National Library of Energy BETA

Sample records for avenue place seattle

  1. Seattle Biodiesel aka Seattle BioFuels | Open Energy Information

    Open Energy Info (EERE)

    Seattle Biodiesel aka Seattle BioFuels Jump to: navigation, search Name: Seattle Biodiesel (aka Seattle BioFuels) Place: Seattle, Washington Sector: Renewable Energy Product:...

  2. City of Seattle, Washington (Utility Company) | Open Energy Informatio...

    Open Energy Info (EERE)

    Light) Jump to: navigation, search Name: Seattle City of Place: Washington Phone Number: (206) 684-3000 Website: www.seattle.govlight Twitter: @SEACityLight Facebook: https:...

  3. 1000 Independence Avenue, SW

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    office of small & disadvantaged business utilization 1000 Independence Avenue, SW ... and Disposal office of small & disadvantaged business utilization what does doe purchase? ...

  4. HERO Seattle Mariners

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    HERO Seattle Mariners vs. St. Louis Cardinals Sunday, June 26, 2016 1:10 pm game time $65/person Payments over $250 must be cashier's check or cash $65/person includes bus ride, game ticket, snacks on the bus and pizza on the way home! Send payment to Linda Meigs (376-5785) @ A3-01 Enjoy Sunday afternoon at Safeco Field, cheering on your favorite team!

  5. Seattle Data Dashboard | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Data Dashboard Seattle Data Dashboard The data dashboard for Seattle, Washington, a partner in the Better Buildings Neighborhood Program. File Seattle Data Dashboard More Documents & Publications Cincinnati Data Dashboard Austin Energy Data Dashboard Massachusetts -- SEP Data Dashboard

  6. PowerAvenue GmbH | Open Energy Information

    Open Energy Info (EERE)

    search Name: PowerAvenue GmbH Place: Schwabach, Germany Zip: 91126 Sector: Hydro, Hydrogen Product: Distributor of fuel cell and hydrogen education systems. Coordinates:...

  7. 1000 Independence Avenue, SW

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    office of small & disadvantaged business utilization 1000 Independence Avenue, SW Washington, DC 20585 202.586.7377 www.smallbusiness.energy.gov the department purchases a wide variety of goods and services, including, but not limited to: 202.586.7377 www.smallbusiness.energy.gov DOE/SB-0002 * Remediation * Facility Management * Construction * R&D * Management/Scientific Consultation and Analysis * Administrative Services * IT and Data Processing * Security * Engineering * Waste

  8. 9800 South Cass Avenue

    Office of Legacy Management (LM)

    Chicago Operations Office- 9800 South Cass Avenue Argonne, Illinois 60139 JAN 18 1979 William E. Mott, Acting Director, Division of Environmental Control Technology, HQ SMALL ANIMAL FACILITY, UNIVERSITY OF CHICAGO - FORMERLY UTILIZED MED/AEC SITES REMEDIAL ACTION PROGRAM (FLISRAP) Enclosed you will find a report detailing the findings of a search as part of the FUSRAP to locate the subject facility. As detailed in the report four areas of the University were reviewed as possible areas within the

  9. DOE Zero Energy Ready Home: Montlake Modern - Seattle, Washington...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Montlake Modern - Seattle, Washington DOE Zero Energy Ready Home: Montlake Modern - Seattle, Washington Case study of a DOE Zero Energy Ready Home in Seattle, WA, that scored HERS ...

  10. Category:Seattle, WA | Open Energy Information

    Open Energy Info (EERE)

    Seattle, WA Jump to: navigation, search Go Back to PV Economics By Location Media in category "Seattle, WA" The following 16 files are in this category, out of 16 total....

  11. Seattle, Washington: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    Institutions in Seattle, Washington ARCH Venture Partners (Washington) Northwest National Marine Renewable Energy Center Washington Technology Center Registered Networking...

  12. Solar Works in Seattle: Domestic Hot Water

    Broader source: Energy.gov [DOE]

    Seattle's residential solar hot water workshop. Content also covers general solar resource assessment, siting, and financial incentives.

  13. Indian Community Development Block Grant Program Workshop - Seattle...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Indian Community Development Block Grant Program Workshop - Seattle Indian Community Development Block Grant Program Workshop - Seattle May 18, 2016 9:00AM to 3:00PM PDT Seattle, ...

  14. SEATTLE HELPS COMMUNITIES POWER BUILDINGS EFFICIENTLY

    Broader source: Energy.gov [DOE]

    Seattle, Washington, is a diverse, environmentally aware city with a variety of languages, cultures, and income levels. Leveraging relationships with public, private, and nonprofit partners, the...

  15. Seattle, Washington: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    Network Puget Sound Clean Air Agency Puget Sound Clean Cities Coalition Washington Clean Technology Alliance Registered Policy Organizations in Seattle, Washington Northwest SEED...

  16. Alternative Fuels Data Center: Seattle's Waste Haulers are Going Green

    Alternative Fuels and Advanced Vehicles Data Center [Office of Energy Efficiency and Renewable Energy (EERE)]

    Seattle's Waste Haulers are Going Green to someone by E-mail Share Alternative Fuels Data Center: Seattle's Waste Haulers are Going Green on Facebook Tweet about Alternative Fuels Data Center: Seattle's Waste Haulers are Going Green on Twitter Bookmark Alternative Fuels Data Center: Seattle's Waste Haulers are Going Green on Google Bookmark Alternative Fuels Data Center: Seattle's Waste Haulers are Going Green on Delicious Rank Alternative Fuels Data Center: Seattle's Waste Haulers are Going

  17. Seattle, Washington: Solar in Action (Brochure), Solar America...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Seattle, Washington Includes case studies on: * "Solar Works in Seattle" Workshops * Interconnection Training for Utility Staff * "Community Solar" Financing Program Implementation ...

  18. Seattle, Washington: Solar in Action (Brochure), Solar America...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Seattle, Washington: Solar in Action (Brochure), Solar America Cities, Energy Efficiency & Renewable Energy (EERE) Seattle, Washington: Solar in Action (Brochure), Solar America ...

  19. Spotlight on Seattle, Washington: Community Partnerships Work to Extend

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Program Reach | Department of Energy Seattle, Washington: Community Partnerships Work to Extend Program Reach Spotlight on Seattle, Washington: Community Partnerships Work to Extend Program Reach Spotlight on Seattle, Washington: Community Partnerships Work to Extend Program Reach, as posted on the U.S. Department of Energy's Better Buildings Neighborhood Program website. PDF icon Spotlight on Seattle, Washington More Documents & Publications Seattle Summary of Reported Data Better

  20. Alternative Fuels Data Center: Seattle Bakery Delivers With Biodiesel

    Alternative Fuels and Advanced Vehicles Data Center [Office of Energy Efficiency and Renewable Energy (EERE)]

    Trucks Seattle Bakery Delivers With Biodiesel Trucks to someone by E-mail Share Alternative Fuels Data Center: Seattle Bakery Delivers With Biodiesel Trucks on Facebook Tweet about Alternative Fuels Data Center: Seattle Bakery Delivers With Biodiesel Trucks on Twitter Bookmark Alternative Fuels Data Center: Seattle Bakery Delivers With Biodiesel Trucks on Google Bookmark Alternative Fuels Data Center: Seattle Bakery Delivers With Biodiesel Trucks on Delicious Rank Alternative Fuels Data

  1. Alternative Fuels Data Center: Seattle Rideshare Fleet Adds EVs, Enjoys

    Alternative Fuels and Advanced Vehicles Data Center [Office of Energy Efficiency and Renewable Energy (EERE)]

    Success Seattle Rideshare Fleet Adds EVs, Enjoys Success to someone by E-mail Share Alternative Fuels Data Center: Seattle Rideshare Fleet Adds EVs, Enjoys Success on Facebook Tweet about Alternative Fuels Data Center: Seattle Rideshare Fleet Adds EVs, Enjoys Success on Twitter Bookmark Alternative Fuels Data Center: Seattle Rideshare Fleet Adds EVs, Enjoys Success on Google Bookmark Alternative Fuels Data Center: Seattle Rideshare Fleet Adds EVs, Enjoys Success on Delicious Rank Alternative

  2. Community Solar Public Opinion Research Results (Seattle)

    Broader source: Energy.gov [DOE]

    500 Seattle City Light customers were polled to determine interest in a community solar program, how people would participate and at what price levels. This is a presentation of the results.

  3. Seattle City Light- Vending Machine Rebate Program

    Broader source: Energy.gov [DOE]

    Seattle City Light offers qualifying customers $80 rebates for the purchase of VendingMiser Energy Efficient Vending Machines. VendingMiser reduces the energy consumption of cold drink vending...

  4. Seattle City Light- New Construction Incentive Program

    Broader source: Energy.gov [DOE]

    Seattle City Light (SCL) works with the design teams of their commercial and industrial customers to create high performance buildings with low long-term operating costs. The utility provides...

  5. EA-1741: Seattle Steam Company Combined Heat and Power at Post Street in Downtown Seattle, Washington

    Broader source: Energy.gov [DOE]

    This EA evaluates the environmental impacts of a proposal to provide an American Recovery Act and Reinvestment Act of 2009 financial assistance grant to Seattle Steam Company to facilitate the installation of a combined heat and power plant in downtown Seattle, Washington. NOTE: This Project has been cancelled.

  6. Climate Action Champions: Seattle, WA | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Seattle, WA Climate Action Champions: Seattle, WA The City of Seattle has long been at the leading edge of environmental innovation. Seattle has been recycling for over 25 years and today has one of the highest recycling and composting rates nationwide. In 2005, Seattle City Light became the first electric utility in the nation to be carbon neutral. Recently, Seattle was recognized as the “most sustainable city in the nation” by STAR communities with a 5-STAR rating and the highest

  7. Orchestrating Market Success: Seattle Market Introduction Workshop Video

    Broader source: Energy.gov [DOE]

    View the video from Jim Brodrick's opening presentation at the July 2011 DOE SSL Market Introduction Workshop in Seattle, Washington.

  8. Washington: Community Power Works is Building a More Efficient Seattle

    Office of Energy Efficiency and Renewable Energy (EERE)

    The City of Seattle and several community organizations are working to improve energy efficiency and reduce carbon emissions.

  9. Seattle Structure Named WAN Sustainable Building of 2013

    Broader source: Energy.gov [DOE]

    World Architecture News (WAN) recently named the Bullit Center in Seattle, Washington, as the WAN Sustainable Building of the Year.

  10. DOE Tour of Zero Floorplans: Bates Avenue by Sunroc Builders...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Bates Avenue by Sunroc Builders DOE Tour of Zero Floorplans: Bates Avenue by Sunroc Builders DOE Tour of Zero Floorplans: Bates Avenue by Sunroc Builders

  11. Seattle, Washington: Solar in Action (Brochure)

    SciTech Connect (OSTI)

    Not Available

    2011-10-01

    This brochure provides an overview of the challenges and successes of Seattle, WA, a 2008 Solar America City awardee, on the path toward becoming a solar-powered community. Accomplishments, case studies, key lessons learned, and local resource information are given.

  12. Chicago Office 9800 South Cass Avenue

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Office of Science Chicago Office 9800 South Cass Avenue Argonne, Illinois 60439 *tf N R OMNP MEMORANDUM FOR GREGORY H. WOODS GENERAL COUNSEL GC-1FORS FROM: SUBJECT: ROXANNE E. ...

  13. Seattle, Washington: Solar in Action (Brochure), Solar America Cities,

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Efficiency & Renewable Energy (EERE) | Department of Energy Seattle, Washington: Solar in Action (Brochure), Solar America Cities, Energy Efficiency & Renewable Energy (EERE) Seattle, Washington: Solar in Action (Brochure), Solar America Cities, Energy Efficiency & Renewable Energy (EERE) This brochure provides an overview of the challenges and successes of Seattle, WA, a 2008 Solar America City awardee, on the path toward becoming a solar-powered community.

  14. Text-Alternative Version: Seattle Market Introduction Workshop Video

    Broader source: Energy.gov [DOE]

    Following is a text version of Jim Brodrick's welcome presentation video from the July 2011 DOE SSL Market Introduction Workshop in Seattle, Washington.

  15. Seattle HomeWise: Weatherization | Department of Energy

    Broader source: Energy.gov (indexed) [DOE]

    Program Type Grant Program Rebate Amount Varies Summary The City of Seattle offers free weatherization services to residents who meet income qualifications. Services are...

  16. Seattle Summary of Reported Data | Department of Energy

    Energy Savers [EERE]

    Washington. PDF icon Seattle Summary of Reported Data More Documents & Publications Virginia -- SEP Summary of Reported Data NYSERDA Summary of Reported Data University Park...

  17. Seattle City Light- Commercial Energy Efficiency Rebate Programs

    Broader source: Energy.gov [DOE]

    Seattle City Light offers a variety of rebates to commercial and industrial customers through the Energy Smart Services Program. Energy Smart Services are available to commercial businesses,...

  18. Seattle City Light- Built Smart Program for Builders and Architects

    Broader source: Energy.gov [DOE]

    Seattle City Light provides incentives for builders, developers, and architects who construct energy efficient multi-family buildings. The program is designed to encourage the construction of...

  19. Seattle City Light- Residential Energy Efficiency Rebate Program

    Broader source: Energy.gov [DOE]

    Seattle City Light provides rebates to its customers for energy audits and purchasing and installing energy saving clothes washers, refrigerators, heat pump water heaters, ductless heat pumps,...

  20. Karen Avenue Wind Farm II (San Gorgonio Farms) | Open Energy...

    Open Energy Info (EERE)

    Farm II (San Gorgonio Farms) Jump to: navigation, search Name Karen Avenue Wind Farm II (San Gorgonio Farms) Facility Karen Avenue Windfarm II (San Gorgonio Farms) Sector Wind...

  1. Lincoln Avenue Spa Pool & Spa Low Temperature Geothermal Facility...

    Open Energy Info (EERE)

    Lincoln Avenue Spa Pool & Spa Low Temperature Geothermal Facility Jump to: navigation, search Name Lincoln Avenue Spa Pool & Spa Low Temperature Geothermal Facility Facility...

  2. Chicago Operations Office 9800 South Cass Avenue

    Office of Legacy Management (LM)

    y,: y; , i 4- 1 .' f?Qj /J < b !. i-. .* ;+ ,.- Department of Energy Chicago Operations Office 9800 South Cass Avenue Argonne, Illinois 60439 : / *- I (jr-. _ __-rCILC-. .-WI __ James L. Liverman, Acting Assistant Secretary for Environment, HQ UNIVERSITY OF ARIZONA On January 17, 1978, Edward J. Jascewsky, Department of Energy (DOE), and Walter H. Smith, Argonne National Laboratory (AX), visited the University of Arizona. The purpose of the visit teas to discuss the past operations of c$rtain

  3. Seattle, Washington A White House Climate Action Champions Case...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ... City of Seattle recognizes its own energy impact and the importance of leading by example. ... of their lowest performers. 6 ResourcesLearning More 1. Contacts Authors Sandra Mallory, ...

  4. DOE Zero Energy Ready Home Case Study: Dwell Development, Seattle...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Case study of a DOE Zero Energy Ready Home in Seattle, WA, that scored HERS 34 without PV. This 2,000-square-foot system home has R-45 double-stud walls, an unvented flat roof with ...

