optimal Hop Distance Ming in mobile ad hoc networks. Specifically, we focus on ad hoc networks where the spa- tial diversity technique technique can enhance the performance of mobile ad hoc networks significantly. Key words: ad hoc networks

Reisslein, Martin

270

SEAD: secure efficient distance vector routing for mobile wireless ad hoc networks  

E-Print Network (OSTI)

SEAD: secure efficient distance vector routing for mobile wireless ad hoc networks Yih-Chun Hu a University, Houston, TX 77005, USA Abstract An ad hoc network is a collection of wireless computers (nodes stations or access points. Although many previous ad hoc network routing protocols have been based in part

Ramkumar, Mahalingam

271

Final Technical Report: Discovering the Nature of Dark Energy: Towards Better Distances from Type Ia Supernovae  

SciTech Connect

The final technical report from the project "Discovering the Nature of Dark Energy: Towards Better Distances from Type Ia Supernovae" led at Rutgers the State University of New Jersey by Prof. Saurabh W. Jha is presented, including all publications resulting from this award.

Saurabh W. Jha

2012-10-03T23:59:59.000Z

272

A Surface Energy Transfer Nanoruler for Measuring Binding Site Distances on Live Cell Surfaces  

E-Print Network (OSTI)

background significantly reduces the signal-to-background ratio of the plasmonic sensor and greatly hinders SET nanoruler for live cells with long distance, easy construction, fast detection, and low background (LSPR) sensors meet these requirements.8-10 Liu et al.8 constructed a nanoplasmonic molecular ruler

Tan, Weihong

273

On the Stability of Network Distance Estimation Yan Chen, Khian Hao Lim, and Randy H. Katz  

E-Print Network (OSTI)

: daily, weekly, monthly, etc. Our results show that Internet Iso-bar has good prediction accuracy-to-end Internet distance can bene#12;t many applications and services, such as e?cient overlay construction, overlay routing and location, and peer-to- peer systems. While there have been many proposals on Internet

Chen, Yan

274

Internet Iso-bar: A Scalable Overlay Distance Monitoring Yan Chen, and Randy H. Katz  

E-Print Network (OSTI)

]. Internet Iso-bar is easy to implement and use, and has good scalability and small communicationInternet Iso-bar: A Scalable Overlay Distance Monitoring System Yan Chen, and Randy H. Katz-to-peer overlay routing and location. However, there is a lack of such scalable system with small over- head, good

Chen, Yan

275

Study of spin sum rules (and the strong coupling constant at large distances)  

E-Print Network (OSTI)

We present recent results from Jefferson Lab on sum rules related to the spin structure of the nucleon. We then discuss how the Bjorken sum rule, with its connection to the Gerasimov-Drell-Hearn sum, allows us to conveniently define an effective coupling for the strong force at all distances.

A. Deur

2009-07-20T23:59:59.000Z

276

On the Stability of Distance-based Formation Control Dimos V. Dimarogonas and Karl H. Johansson  

E-Print Network (OSTI)

to be provably correct when the formation graph is a tree. Moreover, it is shown that the tree structure by the Swedish Research Council, the Swedish Foundation for Strategic Research, and the EU NoE HYCON. recent Ph that it stabilizes the system to the desired relative distances provided that the formation graph is a tree

Johansson, Karl Henrik

277

K-median clustering, model-based compressive sensing, and sparse recovery for earth mover distance  

E-Print Network (OSTI)

We initiate the study of sparse recovery problems under the Earth-Mover Distance (EMD). Specifically, we design a distribution over m x n matrices A such that for any x, given Ax, we can recover a k-sparse approximation ...

Indyk, Piotr

278

Patch Time Allocation by a Parasitoid: The Influence of Con-specifics, Host Abundance and Distance  

E-Print Network (OSTI)

Patch Time Allocation by a Parasitoid: The Influence of Con-specifics, Host Abundance and Distance to the Patch Juan C. Corley & José M. Villacide & Saskya van Nouhuys Revised: 20 April 2010 /Accepted: 10 August 2010 / Published online: 27 August 2010 # Springer Science+Business Media, LLC 2010 Abstract Patch

279

Distance learning and its application to the Yucca Mountain Site Characterization Project  

SciTech Connect

This paper discusses the concept of distance learning, which is used to exchange information via electronic media with real time interaction. Issues concerning policy, funding, legislation, accessibility, and programming are outlined. Possible applications for education, business, and federal projects, with a focus on the Yucca Mountain Site Characterization Project, are also discussed.

Brandt, J.; Sizemore, J. [SAIC, Las Vegas, NV (United States)

1995-12-01T23:59:59.000Z

280

Development of a test of Newton's law of gravitation at micrometer distances using a superconducting spherical torsion balance.  

E-Print Network (OSTI)

??Many theories associated with quantum gravity, such as string theory, predict violations of inverse square law (ISL) of gravity at sub millimetre distances. To search (more)

Rocco, Emanuele

2008-01-01T23:59:59.000Z

Note: This page contains sample records for the topic "avg trip distance" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


281

Long distance measurement-device-independent quantum key distribution with coherent-state superpositions  

E-Print Network (OSTI)

Measurement-device-independent quantum key distribution (MDI-QKD) with decoy-state method is believed to be securely applied to defeat various hacking attacks in practical quantum key distribution systems. Recently, the coherent-state superpositions (CSS) have emerged as an alternative to single-photon qubits for quantum information processing and metrology. Here, in this Letter, CSS are exploited as the source in MDI-QKD. We present an analytical method which gives two tight formulas to estimate the lower bound of yield and the upper bound of bit error rate. We exploit the standard statistical analysis and Chernoff bound to perform the parameter estimation. Chernoff bound can provide good bounds in the long distance MDI-QKD. Our results show that with CSS, both the security transmission distance and secure key rate are significantly improved compared with those of the weak coherent states in the finite-data case.

Hua-Lei Yin; Wen-Fei Cao; Yao Fu; Yan-Lin Tang; Yang Liu; Teng-Yun Chen; Zeng-Bing Chen

2014-09-19T23:59:59.000Z

282

Feasibility of measuring the Shapiro time delay over meter-scale distances  

E-Print Network (OSTI)

The time delay of light as it passes by a massive object, first calculated by Shapiro in 1964, is a hallmark of the curvature of space-time. To date, all measurements of the Shapiro time delay have been made over solar-system distance scales. We show that the new generation of kilometer-scale laser interferometers being constructed as gravitational wave detectors, in particular Advanced LIGO, will in principle be sensitive enough to measure variations in the Shapiro time delay produced by a suitably designed rotating object placed near the laser beam. We show that such an apparatus is feasible (though not easy) to construct, present an example design, and calculate the signal that would be detectable by Advanced LIGO. This offers the first opportunity to measure space-time curvature effects on a laboratory distance scale.

S. Ballmer; S. Mrka; P. Shawhan

2010-07-13T23:59:59.000Z

283

A comparison of engagement and interaction among university distance learning students  

Science Journals Connector (OSTI)

When facilitating instruction in distance learning environments, educators are presented with challenges in student motivation and development of community. We used a mixed-method approach to analyse the interaction patterns and quality of discussion among distance learning college students who used two different course tools to complete assignments. Six patterns of discussion emerged from the posts: agreement, disagreement, countering, belief, statement, and re-state. We used a five-point scale to assess the quality of students' posts. The student posts from VoiceThread (VT) assignments had higher quality scores and higher frequency of countering and belief statements. Whereas, the student posts from discussion board (DB) assignments had lower quality scores and a higher frequency of re-statement and agree statements. Student feedback regarding the use of the VT tool was positive. Additional analysis of using the VT tool with different types of assignments and in other online courses is necessary.

Samantha Tackett; Kelly Moore Torres

2014-01-01T23:59:59.000Z

284

Efficient and Dynamic ? The BMW Group Roadmap for the Application...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

trips 8% Vacation 16% 60% of the fuel is used for long-distance trips per year in Germany. Source: * R. Thom, Fa. CAR * Federal Statistical Office, Germany BMW Group Dr....

285

Too close for comfort: Stimulus valence moderates the influence of motivational orientation on distance perception  

E-Print Network (OSTI)

, whereas avoidance is a preparedness to move away from it (Strack & Deutsch, 2004). According to the compatibility hypothesis (Neumann et al., 2003), positive stimuli are compatible with motivational orientation of approach and thus facilitate... orientation is associated with behaviors such as pulling that bring a stimulus physically closer to the person, it can also be defined as a preparedness to decrease the distance between a person and a stimulus (Strack & Deutsch, 2004). Given...

Krpan, Dario; Krpan, Simone

2014-10-22T23:59:59.000Z

286

Fast Tree: Computing Large Minimum-Evolution Trees with Profiles instead of a Distance Matrix  

SciTech Connect

Gene families are growing rapidly, but standard methods for inferring phylogenies do not scale to alignments with over 10,000 sequences. We present FastTree, a method for constructing large phylogenies and for estimating their reliability. Instead of storing a distance matrix, FastTree stores sequence profiles of internal nodes in the tree. FastTree uses these profiles to implement neighbor-joining and uses heuristics to quickly identify candidate joins. FastTree then uses nearest-neighbor interchanges to reduce the length of the tree. For an alignment with N sequences, L sites, and a different characters, a distance matrix requires O(N^2) space and O(N^2 L) time, but FastTree requires just O( NLa + N sqrt(N) ) memory and O( N sqrt(N) log(N) L a ) time. To estimate the tree's reliability, FastTree uses local bootstrapping, which gives another 100-fold speedup over a distance matrix. For example, FastTree computed a tree and support values for 158,022 distinct 16S ribosomal RNAs in 17 hours and 2.4 gigabytes of memory. Just computing pairwise Jukes-Cantor distances and storing them, without inferring a tree or bootstrapping, would require 17 hours and 50 gigabytes of memory. In simulations, FastTree was slightly more accurate than neighbor joining, BIONJ, or FastME; on genuine alignments, FastTree's topologies had higher likelihoods. FastTree is available at http://microbesonline.org/fasttree.

N. Price, Morgan; S. Dehal, Paramvir; P. Arkin, Adam

2009-07-31T23:59:59.000Z

287

PLANETARY NEBULAE IN THE ELLIPTICAL GALAXY NGC 4649 (M 60): KINEMATICS AND DISTANCE REDETERMINATION  

SciTech Connect

Using a slitless spectroscopy method with (1) the 8.2 m Subaru telescope and its FOCAS Cassegrain spectrograph and (2) the ESO Very Large Telescope unit 1 (Antu) and its FORS2 Cassegrain spectrograph, we have detected 326 planetary nebulae (PNs) in the giant Virgo elliptical galaxy NGC 4649 (M 60) and measured their radial velocities. After rejecting some PNs more likely to belong to the companion galaxy NGC 4647, we have built a catalog with kinematic information for 298 PNs in M 60. Using these radial velocities, we have concluded that they support the presence of a dark matter halo around M 60. Based on an isotropic, two-component Hernquist model, we estimate the dark matter halo mass within 3R{sub e} to be 4 x 10{sup 11} M{sub sun}, which is almost one-half of the total mass of about 10{sup 12} M{sub sun} within 3R{sub e}. This total mass is similar to that estimated from globular cluster, XMM-Newton, and Chandra observations. The dark matter becomes dominant outside. More detailed dynamical modeling of the PN data is being published in a companion paper. We have also measured the m(5007) magnitudes of many of these PNs and built a statistically complete sample of 218 PNs. The resulting PN luminosity function (PNLF) was used to estimate a distance modulus of 30.7 {+-} 0.2 mag, equivalent to 14 {+-} 1 Mpc. This confirms an earlier PNLF distance measurement based on a much smaller sample. The PNLF distance modulus remains smaller than the surface brightness fluctuation distance modulus by 0.4 mag.

Teodorescu, A. M.; Mendez, R. H. [Institute for Astronomy, University of Hawaii, 2680 Woodlawn Drive, Honolulu, HI 96822 (United States); Bernardi, F. [Dipartimento di Matematica, Universita di Pisa, Largo B. Pontecorvo 5, 56127 Pisa (Italy); Thomas, J.; Das, P.; Gerhard, O., E-mail: ana@ifa.hawaii.edu, E-mail: mendez@ifa.hawaii.edu [Max Planck Institut fuer Extraterrestrische Physik, P.O. Box 1603, D-85740 Garching bei Muenchen (Germany)

2011-07-20T23:59:59.000Z

288

Optical fiber configurations for transmission of laser energy over great distances  

DOE Patents (OSTI)

There are provided optical fiber configurations that provide for the delivery of laser energy, and in particular, the transmission and delivery of high power laser energy over great distances. These configurations further are hardened to protect the optical fibers from the stresses and conditions of an intended application. The configurations provide means for determining the additional fiber length (AFL) need to obtain the benefits of such additional fiber, while avoiding bending losses.

Rinzler, Charles C; Zediker, Mark S

2014-11-04T23:59:59.000Z

289

An Optimal Parallel Algorithm for the Euclidean Distance Maps of Binary Images  

E-Print Network (OSTI)

black pixel. The EDM plays an important role in machine vision, pat­ tern recognition and robotics. Many@is.aist­nara.ac.jp 1 Introduction The Euclidean distance map (EDM) of a black and white n 2 n binary image is the n 2 n algorithms have been proposed for computing the EDM. In recent years, O(n 2 ) time sequential algo­ rithms

Fujiwara, Akihiro

290

Modeling and simulation of the industrial numerical distance relay aimed at knowledge discovery in resident event reporting  

Science Journals Connector (OSTI)

In the motivation of tapping the strong potential of computational intelligence in discovering knowledge of protective relay operations using data mining, modeling and simulation of an actual industrial numerical distance relay and its recording facility ... Keywords: Distance protection, Knowledge Discovery in Databases, Rough Set Theory, association rule, computational intelligence, data mining, numerical protective relay, relay modeling

Mohammad Lutfi Othman, Ishak Aris, Noor Izzri Abdul Wahab

2014-06-01T23:59:59.000Z

291

Image-Set Matching using a Geodesic Distance and Cohort Normalization Yui Man Lui, J. Ross Beveridge, Bruce A. Draper  

E-Print Network (OSTI)

Image-Set Matching using a Geodesic Distance and Cohort Normalization Yui Man Lui, J. Ross are viewed as points on a Grassmann manifold, then geodesic distance on the manifold becomes the natural way-known image-set matching algorithm, Mutual Subspace Method (MSM), which does not use geodesic dis- tance

Draper, Bruce A.

292

A multi-level distance learning-based course for high-school computer science leading-teachers  

Science Journals Connector (OSTI)

In this poster we present a flexible model for a multi-level distance learning-based teacher training. The model was implemented to introduce curricular and pedagogical aspects of teaching logic programming (LP) to high-school computer science in-service ... Keywords: computer science education, distance learning, teacher training

Noa Ragonis; Bruria Haberman

2003-06-01T23:59:59.000Z

293

IEEE TRANSACTIONS ON WIRELESS COMMUNICATIONS, VOL. 6, NO. 10, OCTOBER 2007 1 Distance-Bounding Based Defense Against  

E-Print Network (OSTI)

IEEE TRANSACTIONS ON WIRELESS COMMUNICATIONS, VOL. 6, NO. 10, OCTOBER 2007 1 Distance-Bounding Based Defense Against Relay Attacks in Wireless Networks Caimu Tang, Member, IEEE, and Dapeng Oliver Wu in this scheme. This scheme also enjoys the distance-bounding property which makes the proposed scheme

Wu, Dapeng Oliver

294

End-to-end distance distributions and intrachain diffusion constants in unfolded polypeptide chains indicate intramolecular hydrogen bond formation  

Science Journals Connector (OSTI)

...the chromophores and on the distance, r, separating them according to (25...fluorescence lifetime of the donor, and R 0 is the characteristic Forster distance...Mol. Biol. 327 : 867 884 . 16 Pappu R. V. Srinivasan R. Rose G. D. ( 2000 ) Proc. Natl...

Andreas Mglich; Karin Joder; Thomas Kiefhaber

2006-01-01T23:59:59.000Z

295

A Constraint on the Distance Scale to Cosmological Gamma-Ray Bursts  

Science Journals Connector (OSTI)

If ?-ray bursts are cosmological in origin, the sources are expected to trace the large-scale structure of luminous matter in the universe. I use a new likelihood method that compares the counts-in-cells distribution of ?-ray bursts in the BATSE 3B catalog with that expected from the known large-scale structure of the universe, in order to place a constraint on the distance scale to cosmological bursts. I find, at the 95% confidence level, that the comoving distance to the "edge" of the burst distribution is greater than 630 h-1 Mpc (z > 0.25), and that the nearest burst is farther than 40 h-1 Mpc. The median distance to the nearest burst is 170 h-1 Mpc, implying that the total energy released in ?-rays during a burst event is of order 3 ? 1051 h-2 ergs. None of the bursts that have been observed by BATSE are in nearby galaxies, nor is a signature from the Coma Cluster or the "Great Wall" likely to be seen in the data at present.

Jean

1996-01-01T23:59:59.000Z

296

A ``Short'' Distance to the Large Magellanic Cloud With the Hipparcos Calibrated Red Clump Stars  

E-Print Network (OSTI)

Following an approach developed by Paczy\\'nski & Stanek, we derive a distance to the Large Magellanic Cloud (LMC) by comparing red clump stars from the Hipparcos catalog with the red clump stars observed in two fields in the LMC that were selected from the ongoing photometric survey of the Magellanic Clouds to lie in low extinction regions. The use of red clump stars allows a single step determination of the distance modulus to the LMC, $\\mu_{0,LMC} = 18.065\\pm 0.031\\pm 0.09 $mag (statistical plus systematic error), and the corresponding distance, $R_{LMC}= 41.02\\pm 0.59\\pm 1.74 kpc$. This measurement is in excellent agreement with the recent determination by Udalski et al., also based on the red clump stars, but is $\\sim 0.4 $mag smaller than the generally accepted value of $\\mu_{0,LMC} = 18.50\\pm 0.15 $mag. We discuss possible reasons for this discrepancy and how it can be resolved.

K. Z. Stanek; D. Zaritsky; J. Harris

1998-03-16T23:59:59.000Z

297

Minimum separation distances for natural gas pipeline and boilers in the 300 area, Hanford Site  

SciTech Connect

The U.S. Department of Energy (DOE) is proposing actions to reduce energy expenditures and improve energy system reliability at the 300 Area of the Hanford Site. These actions include replacing the centralized heating system with heating units for individual buildings or groups of buildings, constructing a new natural gas distribution system to provide a fuel source for many of these units, and constructing a central control building to operate and maintain the system. The individual heating units will include steam boilers that are to be housed in individual annex buildings located at some distance away from nearby 300 Area nuclear facilities. This analysis develops the basis for siting the package boilers and natural gas distribution systems to be used to supply steam to 300 Area nuclear facilities. The effects of four potential fire and explosion scenarios involving the boiler and natural gas pipeline were quantified to determine minimum separation distances that would reduce the risks to nearby nuclear facilities. The resulting minimum separation distances are shown in Table ES.1.

Daling, P.M.; Graham, T.M.

1997-08-01T23:59:59.000Z

298

Recording and Calculating Gunshot SoundChange of the Volume in Reference to the Distance  

Science Journals Connector (OSTI)

An experiment was conducted in an open practice ground (shooting range) regarding the recording of the sound of gunshots. Shots were fired using various types of firearms (seven pistols five revolvers two submachine guns one rifle and one shotgun) in different calibers from several various distances with reference to the recording sources. Both a conventional sound level meter (device) and a measurement microphone were used having been placed in a fixed point behind the shooting line. The sound of each shot was recorded (from the device). At the same time the signal received by the microphone was transferred to a connected computer through an appropriate audio interface with a pre?amplifier. Each sound wave was stored and depicted as a wave function. After the physic?mathematical analysis of these depictions the volume was calculated in the accepted engineering units(Decibels or dB) of Sound Pressure Level (SPL). The distances from the recording sources were 9.60 meters 14.40 m 19.20 m and 38.40 m. The experiment was carried out by using the following calibers: .22 LR 6.35 mm(.25 AUTO) 7.62 mm Tokarev (7 6225) 7.65 mm(.32 AUTO) 9 mm Parabellum (919) 9 mm Short (917) 9 mm Makarov (918) .45 AUTO .32 S&W .38 S&W .38 SPECIAL .357 Magnum 7 62 mm Kalashnikov (7 6239) and 12 GA. Tables are given for the environmental conditions (temperature humidity altitude & barometric pressure) the length of the barrel of each gun technical characteristics of the used ammunition as well as for the volume taken from the SLM. The data for the sound intensity were collected after 168 gunshots (158 single shot & 10 bursts). According to the results a decreasing of the volume equivalent to the increasing of the distance was remarked as it was expected. Values seem to follow the Inverse square Law. For every doubling of the distance from the sound source the sound intensity diminishes by 5.99040.2325 decibels (on average). In addition we have the chance of determining the volume of the gunshot sound coming from a certain type of weapon. A further application could be the calculation of the distance from a shooting firearm if one is aware of a recorded volume.

Tsiatis E. Nikolaos

2010-01-01T23:59:59.000Z

299

MonthlyReport  

NLE Websites -- All DOE Office Websites (Extended Search)

5 5 Overall AC electrical energy consumption (AC Wh/mi)¹ 111 Overall DC electrical energy consumption (DC Wh/mi)² 71 Overall DC electrical energy captured from regenerative braking (DC Wh/mi) 61 Total number of trips 1,135 Total distance traveled (mi) 4,408 Trips in Charge Depleting (CD) mode³ Gasoline fuel economy (mpg) 22 DC electrical energy consumption (DC Wh/mi) 296 Number of trips 264 Percent of trips city | highway 100% | 0% Distance traveled (mi) 781 Percent of total distance traveled 18% Trips in both Charge Depleting & Charge Sustaining (CD/CS) modes Gasoline fuel economy (mpg) 19 DC electrical energy consumption (DC Wh/mi) 141 Number of trips 44 Percent of trips city | highway 96% | 4% Distance traveled CD | CS (mi) 333 | 389 Percent of total distance traveled CD | CS

300

MonthlyReport  

NLE Websites -- All DOE Office Websites (Extended Search)

1 1 Overall AC electrical energy consumption (AC Wh/mi)¹ 93 Overall DC electrical energy consumption (DC Wh/mi)² 71 Overall DC electrical energy captured from regenerative braking (DC Wh/mi) 40 Total number of trips 11,047 Total distance traveled (mi) 119,879 Trips in Charge Depleting (CD) mode³ Gasoline fuel economy (mpg) 25 DC electrical energy consumption (DC Wh/mi) 208 Number of trips 4,491 Percent of trips city | highway 92% | 8% Distance traveled (mi) 30,376 Percent of total distance traveled 25% Trips in both Charge Depleting & Charge Sustaining (CD/CS) modes Gasoline fuel economy (mpg) 22 DC electrical energy consumption (DC Wh/mi) 71 Number of trips 1,352 Percent of trips city | highway 69% | 31% Distance traveled CD | CS (mi) 12,772 | 20,001 Percent of total distance traveled CD | CS

Note: This page contains sample records for the topic "avg trip distance" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


301

An improved photometric stereo through distance estimation and light vector optimization from diffused maxima region  

Science Journals Connector (OSTI)

Abstract Although photometric stereo offers an attractive technique for acquiring 3D data using low-cost equipment, inherent limitations in the methodology have served to limit its practical application, particularly in measurement or metrology tasks. Here we address this issue. Traditional photometric stereo assumes that lighting directions at every pixel are the same, which is not usually the case in real applications, and especially where the size of object being observed is comparable to the working distance. Such imperfections of the illumination may make the subsequent reconstruction procedures used to obtain the 3D shape of the scene prone to low frequency geometric distortion and systematic error (bias). Also, the 3D reconstruction of the object results in a geometric shape with an unknown scale. To overcome these problems a novel method of estimating the distance of the object from the camera is developed, which employs photometric stereo images without using other additional imaging modality. The method firstly identifies Lambertian diffused maxima region to calculate the object distance from the camera, from which the corrected per-pixel light vector is able to be derived and the absolute dimensions of the object can be subsequently estimated. We also propose a new calibration process to allow a dynamic(as an object moves in the field of view) calculation of light vectors for each pixel with little additional computation cost. Experiments performed on synthetic as well as real data demonstrates that the proposed approach offers improved performance, achieving a reduction in the estimated surface normal error of up to 45% as well as mean height error of reconstructed surface of up to 6mm. In addition, when compared to traditional photometric stereo, the proposed method reduces the mean angular and height error so that it is low, constant and independent of the position of the object placement within a normal working range.

Jahanzeb Ahmad; Jiuai Sun; Lyndon Smith; Melvyn Smith

2014-01-01T23:59:59.000Z

302

Classifying tensile strength of HSLA steel: an investigation through neural networks using Mahalanobis Distance  

Science Journals Connector (OSTI)

This paper addresses a comparative approach of classification of Thermomechanically Controlled Processed (TMCP) High Strength Low Alloy (HSLA) steels based on Mahalanobis-Taguchi System (MTS) principles and ensemble neural networks, including sensitivity analysis for variable selection. Later, a hybrid approach is developed, depending on the ability of Mahalanobis Distance (MD) in capturing the correlation structure of a multi-dimensional system, both for the Multi-Layered Perceptron (MLP) and for Radial Basis Function (RBF) networks. The results are found to be quite consistent in describing the role of input parameters for effective classification of such steel.

Prasun Das; Shubhabrata Datta; Bidyut Kr. Bhattacharyay

2010-01-01T23:59:59.000Z

303

Labeling the r-path with a condition at distance two  

Science Journals Connector (OSTI)

For integer r>=2, the infinite r-path P"~(r) is the graph on vertices ...v"-"3,v"-"2,v"-"1,v"0,v"1,v"2,v"3... such that v"s is adjacent to v"t if and only if |s-t|@?r-1. The r-path on n vertices is the subgraph of P"~(r) induced by vertices v"0,v"1,v"2,...,v"n"-"1. ... Keywords: ?x1,x2-labeling, ?x1,x2-number, Distance-constrained labeling, L(x1,x2)-labeling, r-path

John P. Georges; David W. Mauro; Yan Wang

2009-08-01T23:59:59.000Z

304

External uncertainty and entry mode choice: Cultural distance, political risk and language diversity  

Science Journals Connector (OSTI)

This paper aims at analyzing the effect of external uncertainty on the entry mode choice when investing abroad. We consider the effect of uncertainty coming from the formal host country's environment (political risk) and from the informal one (cultural distance). The potential existence of an interaction effect between both of them is also analyzed. In particular, we analyze how language diversity between the home and host countries may condition the influence of this interaction effect on the entry mode choice. In order to empirically test our predictions, a database of foreign direct investments made by Spanish firms is used.

Cristina Lpez-Duarte; Marta M. Vidal-Surez

2010-01-01T23:59:59.000Z

305

Time-Distance Seismology of the Solar Corona with CoMP  

E-Print Network (OSTI)

We employ a sequence of Doppler images obtained with the Coronal Multi-channel Polarimeter (CoMP) instrument to perform time-distance seismology of the solar corona. We construct the first k-omega diagrams of the region. These allow us to separate outward and inward propagating waves and estimate the spatial variation of the plane-of-sky projected phase speed, and the relative amount of outward and inward directed wave power. The disparity between outward and inward wave power and the slope of the observed power law spectrum indicate that low-frequency Alfvenic motions suffer significant attenuation as they propagate, consistent with isotropic MHD turbulence.

Tomczyk, Steven

2009-01-01T23:59:59.000Z

306

The design, construction, and operation of long-distance high-voltage electricity transmission technologies.  

SciTech Connect

This report focuses on transmission lines, which operate at voltages of 115 kV and higher. Currently, the highest voltage lines comprising the North American power grid are at 765 kV. The grid is the network of transmission lines that interconnect most large power plants on the North American continent. One transmission line at this high voltage was built near Chicago as part of the interconnection for three large nuclear power plants southwest of the city. Lines at this voltage also serve markets in New York and New England, also very high demand regions. The large power transfers along the West Coast are generally at 230 or 500 kV. Just as there are practical limits to centralization of power production, there are practical limits to increasing line voltage. As voltage increases, the height of the supporting towers, the size of the insulators, the distance between conductors on a tower, and even the width of the right-of-way (ROW) required increase. These design features safely isolate the electric power, which has an increasing tendency to arc to ground as the voltage (or electrical potential) increases. In addition, very high voltages (345 kV and above) are subject to corona losses. These losses are a result of ionization of the atmosphere, and can amount to several megawatts of wasted power. Furthermore, they are a local nuisance to radio transmission and can produce a noticeable hum. Centralized power production has advantages of economies of scale and special resource availability (for instance, hydro resources), but centralized power requires long-distance transfers of power both to reach customers and to provide interconnections for reliability. Long distances are most economically served at high voltages, which require large-scale equipment and impose a substantial footprint on the corridors through which power passes. The most visible components of the transmission system are the conductors that provide paths for the power and the towers that keep these conductors at a safe distance from each other and from the ground and the natural and built environment. Common elements that are generally less visible (or at least more easily overlooked) include the maintained ROW along the path of the towers, access roads needed for maintenance, and staging areas used for initial construction that may be restored after construction is complete. Also visible but less common elements along the corridor may include switching stations or substations, where lines of similar or different voltages meet to transfer power.

Molburg, J. C.; Kavicky, J. A.; Picel, K. C.

2008-03-03T23:59:59.000Z

307

Spin Sum Rules and the Strong Coupling Constant at large distance  

E-Print Network (OSTI)

We present recent results on the Bjorken and the generalized forward spin polarizability sum rules from Jefferson Lab Hall A and CLAS experiments, focusing on the low $Q^2$ part of the measurements. We then discuss the comparison of these results with Chiral Perturbation theory calculations. In the second part of this paper, we show how the Bjorken sum rule with its connection to the Gerasimov-Drell-Hearn sum, allows us to conveniently define an effective coupling for the strong force at all distances.

A. Deur

2009-06-23T23:59:59.000Z

308

Performance of distance relay MHO elements on MOV-protected series-compensated transmission lines  

SciTech Connect

The results presented in this paper show that the applicability of memory-polarized distance relay mho elements in the protection of MOV-protected series-compensated lines in dependant on the system configuration, line loading, the location of the potential source, and the magnitude of memory polarization. For configuration with compensation at one end of a line, the results indicate certain advantages in using the potential from the line side of the capacitor, and the use of relatively large magnitude of memory polarization. The presence of a conducting MOV enhances the performance of the mho element both in terms of security on reverse faults and dependability on forward faults.

Marttila, R.J. (Ontario Hydro Research, Toronto, Ontario (CA))

1992-07-01T23:59:59.000Z

309

Long distance transmission of 15 Gb/s digital using subcarrier multiplexing and external modulation  

SciTech Connect

This paper provides an overview of a high-speed link design using subcarrier multiplexing techniques with external modulators. Although we have few experimental results to data, we feel the techniques and technology described in this paper will enable the simultaneous transmission of multi-channel analog video and up to 15 Gb/s of digital data on a single wavelength. Furthermore, we show preliminary modeling that would indicate that at least four channels of 2.5 Gb/s can be sent over distances exceeding 500 km using a new dispersion technique that takes advantage of subcarrier multiplexing.

Hugenberg, K.; Lowry, M.; Beckedahl, D. [Lawrence Livermore National Lab., CA (United States); Blair, J. [EG and G Idaho, Inc., Idaho Falls, ID (United States)

1994-03-01T23:59:59.000Z

310

A statefinder luminosity distance formula in varying speed of light cosmology  

E-Print Network (OSTI)

We derive a luminosity distance formula for the varying speed of light (VSL) theory which involves higher order characteristics of expansion such as jerk, snap and lerk which can test the impact of varying $c$ onto the evolution of the universe. We show that the effect of varying $c$ is possible to be isolated due to the relations connecting observational parameters already by measuring the second-order term in redshift $z$ unless there is a redundancy between the curvature and an exotic fluid of cosmic strings scaling the same way as the curvature.

Adam Balcerzak; Mariusz P. Dabrowski

2014-06-01T23:59:59.000Z

311

A statefinder luminosity distance formula in varying speed of light cosmology  

E-Print Network (OSTI)

We derive a luminosity distance formula for the varying speed of light (VSL) theory which involves higher order characteristics of expansion such as jerk, snap and lerk which can test the impact of varying $c$ onto the evolution of the universe. We show that the effect of varying $c$ is possible to be isolated due to the relations connecting observational parameters already by measuring the second-order term in redshift $z$ unless there is a redundancy between the curvature and an exotic fluid of cosmic strings scaling the same way as the curvature.

Balcerzak, Adam

2014-01-01T23:59:59.000Z

312

A PARALLAX DISTANCE AND MASS ESTIMATE FOR THE TRANSITIONAL MILLISECOND PULSAR SYSTEM J1023+0038  

SciTech Connect

The recently discovered transitional millisecond pulsar system J1023+0038 exposes a crucial evolutionary phase of recycled neutron stars for multiwavelength study. The system, comprising the neutron star itself, its stellar companion, and the surrounding medium, is visible across the electromagnetic spectrum from the radio to X-ray/gamma-ray regimes and offers insight into the recycling phase of millisecond pulsar evolution. Here, we report on multiple-epoch astrometric observations with the Very Long Baseline Array (VLBA) which give a system parallax of 0.731 {+-} 0.022 milliarcseconds (mas) and a proper motion of 17.98 {+-} 0.05 mas yr{sup -1}. By combining our results with previous optical observations, we are able to use the parallax distance of 1368{sup +42}{sub -{sub 39}} pc to estimate the mass of the pulsar to be 1.71 {+-} 0.16 M{sub Sun }, and we are also able to measure the three-dimensional space velocity of the system to be 126 {+-} 5 km s{sup -1}. Despite the precise nature of the VLBA measurements, the remaining {approx}3% distance uncertainty dominates the 0.16 M{sub Sun} error on our mass estimate.

Deller, A. T. [Netherlands Institute for Radio Astronomy (ASTRON), 7990-AA Dwingeloo (Netherlands); Archibald, A. M.; Kaspi, V. M. [Department of Physics, McGill University, 3600 University Street, Montreal, QC H3A 2T8 (Canada); Brisken, W. F. [National Radio Astronomy Observatory, Socorro, NM 87801 (United States); Chatterjee, S. [Astronomy Department, Cornell University, Ithaca, NY 14853 (United States); Janssen, G. H.; Lyne, A. G.; Stappers, B. [Jodrell Bank Centre for Astrophysics, School of Physics and Astronomy, University of Manchester, Manchester M13 9PL (United Kingdom); Lorimer, D.; McLaughlin, M. A. [Department of Physics, West Virginia University, Morgantown, WV 26506 (United States); Ransom, S. [National Radio Astronomy Observatory, Charlottesville, VA 22903 (United States); Stairs, I. H. [Department of Physics and Astronomy, University of British Columbia, 6224 Agricultural Road, Vancouver, BC V6T 1Z1 (Canada)

2012-09-10T23:59:59.000Z

313

Parametric study on maximum transportable distance and cost for thermal energy transportation using various coolants  

SciTech Connect

The operation temperature of advanced nuclear reactors is generally higher than commercial light water reactors and thermal energy from advanced nuclear reactor can be used for various purposes such as district heating, desalination, hydrogen production and other process heat applications, etc. The process heat industry/facilities will be located outside the nuclear island due to safety measures. This thermal energy from the reactor has to be transported a fair distance. In this study, analytical analysis was conducted to identify the maximum distance that thermal energy could be transported using various coolants such as molten-salts, helium and water by varying the pipe diameter and mass flow rate. The cost required to transport each coolant was also analyzed. The coolants analyzed are molten salts (such as: KClMgCl2, LiF-NaF-KF (FLiNaK) and KF-ZrF4), helium and water. Fluoride salts are superior because of better heat transport characteristics but chloride salts are most economical for higher temperature transportation purposes. For lower temperature water is a possible alternative when compared with He, because low pressure He requires higher pumping power which makes the process very inefficient and economically not viable for both low and high temperature application.

Su-Jong Yoon; Piyush Sabharwall

2014-07-01T23:59:59.000Z

314

Faculty perceptions about attributes and barriers impacting diffusion of web-based distance education (WBDE) at the China Agricultural University  

E-Print Network (OSTI)

differed significantly by professional area, level of education, teaching experience, and distance education experience. Gender, age, and academic rank had no significant influence on faculty members' stage. CAU faculty tended to agree with the existence...

Li, Yan

2004-11-15T23:59:59.000Z

315

Unusual flux-distance relationship for pulsars suggested by analysis of the Australia national telescopy facility pulsar catalogue  

SciTech Connect

We analyze pulsar fluxes at 1400 MHz (S(1400)) and distances d taken from the Australia National Telescope Facility (ATNF) Pulsar Catalogue. Under the assumption that pulsar populations in different parts of the Galaxy are similar, we find that either (a) pulsar fluxes diminish with distance according to a non-standard power law (we suggest S(1400){proportional_to} 1/d rather than {proportional_to} 1/d{sup 2}) or (b) that there are very significant (i.e. order of magnitude) errors in the distance estimates quoted in the ATNF Catalogue. The former conclusion (a) supports a recent model for pulsar emission that has also successfully explained the frequency spectrum of the Crab pulsar over 16 orders of magnitude of frequency, whilst alternative (b) would necessitate a radical re-evaluation of both the dispersion method for estimating pulsar distances and current ideas about the distribution of pulsars within our Galaxy.

Singleton, John [Los Alamos National Laboratory; Perez, M R [Los Alamos National Laboratory; Singleton, J [Los Alamos National Laboratory; Ardavan, H [UNIV OF CAMBRIDGE; Ardavan, A [UNIV OF OXFORD

2009-01-01T23:59:59.000Z

316

The Araucaria Project: The Distance to NGC 300 from the Red Giant Branch Tip using HST/ACS imaging  

E-Print Network (OSTI)

We have used the Advanced Camera for Surveys on board the Hubble Space Telescope to obtain deep photometry of the NGC 300 spiral galaxy in the Sculptor group. The results have been used to derive an accurate distance determination based on the Tip of the Red Giant Branch distance estimator. Both edge-detection and maximum likelihood methods have been applied, to derive a distance modulus (m-M)_0=26.30 +/- 0.03 +/- 0.12 for edge-detection, and (m-M)_0=26.36 +/- 0.02 +/- 0.12 for maximum likelihood. These results are fully consistent with the recent distance estimate derived from near-IR photometry of Cepheids variable stars in the context of the Araucaria project, (m-M)_0= 26.37 +/- 0.05 +/- 0.03.

Luca Rizzi; Fabio Bresolin; Rolf-Peter Kudritzki; Wolfgang Gieren; Grzegorz Pietrzynski

2005-10-11T23:59:59.000Z

317

Tangent length and sight distance effects on accident rates at horizontal curves on two-lane rural highways  

E-Print Network (OSTI)

model. Regression analysis on this database suggested that neither tangent length nor preceding sight distance are significant variables in explaining the variability in accidents on horizontal curves for a given degree of curvature category. Results...

Fink, Kenneth Lee

2012-06-07T23:59:59.000Z

318

Extensive distance geometry calculations with different NOE calibrations: New criteria for structure selection applied to Sandostatin and BPTI  

Science Journals Connector (OSTI)

To generate structures efficiently, a version of the distance geometry program DIANA for a parallel computer was developed, new objective criteria for the selection of NMR solution structures are presented, an...

Hans Widmer; Armin Widmer; Werner Braun

1993-05-01T23:59:59.000Z

319

Long-distance seed dispersal by wind: disentangling the effects of species traits, vegetation types, vertical turbulence and wind speed  

Science Journals Connector (OSTI)

Long-distance dispersal (LDD) of plant seeds by wind is affected by functional traits of the ... , as well as by the meteorological parameters wind speed and vertical turbulence. The relative importance of ... fo...

Felix Heydel; Sarah Cunze; Markus Bernhardt-Rmermann

2014-07-01T23:59:59.000Z

320

Five years experience with a new method of field testing cross and quadrature polarized MHO distance relays. Part I  

SciTech Connect

Since 1981, the Saskatchewan Power Corporation (SaskPower) has used a new method to field test cross and quadrature polarized mho distance relays. Experience gained from the use of this new method to test distance relays from different manufacturers over the last five years is presented. The test method has been used successfully to predict and improve distance relay discrimination and to solve unexplained relay operations which was not possible with the previous test method. Discussions on the problems that arise from using this new method are also included. It is shown that unless the test procedures are properly designed, based on an understanding of the relay architecture, the distance relay can give erroneous results without malfunctioning. The test method described in this paper deals with circular relay characteristics, the type most commonly used by SaskPower.

Kennedy, W.O.; Gruell, B.J.; Shih, C.H.; Yee, L. (Saskatchewan Power Corp., Regina, Saskatchewan (CA))

1988-07-01T23:59:59.000Z

Note: This page contains sample records for the topic "avg trip distance" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


321

ORNL trip (3/25~4/1)  

NLE Websites -- All DOE Office Websites (Extended Search)

Methane Recovery from Hydrate-bearing Sediments Methane Recovery from Hydrate-bearing Sediments Final Scientific/Technical Report (Fall 2006 - Spring 2011) Submitted By: J. Carlos Santamarina and Costas Tsouris November 3, 2011 Funding Number: DE-FC26-06NT42963 Georgia Institute of Technology Atlanta, GA 30332-0355 Disclaimer: This report was prepared as an account of work sponsored by an agency of the United States Government. Neither the United States Government nor any agency thereof, nor any of their employees, makes any warranty, express or implied, or assumes any legal liability or responsibility for the accuracy, completeness, or usefulness of any information, apparatus, product, or process disclosed, or represents that its use would not infringe privately owned rights. Reference herein to any specific commercial product,

322

Dual Magnetic Separator for TRI$?$P  

E-Print Network (OSTI)

The TRI$\\mu$P facility, under construction at KVI, requires the production and separation of short-lived and rare isotopes. Direct reactions, fragmentation and fusion-evaporation reactions in normal and inverse kinematics are foreseen to produce nuclides of interest with a variety of heavy-ion beams from the superconducting cyclotron AGOR. For this purpose, we have designed, constructed and commissioned a versatile magnetic separator that allows efficient injection into an ion catcher, i.e., gas-filled stopper/cooler or thermal ionizer, from which a low energy radioactive beam will be extracted. The separator performance was tested with the production and clean separation of $^{21}$Na ions, where a beam purity of 99.5% could be achieved. For fusion-evaporation products, some of the features of its operation as a gas-filled recoil separator were tested.

G. P. A. Berg; O. C. Dermois; U. Dammalapati; P. Dendooven M. N. Harakeh; K. Jungmann; C. J. G. Onderwater; A. Rogachevskiy; M. Sohani; E. Traykov; L. Willmann; H. W. Wilschut

2005-09-09T23:59:59.000Z

323

My Trip to Mongolia | Department of Energy  

Office of Environmental Management (EM)

also have abundant wind and solar resources. These commonalities provided a strong foundation for discussions between the United States and Mongolia about how we can address our...

324

2012 Newsletter Students on field trip  

E-Print Network (OSTI)

on the evening of April 16 at McGirk's Irish Pub in Chenango Bridge to celebrate with John Bridge on h) In This Issue Letter from the Chair . . . . . . . . . . . . . 2 John Bridge, 2011 Sorby Medalist to some travel and fun after her show wraps up. John and Heather Bridge visited us in Florida over

Suzuki, Masatsugu

325

Light celebrating place, West Texas Road Trip  

E-Print Network (OSTI)

The dissertation explores the ability of light to embody and enhance the spirit of place in the Big Bend section of West Texas. A series of surveys and research investigated and then paired elements of light and place that were designed...

Mulholland, Jill Cecilia

2009-05-15T23:59:59.000Z

326

Economic evaluation of long-distance hydrogen transmission by chemical closed-loop cycle  

Science Journals Connector (OSTI)

All over the world there are enormous unexploited renewable energy reserves (hydro, geothermic, solar, wind, etc.). Most originate far from the location of the users, so their exploitation would greatly benefit from the disclosure of new, more economical, and technically feasible transmission systems. A possible alternative to electricity is the use of hydrogen as a medium for transportation of energy. This work proposes a chemical closed-loop cycle based upon catalytic reversible reactions as a means to transmit hydrogen. A real example for the application of the proposed system for transportation of secondary energy was considered. In particular, choosing a large hydro-electric source as reference, a comparison was made between costs and efficiencies in transferring energy as hydrogen (in its different forms) over long distances, with respect to transportation of the same energy as electricity.