  5. DOE Tour of Zero: The Net Zero in Seattle by TC Legend Homes...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Net Zero in Seattle by TC Legend Homes DOE Tour of Zero: The Net Zero in Seattle by TC Legend Homes Addthis 1 of 15 Northwest builder TC Legend Homes has built a certified U.S. DOE...

  6. DOE Commercial Building Energy Asset Rating Program Focus Groups with Primary Stakeholders in Seattle-- Final Report

    Broader source: Energy.gov [DOE]

    Collection, assessment, and analysis of Seattle stakeholder input and opinions regarding the commercial building energy asset rating program.

  7. Urban Wood-Based Bio-Energy Systems in Seattle

    SciTech Connect (OSTI)

    Stan Gent, Seattle Steam Company

    2010-10-25

    Seattle Steam Company provides thermal energy service (steam) to the majority of buildings and facilities in downtown Seattle, including major hospitals (Swedish and Virginia Mason) and The Northwest (Level I) Regional Trauma Center. Seattle Steam has been heating downtown businesses for 117 years, with an average length of service to its customers of 40 years. In 2008 and 2009 Seattle Steam developed a biomass-fueled renewable energy (bio-energy) system to replace one of its gas-fired boilers that will reduce greenhouse gases, pollutants and the amount of waste sent to landfills. This work in this sub-project included several distinct tasks associated with the biomass project development as follows: a. Engineering and Architecture: Engineering focused on development of system control strategies, development of manuals for start up and commissioning. b. Training: The project developer will train its current operating staff to operate equipment and facilities. c. Flue Gas Clean-Up Equipment Concept Design: The concept development of acid gas emissions control system strategies associated with the supply wood to the project. d. Fuel Supply Management Plan: Development of plans and specifications for the supply of wood. It will include potential fuel sampling analysis and development of contracts for delivery and management of fuel suppliers and handlers. e. Integrated Fuel Management System Development: Seattle Steam requires a biomass Fuel Management System to track and manage the delivery, testing, processing and invoicing of delivered fuel. This application will be web-based and accessed from a password-protected URL, restricting data access and privileges by user-level.

  8. GHG Management Institute | Open Energy Information

    Open Energy Info (EERE)

    GHG Management Institute Jump to: navigation, search Name: GHG Management Institute Address: Greenhouse Gas Management Institute 9215 View Avenue NW Seattle, WA USA 98117 Place:...

  9. Washington Biodiesel | Open Energy Information

    Open Energy Info (EERE)

    Logo: Washington Biodiesel Name: Washington Biodiesel Address: 3401 Fremont Avenue N. Place: Seattle, Washington Zip: 98103 Region: Pacific Northwest Area Sector: Biofuels...

  10. Cascadia Capital | Open Energy Information

    Open Energy Info (EERE)

    Cascadia Capital Jump to: navigation, search Name: Cascadia Capital Address: 701 Fifth Avenue Place: Seattle, Washington Zip: 98104 Region: Pacific Northwest Area Product:...

  11. Data-Driven Mailing Helps Heat Up Untapped Seattle Market | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Data-Driven Mailing Helps Heat Up Untapped Seattle Market Data-Driven Mailing Helps Heat Up Untapped Seattle Market Abridged transcript of an interview with Community Power Works Project Manager Ruth Bell and Program/System Analyst Vince Schueler of the Washington State University Energy Program. PDF icon Seattle Focus Series More Documents & Publications The Better Buildings Neighborhood View -- January 2013 howtodesignandmarketenergyefficiencyprogramstospecificneighborhoods.doc

  12. MASSACHUSETTS AVENUE ChMBRIDGE'39, MASSACHUSETTS TELEPHONE UNrvn...

    Office of Legacy Management (LM)

    UNrvn.,,r, 4-5200 blr. Saul Strauch Technical Liason Division United States Atomic Energy Commission New York Operations Office 70 Columbus Avenue New York 23, New York ...

  13. East Avenue Truck Inspection Patterson Pass Road Vasco Road

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Office to be badged Sandia National Laboratories 7011 East Avenue Livermore, CA 94551 Tesla Road Interstate 580 - From OaklandSan Francisco Map Not to Scale Map Not to Scale To...

  14. DOE - Office of Legacy Management -- Latty Avenue Site - MO 04

    Office of Legacy Management (LM)

    MO.04-1 - DOE Letter; Keller to Jarboe; Subject: Agreement for Use of Property at 9200 Latty Avenue, Hazelwood, Missouri; November 22, 1983 MO.04-10 - DOE Report (ORNLRASA-857); ...

  15. DOE Tour of Zero Floorplans: Euclid Avenue by Heirloom Design Build |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy Euclid Avenue by Heirloom Design Build DOE Tour of Zero Floorplans: Euclid Avenue by Heirloom Design Build DOE Tour of Zero Floorplans: Euclid Avenue by Heirloom Design Build

  16. DOE Zero Energy Ready Home Case Study: Dwell Development, Seattle, WA,

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Systems Home | Department of Energy Dwell Development, Seattle, WA, Systems Home DOE Zero Energy Ready Home Case Study: Dwell Development, Seattle, WA, Systems Home Case study of a DOE Zero Energy Ready Home in Seattle, WA, that scored HERS 34 without PV. This 2,000-square-foot system home has R-45 double-stud walls, an unvented flat roof with 2 inches of spray foam plus 18 inches blown cellulose, R-42 XPS under slab, triple-pane windows, and a ductless mini-split heat pump. PDF icon Dwell

  17. U.S. Department of Energy 1000 Independence Avenue, SW

    Energy Savers [EERE]

    25, 2014 Office of Hearings and Appeals U.S. Department of Energy 1000 Independence Avenue, SW Washington, DC 20585-0107 OHA.filings@hq.doe.gov Re: The Steffes Corporation Application for Exception of July 18, 2014 This letter provides joint comments of the National Rural Electric Cooperative Association (NRECA), the Natural Resources Defense Council (NRDC), and the American Council for an Energy-Efficient Economy (ACEEE) supporting the Application for Exception filed by the Steffes Corporation

  18. ARGONNE NATIONAL LABORATORY 9700 South Cass Avenue, Argonne, Illinois 60439

    Office of Legacy Management (LM)

    07 - 76 ARGONNE NATIONAL LABORATORY 9700 South Cass Avenue, Argonne, Illinois 60439 ACTION DESCRIPTION MEMORANDUM INTERIM CLEANUP OF CONTAMINATED MATERIALS FROM BUILDING 3 AT THE UNIVERSAL CYCLOPS SITE, ALIQUIPPA, PENNSYLVANIA by Energy and Environmental Systems Division October 1988 work supported by U.S. DEPARTMENT OF ENERGY Oak Ridge Operations Technical Services Division Oak Ridge,/Tennessee CONTENTS 1 SUMMARY ............................................ ............. 1 2 STTE DSCRIPTION AND

  19. EERE Success Story—Washington: Seattle Rises Above with Alternative Fuels

    Broader source: Energy.gov [DOE]

    From the airport's baggage carriers to the taxis, Seattle's efforts to reduce petroleum in transportation will improve their local energy and environmental security, as well as help tourists realize the benefits of alternative fuels.

  20. Seattle City Light- Multi-Family Residential Energy Efficiency Rebate Program

    Broader source: Energy.gov [DOE]

    Seattle City Light provides incentives for multi-family housing properties with 5 or more units to increase their energy efficiency. Rebates are offered for common area lighting and weatherization...

  1. Data-Driven Mailing Helps Heat Up Untapped Seattle Market | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Data-Driven Mailing Helps Heat Up Untapped Seattle Market Abridged transcript of an interview with Community Power Works Project Manager Ruth Bell and ProgramSystem Analyst Vince ...

  2. East Avenue Truck Inspection Patterson Pass Road Vasco Road

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Vasco Road Thunderbird Lane Greenville Road Greenville Road Directions to the Sandia/CA - Visitor Badge Office Interstate 580 - Oakland/San Francisco, Traveling Eastbound * Exit Vasco Road South * Continue traveling South on Vasco Road for 1.1 miles * Turn left onto Patterson Pass Road * Continue traveling East on Patterson Pass Road for 1.2 miles * Turn right onto Greenville Road * Continue traveling South on Greenville Road for 1.1 miles * Turn right onto East Avenue * Follow the road as it

  3. The Honorable John T. 'Gregorio 301 N. Wood Avenue

    Office of Legacy Management (LM)

    Eiergy ; Washington, DC 20585 -, (, > - .' c ' . FEB 1 7 1995 _ .; , _-, The Honorable John T. 'Gregorio 301 N. Wood Avenue Linden, 'New Jersey 07036 d. \ Dear Mayor Gregorio: ,' ,' .' , Secretary of Energy Hazel O'Leary has announced a new approach to openness, in the'llepartment' of Energy (DDE) and its co,annunications with the .public.', In sup~port of this initiative, we are.pleased to forward.the,enclosed information reiated to the.former Linden Pilot Plant of the Chemical' Construction

  4. Argonne National Laboratory 9700 South Cass Avenue, Argonne, Illinois 60439

    Office of Legacy Management (LM)

    National Laboratory 9700 South Cass Avenue, Argonne, Illinois 60439 DERIVATION OF I,]RANIUM RESIDUAL RADIOACTTVE I\{ATERIAL GI]IDELINES FOR THE ALIQIJIPPA FORGE SITE by F. Monette, L. Jones, and C. Yu Environmental Assessment and Information Sciences Division September 1992 work sponsored by U.S. Department of Energy DOE Field Office Forrner Sites Restoration Division Oak Ridge, Tennessee CONTEI{TS SUMMARY 1 INTRODUCTION AND BRIEF HISTORY 1.1 Site Description and Setting 1.2 Site History 1.3

  5. LiveWall Operational Evaluation: Seattle Law Enforcement Pilot

    SciTech Connect (OSTI)

    Barr, Jonathan L.; Burtner, Edwin R.; Stein, Steven L.

    2013-10-01

    The LiveWall concept envisioned as an outgrowth of the Precision Information Environment (PIE) project allows communications between separate groups using interactive video, audio, and a shared desktop environment; this allows everyone to participate and collaborate in real time, regardless of location. The LiveWall concept provides a virtual window to other locations, where all parties can interact and collaboratively work with each other. This functionality is intended to improve multi-site coordination amongst emergency operations centers (EOC), field operations sites and across organizations and jurisdictions to accommodate communications during routine and emergency events. For the initial LiveWall operational evaluation PNNL partnered with the Seattle Police Department (SPD). This partnership allowed for the creation of an excellent LiveWall test bed specific to law enforcement. This partnership made it possible to test the LiveWall concept with scenarios involving the many facets of the law enforcement work done by SPD. PNNL and SPD agreed that integrating the systems into operations for a real event would be the best test of the technology and give SPD staff greater visibility into the functionality and benefits offered by the LiveWall concept.

  6. EcoCAR 3: Year 1 Finals in Seattle | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    EcoCAR 3: Year 1 Finals in Seattle EcoCAR 3: Year 1 Finals in Seattle Addthis 1 of 11 As part of the EcoCAR 3 Advanced Vehicle Technology Competition, university teams from throughout North America will redesign a 2016 Chevrolet Camaro to reduce its environmental impact while maintaining its "muscle car" performance. Image: Courtesy of EcoCAR 3 2 of 11 As part of EcoCAR 3, university teams will receive a set of keys to a brand new Chevrolet Camaro from General Motors to re-engineer

  7. DOE Tour of Zero Floorplans: McCormick Avenue by BrightLeaf Homes |

    Energy Savers [EERE]

    Department of Energy Marine Drive by Clifton View Homes DOE Tour of Zero Floorplans: Marine Drive by Clifton View Homes DOE Tour of Zero Floorplans: Marine Drive by Clifton View Department of Energy

    McCormick Avenue by BrightLeaf Homes DOE Tour of Zero Floorplans: McCormick Avenue by BrightLeaf Homes DOE Tour of Zero Floorplans: McCormick Avenue by BrightLeaf

  8. Manhattan Project: Places

    Office of Scientific and Technical Information (OSTI)

    Places "Met Lab" (Metallurgical Laboratory) Oak Ridge: Clinton Engineer Works Hanford Engineer Works Los Alamos Other Places Places of the Manhattan Project Places PLEASE NOTE: The Places pages are not yet available. Links to the pages listed below and to the left will be activated as content is developed. Select topics relating to the places where the Manhattan Project occurred have been grouped into the categories listed to the left. A quick overview of places involved in the

  9. DOE Zero Energy Ready Home Case Study: TC Legend, Seattle, WA, Custom Home

    Broader source: Energy.gov [DOE]

    Case study of a DOE Zero Energy Ready Home in Seattle, WA, that scored HERS 37 without PV, HERS -1 with PV. This 1,915-square-foot custom home has SIP walls and roof, R-20 XPS under the slab, triple-pane windows, an air to water heat pump for radiant heat, and balanced ventilation with timer-controlled fans to bring in and exhaust air.

  10. DOE Zero Energy Ready Home Case Study: BrightLeaf Homes, McCormick Avenue,

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Brookfield, IL | Department of Energy BrightLeaf Homes, McCormick Avenue, Brookfield, IL DOE Zero Energy Ready Home Case Study: BrightLeaf Homes, McCormick Avenue, Brookfield, IL DOE Zero Energy Ready Home Case Study: BrightLeaf Homes, McCormick Avenue, Brookfield, IL Case study of a DOE 2015 Housing Innovation Award winning production home in the cold climate that got a HERS 38 without PV, with staggered 2x4 studs every 8"on a 2x6 plate with dense-packed R-25 cellulose, basement with

  11. Health and Safety Research Division RESULTS FROM A RADIOLOGICAL SURVEY ON YARDEORO AVENUE,

    Office of Legacy Management (LM)

    Health and Safety Research Division RESULTS FROM A RADIOLOGICAL SURVEY ON YARDEORO AVENUE, ALBANY, AND CENTRAL AVENUE,, COLONIE, NEW YORK PROPERTIES AL013 - AL028 July 1984 Work performed as part of the RADIOLOGICAL SURVEY ACTIVITIES PROGRAM OAK RIDGE NATIONAL LABORATORY Oak Ridge, Tennessee 37831 operated by MARTIN MARIETTA ENERGY SYSTEMS, INC. for the U.S. DEPARTMENT OF ENERGY under Contract No. DE-AC05840R21400 _- _^." .-. ..-.- _---.--_ -... .- Fk. 3 ,=. Y)*cx gs 1 XEC @ d +I? ,%r $ g

  12. Manhattan Project: Places Images

    Office of Scientific and Technical Information (OSTI)

    PLACES IMAGES Resources > Photo Gallery Scroll down to see each of these images individually. The images are: 1. Remains of a Shinto Shrine, Nagasaki, October 1945 (courtesy the ...

  13. DOE Zero Energy Ready Home Case Study: Dwell Development, Seattle, Washington

    SciTech Connect (OSTI)

    none,

    2013-09-01

    This Challenge Home is one of 42 homes in a micro-community of ultra-modern, energy-efficient homes built by Dwell Development on an urban gray-field site in South Seattle. Every home will achieve a 5-Star Built Green rating from the regional master builders association and meet the criteria of the Northwest ENERGY STAR program, which is more strict than the national ENERGY STAR criteria. Also, the home won a 2013 Housing Innovation Award in the "systems builder" category.

  14. DOE Zero Energy Ready Home Case Study: Montlake Modern - Seattle, Washington

    SciTech Connect (OSTI)

    none,

    2014-11-01

    This case study describes a DOE Zero Energy Ready Home in Seattle, WA, that scored HERS 42 without PV and a -1 with PV. This 3,192 ft2 custom home has 6-inch SIP walls, a 12-inch SIP roof, an R-28 ICF-insulated foundation slab edge with R-20 rigid foam under the slab; an air-to-water heat pump plus radiant floor heat; 100% LED lighting; filtered-fan-powered fresh air intake; triple-pane windows, 9.7 kWh PV for electric car charging station.

  15. Opening New Avenues for High-Efficiency, Low-Emission Coal Gasification |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy Opening New Avenues for High-Efficiency, Low-Emission Coal Gasification Opening New Avenues for High-Efficiency, Low-Emission Coal Gasification April 10, 2012 - 1:00pm Addthis A rendering of the Pratt & Whitney Rocketdyne high pressure, dry-solids feed pump. A rendering of the Pratt & Whitney Rocketdyne high pressure, dry-solids feed pump. Washington, DC - Gasification. It's a versatile technology that uses coal to produce power, chemicals, and fuels. Inherently

  16. DOE Tour of Zero: Euclid Avenue by Heirloom Design Build | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Euclid Avenue by Heirloom Design Build DOE Tour of Zero: Euclid Avenue by Heirloom Design Build Addthis 1 of 12 Heirloom Design Build built this 4,840-square-foot home in Atlanta, Georgia, to the performance criteria of the U.S. Department of Energy Zero Energy Ready Home (ZERH) program. 2 of 12 While the two-story home was designed to fit aesthetically into the historic neighborhood, energy-efficiency features will save the homeowners $1,909 a year in utility bills compared to a home

  17. DOE Tour of Zero: Euclid Avenue by Heirloom Design Build | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Euclid Avenue by Heirloom Design Build DOE Tour of Zero: Euclid Avenue by Heirloom Design Build 1 of 12 Heirloom Design Build built this 4,840-square-foot home in Atlanta, Georgia, to the performance criteria of the U.S. Department of Energy Zero Energy Ready Home (ZERH) program. 2 of 12 While the two-story home was designed to fit aesthetically into the historic neighborhood, energy-efficiency features will save the homeowners $1,909 a year in utility bills compared to a home built

  18. Ch P cage Operations and Regional Office 9800 South Cass Avenue

    Office of Legacy Management (LM)

    artment of Energy Ch P cage Operations and Regional Office 9800 South Cass Avenue Argonne, Illinois 60439 OCT 2 1 1980 Ki.lliam E. Mott, Director Environmental Cinttol Technology Division, KC! SUBJECT I PREHIER MANUFACTURING - SPRINGDALE, PEhVSYLVA?UA A visit to Premier Manufacturing, 644 Garfield, Springdalc, Pennsylvania, was made en October 6, 1980, by Edward J. Jascewsky and Art Whitman, Department of Energy, and Walter R. Smith, Argonne National Laboratory. The group met with Edward

  19. C&ago Operations and Regional Office 9800 South Cass Avenue

    Office of Legacy Management (LM)

    53u Y De artment of Energy . C&ago Operations and Regional Office 9800 South Cass Avenue Argonne, Illinois 60439 P P. R July 14, 1981 Billy D. ghfpp, Director Operational end Rwironmental Safety Division SDBJECT: CARPENTER ISCNNOLQGY GORPORATION, CARPENTER STIWL DIVISION, l&WING, P!6lQWTLVAMA A visit wea made to Carpenter Technology Corp., Carpenter Steel Division, Rnading, Pennsylvania, on June 7, 1981, by Paul Neeaon, DOE, end personnel of Argonne National Laboratory (ANL). ' Ihe AML

  20. HIA 2015 DOE Zero Energy Ready Home Case Study: Sunroc Builders, Bates Avenue, Lakeland, FL

    Energy Savers [EERE]

    Sunroc Builders Bates Avenue Lakeland, FL DOE ZERO ENERGY READY HOME(tm) The U.S. Department of Energy invites home builders across the country to meet the extraordinary levels of excellence and quality specified in DOE's Zero Energy Ready Home program (formerly known as Challenge Home). Every DOE Zero Energy Ready Home starts with ENERGY STAR Certified Homes Version 3.0 for an energy-efficient home built on a solid foundation of building science research. Advanced technologies are designed in

  1. Hr. Richard Ziehm. President : Precision Extrusion Company 720 E. Green Avenue

    Office of Legacy Management (LM)

    WV23 1987 .' c Hr. Richard Ziehm. President : Precision Extrusion Company 720 E. Green Avenue Bensenville,,Illinois, 60106 : '. ;' , Dear Mr. Ziehm: Wall0 11&lr/a7 NE-23 : ,~ F' .v 11 w I would like to thank you and Mr. Cramer for your assistance in the Department of Energy's investigations regarding past Atomic Energy Commission activities at your site. As I indicated, based on the records we have identified and my discussions with you, we have concluded that there is little potential for

  2. 1000 Independence Avenue, SW, Washington, D.C., Carol G. Crawford, Chair,

    U.S. Energy Information Administration (EIA) Indexed Site

    FRIDAY, OCTOBER 25, 2002 The meeting was held at 8:30 in Room 8E-089 of the Department of Energy, 1000 Independence Avenue, SW, Washington, D.C., Carol G. Crawford, Chair, presiding. PRESENT: CAROL G. CRAWFORD, Ph.D. Chair F. JAY BREIDT, Ph.D. Vice Chair MARK BERNSTEIN, Ph.D. JOHNNY BLAIR JAE EDMONDS, Ph.D. JAMES K. HAMMITT, Ph.D. NICHOLAS W. HENGARTNER CALVIN A. KENT, Ph.D. WILLIAM G. MOSS, Ph.D. POLLY A. PHIPPS, Ph.D. RANDY R. SITTER, Ph.D. ROY WHITMORE, Ph.D. ALSO PRESENT: CALVIN A. KENT,

  3. STREET CENTR AL AVENU E C E N T R A L A

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    7 6 15 18 19 17 20 21 23 24 25 20TH STREET CENTR AL AVENU E C E N T R A L A V E N U E CENT RAL AVEN UE CAN YO N RO AD IRIS STREET N E C T A R S T R E E T M YR TL E ST RE ET 15TH STREET 4TH STREET 6TH STREET TRINITY DRIVE DP ROAD T R I N I T Y D R I V E TRINITY DRIVE T R I N I T Y D R I V E O P P E N H E I M E R D R I V E POST OFFICE CHAMBER OF COMMERCE BRADBURY SCIENCE MUSEUM BUS PARKING FULLER LODGE ASHLEY POND HISTORICAL MUSEUM MESA PUBLIC LIBRARY SENIOR CENTER KNECHT STREET 9TH STREET 16 14

  4. Radiological Survey Data for 38 Grove Avenue, Rochelle Park, l'lew Jersey

    Office of Legacy Management (LM)

    sEP 4 1984 l,lE-24 Radiological Survey Data for 38 Grove Avenue, Rochelle Park, l'lew Jersey E . L . K e l l e r , D i r e c t o r T e c h n i c a l S e r v i c e s D i v i s i o n 0ak Ridge Operations 0ffice The radiological survey data for the subject vicinity property has been reviewed by-the Divislbn of Remedial Action Proiects personnel. . Based on these data and the reasons stated ln your memorandum to DeLaney/ldhitman dated 8l?7184, we concur in the proposed remedial action at the subiect

  5. Better Place Formerly Project Better Place | Open Energy Information

    Open Energy Info (EERE)

    California Zip: 94304 Product: Project Better Place will establish a widespread grid of electric charging spots to provide consumers with the energy to keep their cars charged...

  6. Potential social, institutional, and environmental impacts of selected energy-conservation measures in two Washington communities. [Seattle and Yakima

    SciTech Connect (OSTI)

    Edelson, E.; Olsen, M.

    1980-03-01

    The likely environmental, social, and institutional impacts of selected energy-conservation measures in two communities in Washington state are reported. The five conservation measures investigated in this study were: (1) retrofitting existing buildings; (2) district heating and Integrated Community Energy Systems (ICES); (3) small automobiles and vehicle redesign; (4) land-use and housing modifications; and (5) electric-utility rate reform. Twenty potential impact areas were selected for analysis. These areas were divided into five categories of environmental impacts, economic impacts, community impacts, personal impacts, and overall quality of life in the community. The research was conducted in Seattle and Yakima, Washington. In each location, about two dozen public officials and business, labor, and community leaders were interviewed. Their diverse views are summarized. The Seattle respondents saw energy conservation as a highly desirable policy with a number of temporary, transitional problems arising as energy-conservation measures were implemented. Yakima respondents, in contrast, did not expect to encounter many serious energy problems in the foreseeable future and consequently viewed energy conservation as a relatively minor community concern. Moreover, they anticipated that many conservation measures, if implemented by the government, would encounter either apathy or resistance in their community. Two broad generalizations can bedrawn from these interviews: (1) energy conservation will basically be beneficial for the natural environment and our society; and (2) if energy conservation does become a dominant thrust in our society, it could stimulate and reinforce a much broader process of fundamental social change. (LCL)

  7. HIA 2015 DOE Zero Energy Ready Home Case Study: BrightLeaf Homes, McCormick Avenue, Brookfield, IL

    Energy Savers [EERE]

    BrightLeaf Homes McCormick Avenue Brookfield, IL DOE ZERO ENERGY READY HOME(tm) The U.S. Department of Energy invites home builders across the country to meet the extraordinary levels of excellence and quality specified in DOE's Zero Energy Ready Home program (formerly known as Challenge Home). Every DOE Zero Energy Ready Home starts with ENERGY STAR Certified Homes Version 3.0 for an energy-efficient home built on a solid foundation of building science research. Advanced technologies are

  8. URANIUM PRODUCERS OF AMERICA 141 EAST PALACE AVENUE, POST OFFICE Box 669, SANTA FE, NEW MEXICO 87504-0669

    Energy Savers [EERE]

    URANIUM PRODUCERS OF AMERICA 141 EAST PALACE AVENUE, POST OFFICE Box 669, SANTA FE, NEW MEXICO 87504-0669 TELEPHONE(505) 982-4611; FAX (505) 988-2987; WWW.URANJUMPRODUCERSAMERJCA.COM David Henderson U.S. Department of Energy Office of Nuclear Energy Mail Stop NE-52 19901 Germantown Rd. Germantown, MD 20874-1290 April 6, 2015 Re: UP A Response to DOE Notice of Issues for Public Comment on "Excess Uranium Management: Effects of DOE Transfers of Excess Uranium on Domestic Uranium Mining,

  9. Institution Name Institution Name Address Place Zip Notes Website...

    Open Energy Info (EERE)

    Avenue Cambridge Massachusetts http web mit edu eel Greater Boston Area MIT Energy Science and Engineering Laboratory MIT Energy Science and Engineering Laboratory...

  10. Hazelwood Interim Storage Site environmental report for calendar year 1992, 9200 Latty Avenue, Hazelwood, Missouri

    SciTech Connect (OSTI)

    Not Available

    1993-05-01

    This report describes the environmental surveillance program at the Hazelwood Interim storage Site (HISS) and surrounding area, provides the results for 1992, and discusses applicable environmental standards and requirements with which the results were compared. HISS is located in eastern Missouri in the City of Hazelwood (St. Louis County) and occupies approximately 2.2 ha (5.5 acres). Environmental monitoring of HISS began in 1984 when the site was assigned to the US Department of Energy (DOE) as part of the decontamination research and development project authorized by Congress under the 1984 Energy and Water Development Appropriations Act. DOE placed responsibility for HISS under the Formerly Utilized Sites Remedial Action Program (FUSRAP), which was established to identify and decontaminate or otherwise control sites where residual radioactive materials remain from the early years of the nation`s atomic energy program or from commercial operations causing conditions that Congress has authorized DOE to remedy. In 1992 there were no environmental occurrences or unplanned contaminant releases as defined in DOE requirements and in the Superfund Amendment and Reauthorization Act (SARA) Title III of CERCLA.

  11. Radiological survey of Latty Avenue in the vicinity of the former Cotter site, Hazelwood/Berkeley, Missouri (LM001)

    SciTech Connect (OSTI)

    Cottrell, W.D.; Carrier, R.F.

    1987-05-01

    A radiological survey was conducted over a proposed construction corridor in the vicinity of the former Cotter site at 9200 Latty Avenue. The survey included gamma exposure rates at the ground surface and at 1 m above the surface throughout the site, sampling of surface soil, sampling of subsurface soil from auger holes, gamma logging of auger holes, and sampling of subsurface water. The results of the survey demonstrated some degree of radioactive contamination in all areas of the construction corridor, extending north and south in some regions onto adjacent private properties. Redistribution of the contamination by flooding, surface runoff, and road and utility line activities was evident. The pattern of contamination ranged from widespread to isolated spots and was found to occur from near the surface to depths of approx.1.8 m. The most highly contaminated region was noted on both sides of Latty Avenue adjacent to the former Cotter site. Concentrations of /sup 230/Th in soil from that region were as high as 16,000 pCi/g.

  12. 1000 Independence Avenue, SW

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ... opportunities. rules of engagement u.s. department of energy (doe) business model Large facility management contractors (FMCs) manage and operate land and facilities owned by ...

  13. 9800 South Cass Avenue

    Office of Legacy Management (LM)

    ... H. Smith, C. B. Mayes, P. C. Gray, D. W . Reilly. SMALL ANIMAL FACILITY As a .participant in the Department of Energy's Formerly Utilized Sites Remedial Action Program, the Argonne ...

  14. Project Better Place | Open Energy Information

    Open Energy Info (EERE)

    1070 Arastradero Road Place: Palo Alto, California Zip: 94304 Region: Bay Area Sector: Vehicles Product: Electric vehicle infrastructure company building a battery swap out...

  15. Spokane Seattle Portland Y

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Um tan um Rid ge R a t t l e s n a k e M o u n t a i n G a b l e M o u n t a i n G a b l e B u t t e Sa dd le M ou nt a in s H w y . 2 4 0 Hwy. 24 Hw y. 243 H w y . 2 4 4 0 0 4 0 0 ...

  16. Solar Policy Environment: Seattle

    Broader source: Energy.gov [DOE]

    The objective of the Emerald City Solar Initiative is to overcome the barriers to widespread deployment of solar energy technology, dramatically increasing residential, commercial, City-owned, and community-scale solar energy use. The City has assembled a strong team of partners that have proven track records in the fields of public planning, renewable energy resource mapping, financial analysis, site analysis, education and outreach, policy analysis and advocacy, community organizing and renewable energy project development.

  17. In-place HEPA filter penetration test

    SciTech Connect (OSTI)

    Bergman, W.; Wilson, kK.; Elliott, J.; Bettencourt, B.; Slawski, J.W.

    1997-01-01

    We have demonstrated the feasibility of conducting penetration tests on high efficiency particulate air (HEPA) filters as installed in nuclear ventilation systems. The in-place penetration test, which is designed to yield equivalent penetration measurements as the standard DOP efficiency test, is based on measuring the aerosol penetration of the filter installation as a function of particle size using a portable laser particle counter. This in-place penetration test is compared to the current in-place leak test using light scattering photometers for single HEPA filter installations and for HEPA filter plenums using the shroud method. Test results show the in-place penetration test is more sensitive than the in-place leak test, has a similar operating procedure, but takes longer to conduct. Additional tests are required to confirm that the in-place penetration test yields identical results as the standard dioctyl phthalate (DOP) penetration test for HEPA filters with controlled leaks in the filter and gasket and duct by-pass leaks. Further development of the procedure is also required to reduce the test time before the in- place penetration test is practical.