G. Cacciola; V. Recupero; N. Giordano

1985-01-01T23:59:59.000Z

327

Distance-Redshift in Inhomogeneous $Omega_0=1$ Friedmann-Lemaitre-Robertson-Walker Cosmology  

E-Print Network (OSTI)

Distance--redshift relations are given in terms of associated Legendre functions for partially filled beam observations inspatially flat Friedmann-Lemaitre-Robertson-Walker (FLRW) cosmologies. These models are dynamically pressure-free, flat FLRW on large scales but, due to mass inhomogeneities, differ in their optical properties. The partially filled beam area-redshift equation is a Lame$^{\\prime}$ equation for arbitrary FLRW and is shown to simplify to the associated Legendre equation for the spatially flat, i.e. $\\Omega_0=1$ case. We fit these new analytic Hubble curves to recent supernovae (SNe) data in an attempt to determine both the mass parameter $\\Omega_m$ and the beam filling parameter $\

R. Kantowski; R. C. Thomas

2001-06-18T23:59:59.000Z

328

A case-based distance model for multiple criteria ABC analysis  

Science Journals Connector (OSTI)

In ABC analysis, a well-known inventory planning and control technique, stock-keeping units (SKUs) are sorted into three categories. Traditionally, the sorting is based solely on annual dollar usage. The aim of this paper is to introduce a case-based multiple-criteria ABC analysis that improves on this approach by accounting for additional criteria, such as lead time and criticality of SKUs, thereby providing more managerial flexibility. Using decisions from cases as input, preferences over alternatives are represented intuitively using weighted Euclidean distances which can be easily understood by a decision maker. Then a quadratic optimization program finds optimal classification thresholds. This system of multiple criteria decision aid is demonstrated using an illustrative case study.

Ye Chen; Kevin W. Li; D. Marc Kilgour; Keith W. Hipel

2008-01-01T23:59:59.000Z

329

Thick-to-Thin Filament Surface Distance Modulates Cross-Bridge Kinetics in Drosophila Flight Muscle  

SciTech Connect

The demembranated (skinned) muscle fiber preparation is widely used to investigate muscle contraction because the intracellular ionic conditions can be precisely controlled. However, plasma membrane removal results in a loss of osmotic regulation, causing abnormal hydration of the myofilament lattice and its proteins. We investigated the structural and functional consequences of varied myofilament lattice spacing and protein hydration on cross-bridge rates of force development and detachment in Drosophila melanogaster indirect flight muscle, using x-ray diffraction to compare the lattice spacing of dissected, osmotically compressed skinned fibers to native muscle fibers in living flies. Osmolytes of different sizes and exclusion properties (Dextran T-500 and T-10) were used to differentially alter lattice spacing and protein hydration. At in vivo lattice spacing, cross-bridge attachment time (t{sub on}) increased with higher osmotic pressures, consistent with a reduced cross-bridge detachment rate as myofilament protein hydration decreased. In contrast, in the swollen lattice, t{sub on} decreased with higher osmotic pressures. These divergent responses were reconciled using a structural model that predicts t{sub on} varies inversely with thick-to-thin filament surface distance, suggesting that cross-bridge rates of force development and detachment are modulated more by myofilament lattice geometry than protein hydration. Generalizing these findings, our results suggest that cross-bridge cycling rates slow as thick-to-thin filament surface distance decreases with sarcomere lengthening, and likewise, cross-bridge cycling rates increase during sarcomere shortening. Together, these structural changes may provide a mechanism for altering cross-bridge performance throughout a contraction-relaxation cycle.

Tanner, Bertrand C.W.; Farman, Gerrie P.; Irving, Thomas C.; Maughan, David W.; Palmer, Bradley M.; Miller, Mark S. (IIT); (Vermont); (BU)

2012-09-19T23:59:59.000Z

330

RADIO AND MID-INFRARED PROPERTIES OF COMPACT STARBURSTS: DISTANCING THEMSELVES FROM THE MAIN SEQUENCE  

SciTech Connect

We investigate the relationship between 8.44 GHz brightness temperatures and 1.4 to 8.44 GHz radio spectral indices with 6.2 {mu}m polycyclic aromatic hydrocarbon (PAH) emission and 9.7 {mu}m silicate absorption features for a sample of 36 local luminous and ultraluminous infrared galaxies. We find that galaxies having small 6.2 {mu}m PAH equivalent widths (EQWs), which signal the presence of weak PAH emission and/or an excess of very hot dust, also have flat spectral indices. The three active galactic nuclei (AGN) identified through their excessively large 8.44 GHz brightness temperatures are also identified as AGN via their small 6.2 {mu}m PAH EQWs. We also find that the flattening of the radio spectrum increases with increasing silicate optical depth, 8.44 GHz brightness temperature, and decreasing size of the radio source even after removing potential AGN, supporting the idea that compact starbursts show spectral flattening as the result of increased free-free absorption. These correlations additionally suggest that the dust obscuration in these galaxies must largely be coming from the vicinity of the compact starburst itself, and is not distributed throughout the (foreground) disk of the galaxy. Finally, we investigate the location of these infrared-bright systems relative to the main sequence (star formation rate versus stellar mass) of star-forming galaxies in the local universe. We find that the radio spectral indices of galaxies flatten with increasing distance above the main sequence, or in other words, with increasing specific star formation rate. This indicates that galaxies located above the main sequence, having high specific star formation rates, are typically compact starbursts hosting deeply embedded star formation that becomes more optically thick in the radio and infrared with increased distance above the main sequence.

Murphy, E. J. [Observatories of the Carnegie Institution for Science, 813 Santa Barbara Street, Pasadena, CA 91101 (United States); Stierwalt, S.; Armus, L. [Spitzer Science Center, California Institute of Technology, MC 314-6, Pasadena, CA 91125 (United States); Condon, J. J. [National Radio Astronomy Observatory, 520 Edgemont Road, Charlottesville, VA 22903 (United States); Evans, A. S., E-mail: emurphy@obs.carnegiescience.edu [Department of Astronomy, University of Virginia, 530 McCormick Road, Charlottesville, VA 22904 (United States)

2013-05-01T23:59:59.000Z

331

Effect Of Platooning on Fuel Consumption of Class 8 Vehicles Over a Range of Speeds, Following Distances, and Mass  

SciTech Connect

This research project evaluates fuel consumption results of two Class 8 tractor-trailer combinations platooned together compared to their standalone fuel consumption. A series of ten modified SAE Type II J1321 fuel consumption track tests were performed to document fuel consumption of two platooned vehicles and a control vehicle at varying steady-state speeds, following distances, and gross vehicle weights (GVWs). The steady-state speeds ranged from 55 mph to 70 mph, the following distances ranged from a 20-ft following distance to a 75-ft following distance, and the GVWs were 65K lbs and 80K lbs. All tractors involved had U.S. Environmental Protection Agency (EPA) SmartWay-compliant aerodynamics packages installed, and the trailers were equipped with side skirts. Effects of vehicle speed, following distance, and GVW on fuel consumption were observed and analyzed. The platooning demonstration system used in this study consisted of radar systems, Dedicated Short-Range Communication (DSRC) vehicle-to-vehicle (V2V) communications, vehicle braking and torque control interface, cameras and driver displays. The lead tractor consistently demonstrated an improvement in average fuel consumption reduction as following distance decreased, with results showing 2.7% to 5.3% fuel savings at a GVW of 65k. The trailing vehicle achieved fuel consumption savings ranging from 2.8% to 9.7%; tests during which the engine cooling fan did not operate achieved savings of 8.4% to 9.7%. 'Team' fuel savings, considering the platooned vehicles as one, ranged from 3.7% to 6.4%, with the best combined result being for 55 mph, 30-ft following distance, and 65k GVW.

Lammert, M. P.; Duran, A.; Diez, J.; Burton, K.; Nicholson, A.

2014-10-01T23:59:59.000Z

332

Simulated impact of sensor field of view and distance on field measurements of bidirectional reflectance factors for row crops  

Science Journals Connector (OSTI)

Abstract It is well established that a natural surface exhibits anisotropic reflectance properties that depend on the characteristics of the surface. Spectral measurements of the bidirectional reflectance factor (BRF) at ground level provide us a method to capture the directional characteristics of the observed surface. Various spectro-radiometers with different field of views (FOVs) were used under different mounting conditions to measure crop reflectance. The impact and uncertainty of sensor FOV and distance from the target have rarely been considered. The issue can be compounded with the characteristic reflectance of heterogeneous row crops. Because of the difficulty of accurately obtaining field measurements of crop reflectance under natural environments, a method of computer simulation was proposed to study the impact of sensor FOV and distance on field measured BRFs. A Monte Carlo model was built to combine the photon spread method and the weight reduction concept to develop the weighted photon spread (WPS) model to simulate radiation transfer in architecturally realistic canopies. Comparisons of the Monte Carlo model with both field BRF measurements and the RAMI Online Model Checker (ROMC) showed good agreement. \\{BRFs\\} were then simulated for a range of sensor FOV and distance combinations and compared with the reference values (distance at infinity) for two typical row canopy scenes. Sensors with a finite FOV and distance from the target approximate the reflectance anisotropy and yield average values over FOV. Moreover, the perspective projection of the sensor causes a proportional distortion in the sensor FOV from the ideal directional observations. Though such factors inducing the measurement error exist, it was found that the BRF can be obtained with a tolerable bias on ground level with a proper combination of sensor FOV and distance, except for the hotspot direction and the directions around it. Recommendations for the choice of sensor FOV and distance are also made to reduce the bias from the real angular signatures in field BRF measurement for row crops.

Feng Zhao; Yuguang Li; Xu Dai; Wout Verhoef; Yiqing Guo; Hong Shang; Xingfa Gu; Yanbo Huang; Tao Yu; Jianxi Huang

2015-01-01T23:59:59.000Z

333

Discovering the Nature of Dark Energy: Towards Better Distances from Type Ia Supernovae -- Final Technical Report  

SciTech Connect

Type Ia supernovae (SNe Ia; exploding white-dwarf stars) were the key to the Nobel-worthy 1998 discovery and subsequent verification that the expansion of the Universe is accelerating, driven by the effects of dark energy. Understanding the nature of this mysterious, yet dominant, component of the Universe is at the forefront of research in cosmology and fundamental physics. SNe Ia will continue to play a leading role in this enterprise, providing precise cosmological distances that improve constraints on the nature of dark energy. However, for this effort to succeed, we need to more thoroughly understand relatively nearby SNe Ia, because our conclusions come only from comparisons between them and distant (high-redshift) SNe Ia. Thus, detailed studies of relatively nearby SNe Ia are the focus of this research program. Many interesting results were obtained during the course of this project; these were published in 32 refereed research papers that acknowledged the grant. A major accomplishment was the publication of supernova (SN) rates derived from about a decade of operation of the Lick Observatory Supernova Search (LOSS) with the 0.76-meter Katzman Automatic Imaging Telescope (KAIT). We have determined the most accurate rates for SNe of different types in large, nearby galaxies in the present-day Universe, and these can be compared with SN rates far away (and hence long ago in the past) to set constraints on the types of stars that explode. Another major accomplishment was the publication of the light curves (brightness vs. time) of 165 SNe Ia, along with optical spectroscopy of many of these SNe as well as other SNe Ia, providing an extensive, homogeneous database for detailed studies. We have conducted intensive investigations of a number of individual SNe Ia, including quite unusual examples that allow us to probe the entire range of SN explosions and provide unique insights into these objects and the stars before they explode. My team's studies have also led to the identification of subsamples of SNe Ia that can be used to provide the most reliable cosmological distances, and we developed ways to deal with the dust that makes SNe Ia appear fainter than they really are. Using the KAIT/LOSS sample, we produced an excellent Hubble diagram (galaxy recession speed vs. distance), accurately showing the expansion of the Universe. Even smaller scatter was achieved when spectroscopic characteristics were taken into account. Another high-quality Hubble diagram was constructed with SNe Ia from the Sloan Digital Sky Survey (SDSS). These Hubble diagrams provide useful new constraints on the nature of the dark energy that is accelerating the expansion of the Universe. As an added bonus of our research, we also studied core-collapse SNe, which differ fundamentally from SNe Ia.

Filippenko, Alexei Vladimir [Univ. California, Berkeley

2014-05-09T23:59:59.000Z

334

COMPARISON OF SOLAR SURFACE FLOWS INFERRED FROM TIME-DISTANCE HELIOSEISMOLOGY AND COHERENT STRUCTURE TRACKING USING HMI/SDO OBSERVATIONS  

SciTech Connect

We compare measurements of horizontal flows on the surface of the Sun using helioseismic time-distance inversions and coherent structure tracking of solar granules. Tracking provides two-dimensional horizontal flows on the solar surface, whereas the time-distance inversions estimate the full three-dimensional velocity flows in the shallow near-surface layers. Both techniques use Helioseismic and Magnetic Imager observations as input. We find good correlations between the various measurements resulting from the two techniques. Further, we find a good agreement between these measurements and the time-averaged Doppler line-of-sight velocity, and also perform sanity checks on the vertical flow that resulted from the three-dimensional time-distance inversion.

Svanda, Michal [Astronomical Institute, Academy of Sciences of the Czech Republic (v. v. i.), Fricova 298, CZ-25165 Ondrejov (Czech Republic); Roudier, Thierry; Rieutord, Michel [Institut de Recherche en Astrophysique et Planetologie, Universite de Toulouse, 14 avenue Edouard Belin, F-31400, Toulouse (France); Burston, Raymond; Gizon, Laurent, E-mail: michal@astronomie.cz [Max-Planck-Institut fuer Sonnensystemforschung, Max-Planck-Strasse 2, D-37191 Katlenburg-Lindau (Germany)

2013-07-01T23:59:59.000Z

335

High-resistance faults on a multi-terminal line: Analysis, simulated studies and an adaptive distance relaying scheme  

SciTech Connect

The presence of a T-connection to a third terminal can drastically affect the performance of a distance relay at the other terminals. Fault resistance, especially high fault resistance, makes this problem more severe and complicated. Detailed analysis of the apparent impedance for these cases as seen from the relaying point is derived and, based on extensive simulations of the infeed/outfeed and fault-resistance effects on the relay characteristics, an adaptive distance relaying scheme is proposed. A microprocessor based distance relay using this new technique can quickly respond to very-high-resistance faults with maximum coverage of the protected line. The validity of this new scheme has been confirmed by real-time testing on a prototype hardware scheme.

Xia, Y.Q. (Tianjin Univ. (China)); David, A.K.; Li, K.K. (Hong Kong Polytechnic, Kowloon (Hong Kong))

1994-01-01T23:59:59.000Z

336

Determination of the linkage relationships and the gene-centromere genetic distances for endopeptidase structural genes in hexaploid wheat  

E-Print Network (OSTI)

357307 contribute to band 4 Calculation of gene-centromere genet 'c distance for 7BI. using region I (RI) recombinant progeny Genetic distance bet~~een EP-Bly and Ep-Blz and the frequency of region II (RII) cro. over progeny LIST OF FIGURES... ram Phenot e Total ChrolQo some Co~st. it ut ion 42 43 41 41+telo 42+telo 40+telo and/or not ~f ~1* 8 IU VI IX Chromosome ?BL 42. 17 Centromere ~Ey-El Kp-Blz Chromosome 7AL K -Alz 6. 67 3 90 RII ~E-Alx l0. 67 Figure 8. Linkage...

McMillin, David Edwin

2012-06-07T23:59:59.000Z

337

Testing modified gravity at large distances with the HI Nearby Galaxy Surveys rotation curves  

Science Journals Connector (OSTI)

Recently a newquantum motivatedtheory of gravity has been proposed that modifies the standard Newtonian potential at large distances when spherical symmetry is considered. Accordingly, Newtonian gravity is altered by adding an extra Rindler acceleration term that has to be phenomenologically determined. Here we consider a standard and a power-law generalization of the Rindler modified Newtonian potential. The new terms in the gravitational potential are hypothesized to play the role of dark matter in galaxies. Our galactic model includes the mass of the integrated gas, and stars for which we consider three stellar mass functions (Kroupa, diet-Salpeter, and free mass model). We test this idea by fitting rotation curves of seventeen low surface brightness galaxies from the HI Nearby Galaxy Survey (THINGS). We find that the Rindler parameters do not perform a suitable fit to the rotation curves in comparison to standard dark matter profiles (Navarro-Frenk-White and Burkert) and, in addition, the computed parameters of the Rindler gravity show a high spread, posing the model as a nonacceptable alternative to dark matter.

Jorge Mastache; Jorge L. Cervantes-Cota; Axel de la Macorra

2013-03-05T23:59:59.000Z

338

Linear elastic fracture mechanics predicts the propagation distance of frictional slip  

E-Print Network (OSTI)

When a frictional interface is subject to a localized shear load, it is often (experimentally) observed that local slip events initiate at the stress concentration and propagate over parts of the interface by arresting naturally before reaching the edge. We develop a theoretical model based on linear elastic fracture mechanics to describe the propagation of such precursory slip. The model's prediction of precursor lengths as a function of external load is in good quantitative agreement with laboratory experiments as well as with dynamic simulations, and provides thereby evidence to recognize frictional slip as a fracture phenomenon. We show that predicted precursor lengths depend, within given uncertainty ranges, mainly on the kinetic friction coefficient, and only weakly on other interface and material parameters. By simplifying the fracture mechanics model we also reveal sources for the observed non-linearity in the growth of precursor lengths as a function of the applied force. The discrete nature of precursors as well as the shear tractions caused by frustrated Poisson's expansion are found to be the dominant factors. Finally, we apply our model to a different, symmetric set-up and provide a prediction of the propagation distance of frictional slip for future experiments.

David S. Kammer; Mathilde Radiguet; Jean-Paul Ampuero; Jean-Franois Molinari

2014-08-18T23:59:59.000Z

339

Predators and distance between habitat patches modify gap crossing behaviour of juvenile Atlantic cod (Gadus morhua, L. 1758)  

Science Journals Connector (OSTI)

When habitat refugia is fragmented and limited, movement of potential prey animals between patches of protective habitat may be driven by biotic factors including foraging opportunities, risk of predation mortality, as well as density effects. However, few studies have examined these factors in marine landscapes. We examined gap crossing behaviour of juvenile Atlantic cod, Gadus morhua L. 1758, a species with high mortality throughout its juvenile stage. We examined the effect of inter-patch distance, fish length, group size, and the presence of a predator on gap crossing behaviour by juvenile cod in a 12נ3m experimental arena. Habitat patches consisting of artificial eelgrass were positioned within the arena with inter-patch distances of 3.0m and 7.5m. We observed a 37% reduction in frequency of gap crossing movements at larger distances compared to small ones. At the greater inter-patch distance, fish delayed departing a patch, depending on average group size. Juvenile fish released into a patch with a nearby predator moved across gaps 75% less frequently than fish originating in a predator-free patch. We also found that the presence of a predator delayed fish departure from a patch, again depending on group size. Our study demonstrates a suite of complex behavioural mechanisms that juvenile cod may exhibit to reduce predation risk as they navigate a landscape of fragmented habitat patches.

Mary R. Ryan; Shaun S. Killen; Robert S. Gregory; Paul V.R. Snelgrove

2012-01-01T23:59:59.000Z

340

Long-Distance Interconnection as Solar Resource Intermittency Solution: Optimizing the Use of Energy Storage and the Geographic  

E-Print Network (OSTI)

of Energy Storage and the Geographic Dispersion + Interconnection of Solar Generating Facilities. Marc J. R energy targets. Variability of the solar resource occurs across many different temporal scales: from energy storage and Long-distance interconnection coupled with geographic dispersion of solar generating

Note: This page contains sample records for the topic "avg trip distance" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


341

The WiggleZ Dark Energy Survey: improved distance measurements to z=1 with reconstruction of the baryonic acoustic feature  

Science Journals Connector (OSTI)

......research-article Article The WiggleZ Dark Energy Survey: improved distance measurements...measurements from the WiggleZ Dark Energy Survey, achieved by applying the reconstruction...galaxies mapped by the WiggleZ Dark Energy Survey (Drinkwater et-al. 2010......

Eyal A. Kazin; Jun Koda; Chris Blake; Nikhil Padmanabhan; Sarah Brough; Matthew Colless; Carlos Contreras; Warrick Couch; Scott Croom; Darren J. Croton; Tamara M. Davis; Michael J. Drinkwater; Karl Forster; David Gilbank; Mike Gladders; Karl Glazebrook; Ben Jelliffe; Russell J. Jurek; I-hui Li; Barry Madore; D. Christopher Martin; Kevin Pimbblet; Gregory B. Poole; Michael Pracy; Rob Sharp; Emily Wisnioski; David Woods; Ted K. Wyder; H. K. C. Yee

2014-01-01T23:59:59.000Z

342

The WiggleZ Dark Energy Survey: mapping the distanceredshift relation with baryon acoustic oscillations  

Science Journals Connector (OSTI)

......research-article Papers The WiggleZ Dark Energy Survey: mapping the distance-redshift...final data set of the WiggleZ Dark Energy Survey. We combine our correlation...6: the SDSS, the WiggleZ Dark Energy Survey and the 6-degree Field Galaxy......

Chris Blake; Eyal A. Kazin; Florian Beutler; Tamara M. Davis; David Parkinson; Sarah Brough; Matthew Colless; Carlos Contreras; Warrick Couch; Scott Croom; Darren Croton; Michael J. Drinkwater; Karl Forster; David Gilbank; Mike Gladders; Karl Glazebrook; Ben Jelliffe; Russell J. Jurek; I-hui Li; Barry Madore; D. Christopher Martin; Kevin Pimbblet; Gregory B. Poole; Michael Pracy; Rob Sharp; Emily Wisnioski; David Woods; Ted K. Wyder; H. K. C. Yee

2011-12-11T23:59:59.000Z

343

USDLA Awards Boston University School of Social Work a Platinum Award for Best Practices in Distance Learning  

E-Print Network (OSTI)

Instructional Designer James A. Frey from the office of Distance Education collaboratively designed this course School of Social Work as a leader in the industry," said Dr. John G. Flores, executive director of USDLA, but also honors these fine BU educators, Professor Donna McLaughlin and Designer James A. Frey." "This year

Spence, Harlan Ernest

344

Dynamic Distance Disorder in Proteins Is Caused by Trapping Guobin Luo,, Ioan Andricioaei,, X. Sunney Xie,*, and Martin Karplus*,,|  

E-Print Network (OSTI)

Dynamic Distance Disorder in Proteins Is Caused by Trapping Guobin Luo,, Ioan Andricioaei,,§ XVed: December 23, 2005; In Final Form: March 8, 2006 Dynamic disorder in proteins, as demonstrated by variations temperatures on femtosecond to nanosecond time scales. This indicates that the calculated dynamic disorder

Xie, Xiaoliang Sunney

345

Short distance singularities and automatic O($a$) improvement: the cases of the chiral condensate and the topological susceptibility  

E-Print Network (OSTI)

Short-distance singularities in lattice correlators can modify their Symanzik expansion by leading to additional O($a$) lattice artifacts. At the example of the chiral condensate and the topological susceptibility, we show how to account for these lattice artifacts for Wilson twisted mass fermions and show that the property of automatic O($a$) improvement is preserved at maximal twist.