  18. Cure-in-place process for seals

    DOE Patents [OSTI]

    Hirasuna, Alan R.

    1981-01-01

    A cure-in-place process which allows a rubber seal element to be deformed to its service configuration before it is cross-linked and, hence, is a plastic and does not build up internal stress as a result of the deformation. This provides maximum residual strength to resist the differential pressure. Furthermore, the process allows use of high modulus formulations of the rubber seal element which would otherwise crack if cured and then deformed to its service configuration, resulting in a seal which has better gap bridging capability. Basically, the process involves positioning an uncured seal element in place, deforming it to its service configuration, heating the seal element, curing it in place, and then fully seating the seal.

  19. Planetary Fuels LLC | Open Energy Information

    Open Energy Info (EERE)

    Fuels LLC Jump to: navigation, search Name: Planetary Fuels, LLC Place: Seattle, Washington Product: Seattle-based start-up dedicated to the production of biodiesel. Coordinates:...

  20. University of Washington | Open Energy Information

    Open Energy Info (EERE)

    Washington Jump to: navigation, search Name: University of Washington Place: Seattle, Washington Product: Public research university with campuses in Seattle, Tacoma, and Bothell....

  1. Celerity Energy Partners now EnerNOC | Open Energy Information

    Open Energy Info (EERE)

    Partners (now EnerNOC) Place: Seattle, Washington, DC Product: Seattle-based provider of demand response capacity to electric utilities, power marketers, and electric power users....

  2. In-place testing summary - 1990

    SciTech Connect (OSTI)

    Ortiz, J.P.

    1990-05-01

    This is one of several reports concerning an on-going in-place testing program of high efficiency filtration and chemical adsorber systems and portable filtered exhausters at the Los Alamos National Laboratory. This testing is in support of the Laboratory`s airborne waste management programs and asbestos abatement programs. Periodic in-place testing, along with health physics air sampling will determine whether the air cleaning systems are maintaining acceptable air-cleaning levels. These periodic evaluations help ensure that the plant and surrounding environment are free of any significant radioactive particulates, based on current EPA environmental levels and chemical airborne hazards from processing effluents. This report will provide an overview of system performance, testing methods and procedures.

  3. Forwardly-placed firearm fire control assembly

    DOE Patents [OSTI]

    Frickey, Steven J.

    2001-12-22

    A firearm fire control assembly for disposition in a forwardly placed support-hand operative relationship within a firearm having a combination of a firing pin and a firearm hammer adapted to engage and fire a cartridge, a sear assembly to alternately engage and disengage the combination of the firearm hammer and firing pin, and a trigger assembly including a movable trigger mechanism that is operable to engage the sear assembly to cause the firearm hammer firing pin combination to fire the firearm, a fire control assembly including a fire control depression member and a fire control rod operably connected to the depression member, and being positioned in a forward disposition disposed within a forestock of the firearm, and the depression member adapted to be operably engaged and depressed by the user's conventional forwardly placed support hand to maneuver the fire control rod to provide firing control of the firing of the firearm.

  4. In-place filter testing summary

    SciTech Connect (OSTI)

    Ortiz, J.P.; Garcia, E.D.; Ortega, J.M.

    1988-03-01

    The most common method of identifying particle penetration through a filter or adsorber system is through the performance of a periodic penetration test, i.e., in-place test or leak test using an aerosol or gas vapor to challenge the filter or adsorber system. The aerosol is usually formed by vaporization of a liquid, di-2(ethelhexyl sebacate) (DEHS), and allowed to condense to form liquid particles of a certain size and distribution. The gas vapor is formed by vaporization of Freon 11 liquid. The periodic penetration test, although conducted annually, can and has been demonstrated to show the beginning degradation of a filter or adsorber system. Other evidence of penetration can include detection of radiation downstream of the filter system or the existence of an unusually low pressure drop across the filter, i.e., torn filter, etc. However, these kinds of occurrences show up instantaneously and could release radioactive material to the atmosphere before the systems could be shut down. When a filter system fails the in--place test or is showing evidence of.filter or component degradation, corrective measures are put into place in order to return,the system back to its best operating condition. This report presents a summary of all filter tests.

  5. Microsoft Word - HABAdv#224_Proposed COnsent Decree&TPA Modifications...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Seattle, WA 98101 Ins Triay Assistant Secretary for Environmental Management EM-1Forestal Building U.S. Department of Energy 1000 Independence Avenue Washington, D.C. 20585...

  6. DRAFT ADVICE - UNACCEPTABLE PROGRAM IMPACTS UNDER FY 97 BUDGET

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Environmental Protection Agency, Region 10 1200 Sixth Avenue Seattle, WA 98101 Linda Hoffman, Director Washington State Department of Ecology P.O. Box 47600 Olympia, WA...

  7. DRAFT ADVICE - UNACCEPTABLE PROGRAM IMPACTS UNDER FY 97 BUDGET

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    John Iani, Regional Administrator U.S. Environmental Protection Agency, Region 10 1200 Sixth Avenue Seattle, WA 98101 Re: Principles for M-91 Negotiations Dear Mssrs. Klein,...

  8. Microsoft Word - FOI 2013-00962.Partial Response Item 1.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    6, 2013 CERTIFIED MAIL Mr. Tom Carpenter Hanford Challenge 219 1 st Avenue South Suite 310 Seattle, Washington 98104 Dear Mr. Carpenter: FREEDOM OF INFORMATION ACT REQUEST (FOI...

  9. Microsoft Word - FOI 2013-01144.Final.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    19, 2013 CERTIFIED MAIL Ms. Susannah Frame KING Television 333 Dexter Avenue North Seattle, Washington 98105 Dear Ms. Frame: FREEDOM OF INFORMATION ACT REQUEST (FOI 2013-01144)...

  10. The Tri-Party Agencies want your input on proposed changes to...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    - 10:00 pm): September 24, 2002 - Yakima, Washington West Coast Yakima Center - Ballroom 607 East Yakima Avenue Yakima, Washington September 26, 2002 - Seattle, Washington...

  11. Filter:Incentives by Place | Open Energy Information

    Open Energy Info (EERE)

    This filter covers the property Place. Retrieved from "http:en.openei.orgwindex.php?titleFilter:IncentivesbyPlace&oldid267397" Feedback Contact needs updating Image...

  12. Placing Fusion Power on a Pedestal | Princeton Plasma Physics Lab

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Placing Fusion Power on a Pedestal American Fusion News Category: Massachusetts Institute of Technology (MIT) Link: Placing Fusion Power on a Pedestal

  13. CBEI: Broker Training - Placing Value on Energy Retrofits - 2015...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Broker Training - Placing Value on Energy Retrofits - 2015 Peer Review CBEI: Broker Training - Placing Value on Energy Retrofits - 2015 Peer Review Presenter: Susan Wachter, ...

  14. NPS - National Register of Historic Places website | Open Energy...

    Open Energy Info (EERE)

    NPS - National Register of Historic Places website Jump to: navigation, search OpenEI Reference LibraryAdd to library Web Site: NPS - National Register of Historic Places website...

  15. Miller Place, New York: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    Hide Map This article is a stub. You can help OpenEI by expanding it. Miller Place is a census-designated place in Suffolk County, New York.1 References US...

  16. Property:Incentive/Cont2Place | Open Energy Information

    Open Energy Info (EERE)

    search Property Name IncentiveCont2Place Property Type String Pages using the property "IncentiveCont2Place" Showing 25 pages using this property. (previous 25) (next...

  17. Climate Leadership Conference (Seattle, WA)

    Broader source: Energy.gov [DOE]

    Sustainability leaders from the private, public, academic, and non-profit communities meet to explore market transformation, carbon management, and building climate resilience on an annual basis.

  18. CBEI: Broker Training - Placing Value on Energy Retrofits - 2015 Peer

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Review | Department of Energy Broker Training - Placing Value on Energy Retrofits - 2015 Peer Review CBEI: Broker Training - Placing Value on Energy Retrofits - 2015 Peer Review Presenter: Susan Wachter, University of Pennsylvania View the Presentation PDF icon CBEI: Broker Training - Placing Value on Energy Retrofits - 2015 Peer Review More Documents & Publications Market Engagement Overview - 2015 BTO Peer Review Commercial Buildings Integration Program Overview - 2015 BTO Peer Review

  19. Recommendation 214: Placing more emphasis and priority on evaluating technologies

    Broader source: Energy.gov [DOE]

    The ORSSAB recommends that DOE place more emphasis and priority on evaluating technologies that could make recycling excess materials cost effective.

  20. Sample Memorandum to Reactivate a Directive Placed on Hold (NOTE...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Sample Memorandum to Reactivate a Directive Placed on Hold (NOTE: Per Office of Executive Secretariat procedures, please use Calibri, 12 point font for this memorandum.) (Effective...

  1. Tanglewilde-Thompson Place, Washington: Energy Resources | Open...

    Open Energy Info (EERE)

    Tanglewilde-Thompson Place, Washington: Energy Resources Jump to: navigation, search Equivalent URI DBpedia Coordinates 47.0531597, -122.7822066 Show Map Loading map......

  2. West University Place, Texas: Energy Resources | Open Energy...

    Open Energy Info (EERE)

    is a stub. You can help OpenEI by expanding it. West University Place is a city in Harris County, Texas. It falls under Texas's 7th congressional district.12 References ...

  3. Southside Place, Texas: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    article is a stub. You can help OpenEI by expanding it. Southside Place is a city in Harris County, Texas. It falls under Texas's 7th congressional district.12 References ...

  4. North Brawley Power Plant Placed in Service; Currently Generating...

    Open Energy Info (EERE)

    Placed in Service; Currently Generating 17 MW; Additional Operations Update Jump to: navigation, search OpenEI Reference LibraryAdd to library Web Site: North Brawley Power Plant...

  5. Daniel Wright Junior High School Wins First Place In Hydrogen...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Daniel Wright Junior High School Wins First Place In Hydrogen Fuel Cell Car Contest National "Battle of the Brains" continues June 23-24 at the University of Denver June 23, 2006 ...

  6. Greensburg, Kansas: A Better, Greener Place to Live (Revised) (Brochure) |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy Greensburg, Kansas: A Better, Greener Place to Live (Revised) (Brochure) Greensburg, Kansas: A Better, Greener Place to Live (Revised) (Brochure) Content includes EERE subject matter and mentions DOE's role in rebuilding. The layout is designed to be used as a template for other cities in similar situations. PDF icon 45086.pdf More Documents & Publications A Tale of Two Cities: Greensburg Rebuilds as a National Model for Green Communities (Fact Sheet) DOE and NREL

  7. Bright Lights From Dark Places | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    From Dark Places Bright Lights From Dark Places May 23, 2011 - 2:09pm Addthis Charles Rousseaux Charles Rousseaux Senior Communications Specialist (detailee) What are the key facts? Scientists used the illumination of some 14,000 quasars -- powered by gigantic black holes at the heart of galaxies -- about 10 to 12 billion light years away to create the new map. Scientists at the Energy Department's national labs are using black holes to illuminate the distant parts of the universe in detail.

  8. Air Leaks in Unexpected Places | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Air Leaks in Unexpected Places Air Leaks in Unexpected Places February 3, 2015 - 9:58am Addthis Sealing air leaks will help to decrease heating and cooling costs and make your home more comfortable. | Photo courtesy of Dennis Schroeder, National Renewable Energy Laboratory Sealing air leaks will help to decrease heating and cooling costs and make your home more comfortable. | Photo courtesy of Dennis Schroeder, National Renewable Energy Laboratory Elizabeth Spencer Communicator, National

  9. Boise State University Places First in DOE's Collegiate Wind Competition

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    2015 | Department of Energy Boise State University Places First in DOE's Collegiate Wind Competition 2015 Boise State University Places First in DOE's Collegiate Wind Competition 2015 September 15, 2015 - 3:28pm Addthis Collegiate Wind Competition 2015 participants and judges at the National Wind Technology Center at the National Renewable Energy Laboratory. <em>Photo by Lee Jay Fingersh</em> Collegiate Wind Competition 2015 participants and judges at the National Wind Technology

  10. The Place Where Emergency Care Belongs | GE Global Research

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Place Where Emergency Care Belongs Click to email this to a friend (Opens in new window) Share on Facebook (Opens in new window) Click to share (Opens in new window) Click to share on LinkedIn (Opens in new window) Click to share on Tumblr (Opens in new window) The Place Where Emergency Care Belongs Jason Castle 2013.05.23 The average adult's heart beats about 70 times a minute. With each beat, the left ventricle of your heart is pumping blood throughout your body, delivering the nutrients

  11. EXO project equipment successfully placed underground at WIPP

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    DOE Carlsbad Field Office (505) 234-7327 Dennis.hurtt@wipp.ws http://www.wipp.energy.gov U.S. Department of Energy Carlsbad Field Office Waste Isolation Pilot Plant P.O. Box 3090 Carlsbad, New Mexico 88221 DOENews For Immediate Release EXO project equipment successfully placed underground at WIPP Carlsbad, NM July 24, 2007 - The first two clean room modules for the Enriched Xenon Observatory (EXO) project have been successfully placed in the U.S. Department of Energy's (DOE) Waste Isolation

  12. 36 CFR Part 60 – National Register of Historic Places

    Broader source: Energy.gov [DOE]

    Title 36 of the Code of Federal Regulations (36 CFR) Part 60 sets forth the procedural requirements for listing properties on the National Register of Historic Places. The National Historic Preservation Act of 1966 (16 U.S.C. 470 et seq., as amended) authorizes the Secretary of the Interior to expand and maintain a National Register of districts, sites, buildings, structures, and objects significant in American history, architecture, archaeology, engineering, and culture.

  13. 36 CFR Part 60: National Register of Historic Places (1981)

    Broader source: Energy.gov [DOE]

    Title 36 of the Code of Federal Regulations (36 CFR) Part 60 sets forth the procedural requirements for listing properties on the National Register of Historic Places. The National Historic Preservation Act of 1966 (16 U.S.C. 470 et seq., as amended) authorizes the Secretary of the Interior to expand and maintain a National Register of districts, sites, buildings, structures, and objects significant in American history, architecture, archaeology, engineering, and culture.

  14. Sandia's Continuously Recirculating Falling-Particle Receiver Placed Atop

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    the Solar Tower Continuously Recirculating Falling-Particle Receiver Placed Atop the Solar Tower - Sandia Energy Energy Search Icon Sandia Home Locations Contact Us Employee Locator Energy & Climate Secure & Sustainable Energy Future Stationary Power Energy Conversion Efficiency Solar Energy Wind Energy Water Power Supercritical CO2 Geothermal Natural Gas Safety, Security & Resilience of the Energy Infrastructure Energy Storage Nuclear Power & Engineering Grid Modernization

  15. Go Green Save Fuel LLC | Open Energy Information

    Open Energy Info (EERE)

    Go Green Save Fuel LLC Jump to: navigation, search Name: Go Green Save Fuel, LLC Place: Seattle, Washington Zip: 98134 Sector: Carbon Product: Seattle-based lobbyist seeking to...