Krzysztof Cichy; Elena Garcia-Ramos; Karl Jansen

2014-12-01T23:59:59.000Z

346

Centre for Distance Engineering Education Programme A NEWSLETTER OF CDEEP, IIT BOMBAY http://www.cdeep.iitb.ac.in  

E-Print Network (OSTI)

through Video Conferencing. Video on Demand: Currently available free through intranet and with a very technologies that aid distance education. CDEEP courses of Autumn (July - November) 2011 Sr. Course Name (Code.30-10.25, Thurs 10.35-11.30, A1A2 6 VLSI Technology (EE 669) Prof. Anil Kottantharayil Electrical Engineering Tues

Karandikar, Abhay

347

Week 4, Rain in my Brain On top of the Harbor Cone, Otago Peninsula, Pacific Ocean in the distance.  

E-Print Network (OSTI)

Week 4, Rain in my Brain On top of the Harbor Cone, Otago Peninsula, Pacific Ocean in the distance of the ocean or of this beautiful city from on-high and it all comes back that we're here, a dream come true

Bardsley, John

348

Glass-capillary collimator for distance compensation and partial monochromatization at rotating-anode X-ray generators  

Science Journals Connector (OSTI)

A straight glass capillary is used for distance compensation at the spatially inaccessible direct-drive side of rotating-anode X-ray generators. Construction and alignment are discussed and its suitability is demonstrated by a precession photograph of hen egg lysozyme.

Mller, J.J.

1995-12-01T23:59:59.000Z

349

Seasonal associations and atmospheric transport distances of fungi in the genus Fusarium collected with unmanned aerial vehicles and  

E-Print Network (OSTI)

that predict atmospheric loads of Fusarium could inform disease spread, air pollution, and climate change. ?Seasonal associations and atmospheric transport distances of fungi in the genus Fusarium collected air pollution and disease spread. a r t i c l e i n f o Article history: Received 6 February 2014

Ross, Shane

350

3Solar Energy and the Distance to Juno from the Sun As the Juno spacecraft travels to Jupiter,  

E-Print Network (OSTI)

spacecraft? Problem 2 ­ If the amount of solar energy falling on the Juno solar panels is determined by the inverse-square law, and the amount of solar energy generated by the solar panels at r = 1.0 AU is exactly 12,690 watts, what is the formula for the solar panel power at any distance defined by the function P

351

Five years experience with a new method of field testing cross and quadrature polarized MHO distance relays. Part 2  

SciTech Connect

This paper discusses three case studies where the new test method described in allowed the Saskatchewan Power Corporation (SaskPower), using ''off the shelf'' test equipment, to accurately predict the relay operating characteristic, improve relay performance and more accurately set the distance relay for phase to phase (LL) and single line to ground (SLG) faults.

Kennedy, W.O.; Gruell, B.J.; Shih, C.H.; Yee, L. (Saskatchewan Power Corp., Regina, Saskatchewan (CA))

1988-07-01T23:59:59.000Z

352

Wave properties of light Light is energy whose wavelength is the distance traveled in order to complete one cycle.  

E-Print Network (OSTI)

Wave properties of light Light is energy whose wavelength is the distance traveled in order to complete one cycle. The frequency of light refers to the number of cycles in one second. Low-energy light has a long wavelength and a low frequency. High-energy light has a short wavelength and a high

Zworski, Maciej

353

Going the Distance? NRC's Response to the National Academy of Science's Transportation Study  

SciTech Connect

In February 2006, the National Academy of Sciences (NAS) published the results of a 3 1/2-year study, titled Going the Distance, that examined the safety of transporting spent nuclear fuel (SNF) and high level waste (HLW) in the United States. NAS initiated this study to address what it perceived to be a national need for an independent, objective, and authoritative analysis of SNF and HLW transport in the United States. The study was co-sponsored by the U.S. Nuclear Regulatory Commission (NRC), the U.S. Department of Energy (DOE), the U.S. Department of Transportation (DOT), the Electric Power Research Institute and the National Cooperative Highway Research Program. This paper addresses some of the recommendations made in the NAS study related to the performance of SNF transportation casks in long duration fires, the use of full-scale package testing, and the need for an independent review of transportation security prior to the commencement of large scale shipping campaigns to an interim storage site or geologic repository. In conclusion: The NRC believes that the current regulations in 10 CFR Part 71 for the design of SNF and HLW transportation packages provide a very high level of protection to the public for very severe accidents and credible threat scenarios. As recommended by the NAS study, additional studies of accidents involving severe fires have been completed. These studies have confirmed that spent fuel casks would be expected to withstand very severe fires without the release of any fission products from the spent fuel. Additionally, changes in rail operating procedures such as the use of dedicated trains and prohibition on the co-location of SNF and flammable liquids in rail tunnels can further reduce the already low probability of severe rail accident fires involving SNF and HLW. (authors)

Easton, E.P.; Bajwa, C.S. [United States Nuclear Regulatory Commission, Washington, DC (United States)

2008-07-01T23:59:59.000Z

354

Incompatibility of a comoving Ly-alpha forest with supernova-Ia luminosity distances  

E-Print Network (OSTI)

Recently Perlmutter et al. suggested a positive value of Einstein's cosmological constant Lambda on the basis of luminosity distances from type-Ia supernovae. However, Lambda world models had earlier been proposed by Hoell & Priester and Liebscher et al. on the basis of quasar absorption-line data. Employing more general repulsive fluids ("dark energy") encompassing the Lambda component we quantitatively compare both approaches with each other. Fitting the SN-data by a minimum-component model consisting of dark energy + dust yields a closed universe with a large amount of dust exceeding the baryonic content constrained by big-bang nucleosynthesis. The nature of the dark energy is hardly constrained. Only when enforcing a flat universe there is a clear tendency to a dark-energy Lambda fluid and the `canonical' value Omega_M = 0.3 for dust. Conversely, fitting the quasar-data by a minimum-component model yields a sharply defined, slightly closed model with a low dust density ruling out significant pressureless dark matter. The dark-energy component obtains an equation-of-state P = -0.96 epsilon close to that of a Lambda-fluid. Omega_M = 0.3 or a precisely flat spatial geometry are inconsistent with minimum-component models. It is found that quasar and supernova data sets cannot be reconciled with each other via (repulsive ideal fluid+dust+radiation)-world models. Compatibility could be reached by drastic expansion of the parameter space with at least two exotic fluids added to dust and radiation as world constituents. If considering such solutions as far-fetched one has to conclude that the quasar absorption line and the SN-Ia constraints are incompatible.

Jens Thomas; Hartmut Schulz

2001-03-18T23:59:59.000Z

355

DOC First-Year Trips Communication August 2013 Greetings from DOC Trips!  

E-Print Network (OSTI)

! #12;· If you are flying to Boston's Logan International Airport, we suggest using the Dartmouth Coach suitcases/boxes/etc... International students may access their room the day before, if needed. § The Housing bus service to get to campus. If you are flying to Manchester Regional Airport, we suggest Greyhound

356

THE SOLAR NEIGHBORHOOD. XXIII. CCD PHOTOMETRIC DISTANCE ESTIMATES OF SCR TARGETS-77 M DWARF SYSTEMS WITHIN 25 pc  

SciTech Connect

We present CCD photometric distance estimates of 100 SCR (SuperCOSMOS RECONS) systems with {mu} {>=} 0.''18 yr{sup -1}, 29 of which are new discoveries previously unpublished in this series of papers. These distances are estimated using a combination of new VRI photometry acquired at CTIO and JHK magnitudes extracted from 2MASS. The estimates are improvements over those determined using photographic plate BRI magnitudes from SuperCOSMOS plus JHK, as presented in the original discovery papers. In total, 77 of the 100 systems investigated are predicted to be within 25 pc. If all 77 systems are confirmed to have {pi}{sub trig} {>=} 40 mas, this sample would represent a 23% increase in M dwarf systems nearer than 25 pc in the southern sky.

Winters, Jennifer G.; Henry, Todd J.; Jao, Wei-Chun [Department of Physics and Astronomy, Georgia State University, Atlanta, GA 30302-4106 (United States); Subasavage, John P. [Cerro Tololo Inter-American Observatory, Casilla 603, La Serena (Chile); Finch, Charlie T. [United States Naval Observatory, Washington, DC 20392-5420 (United States); Hambly, Nigel C., E-mail: winters@chara.gsu.edu, E-mail: thenry@chara.gsu.edu, E-mail: jao@chara.gsu.edu, E-mail: jsubasavage@ctio.noao.edu, E-mail: finch@usno.navy.mil, E-mail: nch@roe.ac.uk [Scottish Universities Physics Alliance (SUPA), Institute of Astronomy, University of Edinburgh, Royal Observatory, Blackford Hill, Edinburgh EH9 3HJ (United Kingdom)

2011-01-15T23:59:59.000Z

357

The Araucaria Project. The Distance of the Large Magellanic Cloud from Near-Infrared Photometry of RR Lyrae Variables  

E-Print Network (OSTI)

We have obtained deep infrared $J$ and $K$ band observations of five fields located in the Large Magellanic Cloud (LMC) bar with the ESO New Technology Telescope equipped with the SOFI infrared camera. In our fields, 65 RR Lyrae stars catalogued by the OGLE collaboration were identified. Using different theoretical and empirical calibrations of the period-luminosity-metallicity relation, we find consistent LMC distance moduli values. Since the observed fields are situated very close to the center of the LMC, the correction for the tilt of the LMC bar with respect to the line of sight is negligible. Our adopted best true distance modulus to the LMC of $18.58 \\pm 0.03$ (statistical) $\\pm$ 0.11 (systematic) mag agrees very well with most independent determinations to this galaxy.

Olaf Szewczyk; Grzegorz Pietrzynski; Wolfgang Gieren; Jesper Storm; Alistair Walker; Luca Rizzi; Karen Kinemuchi; Fabio Bresolin; Rolf-Peter Kudritzki; Massimo Dall'Ora

2008-04-21T23:59:59.000Z

358

Exercise overloading in the equine: cardiorespiratory and metabolic response to a combined long, slow, distance and interval training exercise regimen  

E-Print Network (OSTI)

output, and metabolic parameters such as blood lactate concentrations as being indicative measures of fitness. Cardiorespiratory and skeletal muscle responses to endurance or aerobic training have also been studied, However, physical training...EXERCISE OVERLOADING IN THE EQUINE CARDIORESPIRATORY AND METABOLIC RESPONSE TO A COMBINED LONG& SLOW, DISTANCE AND INTERVAL TRAINING EXERCISE REGIMEN A Thesis by LEANN FRANCINE DROZD Submitted to the Office of Graduate Studies of Texas A...

Drozd, Leann Francine

1988-01-01T23:59:59.000Z

359

Long-Working-Distance Kirkpatrick-Baez Mirrors for Hard X-ray Beamlines at SPring-8  

SciTech Connect

We designed and installed two types of long-working-distance Kirkpatrick-Baez (KB) mirrors and mirror manipulators, which were customized into each experiment for hard x-ray undulator beamlines at SPring-8. For the BL32XU RIKEN Targeted Proteins beamline, 400-mm-long KB focusing mirrors for a beam size of 1 {mu}m with a 730-mm-long working distance were designed for carrying out the structural analysis of protein microcrystals. We realized a focusing beam size of 0.9x0.9 {mu}m{sup 2}(FWHM) and a focusing intensity of 6x10{sup 10} (photons/s) at an x-ray energy of 12.4 keV. For the BL19LXU RIKEN SR Physics beamline, we developed KB mirrors for 100-nm focusing with a 100-mm-working distance for the purpose of nano-focus x-ray diffraction. A focusing beam size of 100x100 nm{sup 2}(FWHM) and a high focusing intensity of 3.7x10{sup 10} (photons/s) at an x-ray energy of 12.4 keV were realized.

Yumoto, H.; Koyama, T. [Japan Synchrotron Radiation Research Institute (JASRI)/SPring-8, 1-1-1, Kouto, Sayo-cho, Sayo-gun, Hyogo 679-5198 (Japan); Hirata, K.; Kawano, Y.; Ueno, G.; Nisawa, A.; Hikima, T.; Takeshita, S.; Ito, K.; Tanaka, Y.; Arima, T.; Yamamoto, M. [RIKEN/SPring-8, 1-1-1 Kouto, Sayo-cho, Sayo-gun, Hyogo 679-5148 (Japan); Ohsumi, H.; Ohashi, H.; Goto, S. [Japan Synchrotron Radiation Research Institute (JASRI)/SPring-8, 1-1-1, Kouto, Sayo-cho, Sayo-gun, Hyogo 679-5198 (Japan); RIKEN/SPring-8, 1-1-1 Kouto, Sayo-cho, Sayo-gun, Hyogo 679-5148 (Japan)

2011-09-09T23:59:59.000Z

360

Deep Photometry of the Globular Cluster M5: Distance Estimates from White Dwarf and Main Sequence Stars  

E-Print Network (OSTI)

We present deep VI photometry of stars in the globular cluster M5 (NGC 5904) based on images taken with the Hubble Space Telescope. The resulting color-magnitude diagram reaches below V ~ 27 mag, revealing the upper 2-3 magnitudes of the white dwarf cooling sequence, and main sequence stars eight magnitudes and more below the turn-off. We fit the main sequence to subdwarfs of known parallax to obtain a true distance modulus of (m-M)_0 = 14.45 +/- 0.11 mag. A second distance estimate based on fitting the cluster white dwarf sequence to field white dwarfs with known parallax yielded (m-M)_0 = 14.67 +/- 0.18 mag. We couple our distance estimates with extensive photometry of the cluster's RR Lyrae variables to provide a calibration of the RR Lyrae absolute magnitude yielding M_V(RR) = 0.42 +/- 0.10 mag at [Fe/H] = -1.11 dex. We provide another luminosity calibration in the form of reddening-free Wasenheit functions. Comparison of our calibrations with predictions based on recent models combining stellar evolution and pulsation theories shows encouraging agreement. (Abridged)

Andrew C. Layden; Ata Sarajedini; Ted von Hippel; Adrienne M. Cool

2005-07-14T23:59:59.000Z

Note: This page contains sample records for the topic "avg trip distance" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


361

The long-period Galactic Cepheid RS Puppis - III. A geometric distance from HST polarimetric imaging of its light echoes  

E-Print Network (OSTI)

As one of the most luminous Cepheids in the Milky Way, the 41.5-day RS Puppis is an analog of the long-period Cepheids used to measure extragalactic distances. An accurate distance to this star would therefore help anchor the zero-point of the bright end of the period-luminosity relation. But, at a distance of about 2 kpc, RS Pup is too far away for measuring a direct trigonometric parallax with a precision of a few percent with existing instrumentation. RS Pup is unique in being surrounded by a reflection nebula, whose brightness varies as pulses of light from the Cepheid propagate outwards. We present new polarimetric imaging of the nebula obtained with HST/ACS. The derived map of the degree of linear polarization pL allows us to reconstruct the three-dimensional structure of the dust distribution. To retrieve the scattering angle from the pL value, we consider two different polarization models, one based on a Milky Way dust mixture and one assuming Rayleigh scattering. Considering the derived dust distribu...

Kervella, P; Cracraft, M; Szabados, L; Breitfelder, J; Mrand, A; Sparks, W B; Gallenne, A; Bersier, D; Fouqu, P; Anderson, R I

2014-01-01T23:59:59.000Z

362

Strain energy density-distance criterion for the initiation of stress corrosion cracking of alloy X-750  

SciTech Connect

A strain energy density-distance criterion was previously developed and used to correlate rising-load K{sub c} initiation data for notched and fatigue precracked specimens of hydrogen precharged Alloy X-750. This criterion, which was developed for hydrogen embrittlement (HE) cracking, is used here to correlate static-load stress corrosion cracking (SCC) initiation times obtained for smooth geometry, notched and fatigue precracked specimens. The onset of SCC crack growth is hypothesized to occur when a critical strain, which is due to environment-enhanced creep, is attained within the specimen interior. For notched and precracked specimens, initiation is shown by analysis to occur at a variable distance from notch and crack tips. The initiation site varies from very near the crack tip, for highly loaded sharp cracks, to a site that is one grain diameter from the notch, for lower loaded, blunt notches. The existence of hydrogen gradients, which are due to strain-induced hydrogen trapping in the strain fields of notch and crack tips, is argued to be controlling the site for initiation of cracking. By considering the sources of the hydrogen, these observations are shown to be consistent with those from the previous HE study, in which the characteristic distance for crack initiation was found to be one grain diameter from the notch tip, independent of notch radius, applied stress intensity factor and hydrogen level.

Hall, M.M. Jr.; Symons, D.M.

1996-05-01T23:59:59.000Z

363

Improved estimates of separation distances to prevent unacceptable damage to nuclear power plant structures from hydrogen detonation for gaseous hydrogen storage. Technical report  

SciTech Connect

This report provides new estimates of separation distances for nuclear power plant gaseous hydrogen storage facilities. Unacceptable damage to plant structures from hydrogen detonations will be prevented by having hydrogen storage facilities meet separation distance criteria recommended in this report. The revised standoff distances are based on improved calculations on hydrogen gas cloud detonations and structural analysis of reinforced concrete structures. Also, the results presented in this study do not depend upon equivalencing a hydrogen detonation to an equivalent TNT detonation. The static and stagnation pressures, wave velocity, and the shock wave impulse delivered to wall surfaces were computed for several different size hydrogen explosions. Separation distance equations were developed and were used to compute the minimum separation distance for six different wall cases and for seven detonating volumes (from 1.59 to 79.67 lbm of hydrogen). These improved calculation results were compared to previous calculations. The ratio between the separation distance predicted in this report versus that predicted for hydrogen detonation in previous calculations varies from 0 to approximately 4. Thus, the separation distances results from the previous calculations can be either overconservative or unconservative depending upon the set of hydrogen detonation parameters that are used. Consequently, it is concluded that the hydrogen-to-TNT detonation equivalency utilized in previous calculations should no longer be used.

Not Available

1994-05-01T23:59:59.000Z

364

Chevrolet Volt Vehicle Demonstration  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

8.2 Overall AC electrical energy consumption (AC Whmi) 157 Average Trip Distance 12.3 Total distance traveled (mi) 407,245 Average Ambient Temperature (deg F) 67.9 Electric...

365

Chevrolet Volt Vehicle Demonstration  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

70.1 Overall AC electrical energy consumption (AC Whmi) 169 Average Trip Distance 12.3 Total distance traveled (mi) 2,817,365 Average Ambient Temperature (deg F) 62.4 Electric...

366

ADAPTIVE POWER CONTROL BY USING THE RECEIVED SNR AS A PROXY FOR DISTANCE TO OPTIMIZE THE SPECTRUM USAGE IN A COGNITIVE RADIO SYSTEMADAPTIVE POWER CONTROL BY USING THE RECEIVED SNR AS A PROXY FOR DISTANCE TO OPTIMIZE THE SPECTRUM USAGE IN A COGNITIVE RADIO SYSTEM.  

E-Print Network (OSTI)

??In this thesis work we have proposed an Adaptive Power Transmission scheme for Cognitive Radio. The proposed scheme estimates the distance between the primary user (more)

Hussain, Rizwan

2009-01-01T23:59:59.000Z

367

Understanding the large-distance behavior of TMD parton densities and the Collins-Soper evolution kernel  

E-Print Network (OSTI)

There is considerable controversy about the size and importance of non-perturbative contributions to the evolution of transverse momentum dependent (TMD) parton distribution functions. Standard fits to relatively high-energy Drell-Yan data give evolution that when taken to lower Q is too rapid to be consistent with recent data in semi-inclusive deeply inelastic scattering. Some authors provide very different forms for TMD evolution, even arguing that non-perturbative contributions at large transverse distance b_T are not needed or are irrelevant. Here, we systematically analyze the issues, both perturbative and non-perturbative. We make a motivated proposal for the parameterization of the non-perturbative part of the TMD evolution kernel that could give consistency: with the variety of apparently conflicting data, with theoretical perturbative calculations where they are applicable, and with general theoretical non-perturbative constraints on correlation functions at large distances. We propose and use a scheme- and scale-independent function A(b_T) that gives a tool to compare and diagnose different proposals for TMD evolution. We also advocate for phenomenological studies of A(b_T) as a probe of TMD evolution. The results are important generally for applications of TMD factorization. In particular, they are important to making predictions for proposed polarized Drell-Yan experiments to measure the Sivers function.

John Collins; Ted Rogers

2015-01-22T23:59:59.000Z

368

Strain energy density: Distance criterion for the initiation of hydrogen-induced cracking of Alloy X-750  

SciTech Connect

A criterion for initiation of subcritical crack growth at blunt notches and sharp defects was developed and applied to hydrogen- induced cracking of the Ni-base superalloy X-750. Onset of crack growth is shown to occur when a critical strain energy density is attained at a distance from the notch and crack tips characteristic of the microstructure along the prospective crack path. Rising load crack growth initiation data were obtained using homogeneous hydrogen precharged notched and fatigue precracked bend specimens. Notch root radius, grain size and hydrogen concentration were varied. Crack growth initiation loads were dependent on both notch root radius and bulk precharged hydrogen concentration. These data were shown to be correlated using a critical strain energy at-a-distance (SEDAD) criterion. Furthermore, an elastic-plastic analysis of the strain energy distributions showed that the critical strain energy density value is attained at one grain diameter from the notch and fatigue precrack tips. Mechanical and microstructural aspects of crack growth process and relevance to hydrogen-induced cracking are discussed.

Hall, M.M. Jr.; Symons, D.M.; Kearns, J.J.

1991-12-31T23:59:59.000Z

369

Micro-structure in Micro-Neighborhoods: A New Social Distance Measure, and its Effect on Individual and Aggregated Perceptions of Crime and Disorder  

E-Print Network (OSTI)

social distance network structure within this smaller micro-of the broader network structure of ties: whereas micro-would entail network ties criss-crossing the various micro-

Hipp, John R

2013-01-01T23:59:59.000Z

370

Foreign direct investment flows from the south to the east of the EU: dissecting the different effects of psychic distance stimuli  

Science Journals Connector (OSTI)

This paper examines the influence of psychic distance stimuli on foreign direct investment flows from countries located in the south of Europe towards the new members of the European Union from central and Eastern Europe. By applying panel data techniques, evidence of a negative relation is obtained for distance in democracy, whereas a positive one is obtained for per capita GDP and distance in education and industrial development, which demonstrates that these investment flows are characterised by an efficiency-seeking approach and low educational and technical requirements. This FDI motivation prompts firms to maximise cost advantages such as reduced salaries or input prices. Also interestingly, political risk does not seem an obstacle, in accordance with recent literature on political capabilities. The results highlight the fact that distance does not always constitute a barrier but an opportunity for the firm.

Alfredo Jiménez; Carmen Palmero; Juan Alfredo Jiménez

2014-01-01T23:59:59.000Z

371

Incised valley filling deposits: an important pathway system for long-distance hydrocarbon migrationa case study of the Fulaerji Oilfield in the Songliao Basin  

Science Journals Connector (OSTI)

In this paper, incised valley filling deposits, which formed an important pathway system for long-distance hydrocarbon migration, are discussed in detail...23...of the Cretaceous Yaojia Formation is the main hydr...

Renchen Xin; Hao Liu; Guifan Li

2009-09-01T23:59:59.000Z

372

The Development and Validation of a Pre-Evaluation Instrument for the Virtual College of Texas to Measure Quality in Distance Education Courses  

E-Print Network (OSTI)

of one pre-evaluation instrument to control consistency of the quality standards. 12 The significance of this study can also begin to forge the ground for an acceptance of standard criteria for quality for the development of future distance... for the advancement and acceptance of accredited on-line degrees. Moreover, it could promote the value of 13 connecting with human beings in a meaningful way through the use of quality distance education for educational human resource development (Swanson...

Claus, Edna Q.

2010-07-14T23:59:59.000Z

373

THE ARAUCARIA PROJECT. A DISTANCE DETERMINATION TO THE LOCAL GROUP SPIRAL M33 FROM NEAR-INFRARED PHOTOMETRY OF CEPHEID VARIABLES  

SciTech Connect

Motivated by an amazing range of reported distances to the nearby Local Group spiral galaxy M33, we have obtained deep near-infrared photometry for 26 long-period Cepheids in this galaxy with the ESO Very Large Telescope. From the data, we constructed period-luminosity relations in the J and K bands which together with previous optical VI photometry for the Cepheids by Macri et al. were used to determine the true distance modulus of M33, and the mean reddening affecting the Cepheid sample with the multiwavelength fit method developed in the Araucaria Project. We find a true distance modulus of 24.62 for M33, with a total uncertainty of {+-}0.07 mag which is dominated by the uncertainty on the photometric zero points in our photometry. The reddening is determined as E(B - V) = 0.19 {+-} 0.02, in agreement with the value used by the Hubble Space Telescope Key Project of Freedman et al. but in some discrepancy with other recent determinations based on blue supergiant spectroscopy and an O-type eclipsing binary which yielded lower reddening values. Our derived M33 distance modulus is extremely insensitive to the adopted reddening law. We show that the possible effects of metallicity and crowding on our present distance determination are both at the 1%-2% level and therefore minor contributors to the total uncertainty of our distance result for M33.

Gieren, Wolfgang; Pietrzynski, Grzegorz; Graczyk, Dariusz, E-mail: wgieren@astro-udec.cl, E-mail: pietrzyn@hubble.cfm.udec.cl [Warsaw University Observatory, Al. Ujazdowskie 4, 00-478 Warsaw (Poland); and others

2013-08-10T23:59:59.000Z

374

Possible violation of Newtonian gravitational law at small distances and constraints on it from the Casimir effect  

E-Print Network (OSTI)

The recent ideas that the gravitational and gauge interactions become united at the weak scale lead to Yukawa-type corrections to the Newtonian gravitational law at small distances. We briefly summarize the best constraints on these corrections obtained recently from the experiments on the measurement of the Casimir force. The new constraints on the Yukawa-type interaction are derived from the latest Casimir force measurement between a large gold coated sphere and flat disk using an atomic force microscope. The obtained constraints are stronger up to 19 times comparing the previous experiment with aluminum surfaces and up to 4500 times comparing the Casimir force measurements between dielectrics. The application range of constraints obtained by means of an atomic force microscope is extended.

V. M. Mostepanenko; M. Novello

2000-08-03T23:59:59.000Z

375

Tuning in on Cepheids: Radial velocity amplitude modulations. A source of systematic uncertainty for Baade-Wesselink distances  

E-Print Network (OSTI)

[Abridged] I report the discovery of modulations in radial velocity (RV) curves of four Galactic classical Cepheids and investigate their impact as a systematic uncertainty for Baade-Wesselink distances. Highly precise Doppler measurements were obtained using the Coralie high-resolution spectrograph since 2011. Particular care was taken to sample all phase points in order to very accurately trace the RV curve during multiple epochs and to search for differences in linear radius variations derived from observations obtained at different epochs. Different timescales are sampled, ranging from cycle-to-cycle to months and years. The unprecedented combination of excellent phase coverage obtained during multiple epochs and high precision enabled the discovery of significant modulation in the RV curves of the short-period s-Cepheids QZ Normae and V335 Puppis, as well as the long-period fundamental mode Cepheids l Carinae and RS Puppis. The modulations manifest as shape and amplitude variations that vary smoothly on ...

Anderson, Richard I

2014-01-01T23:59:59.000Z

376

The luminosity distance-redshift relation up to second order in the Poisson gauge with anisotropic stress  

E-Print Network (OSTI)

We present the generalization of previously published results, about the perturbed redshift and the luminosity-redshift relation up to second order in perturbation theory, for the case of the Poisson gauge with anisotropic stress. The results are therefore valid for general dark energy models and (most) modify gravity models. We use an innovative approach based on the recently proposed "geodesic light-cone" gauge. We then compare our finding with other results, which recently appeared in the literature, for the particular case of vanishing anisotropic stress. To arrive at a common accepted expression for the non-linear and relativistic corrections to the redshift and distance-redshift relation is of fundamental importance in view of future cosmological surveys. Thanks to these surveys the Universe will be further probed with high precision and at very different scales, where non-linear and relativistic effects can play a key role.

Marozzi, Giovanni

2014-01-01T23:59:59.000Z

377

The luminosity distance-redshift relation up to second order in the Poisson gauge with anisotropic stress  

E-Print Network (OSTI)

We present the generalization of previously published results, about the perturbed redshift and the luminosity-redshift relation up to second order in perturbation theory, for the case of the Poisson gauge and in the presence of anisotropic stress. The results are therefore valid for general dark energy models and (most) modified gravity models. We use an innovative approach based on the recently proposed "geodesic light-cone" gauge. We then compare our finding with other results, which recently appeared in the literature, for the particular case of vanishing anisotropic stress. Arriving at a common accepted expression for the non-linear and relativistic corrections to the redshift and distance-redshift relation is of fundamental importance in view of future cosmological surveys. Thanks to these surveys the Universe will be further probed with high precision and at very different scales, where non-linear and relativistic effects can play a key role.

Giovanni Marozzi

2014-06-04T23:59:59.000Z

378

Technology and System Level Demonstration of Highly Efficient...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

AvgGust: 6.5 mphsteady Temp MinAvgMax: 546368F Wind AvgGust: 2340 mph 20 Aerodynamic Improvements - Technical Progress Configurations Demo 2 - 24% Target Demo 1 - 14%...

379

Keep your distance  

Science Journals Connector (OSTI)

... developing retina know what job they have to do. And once they get there, John Whitfield reports, they know how to assume the correct position. Like Scarlett O'Hara ...

John Whitfield

2000-05-01T23:59:59.000Z

380

THE STRENGTH AND RADIAL PROFILE OF THE CORONAL MAGNETIC FIELD FROM THE STANDOFF DISTANCE OF A CORONAL MASS EJECTION-DRIVEN SHOCK  

SciTech Connect

We determine the coronal magnetic field strength in the heliocentric distance range 6-23 solar radii (Rs) by measuring the shock standoff distance and the radius of curvature of the flux rope during the 2008 March 25 coronal mass ejection imaged by white-light coronagraphs. Assuming the adiabatic index, we determine the Alfven Mach number, and hence the Alfven speed in the ambient medium using the measured shock speed. By measuring the upstream plasma density using polarization brightness images, we finally get the magnetic field strength upstream of the shock. The estimated magnetic field decreases from {approx}48 mG around 6 Rs to 8 mG at 23 Rs. The radial profile of the magnetic field can be described by a power law in agreement with other estimates at similar heliocentric distances.

Gopalswamy, Nat [NASA Goddard Space Flight Center, Greenbelt, MD 20771 (United States); Yashiro, Seiji [Department of Physics, Catholic University of America, Washington, DC 20064 (United States)

2011-07-20T23:59:59.000Z

Note: This page contains sample records for the topic "avg trip distance" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


381

On the Physical Cause and the Distance of Gamma Ray Bursts and Related Phenomena in the X-Rays and the Ultra-Violet  

E-Print Network (OSTI)

The modified Lorentz transformation of a distance-dependent special theory of relativity - which will be briefly summarized - predicts the possibility of superluminal velocity of very distantly moving material bodies to be connected with the generation of Cerencov radiation off the quantum vacuum. It is shown that vacuum Cerencov radiation due to the superluminal propagation of extraterrestrial spaceprobes in the interstellar space would account for all known properties of gamma ray bursts (GRBs) and the "afterglow" at lower frequencies. Distances and other parameter prove to be calculable and the theoretical results on these grounds to be in good accord with experiment.

Ernst Karl Kunst

2000-04-17T23:59:59.000Z

382

_MainReport  

NLE Websites -- All DOE Office Websites (Extended Search)

6 6 Overall AC electrical energy consumption (AC Wh/mi) 175 Average Trip Distance 12.2 Total distance traveled (mi) 272,366 Average Ambient Temperature (deg F) 54.1 Electric Vehicle mode operation (EV) Gasoline fuel economy (mpg) No Fuel Used AC electrical energy consumption (AC Wh/mi) 368 Distance traveled (mi) 129,389 Percent of total distance traveled 47.5% Average driving style efficiency (distance weighted)¹ 75% Extended Range mode operation (ERM) Gasoline fuel economy (mpg) 36.0 AC electrical energy consumption (AC Wh/mi) No Elec. Used Distance traveled (mi) 142,977 Percent of total distance traveled 52.4% Average driving style efficiency (distance weighted)¹ 77% City³ Highway³ Percent of miles in EV operation (%) 65.1% 31.1% Percent Number of trips 85.5% 14.5% Average trip distance (mi)

383

MonthlyReport  

NLE Websites -- All DOE Office Websites (Extended Search)

4.8 4.8 Overall AC electrical energy consumption (AC Wh/mi) 185 Average Trip Distance 13.1 Total distance traveled (mi) 208,165 Average Ambient Temperature (deg F) 77.6 Electric Vehicle mode operation (EV) Gasoline fuel economy (mpg) No Fuel Used AC electrical energy consumption (AC Wh/mi) 369 Distance traveled (mi) 104,687 Percent of total distance traveled 50.3% Average driving style efficiency (distance weighted)¹ 87% Extended Range mode operation (ERM) Gasoline fuel economy (mpg) 37.2 AC electrical energy consumption (AC Wh/mi) No Elec. Used Distance traveled (mi) 103,478 Percent of total distance traveled 49.7% Average driving style efficiency (distance weighted)¹ 82% City³ Highway³ Percent of miles in EV operation (%) 69.8% 33.9% Percent Number of trips 85.0% 15.0% Average trip distance (mi)

384

_MainReport  

NLE Websites -- All DOE Office Websites (Extended Search)

2.5 2.5 Overall AC electrical energy consumption (AC Wh/mi) 166 Average Trip Distance 12.1 Total distance traveled (mi) 385,849 Average Ambient Temperature (deg F) 78.2 Electric Vehicle mode operation (EV) Gasoline fuel economy (mpg) No Fuel Used AC electrical energy consumption (AC Wh/mi) 332 Distance traveled (mi) 193,336 Percent of total distance traveled 50.1% Average driving style efficiency (distance weighted)¹ 85% Extended Range mode operation (ERM) Gasoline fuel economy (mpg) 36.2 AC electrical energy consumption (AC Wh/mi) No Elec. Used Distance traveled (mi) 192,512 Percent of total distance traveled 49.9% Average driving style efficiency (distance weighted)¹ 79% City³ Highway³ Percent of miles in EV operation (%) 67.2% 31.5% Percent Number of trips 86.7% 13.3% Average trip distance (mi)

385

_MainReport  

NLE Websites -- All DOE Office Websites (Extended Search)

7.8 7.8 Overall AC electrical energy consumption (AC Wh/mi) 180 Average Trip Distance 12.8 Total distance traveled (mi) 346,409 Average Ambient Temperature (deg F) 51.5 Electric Vehicle mode operation (EV) Gasoline fuel economy (mpg) No Fuel Used AC electrical energy consumption (AC Wh/mi) 384 Distance traveled (mi) 161,982 Percent of total distance traveled 46.8% Average driving style efficiency (distance weighted)¹ 74% Extended Range mode operation (ERM) Gasoline fuel economy (mpg) 36.1 AC electrical energy consumption (AC Wh/mi) No Elec. Used Distance traveled (mi) 184,427 Percent of total distance traveled 53.2% Average driving style efficiency (distance weighted)¹ 76% City³ Highway³ Percent of miles in EV operation (%) 63.8% 28.4% Percent Number of trips 85.7% 14.3% Average trip distance (mi)

386

_MainReport  

NLE Websites -- All DOE Office Websites (Extended Search)

0 0 Overall AC electrical energy consumption (AC Wh/mi) 174 Average Trip Distance 12.6 Total distance traveled (mi) 1,243,988 Average Ambient Temperature (deg F) 63.2 Electric Vehicle mode operation (EV) Gasoline fuel economy (mpg) No Fuel Used AC electrical energy consumption (AC Wh/mi) 352 Distance traveled (mi) 615,161 Percent of total distance traveled 49.5% Average driving style efficiency (distance weighted)¹ 80% Extended Range mode operation (ERM) Gasoline fuel economy (mpg) 35.4 AC electrical energy consumption (AC Wh/mi) No Elec. Used Distance traveled (mi) 628,828 Percent of total distance traveled 50.5% Average driving style efficiency (distance weighted)¹ 78% City³ Highway³ Percent of miles in EV operation (%) 66.8% 31.7% Percent Number of trips 85.5% 14.5% Average trip distance (mi)

387

_MainReport  

NLE Websites -- All DOE Office Websites (Extended Search)

71.0 71.0 Overall AC electrical energy consumption (AC Wh/mi) 169 Average Trip Distance 12.5 Total distance traveled (mi) 1,661,080 Average Ambient Temperature (deg F) 67.1 Electric Vehicle mode operation (EV) Gasoline fuel economy (mpg) No Fuel Used AC electrical energy consumption (AC Wh/mi) 340 Distance traveled (mi) 826,775 Percent of total distance traveled 49.8% Average driving style efficiency (distance weighted)¹ 81% Extended Range mode operation (ERM) Gasoline fuel economy (mpg) 35.7 AC electrical energy consumption (AC Wh/mi) No Elec. Used Distance traveled (mi) 834,306 Percent of total distance traveled 50.2% Average driving style efficiency (distance weighted)¹ 78% City³ Highway³ Percent of miles in EV operation (%) 66.9% 31.6% Percent Number of trips 85.8% 14.2% Average trip distance (mi)

388

_MainReport  

NLE Websites -- All DOE Office Websites (Extended Search)

5 5 Overall AC electrical energy consumption (AC Wh/mi) 170 Average Trip Distance 12.4 Total distance traveled (mi) 2,041,556 Average Ambient Temperature (deg F) 64.4 Electric Vehicle mode operation (EV) Gasoline fuel economy (mpg) No Fuel Used AC electrical energy consumption (AC Wh/mi) 345 Distance traveled (mi) 1,002,495 Percent of total distance traveled 49.1% Average driving style efficiency (distance weighted)¹ 80% Extended Range mode operation (ERM) Gasoline fuel economy (mpg) 35.9 AC electrical energy consumption (AC Wh/mi) No Elec. Used Distance traveled (mi) 1,039,061 Percent of total distance traveled 50.9% Average driving style efficiency (distance weighted)¹ 78% City³ Highway³ Percent of miles in EV operation (%) 66.2% 31.0% Percent Number of trips 86.0% 14.0% Average trip distance (mi)

389

_MainReport  

NLE Websites -- All DOE Office Websites (Extended Search)

1.1 1.1 Overall AC electrical energy consumption (AC Wh/mi) 182 Average Trip Distance 11.8 Total distance traveled (mi) 355,058 Average Ambient Temperature (deg F) 46.0 Electric Vehicle mode operation (EV) Gasoline fuel economy (mpg) No Fuel Used AC electrical energy consumption (AC Wh/mi) 416 Distance traveled (mi) 155,080 Percent of total distance traveled 43.7% Average driving style efficiency (distance weighted)¹ 69% Extended Range mode operation (ERM) Gasoline fuel economy (mpg) 34.4 AC electrical energy consumption (AC Wh/mi) No Elec. Used Distance traveled (mi) 199,978 Percent of total distance traveled 56.3% Average driving style efficiency (distance weighted)¹ 74% City³ Highway³ Percent of miles in EV operation (%) 60.5% 27.0% Percent Number of trips 86.3% 13.7% Average trip distance (mi)

390

_MainReport  

NLE Websites -- All DOE Office Websites (Extended Search)

6.6 6.6 Overall AC electrical energy consumption (AC Wh/mi) 171 Average Trip Distance 11.9 Total distance traveled (mi) 370,316 Average Ambient Temperature (deg F) 53.8 Electric Vehicle mode operation (EV) Gasoline fuel economy (mpg) No Fuel Used AC electrical energy consumption (AC Wh/mi) 371 Distance traveled (mi) 170,860 Percent of total distance traveled 46.1% Average driving style efficiency (distance weighted)¹ 75% Extended Range mode operation (ERM) Gasoline fuel economy (mpg) 35.9 AC electrical energy consumption (AC Wh/mi) No Elec. Used Distance traveled (mi) 199,456 Percent of total distance traveled 53.9% Average driving style efficiency (distance weighted)¹ 77% City³ Highway³ Percent of miles in EV operation (%) 63.2% 28.1% Percent Number of trips 86.7% 13.3% Average trip distance (mi)

391

_MainReport  

NLE Websites -- All DOE Office Websites (Extended Search)

2 2 Overall AC electrical energy consumption (AC Wh/mi) 157 Average Trip Distance 12.3 Total distance traveled (mi) 407,245 Average Ambient Temperature (deg F) 67.9 Electric Vehicle mode operation (EV) Gasoline fuel economy (mpg) No Fuel Used AC electrical energy consumption (AC Wh/mi) 338 Distance traveled (mi) 189,426 Percent of total distance traveled 46.5% Average driving style efficiency (distance weighted)¹ 82% Extended Range mode operation (ERM) Gasoline fuel economy (mpg) 36.5 AC electrical energy consumption (AC Wh/mi) No Elec. Used Distance traveled (mi) 217,819 Percent of total distance traveled 53.5% Average driving style efficiency (distance weighted)¹ 79% City³ Highway³ Percent of miles in EV operation (%) 65.2% 28.3% Percent Number of trips 86.5% 13.5% Average trip distance (mi)

392

_MainReport  

NLE Websites -- All DOE Office Websites (Extended Search)

73.7 73.7 Overall AC electrical energy consumption (AC Wh/mi) 170 Average Trip Distance 12.6 Total distance traveled (mi) 370,987 Average Ambient Temperature (deg F) 71.0 Electric Vehicle mode operation (EV) Gasoline fuel economy (mpg) No Fuel Used AC electrical energy consumption (AC Wh/mi) 341 Distance traveled (mi) 185,282 Percent of total distance traveled 49.9% Average driving style efficiency (distance weighted)¹ 83% Extended Range mode operation (ERM) Gasoline fuel economy (mpg) 36.9 AC electrical energy consumption (AC Wh/mi) No Elec. Used Distance traveled (mi) 185,705 Percent of total distance traveled 50.1% Average driving style efficiency (distance weighted)¹ 79% City³ Highway³ Percent of miles in EV operation (%) 68.0% 32.4% Percent Number of trips 85.4% 14.6% Average trip distance (mi)

393

Features of Muon Arrival Time Distributions of High Energy EAS at Large Distances From the Shower Axis  

E-Print Network (OSTI)

In view of the current efforts to extend the KASCADE experiment (KASCADE-Grande) for observations of Extensive Air Showers (EAS) of primary energies up to 1 EeV, the features of muon arrival time distributions and their correlations with other observable EAS quantities have been scrutinised on basis of high-energy EAS, simulated with the Monte Carlo code CORSIKA and using in general the QGSJET model as generator. Methodically various correlations of adequately defined arrival time parameters with other EAS parameters have been investigated by invoking non-parametric methods for the analysis of multivariate distributions, studying the classification and misclassification probabilities of various observable sets. It turns out that adding the arrival time information and the multiplicity of muons spanning the observed time distributions has distinct effects improving the mass discrimination. A further outcome of the studies is the feature that for the considered ranges of primary energies and of distances from the shower axis the discrimination power of global arrival time distributions referring to the arrival time of the shower core is only marginally enhanced as compared to local distributions referring to the arrival of the locally first muon.

I. M. Brancus; H. Rebel; A. F. Badea; A. Haungs; C. D. Aiftimiei; J. Oehlschlaeger; M. Duma

2002-12-20T23:59:59.000Z

394

Scaling and estimation of earthquake ground motion as a function of the earthquake source parameters and distance  

SciTech Connect

In this report we review the various methodologies currently available to predict the near-source ground motion from an earthquake. The limitations of the various approaches are discussed in light of recently developed theory and recorded data. To overcome some of the limitations of available approaches, we develop improved rules for scaling between earthquakes. Ground-motion data obtained from salvo (line source) explosions are also investigated to gain insight into the appropriate form for the attenuation of peak acceleration and peak velocity. The scaling laws are combined with the appropriate attenuation relations and the data from the 1971 San Fernando and 1940 Imperial Valley earthquakes to obtain relations among the key source parameters: dynamic stress drop and equivalent radius of the highly stressed region, distance from the center of energy release, and peak ground acceleration and velocity. These relations are verified by comparing the predicted levels of ground motion to those actually recorded from a number of earthquakes, including the recent 1979 Imperial Valley and Coyote Lake earthquakes. The relations among earthquake magnitude, earthquake source parameters, and peak ground motion are discussed. 83 refs., 37 figs., 9 tabs.