  16. Making the "Best Place to Live" Even Better

    Broader source: Energy.gov [DOE]

    For 2010, the appropriately named Eden Prairie, Minnesota was honored as the No. 1 Best Place to Live in the United States by Money Magazine. The highly-coveted civic title reflects many aspects of the family-friendly suburb of 62,000 located 16 miles from downtown Minneapolis, including the advantages of being the home to major employers like Fortune 500 trucking company C.H. Robinson and hearing-aid maker Starkey Labs. The city also hass many natural amenities like 17 lakes and parks with 125 miles of running, hiking, and biking trails.

  17. BPA-2015-00475-FOIA Correspondence

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    FREEDOM OF INFORMATION ACT PROGRAM In reply refer to: FOIA BPA-2015-00475 Ben Tansey, Senior Contributing Editor Energy NewsData Publications 3400 25 1 h Avenue W, 401 Seattle,...

  18. Department

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    March 25,2010 Mr. Mel Crawford MacDonald Hoague & Bayless 705 Second Avenue, Suite 1500 Seattle, Washington 98104 Dear Mr. Crawford: FREEDOM OF INFORMATION ACT REQUEST (FOr...

  19. Morris. Alexander From: Sent: To: Subject: FOIA-Central@hq.doe...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    12:04 PM FOIA-CentraJ DOE Headquarters FOIA Request Name:l crawfor Organization: MacDonald Hoague & Bayless FAX: 2063433961 Address: 705 Second Avenue Suite 1500 Seattle I WA...

  20. BPA-2014-01135-FOIA Correspondence

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Daniel Crowner Patterson, Buchanan, Fobes & Leitch, Inc., P.S. 2112 Third Avenue, Suite 500 Seattle, WA 98121 FOIA BPA-2014-01135-F Dear Mr. Crowner: We have received your request...

  1. Department

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Richland Operations Office . P.O. Box 550 Richland, Washington 99352 May 17,2010 Certified Mail Mr. Glenn Draper Bergman Draper & Frockt 614 First Avenue, Third Floor Seattle,...

  2. Department

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    20, 2010 Mr. James Burns Law Offices of James Burns, P.S. 2200 Fourth Avenue Seattle, Washington 98121-2087 Dear Mr. Bums: FREEDOM OF INFORMATION ACT REQUEST (FOI 2010-01283) You...

  3. Mithun | Open Energy Information

    Open Energy Info (EERE)

    to: navigation, search Name: Mithun Place: Seattle, Washington Zip: 981012913 Sector: Buildings Product: Focused on design of sustainable places, buildings and neighborhoods....

  4. Sheltering in Place | U.S. DOE Office of Science (SC)

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Emergency Information Emergency Information Home Public Notifications Emergency Vocabulary Sheltering in Place Evacuation ISC Home Sheltering in Place Print Text Size: A A A...

  5. Ames Site Ofice 9800 South Cass Avenue

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    NATIONAL ENVIRONMENTAL POLICY ACT (NEPA) PLANNING SUMMARY Section 5(a)(7) of DOE Order 451.1B Change 3, NEPA Compliance Program, requires each Secretarial Officer and Head of ...

  6. Ames Site Office 9800 South Cass Avenue

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    with Ames Laboratory staff determined that we have no Environmental Impacts Statements or Environmental Assessments either ongoing or forecast for the next 12 to 24 months. ...

  7. Chicago Operations Office 9800 South Cass Avenue

    Office of Legacy Management (LM)

    THE DOW CHEMICAL COMPANY On December 8, 1977, Edward J. Jascewsky, Department of Energy (DOE), and Walter Smith, Argonne National Laboratory (ANL), visited The Dow Chemical ...

  8. Chicago Operations Office 9800 South Cass Avenue

    Office of Legacy Management (LM)

    and Walter H. Smith, Argonne National Laboratory (AX), visited the University of Arizona. ... A cursory survey of the facility was performed by Ycssrs. Jascevsky and Smith. The ...

  9. CHP at Post Street in Downtown Seattle

    SciTech Connect (OSTI)

    Gent, Stan

    2012-04-12

    The Post Street project had four (4), 7.960 MW, Solar Taurus-70-10801S natural gas combustion turbines. Each turbine equipped with a 40,000 lb/hr heat recovery steam generator (HRSG). The dual-fuel HRSGs was capable of generating steam using gas turbine exhaust heat or surplus electric power. The generation capacity was nominally rated at 29.2 MW. The project as proposed had a fuel rate chargeable to power of 4,900 - 5,880 Btu/kWh dependent on time of year. The CHP plant, when operating at 29.2 MW, can recycle turbine exhaust into supply 145 kpph of steam to SSC per hour. The actual SSC steam loads will vary based on weather, building occupation, plus additions / reductions of customer load served. SSC produces up to 80 kpph of steam from a biomass boiler, which is currently base loaded all year.

  10. Seattle harnessing sun's power | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    a year from the renewable energy produced by solar systems installed at public utility sites. ... anyone anywhere in the country has enough sun to realize renewable energy's benefits. ...

  11. Seattle Gasoline and Diesel Retail Prices

    U.S. Energy Information Administration (EIA) Indexed Site

    All Grades - Conventional Areas 2.359 2.371 2.340 2.362 2.380 2.447 2003-2016 Regular 2.307 2.319 2.285 2.309 2.327 2.393 2003-2016 Conventional Areas 2.307 2.319 2.285 2.309 2.327 ...

  12. SEATTLE HELPS COMMUNITIES POWER BUILDINGS EFFICIENTLY | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ... including free energy assessments, support, and troubleshooting through a business upgrade coordinator, as well as translation services for non-English speaking business owners. ...

  13. 3rd Annual Arctic Encounter Symposium Seattle

    Broader source: Energy.gov [DOE]

    The Arctic Encounter Symposium will convene policymakers, industry leaders, and leading experts to confront the leading issues in Arctic policy, innovation, and development. The two-day program includes two keynote luncheons, expert plenary sessions and breakout sessions.

  14. Spotlight on Seattle, Washington: Community Partnerships Work...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Simultaneously, CPW is set to achieve significant energy, climate, and economic development goals with its 40 partners-setting the city up for program sustainability. Leverage ...

  15. Spotlight on Seattle, Washington: Community Partnerships Work...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Making the Program Work for Contractors Better Buildings - Spotlight on Portland, Oregon; Financing and Incetntives: Use Incentives to Get Attention and Encourage Deep Savings

  16. ASU is a place to be for energy research | Center for Bio-Inspired...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    ASU is a place to be for energy research 1 Nov 2013 Dayn Sommer is a graduate student in ... proton-reduction catalysts....ASU is a place to be for photosynthesis and energy research. ...

  17. Blue Marble Energy | Open Energy Information

    Open Energy Info (EERE)

    Energy Jump to: navigation, search Name: Blue Marble Energy Address: P.O. Box 9190 Place: Seattle, Washington Zip: 98109 Region: Pacific Northwest Area Sector: Biomass Product:...

  18. 3TIER Environmental Forecast Group Inc 3TIER | Open Energy Information

    Open Energy Info (EERE)

    TIER Environmental Forecast Group Inc 3TIER Jump to: navigation, search Name: 3TIER Environmental Forecast Group Inc (3TIER) Place: Seattle, Washington Zip: 98121 Sector: Renewable...

  19. Terra Matters PLLC | Open Energy Information

    Open Energy Info (EERE)

    to: navigation, search Name: Terra Matters, PLLC Place: Seattle, Washington Zip: 98122 Product: Boutique consultancy providing advice on sustainable design and business...

  20. Northwest Biodiesel Network | Open Energy Information

    Open Energy Info (EERE)

    Biodiesel Network Jump to: navigation, search Logo: Northwest Biodiesel Network Name: Northwest Biodiesel Network Address: 6532 Phinney Ave N Place: Seattle, Washington Zip: 98103...

  1. General Biodiesel | Open Energy Information

    Open Energy Info (EERE)

    Biodiesel Jump to: navigation, search Name: General Biodiesel Address: 4034 West Marginal Way Place: Seattle, Washington Zip: 98106 Region: Pacific Northwest Area Sector: Biofuels...

  2. General Biodiesel Incorporated | Open Energy Information

    Open Energy Info (EERE)

    Biodiesel Incorporated Jump to: navigation, search Name: General Biodiesel Incorporated Place: Seattle, Washington Zip: 98136 Product: General BioDiesel", Inc. specializes in...

  3. Northwest National Marine Renewable Energy Center | Open Energy...

    Open Energy Info (EERE)

    Marine Renewable Energy Center Jump to: navigation, search Name: Northwest National Marine Renewable Energy Center Address: 4000 15th Ave Place: Seattle, Washington Zip: 98105...

  4. Rainier Renewable Energy | Open Energy Information

    Open Energy Info (EERE)

    Rainier Renewable Energy Jump to: navigation, search Logo: Rainier Renewable Energy Name: Rainier Renewable Energy Address: 1037 NE 65th Street 152 Place: Seattle, Washington Zip:...

  5. Cruising Equipment Company CECO | Open Energy Information

    Open Energy Info (EERE)

    Equipment Company (CECO) Place: Seattle, Washington Zip: 98107 Product: Maker of pollution control equipment - bought by Xantrex in 2000. Coordinates: 47.60356,...

  6. Clarian Power | Open Energy Information

    Open Energy Info (EERE)

    Power Place: Seattle, Washington Sector: Solar Website: www.clariantechnologies.comma Coordinates: 47.6062095, -122.3320708 Show Map Loading map... "minzoom":false,"mapp...

  7. Blue Marble Energy Corporation | Open Energy Information

    Open Energy Info (EERE)

    Name: Blue Marble Energy Corporation Place: Seattle, Washington Zip: 98108 Sector: Bioenergy Product: Washington State-based firm developing technology to convert biowaste into...

  8. Powerit Solutions | Open Energy Information

    Open Energy Info (EERE)

    Powerit Solutions Jump to: navigation, search Name: Powerit Solutions Address: 568 First Ave South Place: Seattle, Washington Zip: 98104 Region: Pacific Northwest Area Sector:...

  9. Principle Power Inc | Open Energy Information

    Open Energy Info (EERE)

    Principle Power Inc Address: 93 S. Jackson Street Place: Seattle, Washington Zip: 98104 Region: Pacific Northwest Area Sector: Wind energy Product: Developing a method so wind...

  10. Bio Algene | Open Energy Information

    Open Energy Info (EERE)

    Algene Jump to: navigation, search Name: Bio Algene Address: 100 NE Northlake Way Place: Seattle, Washington Zip: 98105 Region: Pacific Northwest Area Sector: Biofuels Product:...

  11. Bio Architecture Lab | Open Energy Information

    Open Energy Info (EERE)

    Architecture Lab Jump to: navigation, search Name: Bio Architecture Lab Address: 454 North 34th Street Place: Seattle, Washington Zip: 98103 Region: Pacific Northwest Area Sector:...

  12. Ecology Environment Inc | Open Energy Information

    Open Energy Info (EERE)

    Environment Inc Jump to: navigation, search Name: Ecology & Environment, Inc. Place: Seattle, Washington Zip: 98104 Product: Environmental consulting firm serving corporate and...

  13. McAdams Wright Ragen | Open Energy Information

    Open Energy Info (EERE)

    Suite 3900 Place: Seattle, Washington Zip: 98104 Region: Pacific Northwest Area Product: Financial Services Number of Employees: 51-200 Phone Number: 206-664-8850 Website:...

  14. Propel Biofuels | Open Energy Information

    Open Energy Info (EERE)

    Propel Biofuels Jump to: navigation, search Name: Propel Biofuels Address: 4444 Woodland Park Ave North Place: Seattle, Washington Zip: 98103 Region: Pacific Northwest Area Sector:...

  15. MicroPlanet Technology Corp formerly HF Capital Corp | Open Energy...

    Open Energy Info (EERE)

    Technology Corp formerly HF Capital Corp Jump to: navigation, search Name: MicroPlanet Technology Corp (formerly HF Capital Corp) Place: Seattle, Washington Zip: 98104 Sector:...

  16. Northwest SEED | Open Energy Information

    Open Energy Info (EERE)

    SEED Jump to: navigation, search Name: Northwest Sustainable Energy for Economic Development (SEED) Address: 1402 3rd Ave. Suite 901 Place: Seattle, WA Zip: 98101 Phone Number:...

  17. PowerIt Solutions | Open Energy Information

    Open Energy Info (EERE)

    Place: Seattle, Washington Zip: 98104 Product: Powerit Solutions provides energy demand response and demand control solutions for industrial and commercial applications....

  18. Washington Technology Center | Open Energy Information

    Open Energy Info (EERE)

    Logo: Washington Technology Center Name: Washington Technology Center Address: 300 Fluke Hall Place: Seattle, Washington Zip: 98195 Region: Pacific Northwest Area Website:...

  19. New Earth Renewable Energy Inc | Open Energy Information

    Open Energy Info (EERE)

    New Earth Renewable Energy Inc Address: 1122 E Pike St Place: Seattle, Washington Zip: 98122 Region: Pacific Northwest Area Sector: Biomass Product: Aspires to develop inexpensive...

  20. Blue C Ltd | Open Energy Information

    Open Energy Info (EERE)

    C Ltd Jump to: navigation, search Name: Blue C, Ltd. Place: Seattle, Washington Zip: 98104 Sector: Renewable Energy Product: An advisory firm providing project and investment...

  1. 2010 DOE National Science Bowl® Photos - First Place Winners...

    Office of Science (SC) Website

    First Place Winners National Science Bowl (NSB) NSB Home About National Science Bowl Contacts Regional Science Bowl Coordinators National Science Bowl FAQ's Alumni Past National ...

  2. EECBG Success Story: Making the "Best Place to Live" Even Better

    Broader source: Energy.gov [DOE]

    One advantage that Eden Prairie, Minnesota, will have going into next year’s Best Place to Live competition will be the energy efficiency upgrades taking place across the city thanks to $626,000 in Energy Efficiency and Conservation Block Grant (EECBG) funding provided through the American Recovery and Reinvestment Act. Learn more.

  3. NASCAR Green Gets First Place in Daytona 500 | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    NASCAR Green Gets First Place in Daytona 500 NASCAR Green Gets First Place in Daytona 500 February 24, 2014 - 12:00am Addthis A story about how fuel cell generators were used at the Daytona 500 is currently posted on the Energy Department's blog. Read NASCAR Green Gets First Place in Daytona 500 to learn more about the potential for fuel cell generators at NASCAR events. Addthis Related Articles At this year's Daytona 500, four fuel cell generators will power some of the broadcast cameras and

  4. Oil and Gas Company Oil and Gas Company Address Place Zip Website

    Open Energy Info (EERE)

    Oil and Gas Company Address Place Zip Website Abu Dhabi National Oil Company Abu Dhabi National Oil Company Abu http www adnoc ae default aspx Al Furat Petroleum Company Al Furat...

  5. Title 36 CFR 60 National Register of Historic Places | Open Energy...

    Open Energy Info (EERE)

    of Historic Places. Published NA Year Signed or Took Effect 1966 Legal Citation 36 C.F.R. 60 DOI Not Provided Check for DOI availability: http:crossref.org Online Internet...

  6. Denver Post Names NREL as a Top Work Place - News Releases |...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    as a Top Work Place April 17, 2013 The U.S. Department of Energy's (DOE) National Renewable Energy Laboratory (NREL) has been recognized by the Denver Post as a "2013 Top Work...