Bernreuter, D.L.

1981-04-01T23:59:59.000Z

395

Orbital parameters, masses and distance to Beta Centauri determined with the Sydney University Stellar Interferometer and high resolution spectroscopy  

E-Print Network (OSTI)

The bright southern binary star beta Centauri (HR 5267) has been observed with the Sydney University Stellar Interferometer (SUSI) and spectroscopically with the ESO CAT and Swiss Euler telescopes at La Silla. The interferometric observations have confirmed the binary nature of the primary component and have enabled the determination of the orbital parameters of the system. At the observing wavelength of 442 nm the two components of the binary system have a magnitude difference of 0.15. The combination of interferometric and spectroscopic data gives the following results: orbital period 357 days, semi-major axis 25.30 mas, inclination 67.4 degrees, eccentricity 0.821, distance 102.3 pc, primary and secondary masses M1 = M2 = 9.1 solar masses and absolute visual magnitudes of the primary and secondary M1V = -3.85 and M2V = -3.70. The high accuracy of the results offers a fruitful starting point for future asteroseismic modelling of the pulsating binary components.

Davis, J; Seneta, E B; Tango, W J; Booth, A J; O'Byrne, J W; Thorvaldson, E D; Ausseloos, M; Aerts, C; Uytterhoeven, K

2004-01-01T23:59:59.000Z

396

Andromeda: A mission to determine the gamma-ray burst distance scale F.A. Harrison, W.R. Cook, T.A. Prince, S.M. Schindler  

E-Print Network (OSTI)

Andromeda: A mission to determine the gamma-ray burst distance scale F.A. Harrison, W.R. Cook, T was submitted to the STEDI program, and will also be proposed as a NASA Small Explorer. Keywords: bursts, gamma-rays, small missions 1 SCIENTIFIC OBJECTIVES 1.1 Gamma-ray Bursts Gamma-ray bursts GRBs were discovered

Prince, Thomas A.

397

1.1 Basic ideas r(t) is the position of a particle; r = |r| is the distance to the origin.  

E-Print Network (OSTI)

speed of the particle is v = R. (11) #12;Chapter 2 Dynamics: Newton's laws of motion and gravitation 2 interacting though equal and opposite forces is constant. 3 #12;4 2.2 Newton's Law of Gravitation 2.2 Newton's Law of Gravitation Two particles of masses M and m a distance r apart exert a mutually attractive

Rucklidge, Alastair

398

Guidance, Navigation and Control Conference, August 16-19 2007, Hilton Head, South Carolina Long Distance/Duration Trajectory Optimization for  

E-Print Network (OSTI)

University, University Park, PA 16802, USA This paper presents a system for autonomous soaring flight by small and micro unin- habited aerial vehicles. It combines a prediction of wind field with a trajectory or ridge) lift to enable long duration, long distance flights by a small autonomous uninhabited aerial

Langelaan, Jack W.

399

The Attitude of Middle Eastern Faculty toward the use of Distance Education in the Middle Eastern State Universities: A Comparative Study between the Middle Eastern Faculty and USA Faculty.  

E-Print Network (OSTI)

??Although distance education is offered in many academic institutions, specifically universities, in most of the developed countries, utilizing it as a part of the educational (more)

AlTameemy, Farooq A.

2010-01-01T23:59:59.000Z

400

Trip Report: Northern New Mexico Citizens Advisory Board Meeting  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Northern New Mexico Northern New Mexico Citizens' Advisory Board Public Meeting August 24, 2006 Submitted by: Jennifer Salisbury Background: On behalf of the Environmental Management Advisory Board, Ms. Jennifer Salisbury attended the Northern New Mexico Citizens' Advisory Board (NNMCAB) meeting on Wednesday, July 26, 2006. The NNMCAB is an Environmental Management Site-Specific Advisory Board, responsible for providing information, advice, and recommendations on EM issues specific to Los Alamos National Laboratory (LANL). The goal of Ms. Salisbury's attendance was to: Observe the meeting activities. Report observations to Assistant Secretary James Rispoli (EM-1). Provide feedback and/or recommendations. Findings and Observations: J.D. Campbell, the NNMCAB chair, was appreciative of EMAB's interest in their

Note: This page contains sample records for the topic "avg trip distance" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


401

Trip Report: DOE Seventh Annual Small Business Conference  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Department of Energy Seventh Department of Energy Seventh Annual Small Business Conference August 24, 2006 Submitted by: Mr. Dennis Ferrigno Background: On behalf of the Environmental Management Advisory Board, Mr. Dennis Ferrigno attended the Department of Energy's (DOE) Seventh Annual Small Business Conference sessions Tuesday, June 27 through Friday, June 30, 2006. DOE was represented at the mid-level management rank by Environmental Management, the Office of Energy Efficiency and Renewable Energy (EE), the National Nuclear Security Administration (NNSA), the Office of Civilian Radioactive Waste (RW), the Department of Science, the Small Business Office, and large DOE Management and Operating (M&O) Contractors. In addition, Federal entities, including the General Services Administration (GSA), the

402

Trip Report: Idaho National Laboratory Citizens Advisory Board Meeting  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Idaho National Laboratory Site Idaho National Laboratory Site EM Citizens Advisory Board Public Meeting Report of Observations August 24, 2006 Submitted by: C. Stephen Allred Background: On behalf of the Environmental Management Advisory Board, Mr. C. Stephen Allred attended the Idaho National Laboratory (INL) Site Environmental Management Citizens Advisory Board (CAB) meeting on Tuesday, July 18, and Wednesday, July 19, 2006. The INL CAB is an Environmental Management Site-Specific Advisory Board, responsible for providing information, advice, and recommendations on EM issues specific to INL. The goal of Mr. Allred's attendance was to: Observe the meeting activities. Report observations to Assistant Secretary James Rispoli (EM-1). Provide feedback and/or recommendations.

403

Major Challenges in Landscape Planning: Simulated Field Trips  

E-Print Network (OSTI)

of production. The surface mining process generally consists of four phases: (1) exploration; (2) development Rowland and Reed Stalder 2/ Abstract: The surface mining process consists of four phases: (1) exploration; (3) production; and (4) reclamation. The purpose of exploration or "prospec- ting" is to discover

Standiford, Richard B.

404

fieldtripexperience-8thgrade Cater your field trip experience  

E-Print Network (OSTI)

Activities (MS-ESS1-1, MS-ESS1-2, MS-ESS2-1, MS-ESS2-2): Our Solar System is a fascinating place. Learn about

Waliser, Duane E.

405

fieldtripexperience-6thgrade Cater your field trip experience  

E-Print Network (OSTI)

Gen standard-alligned exhibits and activities! Sixth Grade: Science on a Sphere (MS- ESS2-2, MS-ESS2-3, MS-ESS3 on a Sphere! Ames Spacecraft Missions (MS-ESS1-3): The IRIS Mission studies a very dynamic region of the Sun

Waliser, Duane E.

406

Solution Methods for the Multi-trip Elementary Shortest Path ...  

E-Print Network (OSTI)

One approach to solve MESPPRC is to use a branch-and-cut methodology based on the mathematical pro ..... M. Desrochers, J. Desrosiers, and M. M. Solomon.

2011-03-15T23:59:59.000Z

407

Smithson Tennant: meteorites and the final trip to France  

Science Journals Connector (OSTI)

...Library, and the LuEsther T. Mertz Library of the NY Botanical Gardens; and...the staff of the Briarcliff Manor Public Library, NY. I also thank Ilse Mertens...119 O. R. Norton, Rocks from space, meteorites and meteorite hunters...

2007-01-01T23:59:59.000Z

408

Mobile Transit Trip Planning with Real-Time Data  

E-Print Network (OSTI)

International Confer- ence on Mobile Systems, Applications,international conference on Mobile systems, applications,international conference on Mobile systems, applica- tions,

Jariyasunant, Jerald; Work, Daniel B.; Kerkez, Branko; Sengupta, Raja; Glaser, Steven; Bayen, Alexandre

2011-01-01T23:59:59.000Z

409

Field trip to WTE facility I/S Nordforbrnding  

E-Print Network (OSTI)

at high temperatures in the furnace. As a result, the heat of combustion is used to produce steam in the boiler. This steam drives a generator of electricity. The flue gases, released from the combustion is handled by a fully automatic container system, which helps to increase the safety and efficiency

Columbia University

410

Trip Report: March 14-18, 2011 1. Objectives  

E-Print Network (OSTI)

Artaxo (USP), Rodrigo Souza (UEA), Rosa Santos (UEA), Scot Martin (Harvard). A roundtable discussion

411

AMEC GEOMATRIX/ARA GROUNDWATER REMEDIAITON TRIP REPORT  

SciTech Connect

City of Rialto, Well No.3 Demonstration System Integration Project, and Baldwin Park Operable Unit, Baldwin Park, California. The groundwater remediation contractors are AMEC Geomatrix and ARA. The sites were visited on July 22, 2008. Fluor Hanford and the U.S. Department of Energy are currently looking at a variety of alternatives to capture carbon tetrachloride, nitrates, and other COCs from 200-ZP-l groundwater. A few of the more important objectives of our visits were to: (1) Evaluate the treatment systems being used by AMEC Geomatrix to address VOCs, perchlorate, NDMA, 1,4,-Dioxane, and 1,2,3 TCP in a drinking water source; (2) Evaluate how effective these treatment methods have been; (3) Determine the types of problems they have encountered with these treatment systems and how they addressed these problems; (4) Determine the types of secondary wastes being generated by the system; (5) Determine how clean of an operation these companies run; and (6) Determine if the site is worth being visited by DOE-RL at a later date.

SIMMONS SA

2008-08-07T23:59:59.000Z

412

Optimal Energy Management of a PHEV Using Trip Information  

Energy.gov (U.S. Department of Energy (DOE))

2012 DOE Hydrogen and Fuel Cells Program and Vehicle Technologies Program Annual Merit Review and Peer Evaluation Meeting

413

________ COMMITTEE ON THE FUTURE INTERVIEWEES FOR WASHINGTON, DC TRIP  

E-Print Network (OSTI)

of the United States Marine Corps Pentagon Room 4E734 (703) 614-2500 11:15 a.m. ­ 12:00 p.m. ADM Mark E;3 1:00 p.m. ­ 2:00 p.m. ADM Kirkland M. Donald Director, Naval Nuclear Propulsion Program 4:30 p

414

Land Use Influences on Trip Chaining in Portland, Oregon  

E-Print Network (OSTI)

Heating Oil, Diesel Fuel, And Distillate Most Recent Weekly Data Weekly On-Highway Diesel Prices.

Greenwald, Michael J.; McNally, Michael G.

2008-01-01T23:59:59.000Z

415

Visit Russia A trip to St. Petersburg will be arranged  

E-Print Network (OSTI)

to contact staff at LUT Summer School. Visit us Lappeenranta University of Technology International Services Skinnarilankatu 34 FI- 53850 LAPPEENRANTA FINLAND LUT Summer School 2012 Harbour of Lappeenranta 25 June ­ 8 July 2012, Lappeenranta, Finland Unique cultural experience Lappeenranta's safe and green environment

Hellebrand, Sybille

416

Optimal Energy Management of a PHEV Using Trip Information  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

NAVTEQ (Map data) Argonne's Transportation Research and Analysis Computing Center (TRACC) (traffic modeling) 2 2012 DOE VT Merit Review - VSS068 - Optimal Energy...

417

ARI delegation to Japan on Alternative Refrigerants. [Foreign Trip Report  

SciTech Connect

Researchers from ARI member companies spoke at the International Conference on Alternative Refrigerants in Tokyo and visited several Japanese organizations for the purpose of exchanging information on alternative refrigerants. The specific purpose of the meetings was to review the methods being utilized to screen alternatives to CFCs and HCFCs: materials compatibility screening methods, lubricant testing techniques, as well as flammability studies. A list of papers presented at the conference is included.

Not Available

1993-02-01T23:59:59.000Z

418

Three E's: Education, Experience, and Employment 2011 Field Trip  

E-Print Network (OSTI)

risk." Miche!e Gutierrez " Fire Management Officer, Mary Kay Hicks, Texas Forest Service, taught us Mountains National Wildlife Refuge in Oklahoma #12;National Weather Center, Norman, Oklahoma #12;Flint Hills Research Unit, Manhattan, Kansas #12;"Pine bark beetle damage in the black hi!s national forest - Recent

419

Trip Prediction and Route-Based Vehicle Energy Management  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Barriers * Start: September 2012 * End: September 2014 * Status: 70% complete * Cost of testing advanced technologies through multiple vehicle builds * Risk aversion of OEM...

420

Florida SR-66 Sinkhole Monitoring April 2005 Field Trip Report  

E-Print Network (OSTI)

by a solar panel and deep- cycle battery. The communication link is powered on for only a brief window each. A site visit by FDOT personnel revealed that the solar panel powering the instrument box had been sawn off its pole and stolen. ITI engineers decided to travel to the site to replace the solar panel

Note: This page contains sample records for the topic "avg trip distance" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


421

A cosmic trip: 25 years of cosmogenic nuclides in geology  

Science Journals Connector (OSTI)

...are based largely on designs by R. Middleton (1983). After...Southon, J., Finkel, R., and McAninch, J., 2007...geomorph.2010.08.013. Pappu, S. , Gunnell, Y., Akhilesh, K., Braucher, R., Taieb, M., Demory, F...

Darryl E. Granger; Nathaniel A. Lifton; Jane K. Willenbring

422

Japan trips up over high-definition television  

Science Journals Connector (OSTI)

... Tokyo. A top official of Japan's Ministry of Posts and Telecommunications has caused uproar by suggesting that ... 's Ministry of Posts and Telecommunications has caused uproar by suggesting that Japan should fol-low the United States and Europe and switch to the development of digital ...

David Swinbanks

1994-03-03T23:59:59.000Z

423

Microsoft Word - SAFETY TRIP REPORT2009r13.doc  

NLE Websites -- All DOE Office Websites (Extended Search)

17 1 Report on the 13 th Meeting of the Joint Working Group of the U.S-Japan Coordinating Committee of Fusion Energy on Safety in Inter-Institutional...

424

The Clustering of the SDSS DR7 Main Galaxy Sample I: A 4 per cent Distance Measure at z=0.15  

E-Print Network (OSTI)

We create a sample of spectroscopically identified galaxies with $z Survey (SDSS) Data Release 7, covering 6813 deg$^2$. Galaxies are chosen to sample the highest mass haloes, with an effective bias of 1.5, allowing us to construct 1000 mock galaxy catalogs (described in Paper II), which we use to estimate statistical errors and test our methods. We use an estimate of the gravitational potential to "reconstruct" the linear density fluctuations, enhancing the Baryon Acoustic Oscillation (BAO) signal in the measured correlation function and power spectrum. Fitting to these measurements, we determine $D_{V}(z_{\\rm eff}=0.15) = (664\\pm25)(r_d/r_{d,{\\rm fid}})$ Mpc; this is a better than 4 per cent distance measurement. This "fills the gap" in BAO distance ladder between previously measured local and higher redshift measurements, and affords significant improvement in constraining the properties of dark energy. Combining our measurement with other BAO measurements from BOSS and...

Ross, Ashley J; Howlett, Cullan; Percival, Will J; Burden, Angela; Manera, Marc

2014-01-01T23:59:59.000Z

425

Study Questions 1. What is the formula for the distance between two points P1 and P2 in R3  

E-Print Network (OSTI)

that this limit does not exist? 23. What does it mean to say that f : R2 R is continuous at a point (a, b)? 24 and P2 in R3 ? Why does this formula make sense? 2. What is the equation for a sphere with radius r centered at the point C(h, k, l)? How does this formula arise from the distance formula? 3. What

Myers, Amy

426

Influence of compensator thickness, field size, and off-axis distance on the effective attenuation coefficient of a cerrobend compensator for intensity-modulated radiation therapy  

SciTech Connect

Intensity-modulated radiation therapy (IMRT) can be performed by using compensators. To make a compensator for an IMRT practice, it is required to calculate the effective attenuation coefficient (?{sub eff}) of its material, which is affected by various factors. We studied the effect of the variation of the most important factors on the calculation of the ?{sub eff} of the cerrobend compensator for 6-MV photon beams, including the field size, compensator thickness, and off-axis distance. Experimental measurements were carried out at 100 cm source-to-surface distance and 10 cm depth for the 6-MV photon beams of an Elekta linac using various field size, compensator thickness, and off-axis settings. The field sizes investigated ranged from 4 4 to 25 25 cm{sup 2} and the cerrobend compensator thicknesses from 0.56 cm. For a fixed compensator thickness, variation of the ?{sub eff} with the field size ranged from 3.76.8%, with the highest value attributed to the largest compensator thickness. At the reference field size of 10 10 cm{sup 2}, the ?{sub eff} varied by 16.5% when the compensator thickness was increased from 0.56 cm. However, the variation of the ?{sub eff} with the off-axis distance was only 0.99% at this field size, whereas for the largest field size, it was more significant. Our results indicated that the compensator thickness and field size have the most significant effect on the calculation of the compensator ?{sub eff} for the 6-MV photon beam. Therefore, it is recommended to consider these parameters when calculating the compensator thickness for an IMRT practice designed for these beams. The off-axis distance had a significant effect on the calculation of the ?{sub eff} only for the largest field size. Hence, it is recommended to consider the effect of this parameter only for field sizes larger than 25 25 cm{sup 2}.

Haghparast, Abbas [Department of Medical Physics, Faculty of Medical Sciences, Tarbiat Modares University, Tehran, Islamic Republic of Iran (Iran, Islamic Republic of); Hashemi, Bijan, E-mail: bhashemi@modares.ac.ir [Department of Medical Physics, Faculty of Medical Sciences, Tarbiat Modares University, Tehran, Islamic Republic of Iran (Iran, Islamic Republic of); Eivazi, Mohammad Taghi [Department of Medical Physics, Faculty of Medicine, Kermanshah University of Medical Sciences, Kermanshah, Islamic Republic of Iran (Iran, Islamic Republic of)

2013-04-01T23:59:59.000Z

427

N.J. Themelis Trip to China, October 2007 Trip of Nickolas Themelis, WTERT Chair, to China, October 18-  

E-Print Network (OSTI)

greatly by the Renewable Energy policy of the country: Coal-fired power plants receive 4-6 cents/kWh. WTE was defined as clean and renewable energy. WTE plants in China are of two main types: Stoker grate and Circulating Fluid Bed. The latter are much smaller and they need coal co-firing, up to 20% of the feed

Columbia University

428

The ARAUCARIA project: Deep near-infrared survey of nearby galaxies. I. The distance to the Large Magellanic Cloud from K-band photometry of red clump stars  

E-Print Network (OSTI)

We have obtained deep imaging in the near-infrared J and K bands for 2 nearby fields in the bar of the LMC with the ESO NTT telescope, under exquisite seeing conditions. The K, J-K color-magnitude diagrams constructed from these data are of outstanding photometric quality and reveal the presence of several hundreds of red clump stars. Using the calibration of Alves for the K-band absolute magnitude of Hipparcos-observed red clump stars in the solar neigbourhood we derive a distance modulus to our observed LMC fields of 18.487 mag. Applying a correction for the tilt of the LMC bar with respect to the line of sight according to the geometrical model of van der Marel et al., the corresponding LMC barycenter distance is 18.501 mag. If we adopt a K-band population correction of -0.03 mag, as done by Alves et al. 2002, to account for the difference in age and metallicity between the solar neighborhood and LMC red clump star populations, we obtain an LMC barycenter distance modulus of 18.471 mag from our data. This is in excellent agreement with the result of Alves et al., and of another very recent study of Sarajedini et al. (2002) obtained from K-band photometry. However, we emphasize that current model predictions about the uncertainties of population corrections seem to indicate that errors up to about 0.12 mag may be possible, probably in any photometric band. Therefore, work must continue to tighten the constraints on these corrections. We also determine the mean red clump star magnitude in our LMC fields in the J band, which could be a useful alternative to the K band should future work reveal that population effect corrections for red clump stars in the J band are smaller, or more reliably determined than those for the K band.

G. Pietrzynski; W. Gieren

2002-08-07T23:59:59.000Z

429

Dissertations Circulating from University Libraries, Virginia Tech as of Feb. 1996 and Feb. 1998  

E-Print Network (OSTI)

in branches main+branch 1863 5953 3.20 libraries avg. no. circ's per item on campus off-site 1911 216 0.11 avg. no. circ's per item off-site all sites 3774 6169 1.63 avg.no. circ's per item as of Feb. 1996 in branches main+branch 1918 8221 4.29 libraries avg. no. circ's per item on campus off-site 2272 217 0.10 avg

Beex, A. A. "Louis"

430

Segmentation and morphometric analysis of subcortical regions in autistic MR brain images using fuzzy Gaussian distribution model-based distance regularised multi-phase level set  

Science Journals Connector (OSTI)

In this work, subcortical regions of autism spectrum disorder are analysed using fuzzy Gaussian distribution model-based distance regularised multi-phase level set method in autistic MR brain images. The fuzzy Gaussian distribution model is used as the intensity discriminator. The segmented images are validated with the ground truth using geometrical measure area. The results show that the fuzzy Gaussian distribution model-based multi-phase level set method is able to extract the subcortical tissue boundaries. The subcortical regions segmented using this method gives high correlation with ground truth. The corpus callosum area gives very high (R = 0.94) correlation. The brain stem and cerebellum present high correlations of 0.89 and 0.84, respectively. Also, it is found the segmented autistic subcortical regions have reduced area and are statistically significant (p brain area.

A.R. Jac Fredo; G. Kavitha; S. Ramakrishnan

2014-01-01T23:59:59.000Z

431

System and method employing a minimum distance and a load feature database to identify electric load types of different electric loads  

DOE Patents (OSTI)

A method identifies electric load types of a plurality of different electric loads. The method includes providing a load feature database of a plurality of different electric load types, each of the different electric load types including a first load feature vector having at least four different load features; sensing a voltage signal and a current signal for each of the different electric loads; determining a second load feature vector comprising at least four different load features from the sensed voltage signal and the sensed current signal for a corresponding one of the different electric loads; and identifying by a processor one of the different electric load types by determining a minimum distance of the second load feature vector to the first load feature vector of the different electric load types of the load feature database.