  7. I.C. 42-222 - Appeals -- Change in Point of Diversion, Place...

    Open Energy Info (EERE)

    2 - Appeals -- Change in Point of Diversion, Place of Use, Period of Use, or Nature of Use Jump to: navigation, search OpenEI Reference LibraryAdd to library Legal Document-...

  8. H.A.R. 13-198 - Hawai`i and National Register of Historic Places...

    Open Energy Info (EERE)

    search OpenEI Reference LibraryAdd to library Legal Document- RegulationRegulation: H.A.R. 13-198 - Hawaii and National Register of Historic Places ProgramsLegal Abstract The...

  9. H.A.R. 13-197 - Hawai`i Historic Places Review Board | Open Energy...

    Open Energy Info (EERE)

    search OpenEI Reference LibraryAdd to library Legal Document- RegulationRegulation: H.A.R. 13-197 - Hawaii Historic Places Review BoardLegal Abstract The regulations under this...

  10. Do you believe that atoms stay in place when you observe them...

    Office of Scientific and Technical Information (OSTI)

    Do you believe that atoms stay in place when you observe them in HREM? This content will become publicly available on December 14, 2016 Title: Do you believe that atoms stay in ...

  11. Technical Basis for Work Place Air Monitoring for the Plutonium Finishing Plan (PFP)

    SciTech Connect (OSTI)

    JONES, R.A.

    1999-10-06

    This document establishes the basis for the Plutonium Finishing Plant's (PFP) work place air monitoring program in accordance with the following requirements: Title 10, Code of Federal Regulations (CFR), Part 835 ''Occupational Radiation Protection''; Hanford Site Radiological Control Manual (HSRCM-1); HNF-PRO-33 1, Work Place Air Monitoring; WHC-SD-CP-SAR-021, Plutonium Finishing Plant Final Safety Analysis Report; and Applicable recognized national standards invoked by DOE Orders and Policies.

  12. Make the World a Better Place (Program Document) | SciTech Connect

    Office of Scientific and Technical Information (OSTI)

    Program Document: Make the World a Better Place Citation Details In-Document Search Title: Make the World a Better Place Representing the Center for Frontiers of Subsurface Energy Security (CFSES), this document is one of the entries in the Ten Hundred and One Word Challenge. As part of the challenge, the 46 Energy Frontier Research Centers were invited to represent their science in images, cartoons, photos, words and original paintings, but any descriptions or words could only use the 1000 most

  13. Summary of the ergonomic assessments of selected EG G Idaho work places

    SciTech Connect (OSTI)

    Ostrom, L.T.; Gilbert, B.G.; Wilhelmsen, C.A.

    1991-07-01

    The purpose of this document is to describe the methodology, summarize the findings, and present the recommendations from ergonomic assessments at selected EG G Idaho work places. Members from EG G Idaho's Human Factors Research Unit formed an ergonomics team and performed this work from January to July 1991 as part of the Industrial Hygiene Initiative. The ergonomics team developed an assessment checklist as the first step in the process. They then used the checklist to conduct ergonomic assessments of selected work places. The findings from the ergonomic assessments showed that there were situations in every work place visited that have the potential of causing ergonomic problems. In most cases, however, they were not serious in nature. Recommendations include (a) having an industrial hygienist review new work place and task designs to ensure they incorporate ergonomic principles, (b) having an industrial hygienist help investigate musculoskeletal injuries, (c) ensuring all employees receive training on the caused of back injuries and cumulative trauma disorders, and (d) ensuring that a source of ergonomically designed furniture and equipment is available. A summary of specific findings and recommendations from work place assessments is also included. 13 refs., 1 tab.

  14. Third Annual Science Alliance Takes Place in Ohio | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Annual Science Alliance Takes Place in Ohio Third Annual Science Alliance Takes Place in Ohio October 9, 2012 - 12:14pm Addthis Science Alliance 1 of 5 Science Alliance Students arrive at the welcome tent during the beginning of the two-day Science Alliance, in which more than 900 area high school juniors enjoyed presentations in 14 separate areas on a midway in the X-2207A parking lot. Image: Energy Department's Office of Environmental Management Date taken: 2012-09-25 08:59 Science Alliance 2

  15. NASCAR Green Gets First Place in Daytona 500 | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    NASCAR Green Gets First Place in Daytona 500 NASCAR Green Gets First Place in Daytona 500 February 21, 2014 - 10:20am Addthis At this year's Daytona 500, four fuel cell generators will power some of the broadcast cameras and spotlights, demonstrating how the technology could help NASCAR save money on fuel costs. This technology was beta-tested during the IMSA Rolex 24 race weekend last month. | Photo courtesy of P.T. Jones, Oak Ridge National Lab. At this year's Daytona 500, four fuel cell

  16. Smith Middle School Takes First Place at Science Bowl Hydrogen Fuel Cell

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Car Competition - News Releases | NREL Smith Middle School Takes First Place at Science Bowl Hydrogen Fuel Cell Car Competition National "Battle of the Brains" continues June 25 with academic face off June 24, 2005 Golden, Colo. - Smith Middle School from Chapel Hill, N.C., captured top place in the model hydrogen fuel cell competition on the first day of the National Middle School Science Bowl. St. Andrew's Episcopal School, from Amarillo, Texas, took second and Robert Frost

  17. How High Up Is That Place? How Far In The Future Is That Event? - D

    Office of Scientific and Technical Information (OSTI)

    D. How far apart were those events? How did Einstein conclude that space and time are related in this way? We can get a better idea by switching things around. We've been looking at how events in different places can either occur at the same time or at different times in different frames of reference. Now, let's take another look at the earlier events of your picking up and putting down your phone, which occurred at different times, but in the same or different places according to the frame of

  18. Science on the Hill: Portable MRI might make the world a better place

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Portable MRI might make the world a better placer Science on the Hill: Portable MRI might make the world a better place Los Alamos' Battlefield MRI uses ultra-low-field magnetic resonance imaging to create images of the brain that can be used in field hospitals or in remote villages. August 9, 2015 portable mri Portable MRI systems created by Lab researchers can be used in battlefield hospitals. Science on the Hill: Portable MRI might make the world a better place Science moves forw--ard in

  19. Argonne named a 'Best Place' to work for postdocs in 2010 | Argonne

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    National Laboratory named a 'Best Place' to work for postdocs in 2010 February 25, 2010 Tweet EmailPrint The Department of Energy's (DOE) Argonne National Laboratory is one of the best places in the country for postdocs to work, according to a survey released today by the life sciences magazine, The Scientist. Argonne ranked 11th in the survey, honored by the magazine for its effort to help postdocs navigate their careers. The laboratory also received high marks for its open door

  20. Y-12, Making the World a Safer Place | Y-12 National Security Complex

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    , Making the World a ... Y-12, Making the World a Safer Place The mp4 video format is not supported by this browser. Download video Time: 8:23 min. A look at past and current missions that could be accomplished only at Y-12

  1. Support for solar energy: Examining sense of place and utility-scale development in California

    DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

    Carlisle, Juliet E.; Kane, Stephanie L.; Solan, David; Joe, Jeffrey C.

    2014-08-20

    As solar costs have declined PV systems have experienced considerable growth since 2003, especially in China, Japan, Germany, and the U.S. Thus, a more nuanced understanding of a particular public's attitudes toward utility-scale solar development, as it arrives in a market and region, is warranted and will likely be instructive for other areas in the world where this type of development will occur in the near future. Using data collected from a 2013 telephone survey (N=594) from the six Southern Californian counties selected based on existing and proposed solar developments and available suitable land, we examine public attitudes toward solarmore » energy and construction of large-scale solar facilities, testing whether attitudes toward such developments are the result of sense of place and attachment to place. Overall, we have mixed results. Place attachment and sense of place fail to produce significant effects except in terms of perceived positive benefits. That is, respondents interpret the change resulting from large-scale solar development in a positive way insofar as perceived positive economic impacts are positively related to support for nearby large-scale construction.« less

  2. Support for solar energy: Examining sense of place and utility-scale development in California

    SciTech Connect (OSTI)

    Juliet E. Carlisle; Stephanie L. Kane; David Solan; Jeffrey C. Joe

    2015-07-01

    As solar costs have declined PV systems have experienced considerable growth since 2003, especially in China, Japan, Germany, and the U.S. Thus, a more nuanced understanding of a particular public's attitudes toward utility-scale solar development, as it arrives in a market and region, is warranted and will likely be instructive for other areas in the world where this type of development will occur in the near future. Using data collected from a 2013 telephone survey (N = 594) from the six Southern Californian counties selected based on existing and proposed solar developments and available suitable land, we examine public attitudes toward solar energy and construction of large-scale solar facilities, testing whether attitudes toward such developments are the result of sense of place and attachment to place. Overall, we have mixed results. Place attachment and sense of place fail to produce significant effects except in terms of perceived positive benefits. That is, respondents interpret the change resulting from large-scale solar development in a positive way insofar as perceived positive economic impacts are positively related to support for nearby large-scale construction.

  3. Support for solar energy: Examining sense of place and utility-scale development in California

    SciTech Connect (OSTI)

    Carlisle, Juliet E.; Kane, Stephanie L.; Solan, David; Joe, Jeffrey C.

    2014-08-20

    As solar costs have declined PV systems have experienced considerable growth since 2003, especially in China, Japan, Germany, and the U.S. Thus, a more nuanced understanding of a particular public's attitudes toward utility-scale solar development, as it arrives in a market and region, is warranted and will likely be instructive for other areas in the world where this type of development will occur in the near future. Using data collected from a 2013 telephone survey (N=594) from the six Southern Californian counties selected based on existing and proposed solar developments and available suitable land, we examine public attitudes toward solar energy and construction of large-scale solar facilities, testing whether attitudes toward such developments are the result of sense of place and attachment to place. Overall, we have mixed results. Place attachment and sense of place fail to produce significant effects except in terms of perceived positive benefits. That is, respondents interpret the change resulting from large-scale solar development in a positive way insofar as perceived positive economic impacts are positively related to support for nearby large-scale construction.

  4. Rigless multizone recompletion using a cement packer placed with coiled tubing: A case history

    SciTech Connect (OSTI)

    Nowak, T.W.; Patout, T.S.

    1997-12-01

    Cement packers have been used for some time when reserve estimates have not justified the cost of major rig remedial work. They typically provide a means of zonal isolation of the last reserves in an existing wellbore. The success of these operations has historically been low. This is predominantly because of poor cement bonding in the annulus between the tubing and production casing. Because of the minimal amount of equipment on location and lack of upfront design work involved, most cement packers are doomed to failure before they are even placed. Cement packers have been placed using a large number of methods. In the Ship Shoal 181 field, Well B-4 would not economically justify a major rig workover, even though there were several uphole gas sands capable of producing in this well. With proper upfront planning and design, it would be economical; however, all these reserves could be produced in a through-tubing process using a cement packer. This case history presents a refined look at existing technology involving placement of a cement packer and reviews problems common to cement-packer completions, including a case history. Solutions are also discussed for successfully completing and recovering reserves from not one but several remaining gas intervals. This paper reviews the design considerations and precautions, along with the production results and economics, for placing what is believed to be the largest cement packer placed through coiled tubing.

  5. Hanford Waste Treatment Plant places first complex piping module in Pretreatment Facility

    Broader source: Energy.gov [DOE]

    Crews at the Hanford Waste Treatment Plant, also known as the "Vit Plant," placed a 19-ton piping module inside the Pretreatment Facility. The module was lifted over 98-foot-tall walls and lowered into a space that provided less than two inches of clearance on each side and just a few feet on each end. It was set 56 feet above the ground.

  6. Groundwater was the focus of a special tour that took place recently at

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    was the focus of a special tour that took place recently at the Nevada National Security Site (NNSS). The small tour group, composed mainly of members of the public, got an up-close look at the extensive work that goes into the well operations, groundwater sampling, and monitoring programs at the Site. These activities are helping scientists better understand the movement of contamination resulting from historic underground nuclear tests. "This was an opportunity for some citizens to see

  7. Ant Colony Optimization for Mapping, Scheduling and Placing in Reconfigurable Systems

    SciTech Connect (OSTI)

    Ferrandi, Fabrizio; Lanzi, Pier Luca; Pilato, Christian; Sciuto, Donatella; Tumeo, Antonino

    2013-06-24

    Modern heterogeneous embedded platforms, com- posed of several digital signal, application specific and general purpose processors, also include reconfigurable devices support- ing partial dynamic reconfiguration. These devices can change the behavior of some of their parts during execution, allowing hardware acceleration of more sections of the applications. Never- theless, partial dynamic reconfiguration imposes severe overheads in terms of latency. For such systems, a critical part of the design phase is deciding on which processing elements (mapping) and when (scheduling) executing a task, but also how to place them on the reconfigurable device to guarantee the most efficient reuse of the programmable logic. In this paper we propose an algorithm based on Ant Colony Optimization (ACO) that simultaneously executes the scheduling, the mapping and the linear placing of tasks, hiding reconfiguration overheads through prefetching. Our heuristic gradually constructs solutions and then searches around the best ones, cutting out non-promising areas of the design space. We show how to consider the partial dynamic reconfiguration constraints in the scheduling, placing and mapping problems and compare our formulation to other heuristics that address the same problems. We demonstrate that our proposal is more general and robust, and finds better solutions (16.5% in average) with respect to competing solutions.

  8. Mr. Frank Russo, Project Director Bechtel National, Inc. 2435 Stevens Center Place

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    NTO. ~,U.S. Department of Energy P.O. Box 450, MSIN 1-6-60 IAIFSO\Richland, Washington 99352 SEP 1 7 Z012 I 2-WTP-0291 Mr. Frank Russo, Project Director Bechtel National, Inc. 2435 Stevens Center Place Richland. Washington 99354 Dear Mr. Russo: CONTRACT NO. DF-AC27-01 RV 14136 -AWARD ELIF 1)ETERMINATION FOR PERIO[D 2 012 -A References: 1 . Contract No. DE-AC27-()IRV 14136 -Section 13.7 Ax\ ard Fee Administration. 2. Performance Evaluation and Measurement Plan (PFN'P) for Award Fee Period 2012-A.

  9. An environmental sampling model for combining judgment and randomly placed samples

    SciTech Connect (OSTI)

    Sego, Landon H.; Anderson, Kevin K.; Matzke, Brett D.; Sieber, Karl; Shulman, Stanley; Bennett, James; Gillen, M.; Wilson, John E.; Pulsipher, Brent A.

    2007-08-23

    In the event of the release of a lethal agent (such as anthrax) inside a building, law enforcement and public health responders take samples to identify and characterize the contamination. Sample locations may be rapidly chosen based on available incident details and professional judgment. To achieve greater confidence of whether or not a room or zone was contaminated, or to certify that detectable contamination is not present after decontamination, we consider a Bayesian model for combining the information gained from both judgment and randomly placed samples. We investigate the sensitivity of the model to the parameter inputs and make recommendations for its practical use.

  10. In-place stabilization of pond ash deposits by hydrated lime columns

    SciTech Connect (OSTI)

    Chand, S.K.; Subbarao, C.

    2007-12-15

    Abandoned coal ash ponds cover up vast stretches of precious land and cause environmental problems. Application of suitable in situ stabilization methods may bring about improvement in the geotechnical properties of the ash deposit as a whole, converting it to a usable site. In this study, a technique of in-place stabilization by hydrated lime columns was applied to large-scale laboratory models of ash ponds. Samples collected from different radial distances and different depths of the ash deposit were tested to study the improvements in the water content, dry density, particle size distribution, unconfined compressive strength, pH, hydraulic conductivity, and leachate characteristics over a period of one year. The in-place stabilization by lime column technique has been found effective in increasing the unconfined compressive strength and reducing hydraulic conductivity of pond ash deposits in addition to modifying other geotechnical parameters. The method has also proved to be useful in reducing the contamination potential of the ash leachates, thus mitigating the adverse environmental effects of ash deposits.

  11. Chggo Operations and Reglonal Offlce 9000 South Cass Avenue

    Office of Legacy Management (LM)

    ... split with the Ames Laboratory Health Physics Group.for the purpose of cross-checking ... Group utilizing a method similar to that employed by the Ames Health Physics Group. ...

  12. Forrestal Building, 1000 Independence Avenue, S.W.,

    U.S. Energy Information Administration (EIA) Indexed Site

    ... And we're looking in our strategic plan at a more systematic ... a little bit later is the changing demographics of EIA, and ... the National Center for Education Statistics that had very ...

  13. Forrestal Building, 1000 Independence Avenue, S.W.,

    U.S. Energy Information Administration (EIA) Indexed Site

    ... It just takes time to sit down and do it, set up a system. MR. WOOD: By the ... this way, the number of wells in the class is more like a 50 percent change as you come down the class. ...

  14. The Honorable Gary Loster 1315 S. Washington Avenue

    Office of Legacy Management (LM)

    W. Alerander Williams (301-427-1719) of my staff. Sincer ly, 4 z&a Oames W. Wagoner II" Director Off-SiteSavannah River Division Office of Eastern Area Programs Office of ...

  15. DOE ZERH Case Study: Sunroc Builders, Bates Avenue, Lakeland, FL

    SciTech Connect (OSTI)

    none,

    2015-09-01

    Case study of a DOE 2015 Housing Innovation Award winning affordable home in the hot-humid climate that got HERS 57 without PV, with 6.5” SIP walls and 8.25” SIP roof; uninsulated slab foundation; fresh air intake; SEER 16 ducted air source heat pump.

  16. ARGONNE NATIONAL LABORATORY 9700 South Cass Avenue, Argonne, Illinois 60439

    Office of Legacy Management (LM)

    DEMONSTRATION OF THE EFFECTIVENESS OF ABRASIVE BLASTING TECHNIQUES FOR DECONTAMINATING CONCRETE PADS AT THE ELZA GATE SITE, OAK RIDGE, TENNESSEE by Energy and Environmental Systems Division May 1989 work supported by U.S. DEPARTMENT OF ENERGY Oak Ridge Operations Technical Services Division Oak Ridge, Tennessee CONTENTS 1 SUMMARY ................................................ ............ 1 2 SITE DESCRIPTION AND HISTORY ....................................... 2 3 RADIOACTIVE CONTAMINATION AND

  17. Elimination'Recommendatc Crane Company 4100 South Kedzie Avenue

    Office of Legacy Management (LM)

    functions: in the development of valves and in the supply of uranium and thorium metals. ... other MED activity in which Crane was involved was as a supplier of uranium and thorium. ...

  18. U.S. Department of Energy 1000 Independence Avenue, SW

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Cooperative Association (NRECA), the Natural Resources Defense Council (NRDC), and the American Council for an Energy-Efficient Economy (ACEEE) supporting the Application for ...

  19. Chicago Operations Off ice 9800 South Cass Avenue

    Office of Legacy Management (LM)

    Department of Energy (DOE), and Walter H. Smith, Argonne National Laboratory (ANL), ... This area was completely surveyed by Messrs. Jascewsky and Smith using an Eberline gas ...

  20. The Honorable John T. 'Gregorio 301 N. Wood Avenue

    Office of Legacy Management (LM)

    Wagoner II I. Director Off-SiteSavannah River Program Division 0ffice:of Eastern Area ... Linden, NJ 07036 Former name at site: Linden Pilot Plant of the Chemical Construction ...

  1. Chicago Operations Off ice 9800 South Cass Avenue

    Office of Legacy Management (LM)

    I I I inois 60439 DEC 2 3 1977 James L. Liverman, Acting Assistant Secretary for Environment, HQ COLORADO SCHOOL OF MINES On December 7, 1977, Edward J. Jascewsky, Department of Energy (DOE), and Walter H. Smith, Argonne National Laboratory (ANL), visited the Colorado School of Mines Research Institute (CSMRI). The purpose of the visit was to discuss the past operations at these facilities that involved work under Atomic Energy Commission (AEC), Contract AT(49-6)-916 and AT(O5-l)-462. The former

  2. Chicago Operations Off ice 9800 South Cass Avenue

    Office of Legacy Management (LM)

    3 1977 James L. Liverman, Acting Assistant Secretary for Environment, HQ BUREAU OF MINES - UTAH On November 28, 1977, Edward J. Jascewsky, Department of Energy (DOE), and Walter H. Smith, Argonne National Laboratory (ANL), visited the U. S. Bureau of Mines Metallurgy Research Center in Salt Lake City, Utah. The purpose of the visit was to discuss the past operations at the facility that involved work under an Atomic Energy Commission (AEC) contract during the early 1950's. The work performed

  3. Chicago Operations Off ice 9800 South Cass Avenue

    Office of Legacy Management (LM)

    8 1977, James L. Liver-man, Acting Assistant Secretary for Environment, HQ UNIVERSITY OF UTAH On November 29, 1977, Edward J. Jascewsky, Department of Energy (DOE), and Walter H. Smith, Argonne National Laboratory (ANL), visited the University of Utah's Medical Research Center and the School of Mines. The purpose of the visit was to discuss the past operations at these facilities that involved work under an Atomic Energy Commission (AEC) contract during the early 1950's. Personnel visited at the

  4. 1010 Avenue of the Arts, New School & Performing Arts Theater

    Broader source: Energy.gov [DOE]

    Project objectives: Demonstrate the feasibility of using geothermal energy at a historically certified urban educational and arts institution. Create a replicable financing model for using geothermal technology at educational and non-profit institutions throughout the region.

  5. DOE Tour of Zero: Bates Avenue by Sunroc Builders | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    The high-efficiency windows use advanced technology coatings and argon gas between two panes to reduce heat transfer. 7 of 15 The home is equipped with a programmable thermostat to ...

  6. DOE Tour of Zero: Bates Avenue by Sunroc Builders | Department...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    The kitchen is equipped with an energy-saving ENERGY STAR-certified refrigerator and dishwasher. 5 of 15 EPA WaterSense-labeled fixtures save water in the bathrooms. 6 of 15 The ...

  7. ARGONNE NATIONAL LABORATORY 9700 South Cass Avenue, Argonne, Illinois 60439

    Office of Legacy Management (LM)

    DERIVATION OF A URANIUM RESIDUAL RADIOACTIVITY GUIDELINE FOR THE NATIONAL GUARD ARMORY IN CHICAGO, ILLINOIS prepared by Charley Yu and John M. Peterson Energy and Environmental Systems Division May 1987 work sponsored by U.S. DEPARTMENT OF ENERGY Oak Ridge Operations Office II-3 CONTENTS . 1 ABSTRACT ............................................................ 1 1 HISTORY AND SUMMARY OF EXISTING CONDITIONS . ............ ....... 1 2 SCENARIO DEFINITIONS

  8. ARGONNE NATIONAL LABORATORY 9700 South Cass Avenue, Argonne, Illinois 60439

    Office of Legacy Management (LM)

    PROPOSED REMEDIAL ACTION ACTIVITIES AT THE UNIVERSITY OF CHICAGO by Energy and Environmental Systems Division :0 July 1987 work supported by U.S. DEPARTMENT OF ENERGY Oak Ridge Operations Technical Services Division Oak Ridge, Tennessee II-49 --- _______ ________________________--- CONTENTS 1 SUMMARY OF PROPOSED ACTION ...................... ................ 1 2 HISTORY AND NEED FOR ACTION ....................................... 3 W* 2.1 General Setting

  9. Visual probes and methods for placing visual probes into subsurface areas

    DOE Patents [OSTI]

    Clark, Don T.; Erickson, Eugene E.; Casper, William L.; Everett, David M.

    2004-11-23

    Visual probes and methods for placing visual probes into subsurface areas in either contaminated or non-contaminated sites are described. In one implementation, the method includes driving at least a portion of a visual probe into the ground using direct push, sonic drilling, or a combination of direct push and sonic drilling. Such is accomplished without providing an open pathway for contaminants or fugitive gases to reach the surface. According to one implementation, the invention includes an entry segment configured for insertion into the ground or through difficult materials (e.g., concrete, steel, asphalt, metals, or items associated with waste), at least one extension segment configured to selectively couple with the entry segment, at least one push rod, and a pressure cap. Additional implementations are contemplated.

  10. Indian Community Development Block Grant Program Workshop- Seattle

    Broader source: Energy.gov [DOE]

    The U.S. Department of Housing and Urban Development (HUD) Southwest Office of Native American Programs is conducting this training workshop to assist applicants with the Indian Community Development Block Grant Program.

  11. Solar Works! In Seattle: Introduction to Solar Electric (PV)

    Broader source: Energy.gov [DOE]

    Presentation slides from residential PV workshop. Also covers general solar resource assessment, siting and financial incentives.

  12. City of Seattle - Sustainable Buildings and Sites Policy | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    with over 5,000 square feet of occupied space to achieve a Gold Rating using the US Green Building Council's (USGBC) LEED Rating System. In addition, these projects must meet...

  13. DOE Zero Energy Ready Home: Montlake Modern- Seattle, Washington

    Broader source: Energy.gov [DOE]

    This DOE Zero Energy Ready Home features structural insulated panel walls and roof, an air-to-water heat pump plus radiant floor heat; 100% LED lighting; filtered-fan-powered fresh air intake; triple-pane windows, and 9.7 kWh PV for electric car charging station.

  14. City of Seattle- Community Power Works Loan Program

    Broader source: Energy.gov [DOE]

    Once a home is assessed, customers select energy efficiency improvements, choose a contractor from a pool of approved contractors, and apply for financing.  Loan amounts are calculated after fact...

  15. City of Seattle, Washington (Utility Company) | Open Energy Informatio...

    Open Energy Info (EERE)

    27,512 519,210 39,402 4,885 105,963 220 3 50 3 55,758 999,805 391,180 2008-12 15,946 266,607 350,675 24,130 441,877 39,392 4,551 95,303 219 3 56 3 44,630 803,843 390,289 2008-11...

  16. Seattle, Washington, Summary of Reported Data From July 1, 2010...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ... These partners help overcome language barriers that have prevented participation i n energy efficiency programs thanks to their expertise in 15 languages, including Spanish, ...

  17. Data-Driven Mailing Helps Heat Up Untapped Seattle Market

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ... you're probably reaching folks who aren't strong prospects for energy efficiency upgrades. ... Whether it's the age of the home, heating source, or age of the families living there, use ...

  18. City of Seattle, Washington (Utility Company) | Open Energy Informatio...

    Open Energy Info (EERE)

    ) OTH SALES (MWH) OTH CONS TOT REV (THOUSAND ) TOT SALES (MWH) TOT CONS 2009-03 23,601 373,913 353,104 24,986 456,778 39,325 4,440 92,495 220 3 47 3 53,030 923,233 392,652...

  19. Northwest Distributed/Community Wind Workgroup Meeting- Seattle

    Broader source: Energy.gov [DOE]

    As part of the DOE's Northwest Wind Resource and Action Center, Northwest SEED will facilitate a workgroup meeting for stakeholders involved in the distributed and community wind sector in the...

  20. Washington: Seattle Rises Above with Alternative Fuels | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    on fuel due to the cost differential between compresses natural gas (CNG) and gasoline. ... who was a veteran started a taxi company with a 100% alternative fuel fleet-CNG For Hire. ...

  1. Seattle City Light - Multi-Family Residential Energy Efficiency...

    Broader source: Energy.gov (indexed) [DOE]

    for common area lighting and weatherization measures including the installation of dual-pane windows and increased insulation, although insulation-only jobs are not eligible...

  2. DOE ZERH Case Study: Dwell Development, Reclaimed Modern, Seattle, WA

    SciTech Connect (OSTI)

    none,

    2015-09-01

    Case study of a DOE 2015 Housing Innovation Award winning custom home in the cold climate that got a HERS 30 without PV, with 2x8 24” on center walls with blown fiberglass and 4” polysio rigid foam; basement with 2” XPS interior, 4” under slab, 4” exterior of foundation wall; vented attic with R-100 blown cellulose; wo air-to-air heat pumps SEER 14.1; HSPF 9.6; heat pump water heater.

  3. A Marvel of Science and History is a Must-See in the Northwest | Department

    Broader source: Energy.gov (indexed) [DOE]

    of Energy Hanford makes a Seattle list of best places to visit in the Northwest. | Energy Department Photo Hanford makes a Seattle list of best places to visit in the Northwest. | Energy Department Photo Mékell Mikell Mékell Mikell Stakeholder Engagement Director The B Reactor National Historic Landmark tour and the Hanford Site cleanup tour in Washington State are getting a positive reaction from Seattle Met magazine. The publication added the historical tours to its list of best places

  4. Registration Starts Soon for Hanford's Two Annual Public Tour...

    Broader source: Energy.gov (indexed) [DOE]

    2011 Hanford Tours Hanford makes a Seattle list of best places to visit in the Northwest. | Energy Department Photo A Marvel of Science and History is a Must-See in the Northwest...

  5. Sample Memorandum to Reactivate a Directive Placed on Hold (NOTE: Per Office of Executive Secretariat procedures, please use

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Sample Memorandum to Reactivate a Directive Placed on Hold (NOTE: Per Office of Executive Secretariat procedures, please use Calibri, 12 point font for this memorandum.) (Effective April 2014) MEMORANDUM FOR: XXXXXXXXXXXXXXXX ASSOCIATE ADMINISTRATOR FOR MANAGEMENT AND BUDGET THROUGH: INGRID KOLB DIRECTOR, OFFICE OF MANAGEMENT FROM: XXXXXXXXXXXXXXXX XXXXXXXXXXXXXXXX SUBJECT: Request to Reactivate Directive Currently on Hold PURPOSE: The purpose of this memorandum is to request the Directives

  6. Hydraulic and Clean-in-Place Evaluations for a 12.5-cm Annular Centrifugal Contactor at INL

    SciTech Connect (OSTI)

    Troy G. Garn; David H. Meikrantz; Nick R. Mann; Jack D. Law; Terry A. Todd

    2008-09-01

    Hydraulic and Clean-in-Place Evaluations for a 12.5 cm Annular Centrifugal Contactor at the INL Troy G. Garn, Dave H. Meikrantz, Nick R. Mann, Jack D. Law, Terry A. Todd Idaho National Laboratory Commercially available, Annular Centrifugal Contactors (ACC) are currently being evaluated for processing dissolved nuclear fuel solutions to selectively partition integrated elements using solvent extraction technologies. These evaluations include hydraulic and clean-in-place (CIP) testing of a commercially available 12.5 cm unit. Data from these evaluations is used to support design of future nuclear fuel reprocessing facilities. Hydraulic testing provides contactor throughput performance data on two-phase systems for a wide range of operating conditions. Hydraulic testing results on a simple two-phase oil and water system followed by a 30 % Tributyl phosphate in N-dodecane / nitric acid pair are reported. Maximum total throughputs for this size contactor ranged from 20 to 32 liters per minute without significant other phase carryover. A relatively new contactor design enhancement providing Clean-in-Place capability for ACCs was also investigated. Spray nozzles installed into the central rotor shaft allow the rotor internals to be cleaned, offline. Testing of the solids capture of a diatomaceous earth/water slurry feed followed by CIP testing was performed. Solids capture efficiencies of >95% were observed for all tests and short cold water cleaning pulses proved successful at removing solids from the rotor.