Lu, Bin; Yang, Yi; Sharma, Santosh K; Zambare, Prachi; Madane, Mayura A

2014-12-23T23:59:59.000Z

432

Lifetime measurement of candidate chiral doublet bands in the Rh103,104 isotopes with the recoil-distance Doppler-shift method in inverse kinematics  

Science Journals Connector (OSTI)

Lifetimes of chiral candidate structures in Rh103,104 were measured using the recoil distance Doppler-shift method. The Gammasphere detector array was used in conjunction with the Cologne plunger device. Excited states of Rh103,104 were populated by the 11B(96Zr,4n)103Rh and 11B(96Zr,3n)104Rh fusion-evaporation reactions in inverse kinematics. Three and five lifetimes of levels belonging to the proposed chiral doublet bands are measured in Rh103 and Rh104, respectively. The previously observed even-odd spin dependence of the B(M1)/B(E2) values is caused by the variation in the B(E2) values, whereas the B(M1) values decrease as a function of spin.

T. Suzuki; G. Rainovski; T. Koike; T. Ahn; M. P. Carpenter; A. Costin; M. Danchev; A. Dewald; R. V. F. Janssens; P. Joshi; C. J. Lister; O. Mller; N. Pietralla; T. Shinozuka; J. Timr; R. Wadsworth; C. Vaman; S. Zhu

2008-09-22T23:59:59.000Z

433

On the Performance of Spin Diffusion NMR Techniques in Oriented Solids: Prospects for Resonance Assignments and Distance Measurements from Separated Local Field Experiments  

Science Journals Connector (OSTI)

We conclude that, in order to assign SLF spectra and measure short- and long-range distances, the combined use of homonuclear correlation spectra, such as the ones surveyed in this work, are necessary. ... (1-11) To accurately probe membrane protein topology, separated local field (SLF) experiments such as PISEMA,(12, 13) SAMPI4,(14) HIMSELF,(15) and their sensitivity-enhanced variants(16-18) are used to measure DC and CS. ... For membrane proteins, SLF-type spectra are assigned using selectively and/or uniformly labeled samples that rely on the periodic nature of the DC and CS (polar index slant angle, PISA, wheel pattern(22, 23)) that results from the periodicity of secondary structures (helices and sheets) commonly present in membrane proteins. ...

Nathaniel J. Traaseth; T. Gopinath; Gianluigi Veglia

2010-10-11T23:59:59.000Z

434

Distance-dependent radiation chemistry: Oxidation versus hydrogenation of CO in electron-irradiated H2O/CO/H2O ices  

SciTech Connect

Electron-stimulated oxidation of CO in layered H2O/CO/H2O ices was investigated with infrared reflection-absorption spectroscopy (IRAS) as function of the distance of the CO layer from the water/vacuum interface. The results show that while both oxidation and reduction reactions occur within the irradiated water films, there are distinct regions where either oxidation or reduction reactions are dominant. At depths less than ~ 15 ML, CO oxidation dominates over the sequential hydrogenation of CO to methanol (CH3OH), and CO2 is the major product of CO oxidation, consistent with previous observations. At its highest yield, CO2 accounts for ~45% of all the reacted CO. Another oxidation product is identified as the formate anion (HCO2-). In contrast, for CO buried more than ~ 35 ML below the water/vacuum interface, the CO-to-methanol conversion efficiency is close to 100%. Production of CO2 and formate are not observed for the more deeply buried CO layers, where hydrogenation dominates. Experiments with CO dosed on pre-irradiated ASW samples suggest that OH radicals are primarily responsible for the oxidation reactions. Possible mechanisms of CO oxidation, involving primary and secondary processes of water radiolysis at low temperature, are discussed. The observed distance-dependent radiation chemistry results from the higher mobility of hydrogen atoms that are created by the interaction of the 100 eV electrons with the water films. These hydrogen atoms, which are primarily created at or near the water/vacuum interface, can desorb from or diffuse into the water films, while the less-mobile OH radicals remain in the near-surface zone resulting in preferential oxidation reactions there. The diffusing hydrogen atoms are responsible for the hydrogenation reactions that are dominant for the more deeply buried CO layers.

Petrik, Nikolay G.; Monckton, Rhiannon J.; Koehler, Sven; Kimmel, Gregory A.

2014-11-26T23:59:59.000Z

435

On Distance from the Truth as a True Distance  

Science Journals Connector (OSTI)

False scientific theories, we imagine, can differ in their closeness to the truth. Poppers qualitative theory of verisimilitude ( ... as a variation in the set of true consequences coupled with a countermodulati...

David Miller

1979-01-01T23:59:59.000Z

436

SOME CONFLICTING ESTIMANES OF DISTANCE  

Science Journals Connector (OSTI)

...plans, struggled with their (lifficulties, fought their battles. and made their exit from the worry and work of life 3,370...Ehu-en-Aten, at a place now kinow-n as Tell el-Amarna, midway between Minieh and Assiout, on the eastern bank of the Nile...

Arthur E. Bostwick

1893-05-19T23:59:59.000Z

437

The `Skyline' Distance 46km  

E-Print Network (OSTI)

swooping singletrack threading through beautiful forest to exposed rocky doubletrack on wide open hills-track ascent as White's Level and continuing on long, forest road climbs with sweet, flowing technical eto, byddwch yn barod. ynyGoedwig-intheForest Afan mountainbiking beiciomynydd Am wybodaeth bellach

438

Photo Gallery - Hanford Site  

NLE Websites -- All DOE Office Websites (Extended Search)

Trips Get a Grip on Slips,Trips and Falls Get a Grip on Slips,Trips and Falls Extreme Slips Trips Extreme Slips Trips...

439

Laser Phase Control of High-Order Harmonic Generation at Large Internuclear Distance: The H{sup +}-H{sub 2}{sup +} System  

SciTech Connect

Exact (Born-Oppenheimer) 3-D numerical solutions of the time-dependent Schroedinger equation are obtained for the one electron linear H{sup +}-H{sub 2}{sup +} atom-molecule system at large internuclear distance R in interaction with two-cycles intense (I>10{sup 14} W cm{sup -2}) 800 nm laser pulses. High-order harmonic generation (HHG) spectra are obtained with an energy cutoff larger than the atomic maximum of I{sub p}+3U{sub p}, where I{sub p} is the ionization potential and U{sub p} is the ponderomotive energy. At large R, this extended cutoff is shown to be related to the nature of electron transfer, whose direction is shown to depend critically on the carrier-envelope phase (CEP) of the ultrashort pulse. Constructive and destructive interferences in the HHG spectrum resulting from coherent superpositions of electronic states in the H{sup +}-H{sub 2}{sup +} system are interpreted in terms of multiple electron trajectories extracted from a time profile analysis.

Bandrauk, Andre D.; Barmaki, Samira; Kamta, Gerard Lagmago [Laboratoire de Chimie Theorique, Faculte des Sciences, Universite de Sherbrooke, Sherbrooke, Quebec, J1K 2R2 (Canada)

2007-01-05T23:59:59.000Z

440

Solution structure of a fragment of the dimerization domain of DP-1 determined by 1H-nuclear magnetic resonance and distance geometry  

Science Journals Connector (OSTI)

The structure of a synthesized peptide with the sequence of NHILPNESAYDQKNIRRRVYDALNVLMAMNIISK that corresponds to residues 151184 of transcription factor DP-1 (Girling et al., Nature 362 (1993) 8387) was determined by 1H-nuclear magnetic resonance in water and 40% d3-trifluoroethanol/water, respectively. Nuclear Overhauser effect cross peaks, ?H chemical shifts and J-coupling constants of ?HNH show that the peptide consists a helix from Ser-8 to Ser-33 in solution. Fifty structures were constructed with 288 upper distance limits and 21 angle constraints by DIANA (Guntert et al., J. Mol. Biol. 217 (1991) 517530). Although the N-terminal of the peptide exhibits a random conformation, the 20 best structures show a root mean square deviation of 0.890.36 for backbone atoms and 1.800.34 for heavy atoms from residue Ser-8 to Ser-33. This result supports the proposal that DP-1 and E2F-1 may dimerize with a coiled-coil type interaction.

Shouhong Guang; Jihui Wu; Tianning Yu; Youlin Xia; Yunyu Shi

1998-01-01T23:59:59.000Z

Note: This page contains sample records for the topic "avg trip distance" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


441

Solution structure of a fragment of the dimerization domain of E2F-1 determined by circular dichroism, 1H nuclear magnetic resonance and distance geometry  

Science Journals Connector (OSTI)

The structure of a synthesized peptide with the sequence GVVDLNWAAEVLKVQKRRIYDITNVLEGIQ which corresponds to residues 149178 of transcription factor E2F-1 was determined by 1H nuclear magnetic resonance in 40% d3-TFE/water. NOE cross peaks and ?H chemical shifts indicate that the peptide consists of a helix from Ala-8 to Leu-26 in this solution. Circular dichroism measurements confirm the presence of nearly 45% helix in TFE/water solution but show no evidence of helicity in water solution of this peptide. Fifty structures were constructed with 329 upper distance limits by DIANA. The 20 best conformers show a RMSD of 0.78 for backbone atoms and 1.78 for heavy atoms from residue Ala-8 to Leu-26. This result, together with our previous work on the solution structure of a fragment of DP-1, supports the proposal that E2F-1 and DP-1 may dimerize with a coiled-coil type interaction.

Shouhong Guang; Jihui Wu; Limei Tao; Youlin Xia; Yunyu Shi

1998-01-01T23:59:59.000Z

442

Biol. Chem., Vol. 385, pp. 913920, October 2004 Copyright by Walter de Gruyter Berlin New York. DOI 10.1515/BC.2004.119 Inter-and intra-molecular distances determined by EPR  

E-Print Network (OSTI)

York. DOI 10.1515/BC.2004.119 2004/122 Review Inter- and intra-molecular distances determined by EPR and electron paramagnetic resonance (EPR) spectroscopy an attractive approach for the study of pro- tein approximately 0.5 to 8 nm by the com- bination of continuous wave and pulse EPR methods. Recent applications

Steinhoff, Heinz-Jürgen

443

Energy efficiency in the European Union: What can be learned from the joint application of directional distance functions and slacks-based measures?  

Science Journals Connector (OSTI)

Abstract Over the last few years concerns have increased about the energy mix in many countries. These concerns have been of greater magnitude for countries with a common energy regulation such as European Union (EU) member states. An important aspect to take into account when choosing a given energy mix is the efficiency involved in its generation. In this context, the present study analyzes the efficiency with which electricity and derived heat was produced in 25 EU member states over the last decade. This analysis considers not only the inputs and outputs involved but, more importantly, which undesirable by-products were generated during the production process, a relevant issue for EU climate policy. To this end, two nonparametric frontier models are applied: first, a Directional Distance Function (DDF), based on Briecs (1997) [16] proposal and, second, a modified version of Tones (2001) [51] Slacks-Based Measure (SBM) model, both of which are especially appropriate in this particular context due to their treatment of undesirable outputs. Results are partly innovative since, with few exceptions, applications on this issue are relatively scarce. From a policy implications point of view, our achievements are also interesting because they reveal remarkable efficiency differences among EU countries: those countries from the latest EU enlargements account for the lowest efficiencies, with large opportunities for improvement in CO2 abatement and primary energy saving. Results also show stable efficiencies along the evaluated period and, therefore, highlighting the need to further intensify the initiatives designed to harmonize environmental policies and identifying drivers for efficiency improvement turn out to be still key objectives.

Roberto Gmez-Calvet; David Conesa; Ana Rosa Gmez-Calvet; Emili Tortosa-Ausina

2014-01-01T23:59:59.000Z

444

CP ROAD MAP Mix Design & Analysis Track  

E-Print Network (OSTI)

& reinforcing steel. . . The "Resistance to severe weathering and sulfate waters is determined largely Beams: 764, 7-d ­ Avg. 601 psi 28-d ­ Avg. 734 psi #12;SAUDI ARABIA - 1970 · $660 million headquarters

445

A B S T R A C T OIIOof iiiosl cli;ill(wgiiig problems in the field of friinie-  

E-Print Network (OSTI)

. - Avg % error = 9.3 % 8 - f 6 - E- b:0 Calc Dy Disp. - Avg % error = 6.0 % m:o Calc 0 5 10 15 Bead No

Miga, Michael I.

446

The curse of dimension in nonparametric regression  

E-Print Network (OSTI)

to three dimensions. Rotating teapot: This consists ofimages of a rotating teapot, each 3050 pixels in size. ThusAvg of max diam square n Teapot dataset ? n : Avg of max

Kpotufe, Samory

2010-01-01T23:59:59.000Z

447

Seagate Crystal Reports - RADCM  

Office of Environmental Management (EM)

Sludges & Treatment Residues - 1 Sludges & Treatment Residues - 1 WASTE STREAM CODE: 01582 STREAM NAME:Sludges & Treatment Residues - 1 MPC NAME:Inorganic Sludges TOTAL CURIES: 26.000 Approved Volume : Future Volume Avg: Future Volume Lower Limit: Future Volume Upper Limit: 100.000 Sludges & Treatment Residues - 1 Isotopes Scandium-46 Avg Concentration: Low Limit Concent: Upper Limit Concent: Tin-113 Avg Concentration: Low Limit Concent: Upper Limit Concent: Strontium-85 Avg Concentration: Low Limit Concent: Upper Limit Concent: Tantalum-182 Avg Concentration: Low Limit Concent: Upper Limit Concent: Californium-250 Avg Concentration: Low Limit Concent: Upper Limit Concent: Lead-212 Avg Concentration: Low Limit Concent: Upper Limit Concent: Americium-244 Avg Concentration: Low Limit Concent: Upper Limit Concent:

448

Tetrahedron: Asymmetry report number 86 a-Vinylic amino acids: occurrence, asymmetric synthesis,  

E-Print Network (OSTI)

-Substituted . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 871 2.3. c-Substituted . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 871 2.3.1. MVG . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 871 2.3.2. AVG

Berkowitz, David

449

VVV SURVEY NEAR-INFRARED PHOTOMETRY OF KNOWN BULGE RR LYRAE STARS: THE DISTANCE TO THE GALACTIC CENTER AND ABSENCE OF A BARRED DISTRIBUTION OF THE METAL-POOR POPULATION  

SciTech Connect

We have combined optical and near-infrared data of known RR Lyrae (RRL) stars in the bulge in order to study the spatial distribution of its metal-poor component by measuring precise reddening values and distances of 7663 fundamental-mode RRL stars with high-quality photometry. We obtain a distance to the Galactic center of R {sub 0} = 8.33 0.05 0.14 kpc. We find that the spatial distribution of the RRL stars differs from the structures traced by the predominantly metal-rich red clump (RC) stars. Unlike the RC stars, the RRL stars do not trace a strong bar, but have a more spheroidal, centrally concentrated distribution, showing only a slight elongation in its very center. We find a hint of bimodality in the density distribution at high southern latitudes (b < 5), which needs to be confirmed by extending the areal coverage of the current census. The different spatial distributions of the metal-rich and metal-poor stellar populations suggest that the Milky Way has a composite bulge.

Dkny, I.; Minniti, D.; Catelan, M.; Zoccali, M.; Hempel, M. [Instituto de Astrofsica, Facultad de Fsica, Pontificia Universidad Catlica de Chile, Av. Vicua Mackenna 4860, 782-0436 Macul, Santiago (Chile)] [Instituto de Astrofsica, Facultad de Fsica, Pontificia Universidad Catlica de Chile, Av. Vicua Mackenna 4860, 782-0436 Macul, Santiago (Chile); Saito, R. K. [Departamento de Fsica, Universidade Federal de Sergipe, Av. Marechal Rondon s/n, 49100-000, So Cristvo, SE (Brazil)] [Departamento de Fsica, Universidade Federal de Sergipe, Av. Marechal Rondon s/n, 49100-000, So Cristvo, SE (Brazil); Gonzalez, O. A., E-mail: idekany@astro.puc.cl [European Southern Observatory, Alonso de Crdova 3170, Vitacura, Santiago (Chile)

2013-10-20T23:59:59.000Z

450

Photo Gallery - Hanford Site  

NLE Websites -- All DOE Office Websites (Extended Search)

Slips Get a Grip on Slips,Trips and Falls Get a Grip on Slips,Trips and Falls Extreme Slips Trips Extreme Slips Trips...

451

Trip Report: DOE ¬タモ DOD Case Study Forum, National Defense University  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Joint DOE-DOD Case Study Forum Joint DOE-DOD Case Study Forum National Defense University/Defense Acquisition University August 24, 2006 Submitted by: Mr. David W. Swindle, Jr. Background: Mr. David Swindle attended a Federal Acquisition Workshop held at the Defense Acquisition University (DAU) on May 22 - 25, 2006 as an observer. The workshop included courses on acquisition practices, policies, and experiences. Senior/Executive leaders from the Department of Energy's (DOE) Environmental Management Headquarters and field offices engaged with the disciplined training acquisition processes of the Department of Defense (DOD) in Program/Acquisition Management. The workshop is second in a series of three like sessions focused on advanced acquisition/project management training.

452

Join HERO for our Annual Ski Trip to Whitefish, Montana March...  

NLE Websites -- All DOE Office Websites (Extended Search)

boot room, heated locked ski storage, 50 yard walk to ski-out, microwave, small refrigerator, some rooms with kitchens, free wireless internet. Note: This hotel does NOT have...

453

Taking TRIPS to India Novartis, Patent Law, and Access to Medicines  

Science Journals Connector (OSTI)

...health safeguards developed by the Indian government. For example, the government has imposed price controls on essential medicines since 1970, and recent reports suggest that it may be expanding the list of drugs that are subject to such controls. More to the point, a number of safeguards have been built... Many have protested Novartis' efforts to obtain an Indian patent on Gleevec. Janice Mueller writes that the Gleevec challenge is the latest controversy facing India since its implementation of substantially enhanced patent protection for pharmaceuticals. ...

Mueller J.M.

2007-02-08T23:59:59.000Z

454

Field Trip: Hydrographic in-situ measurements, water and plankton Introduction  

E-Print Network (OSTI)

Field studies are an important and integral part of any course in marine biology and oceanography. Field: · All students aboard have to wear life preservers all the time. · Wear solid shoes with rubber sole

Jochem, Frank J.

455

NHMRC Alert 3-Project Grants, Career Development Fellowships and Translating Research into Practice (TRIP) Fellowships  

E-Print Network (OSTI)

: Removal of CIA Greatest Time Commitment b) Clarification of Percentage NHMRC Research Time c) Cure Cancer Update: Removal of CIA Greatest Time Commitment The NHMRC has advised that the requirement for Chief Teams). CIA must still demonstrate leadership over the project conduct and their role in driving

New South Wales, University of

456

Field trip to WTE facility Floetzersteig/Fernwaerme Wien GmbH  

E-Print Network (OSTI)

to provide gas control that complied with new environmental legislation. A three-stage gas cleaning system to 5 tons of waste). Every truck is weighted and unloads the waste at one of the six tipping stations the bunker to the combustion chambers Figure 4: Unloading the trucks at the tipping stations #12;- 4 - Figure

Columbia University

457

Trip Report: AMPS Validations and User Feedback Conducted at McMurdo and South Pole  

E-Print Network (OSTI)

in stronger weather conditions, be it winds or precipitation which do not always validate. Ken Edele did note, interacting with the forecasters and conducting some real-time validations of the AMPS products, particularly moisture prediction, to validate the new pseudo-satellite product generated here at Ohio State, to better

Howat, Ian M.

458

A simulation study of a Subsea Mudlift Drilling system during tripping operations  

E-Print Network (OSTI)

To face the new challenges that the petroleum industry has in deepwaters, a Subsea Mudlift Drilling Joint Industry Project, SMDJIP, was formed. The main task for this project is to develop the technology needed to drill in water depths beyond 7500...

Escobar Parada, Alvaro Hernando

1999-01-01T23:59:59.000Z

459

Ice Climbing in Clear Creek Canyon A climbing trip report by Glenn Murray  

E-Print Network (OSTI)

metal thingies?' Sean pulls on his boots. He has great boots, massive leather Kastingers with wooden

460

(Power sector integrated efficiency program): Foreign trip report, August 1--11, 1989  

SciTech Connect

I traveled to Guatemala City to discuss host country and US Agency for International Development (USAID) Mission interest in an AID/Washington sponsored integrated utility efficiency initiative and to participate in a cogeneration conference. Discussions were held with USAID/Regional Office for Central America Panama (ROCAP), USAID/Guatemala City, the Ministry of Energy and Mines (MEM), the Empresa Electrica de Guatemala, and several members of the private sector regarding interest and the appropriateness of the proposed efficiency initiative. I then traveled to San Jose, Costa Rica to participate in a small scale hydro assessment study with a National Rural Electric Cooperative Association (NRECA) engineer for a newly formed generation and transmission consortium. Data were gathered both on member cooperative annual, seasonal and diurnal energy demand, as well as engineering data for the site analyses. Meetings were held with the cooperative members; USAID/San Jose; and the Ministry of Natural Resources, Energy and Mines to inform them of our progress.

Waddle, D.B.

1989-08-18T23:59:59.000Z

Note: This page contains sample records for the topic "avg trip distance" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


461

Design of Total Runoff Integrating Pathways (TRIP)A Global River Channel Network  

Science Journals Connector (OSTI)

As a first step toward designing a comprehensive model for validating land surface hydrology and river flow in Earth system models, a global river channel network has been prepared at 1 latitude 1 longitude resolution. The end product is the ...

Taikan Oki; Y. C. Sud

1998-01-01T23:59:59.000Z

462

Field Trip Opportunities Saturday, March 29, 2014 Wildside Tours (Tour limited to 16 people)  

E-Print Network (OSTI)

. The quiet motor catamaran with comfortable wrap around seating will allow passengers to move around, sunglasses, sunscreen, camera Food Provided: Lunch and bottled water; soft drinks and water available on

Jawitz, James W.

463

TRIP REPORT Listening Tour #2 for M.D. Curriculum Transformation Meeting Notes  

E-Print Network (OSTI)

physicians in the future? Learn about future workforce needs, views on health care reform and evolving and education leaders; health advocates; tribal clinic leaders; All Care Oregon leaders; editorial board), and a new focus on longitudinal aspects of health care, such as palliative care and chronic diseases

Chapman, Michael S.

464

Fact #616: March 29, 2010 Household Vehicle-Miles of Travel by Trip Purpose  

Energy.gov (U.S. Department of Energy (DOE))

In 2009, getting to and from work accounted for about 27% of household vehicle-miles of travel (VMT). Work-related business was 8.4% of VMT in 2001, but declined to 6.7% in 2009, possibly due to...

465

Trip report, Interagency Manufacturing Operations Group (IMOG) Steering Committee meeting, November 29, 1989  

SciTech Connect

As the Subgroup Chairman for the Process Automation Control Technology Subgroup of IMOG, I was requested to attend the annual Steering Committee Meeting held this year at the Allied-Signal Kansas City Plant and summarize the past year's activities of the Subgroup. The next IMOG Steering Committee Meeting will be held November 14 and 15, 1990 in Los Alamos. The next Process Automation Control Technology Subgroup Meeting will be held in June, 1990 in Rocky Flats.

Butterworth, R.R.

1989-12-06T23:59:59.000Z

466

NYSGA 2010 Trip 4 -Olsen Fossil Great Lakes of the Newark Supergroup  

E-Print Network (OSTI)

of the dinosaurs, the rifting process, carbon sequestration, and chaos in the Solar System. INTRODUCTION: THE TRIASSIC-JURASSIC GREAT LAKES OF CENTRAL PANGEA This guidebook focuses of the deposits, fossils dimension comparable to the scale of the American Great Lakes or the East African Great Lakes and perhaps

Olsen, Paul E.

467

Seagate Crystal Reports - RADCM  

Office of Environmental Management (EM)

Sludge, Salt, Liquid Sludge, Salt, Liquid WASTE STREAM CODE: 02113 STREAM NAME:Sludge, Salt, Liquid MPC NAME:Aqueous Liquids/Slurries TOTAL CURIES: Approved Volume : Future Volume Avg: Future Volume Lower Limit: Future Volume Upper Limit: 100.000 Sludge, Salt, Liquid Isotopes Americium-241 Avg Concentration: 3.4967E-001 Ci/m3 Low Limit Concent: Upper Limit Concent: Cadmium-113m Avg Concentration: 8.4542E-002 Ci/m3 Low Limit Concent: Upper Limit Concent: Niobium-93m Avg Concentration: 1.8159E-002 Ci/m3 Low Limit Concent: Upper Limit Concent: Protactinium-231 Avg Concentration: 7.8039E-004 Ci/m3 Low Limit Concent: Upper Limit Concent: Europium-152 Avg Concentration: 7.4037E-003 Ci/m3 Low Limit Concent: Upper Limit Concent: Plutonium-240 Avg Concentration: 4.4672E-002 Ci/m3 Low Limit Concent: Upper Limit Concent:

468

Report Notes  

NLE Websites -- All DOE Office Websites (Extended Search)

Notes Notes 1 "Overall AC electrical energy consumption (AC Wh/mi)" is based on AC electricity consumed during charging events which began during the reporting period and distance driven during all trips in the reporting period. 2 "Overall DC electrical energy consumption (DC Wh/mi)" is based on net DC electricity discharged from or charged to the plug-in battery pack and distance driven during all trips in the reporting period. DC Wh/mi may not be comparable to AC Wh/mi if AC electricity charged prior to the reporting period was discharged during driving within the reporting period, or if AC electricity charged during the reporting period was not discharged during driving within the reporting period. 3 Trips when the plug-in battery pack charge was depleted to propel the vehicle throughout

469

Spectrophotometric distances to Galactic H II regions  

Science Journals Connector (OSTI)

......responsible for a large amount of the momentum and kinetic energy input into the interstellar gas. Thus, the formation of these...phases of their the life. Such objects are stars in which nuclear fusion has most likely started in the core. However, they have......

A. P. Moiss; A. Damineli; E. Figuerdo; R. D. Blum; P. S. Conti; C. L. Barbosa

2011-02-21T23:59:59.000Z

470

Topology Planning for Long Distance Wireless Mesh  

E-Print Network (OSTI)

: ­ Provide 100% connectivity to rural India, as 74% Indian population rural. What Technology to use ? #12 Nov ` 02 0.9 Km 37 Km MS3 Jun ` 02 Not to scale 39 Km Land-line access point (close to high-population density area) 802.11 for last-hop access within a village Point-to- Point 802.11 link 12 Km Banthar Jun

Liblit, Ben

471

A Proximal Point Algorithm with Bregman Distances  

E-Print Network (OSTI)

path of local decisions and actions anchored to the current state, via inertia aspects,. i.e. costs to move ... while the previous models do not. What is original in ... is the decision space of states which can be alternatives, performances, actions,.

2007-04-18T23:59:59.000Z

472

Saturn's Largest Moon Distance to Saturn  

E-Print Network (OSTI)

: Three radioisotope thermoelectric generators (RTGs) · Optical Remote-Sensing Instruments: Will determine

Waliser, Duane E.

473

Case study: copyright issues in distance education  

E-Print Network (OSTI)

?...????????.. 165 APPENDIX E: THE UNIVERSITY OF TEXAS SYSTEM POLICY ??...?. 179 APPENDIX F: MASSACHUSETTS INSTITUTE OF TECHNOLOGY POLICY 186 APPENDIX G: STANFORD UNIVERSITY POLICY ?..????????. 191 APPENDIX H: UNIVERSITY OF ARIZONA POLICY...

Huddleston, Michael B

2006-10-30T23:59:59.000Z

474

2, 18931923, 2005 Distance in spatial  

E-Print Network (OSTI)

maps with daily or better resolution are necessary for investigation of the climatology of extreme as possible (e.g. in climatology). The back-bone of these maps are rain gauge data since the reliability monitoring product of the Global Precipitation Climatology Centre (http://gpcc.dwd.de) is based on about 6000

Paris-Sud XI, Université de

475

Testing the Newton law at long distances  

E-Print Network (OSTI)

Experimental tests of Newton law put stringent constraints on potential deviations from standard theory with ranges from the millimeter to the size of planetary orbits. Windows however remain open for short range deviations, below the millimeter, as well as long range ones, of the order of or larger than the size of the solar system. We discuss here the relation between long range tests of the Newton law and the anomaly recorded on Pioneer 10/11 probes.

Serge Reynaud; Marc-Thierry Jaekel

2005-01-12T23:59:59.000Z

476

The Library for Distance Learners: Engineering  

E-Print Network (OSTI)

books, journals and databases are accessible via the Library website, on or off campus, using your Bath.bath.ac.uk/library/help/infoguides/catalogue.html Books & e-Books To find books, use the catalogue to search for keywords and/or author names Library borrower number. Dissertations M.Sc. dissertations submitted to the Library over the past five

Rzepa, Henry S.

477

Ultrasonic distance scanning techniques for mobile robots  

Science Journals Connector (OSTI)

This paper discusses the application of ultrasound to mobile robot navigation. Two methods employing transducer arrays are described, namely the phased array (PA) method and the maximum-likelihood-estimation (MLE) method. These two methods are compared with the conventional time-of-flight (ToF) method. The paper shows that the PA method has advantages such as giving focused beams and allowing efficient beam steering. Limitations of the method are also discussed, including the need to assume a far-field, the undesired side grating lobes and the unavailability of suitably-sized transmitters. In order to understand the measurement uncertainty, a quantified estimation of the effective range and bearing measurement is calculated. The MLE method has the advantage of only involving one transmitter. The locations of the reflectors employed with this method can be represented in a probability map. Experimental results show that the reliability can be improved through the use of multiple receivers.

D.T. Pham; Z. Ji; A. Soroka

2009-01-01T23:59:59.000Z

478

Discretization vertex orders in distance geometry  

E-Print Network (OSTI)

Aug 28, 2014 ... or physical reasons, or because they were estimated using Nuclear ..... The TOP, CTOP and ReOP are trivially in NP, since testing whether a...

2014-08-28T23:59:59.000Z

479

Mathematics Competition  

E-Print Network (OSTI)

km (since BC > 0). Piravena travels a distance of 3250 + 1250 + 3000 = 7500 km for her complete trip. To fly from C to A, the cost is 3000 ? 0.10 + 100 = $400. To bus from C to A, the cost is 3000 ? 0 the notation | XY Z| to represent the area of triangle XY Z. Then, | APE| = | ABE| - | ABP|. Since ABE

Le Roy, Robert J.

480

Measuring prehistoric mobility strategies based on obsidian geochemical and technological signatures in the Owens Valley, California  

E-Print Network (OSTI)

signatures in the Owens Valley, California Jelmer W. Eerkens a,*, Amy M. Spurling a,c , Michelle A. Gras b, a village site in southern Owens Valley, eastern California. Previous archaeological studies suggest quarrying within long-distance trips to distant hunting grounds, and subsequently transported bifacial cores

Note: This page contains sample records for the topic "avg trip distance" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


481

Response of laser-localized structures to external perturbations in coupled semiconductor microcavities  

Science Journals Connector (OSTI)

...in which LSs are bistable in search of excitable LSs [29] which...by the BS and that did not enter the system. After one round-trip...increases with the distance, in terms of parameters, from the spontaneous...interpretation of the results in terms of excitable LSs. 5. Conclusion...

2014-01-01T23:59:59.000Z

482

Seagate Crystal Reports - RADCM  

Office of Environmental Management (EM)

Mexico Mexico SITE: LosAlamos PROGRAM: DP WASTE TYPE: Low Level Waste OPERATIONS OFFICE: Albuquerque Operations Office % of Stream LosAlamos - Low Level Waste - LLW-PCB WASTE STREAM CODE: 02015 STREAM NAME:LLW-PCB MPC NAME:Soil/Debris TOTAL CURIES: Approved Volume : Future Volume Avg: Future Volume Lower Limit: Future Volume Upper Limit: 100.000 LLW -PCB Isotopes Plutonium-239 Avg Concentration: Low Limit Concent: Upper Limit Concent:1.0000E+002 nCi/g Americium-241 Avg Concentration: Low Limit Concent: Upper Limit Concent:1.0000E+002 nCi/g Cesium-137 Avg Concentration: Low Limit Concent: Upper Limit Concent:8.6400E+002 nCi/g Uranium-238 Avg Concentration: Low Limit Concent: Upper Limit Concent:4.8900E+002 nCi/g Plutonium-238 Avg Concentration: Low Limit Concent: Upper Limit Concent:1.0000E+002 nCi/g

483

Seagate Crystal Reports - RADCM  

Office of Environmental Management (EM)

South Carolina South Carolina SITE: Savannah PROGRAM: DP WASTE TYPE: Low Level Waste OPERATIONS OFFICE: Savannah River Operations Office % of Stream Savannah - Low Level Waste - Intermediate Level Waste WASTE STREAM CODE: 00539 STREAM NAME:Intermediate Level Waste MPC NAME:Solids TOTAL CURIES: Approved Volume : Future Volume Avg: Future Volume Lower Limit: Future Volume Upper Limit: 100.000 Intermediate Level W aste Isotopes Nickel-59 Avg Concentration: Low Limit Concent: Upper Limit Concent:8.3000E-002 Ci/ft3 Uranium-234 Avg Concentration: Low Limit Concent: Upper Limit Concent:4.7000E-004 Ci/ft3 Carbon-14 Avg Concentration: Low Limit Concent: Upper Limit Concent:4.7000E-004 Ci/ft3 Hydrogen-3 Avg Concentration: Low Limit Concent: Upper Limit Concent:3.0000E+001 Ci/ft3 Technetium-99 Avg Concentration: Low Limit Concent:

484

Seagate Crystal Reports - RADCM  

Office of Environmental Management (EM)

Colorado Colorado SITE: GrJuncOff PROGRAM: EM WASTE TYPE: 11e(2) Byproduct Waste OPERATIONS OFFICE: Idaho Operations Office % of Stream GrJuncOff - 11e(2) Byproduct Waste - RRM Contaminated Soil WASTE STREAM CODE: 01091 STREAM NAME:RRM Contaminated Soil MPC NAME:Soil TOTAL CURIES: Approved Volume : 30.000 Future Volume Avg: 0.000 Future Volume Lower Limit: Future Volume Upper Limit: 100.000 RRM Contaminated Soil Isotopes Radium-226 Avg Concentration: Low Limit Concent: Upper Limit Concent: Uranium-234 Avg Concentration: Low Limit Concent: Upper Limit Concent: Uranium-238 Avg Concentration: Low Limit Concent: Upper Limit Concent: Thorium-230 Avg Concentration: Low Limit Concent: Upper Limit Concent: Uranium-235 Avg Concentration: Low Limit Concent: Upper Limit Concent: % of Stream GrJuncOff - 11e(2) Byproduct Waste - RRM Contaminated Rubble/Debris

485

Seagate Crystal Reports - RADCM  

Office of Environmental Management (EM)

Cs/Sr Capsules Cs/Sr Capsules WASTE STREAM CODE: 02115 STREAM NAME:Cs/Sr Capsules MPC NAME:Salt Waste TOTAL CURIES: Approved Volume : Future Volume Avg: Future Volume Lower Limit: Future Volume Upper Limit: 100.000 Cs/Sr Capsules Isotopes Barium-137m Avg Concentration: 2.5941E+007 Ci/m3 Low Limit Concent: Upper Limit Concent: Cesium-137 Avg Concentration: 2.7391E+007 Ci/m3 Low Limit Concent: Upper Limit Concent: Yttrium-90 Avg Concentration: 1.1840E+007 Ci/m3 Low Limit Concent: Upper Limit Concent: Strontium-90 Avg Concentration: 1.1840E+007 Ci/m3 Low Limit Concent: Upper Limit Concent: % of Stream Hanford - High Level Waste - HLW to Treatment WASTE STREAM CODE: 03857 STREAM NAME:HLW to Treatment MPC NAME:Aqueous Liquids/Slurries TOTAL CURIES: Approved Volume : Future Volume Avg: Future Volume Lower Limit:

486

Algorithms for processing ultrasonic echo data for height control systems  

E-Print Network (OSTI)

estimation was affected by the value of the weighting factor (M) in equation (1). The accuracy of this stubble height estimation was evaluated by using the Student's t test technique. ESTH(n) = AVS(n) ? AVG(n) (3) Computer program: A FORTRAN program... YES IS HTs'P READ AVS & AVG, STALK AND GROUND AVERAGES r---- RAISE BLADES t, READ THD OR THH & THL, SINGLE THRESHOLD OR GET NEW SAMPLE ECHO ECHO DISCRIMINATION GROUND STALK OR GROUND ? STALK AVS ~AVS + Y(I)-AVS n n-I AVG =AVG Y...

Lin, Reng Rong

2012-06-07T23:59:59.000Z

487

1  

NLE Websites -- All DOE Office Websites (Extended Search)

Instrument Measurement Manufacturer Sampling Rate (interval) Accuracy HeightRange Thermometer Temperature Vaisala 1 min. avgs. (1 sec) 0.41C 2 m RH Sensor Relative humidity...

488

Single-trip tubing-conveyed perforating, production testing, and pressure-buildup testing in nonflowing wells  

SciTech Connect

This paper describes tools and procedures for tubing-conveyed perforating (TCP) and subsequent production testing of a well with a reverse-flow jet pump with a specially designed blanking sleeve. A downhole shut-in pressure buildup is also obtained and all equipment is pressure-actuated, eliminating the use of wireline.

Barnes, J.A.; Snider, P.M. (Marathon Oil Co. (US)); Swafford, C.V. (BST Lift Systems (US))

1991-05-01T23:59:59.000Z

489

Headless and Homeless: Zen Non-Thinking Awareness in American Countercultural Trip Narratives Post-WWI to the Vietnam War  

E-Print Network (OSTI)

May 2013. Wallace, David Foster. Good Old Neon. Oblivion.this ignorance. David Foster Wallaces short story Good Old

Bond, Matthew James

2014-01-01T23:59:59.000Z

490

California State University,Desert Studies Consortium and LSA Associates,Inc. Making tracks--the field trip guide  

E-Print Network (OSTI)

will see: The day 1 route takes us north through the Soda Valley into southern Death Valley and ends in the valley of the Amargosa River. We pass Soda, Silver, Silurian and Dumont dry lakes that have been Mountains and the Silurian Hills to the east and west of Highway 127 contain Miocene sedi- ments that filled

de Lijser, Peter

491

Field Trip Opportunities Saturday, March 29, 2014 Ritch Grissom Memorial Wetlands at Viera (Tour limited to 15 people)  

E-Print Network (OSTI)

, reflecting diverse wetland conditions. The wetlands are an integral component of Brevard County's water reuse of approximately 35 acres each, plus a central lake. The cells were designed to maintain differing depths of water system. Providing increased water quality and savings over traditional water treatment methods

Jawitz, James W.

492

COLI 580A /480X (TRIP 580A/460, LING 449A, PIC 612E) INTRODUCTION TO TRANSLATION STUDIES  

E-Print Network (OSTI)

, we will be examining, for instance, some of the consequences of the relationships that have been.mit.edu/Plato/republic.html.) - F. Nietzsche: "On Truth and Lies in a Nonmoral Sense," D. Breazeale, ed., Philosophy and Truth

Suzuki, Masatsugu

493

Global Evaluation of the ISBA-TRIP Continental Hydrological System. Part I: Comparison to GRACE Terrestrial Water Storage Estimates  

E-Print Network (OSTI)

In earth system models, the partitioning of precipitation among the variations of continental water storage climate system sim- ulated by earth system models (ESMs). The continental freshwater reservoirs represent

Ribes, Aurélien

494

Global Evaluation of the ISBA-TRIP Continental Hydrological System. Part II: Uncertainties in River Routing Simulation Related to Flow  

E-Print Network (OSTI)

the entire globe. RRMs have been introduced into earth system models (ESMs) to convert the runoff simulated

Boyer, Edmond

495

(Perform quantum chemistry calculations on element 104 using existing computer programs): Foreign trip report, June 1, 1988--May 10, 1989  

SciTech Connect

Electron ionization energies and parameters for the atomic radii of elements 104 and 105 are discussed. Values for these properties have not been proposed before. The results are expected to provide part of the basis for the calculation of certain chemical properties of elements 104 and 105. Chemical properties of elements 104 and 105 are difficult to determine experimentally because of the short half-lives and low production rates of these elements. A fully numerical method for the solution of the Schrodinger equation of quantum mechanics is discussed. Fully numerical methods are capable of yielding more accurate results than the method that was used to obtain the ionization energies mentioned above. Compared to other fully numerical methods, the method discussed here requires less computation time and it does not have the mathematical singularities that occur in other such methods. Energy research and development projects at the Gesamthochschule Kassel, Federal Republic of Germany are summarized. These projects involve consultation, wind and solar energy production, storage and distribution, hydroelectricity production, the production of biogas, the design of fuel cells, technology transfer, and the political aspects of energy production and distribution. 12 refs.

Johnson, E.

1989-05-26T23:59:59.000Z

496

(Fluidized bed combustion of high-ash Indian coals): Foreign trip report, January 5, 1988--March 16, 1988  

SciTech Connect

The foreign research assignment at BHEL, Trichy, was undertaken to participate in the ongoing USAID/BHEL joint program in fluidized bed combustion (FBC). As part of this program, an experimental FBC research test facility has been designed, erected and commissioned at BHEL, Trichy, to conduct experiments on the combustion of high-ash Indian coals and coal washery rejects. The data will be used to optimize the design and to select the operational parameters for large scale industrial and utility FBC boilers. ORNL has been providing technical assistance to BHEL since the initiation of the project in November 1983. The US team visited at 10 MW(e) FBC boiler fired with coal washery rejects at the Tata Iron and Steel Company (supplied by BHEL). The tour was very informative and gave the US team a good first-hand perspective of the Indian experience and concerns with FBC technology.

Krishnan, R.P.; Daw, C.S.

1988-03-01T23:59:59.000Z

497

Field Trip Guide to Serpentinite, Silica-Carbonate Alteration, and Related Hydrothermal Activity in the Clear Lake Region, California  

SciTech Connect

This guide is designed to familiarize scientists with the geology, structure, alteration, and fluids typical of California serpentinites for purposes of carbon dioxide sequestration (Lackner et al., 1995). Goff et al. (1997) and Goff and Lackner (1998) describe the geology and geochemistry of some of the serpentinites from this area. Mechanisms of silica-carbonate alteration were outlined by Barnes et al. (1973). Donnelly-Nolan et al. (1993) most recently reviewed relations between regional hydrothermal alteration and Quarternary volcanic activity. Stanley et al. (1998) summarized geophysical characteristics of the region.

Fraser Goff; George Guthrie

1999-06-01T23:59:59.000Z

498

Protection and communication for a 230 kV transmission line using a pilot overreaching transfer tripping (POTT) scheme.  

E-Print Network (OSTI)

??New applications are continuously emerging in the ever-changing field of power systems in the United States and throughout the world, consequently causing new pressures on (more)

Escalante De Leon, Lazaro Samuel

2013-01-01T23:59:59.000Z

499

Code of Practice for Safety in Fieldwork and Off-Campus Trips for Undergraduates and Masters Students, Department of Anthropology,  

E-Print Network (OSTI)

are posted e.g. in quarries you may need to wear goggles to keep grit from your eyes or to wear helmets where

Sussex, University of

500

"Price Hub","Trade Date","Delivery Start Date","Delivery End Date","High Price $/MWh","Low Price $/MWh","Wtd Avg Price $/MWh","Daily Volume MWh","Number of Trades","Number of Companies"  

U.S. Energy Information Administration (EIA) Indexed Site

6893,36894,36894,83,83,83,800,1,2 6893,36894,36894,83,83,83,800,1,2 "Entergy",36894,36895,36895,93,93,93,800,1,2 "Entergy",36895,36896,36896,83,78.5,80.83,7200,9,4 "Entergy",36896,36899,36899,78,67,74.25,3200,4,5 "Entergy",36899,36900,36900,57,54,55.5,1600,2,4 "Entergy",36900,36901,36901,53,53,53,1600,1,2 "Entergy",36902,36903,36903,67.5,65,66.5,4000,5,3 "Entergy",36903,36906,36906,52.5,48,50.25,1600,2,3 "Entergy",36907,36908,36908,52,45,48.86,8800,11,4 "Entergy",36908,36909,36909,56,51,51.95,16800,21,6 "Entergy",36909,36910,36910,50,48.5,49.33,24000,30,7 "Entergy",36910,36913,36913,56.5,54,55.25,11200,13,7 "Entergy",36913,36914,36914,63,57,58.38,6400,8,3 "Entergy",36914,36915,36915,61.5,42,55.75,15200,19,9