  7. Development of NZP ceramic based {open_quotes}cast-in-place{close_quotes} diesel engine port liners

    SciTech Connect (OSTI)

    Nagaswaran, R.; Limaye, S.Y.

    1996-02-01

    BSX (Ba{sub 1+x}Zr{sub 4}P{sub 6-2x}Si{sub 2x}O{sub 24}) and CSX (Ca{sub l-x}Sr{sub x}Zr{sub 4}P{sub 6}O{sub 24}) type NZP ceramics were fabricated and characterized for: (i) thermal properties viz., thermal conductivity, thermal expansion, thermal stability and thermal shock resistance; (ii) mechanical properties viz., flexure strength and elastic modulus; and (iii) microstructures. Results of these tests and analysis indicated that the BS-25 (x=0.25 in BSX) and CS-50 (x=0.50 in CSX) ceramics had the most desirable properties for casting metal with ceramic in place. Finite element analysis (FEA) of metal casting (with ceramic in place) was conducted to analyze thermomechanical stresses generated and determine material property requirements. Actual metal casting trials were also conducted to verify the results of finite element analysis. In initial trials, the ceramic cracked because of the large thermal expansion mismatch (hoop) stresses (predicted by FEA also). A process for introduction of a compliant layer between the metal and ceramic to alleviate such destructive stresses was developed. The compliant layer was successful in preventing cracking of either the ceramic or the metal. In addition to these achievements, pressure slip casting and gel-casting processes for fabrication of NZP components; and acoustic emission and ultrasonics-based NDE techniques for detection of microcracks and internal flaws, respectively, were successfully developed.

  8. Multi-facet concentrator of solar setup for irradiating the objects placed in a target plane with solar light

    DOE Patents [OSTI]

    Lewandowski, Allan A.; Yampolskiy, Vladislav; Alekseev, Valerie; Son, Valentin

    2001-01-01

    According to the proposed invention, this technical result is achieved so that many-facet concentrator of a solar setup for exposure of objects, placed in a target plane, to the action of solar radiation containing a supporting frame and facets differing by that the facets of the concentrator are chosen with spherical focusing reflective surfaces of equal focal lengths and with selective coatings reflecting a desired spectral fraction of solar radiation, and are arranged on the supporting frame symmetrically with respect to the common axis of the concentrator, their optical axes being directed to the single point on the optical axis of the concentrator located before the nominal focus point of the concentrator and determining the position of arranging the target plane.

  9. Effect of doping on growth and field emission properties of spherical carbon nanotube tip placed over cylindrical surface

    SciTech Connect (OSTI)

    Santolia, Isha; Tewari, Aarti; Sharma, Suresh C.; Sharma, Rinku

    2014-06-15

    Theoretical investigations to study the effect of doping of hetero-atoms on the growth and field emission properties of Carbon Nanotubes (CNTs) tip placed over a cylindrical surface in complex plasma have been carried out. A theoretical model incorporating kinetics of plasma species such as electron, ions, and neutral atoms including doping elements like nitrogen (N) and boron (B) and energy balance of CNTs in a complex plasma has been developed. The effect of doping elements of N and B on the growth of CNTs, namely, the tip radius has been carried out for typical glow discharge plasma parameters. It is found that N and B as doping elements affect the radius of CNTs extensively. We obtain small radii of CNT doped with N and large radius of CNT doped with B. The field emission characteristics from CNTs have therefore been suggested on the basis of results obtained. Some of theoretical results are in compliance with the existing experimental observations.

  10. Phase mixing of upper hybrid oscillations in a cold inhomogeneous plasma placed in an inhomogeneous magnetic field

    SciTech Connect (OSTI)

    Sarkar, Anwesa; Maity, Chandan; Chakrabarti, Nikhil

    2013-05-15

    We study phase mixing/wave breaking phenomena of upper hybrid modes in a cold inhomogeneous plasma placed in an inhomogeneous magnetic field. Inhomogeneities both in the background ion density and magnetic field profile are treated as periodic in space but independent in time. The Lagrangian fluid description is employed to obtain an exact solution of this fully nonlinear problem. It is demonstrated that the upper hybrid modes, excited by an initial local charge imbalance, break via phase mixing, induced by the inhomogeneities. It is also shown that it is possible to avoid phase mixing in excited upper hybrid oscillations in an inhomogeneous plasma containing a finite amplitude ion density fluctuation. The choice of external magnetic field is shown to have a key role in avoiding phase mixing in such oscillations. The relevance of our investigation regarding the particle acceleration in an inhomogeneous plasma has also been discussed.

  11. Axial and transverse acoustic radiation forces on a fluid sphere placed arbitrarily in Bessel beam standing wave tweezers

    SciTech Connect (OSTI)

    Mitri, F.G.

    2014-03-15

    The axial and transverse radiation forces on a fluid sphere placed arbitrarily in the acoustical field of Bessel beams of standing waves are evaluated. The three-dimensional components of the time-averaged force are expressed in terms of the beam-shape coefficients of the incident field and the scattering coefficients of the fluid sphere using a partial-wave expansion (PWE) method. Examples are chosen for which the standing wave field is composed of either a zero-order (non-vortex) Bessel beam, or a first-order Bessel vortex beam. It is shown here, that both transverse and axial forces can push or pull the fluid sphere to an equilibrium position depending on the chosen size parameter ka (where k is the wave-number and a the spheres radius). The corresponding results are of particular importance in biophysical applications for the design of lab-on-chip devices operating with Bessel beams standing wave tweezers. Moreover, potential investigations in acoustic levitation and related applications in particle rotation in a vortex beam may benefit from the results of this study. -- Highlights: The axial and transverse forces on a fluid sphere in acoustical Bessel beams tweezers are evaluated. The attraction or repulsion to an equilibrium position in the standing wave field is examined. Potential applications are in particle manipulation using standing waves.

  12. Occupant-in-Place Energy Efficiency Retrofit in a Group Home for 30% Energy Savings in Climate Zone 4

    SciTech Connect (OSTI)

    Moore, Mike

    2013-08-01

    Energy efficiency retrofits (EERs) face many challenges on the path to scalability. Limited budgets, cost effectiveness, risk factors, and accessibility impact the type and the extent of measures that can be implemented feasibly to achieve energy savings goals. Group home retrofits can face additional challenges than those in single family homes – such as reduced access (occupant-in-place restrictions) and lack of incentives for occupant behavioral change. This project studies the specification, implementation, and energy savings from an EER in a group home, with an energy savings goal of 30%. This short term test report chronicles the retrofit measures specified, their projected cost effectiveness using building energy simulations, and the short term test results that were used to characterize pre-retrofit and post-retrofit conditions. Additionally, the final report for the project will include analysis of pre- and post-retrofit performance data on whole building energy use, and an assessment of the energy impact of occupant interface with the building (i.e., window operation). Ultimately, the study’s results will be used to identify cost-effective EER measures that can be implemented in group homes, given constraints that are characteristic of these buildings. Results will also point towards opportunities for future energy savings.

  13. Occupant-in-Place Energy Efficiency Retrofit in a Group Home for 30% Energy Savings in Climate Zone 4

    SciTech Connect (OSTI)

    Moore, M.

    2013-08-01

    Energy efficiency retrofits (EERs) face many challenges on the path to scalability. Limited budgets, cost effectiveness, risk factors, and accessibility impact the type and the extent of measures that can be implemented feasibly to achieve energy savings goals. Group home retrofits can face additional challenges than those in single family homes - such as reduced access (occupant-in-place restrictions) and lack of incentives for occupant behavioral change. This project studies the specification, implementation, and energy savings from an EER in a group home, with an energy savings goal of 30%. This short term test report chronicles the retrofit measures specified, their projected cost-effectiveness using building energy simulations, and the short term test results that were used to characterize pre-retrofit and post-retrofit conditions. Additionally, the final report for the project will include analysis of pre- and post-retrofit performance data on whole building energy use, and an assessment of the energy impact of occupant interface with the building (i.e., window operation). Ultimately, the study's results will be used to identify cost effective EER measures that can be implemented in group homes, given constraints that are characteristic of these buildings. Results will also point towards opportunities for future energy savings.

  14. Measurements of stable isotope ratios in milk samples from a farm placed in the mountains of Transylvania

    SciTech Connect (OSTI)

    Magdas, D. A. Cristea, G. Bot, A.; Puscas, R.; Radu, S.; Mirel, V.; Cordea, D. V.; Mihaiu, M.

    2013-11-13

    Product origin is of great importance for consumers especially because its association in consumer's perception with food quality, freedom from disease or pollution. Stable isotope ratio analysis is a powerful technique in food authenticity and traceability control which has been introduced within the European wine industry to ensure authenticity of wine provenance and to detect adulteration. Isotopic ratios measurements have also been successfully to other food commodities like: fruit juices, honey and dairy foods. The δ{sup 18}O and δ{sup 2}H content in milk water reflects the isotope composition of the ground water drunk by animals. Seasonal effects are also very important: in summer, milk water contains higher δ{sup 18}O and δ{sup 2}H values due to the fresh plants that are ate by animals. Relative carbon stable isotope abundances in total milk reflect the isotopic composition of the diet fed to the dairy cows. In this study the hydrogen, oxygen and carbon isotopic composition of 15 milk samples coming from a unit placed in the mountains of Transylvania was investigated. The distribution of the obtained isotopic values was than discussed taking into account that all the animals were feed with the same type of forage and consumed water was taken from the same source.

  15. file://L:\DOE-hanford.gov\public\boards\hab\advice\advice04.htm

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Chuck Clarke, Regional Administrator U.S. Environmental Protection Agency, Region 10 1200 Sixth Avenue Seattle, WA 98101 Mary Riveland, Director Department of Ecology State of Washington PO Box 47600 Olympia, WA 98504-7600 September 22, 1994 Dear Messrs. Wagoner and Clarke, and Ms. Riveland: On behalf of the Hanford Advisory Board, I am forwarding to you the following statement of concerns, which was adopted by the Board at the September 8 & 9 meeting: The cleanup of contaminated sites and

  16. file://L:\DOE-hanford.gov\public\boards\hab\advice\advice100.ht

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Chuck Clarke, Regional Administrator U.S. Environmental Protection Agency, Region 10 1200 Sixth Avenue Seattle, WA 98101 Tom Fitzsimmons, Director Washington Department of Ecology P.O. Box 47600 Olympia, WA 98504-7600 Keith Klein, Manager U.S. Department of Energy, Richland Operations P.O. Box 550 (A7-50) Richland, WA 99352 Dick French, Manager Office of River Protection 2440 Stevens Center Richland, WA 99352 Subject: TPA Agency Processes for Responding to HAB Consensus Advice Dear Messrs.

  17. file://L:\DOE-hanford.gov\public\boards\hab\advice\advice111.ht

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    0 Keith Klein, Manager U.S. Department of Energy, Richland Operations P.O. Box 550 (A7-50) Richland, WA 99352 Harry Boston, Manager Office of River Protection 2440 Stevens Center Richland, WA 99352 Chuck Findley, Regional Administrator U.S. Environmental Protection Agency, Region 10 1200 Sixth Avenue Seattle, WA 98101 Tom Fitzsimmons, Director Washington Department of Ecology P.O. Box 47600 Olympia, WA 98504-7600 Subject: FY2001 Performance Measures Dear Messrs. Klein, Boston, Findley, and

  18. file://L:\DOE-hanford.gov\public\boards\hab\advice\advice29c.ht

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Riveland, Director The Washington Department of Ecology PO Box 47600 Olympia, WA 98504-7600 Chuck Clarke, Regional Administrator U.S. Environmental Protection Agency, Region 10 1200 Sixth Avenue Seattle, WA 98101 August 11, 1995 Dear Ms. Riveland and Mr. Clarke: RE: Stewardship and Stockpile Scoping Hearings Enclosed is the Hanford Advisory Board's request toUSDOE to extend the public comment period on the stewardship and stockpile scoping hearings. We also urge the Washington State Department

  19. file://L:\DOE-hanford.gov\public\boards\hab\advice\advice36.htm

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Washington, DC 20585 Chuck Clarke, Regional Administrator U.S. Environmental Protection Agency, Region 10 1200 Sixth Avenue Seattle, WA 98101 Mary Riveland, Director Washington Department of Ecology PO Box 47600 Olympia, WA 98504-7600 John Wagoner, Manager Department of Energy, Richland Operations PO Box 550 Richland, WA 99352 December 8, 1995 RE: Review of FY96 BEMR, MYPP and Site Level Assumptions (HAB Advice #36) Dear Messrs. Grumbly, Clarke and Wagoner, and Ms. Riveland: The FY96 BEMR, MYPP

  20. file://L:\DOE-hanford.gov\public\boards\hab\advice\advice67.htm

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Chuck Clarke, Regional Administrator U.S. Environmental Protection Agency, Region 10 1200 Sixth Avenue Seattle, WA 98101 Tom Fitzsimmons, Director Washington Department of Ecology P.O. Box 47600 Olympia, WA 98504-7600 John Wagoner, Manager U.S. Department of Energy, Richland Operations P.O. Box 550 (A7-50) Richland, WA 99352 Subject: TWRS Vadose Zone Characterization Dear Messrs. Clarke, Fitzsimmons and Wagoner: Background In February 1996, new data were disclosed that contamination in the form

  1. http://www.hanford.gov/boards/hab/response/075.htm

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    5 From: George H. Sanders 97-EAP-712 Mr. Chuck Clarke Regional Administrator U.S. Environmental Protection Agency Region 10 1200 Sixth Avenue Seattle, Washington 98101 Mr. Tom Fitzsimmons. Director State of Washington Department of Ecology P.O. Box 47600 Olympia. Washington 98504 Dear Messrs. Clarke and Fitzsimmons: RESPONSE TO BOARD CONSENSUS ADVICE #75, ENVIRONMENTAL RESTORATION DISPOSAL FACILITY (ERDF) EXPANSION SEPTEMBER 5, 1997 Enclosed is a proposed joint response to a Hanford Advisory

  2. DOE Letterhead

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    August 11, 2014 Mr. Tom Carpenter Hanford Challenge 219 1 st Avenue South Suite 310 Seattle, Washington 98104 Dear Mr. Carpenter: FREEDOM OF INFORMATION ACT REQUEST (FOI 2014-01094) This letter is an interim response to your Freedom of Information Act (FOIA) request that you sent to this office requesting the following records: 1. "Any and all records related to or generated in connection with a contract involving Savannah River National Lab and any Hanford contractor, including but not

  3. DOE Letterhead

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    November 19, 2014 CERTIFIED MAIL Mr. Tom Carpenter Hanford Challenge 219 1 st Avenue South Suite 310 Seattle, Washington 98104 Dear Mr. Carpenter: FREEDOM OF INFORMATION ACT REQUEST (FOI 2014-01094) This letter is an interim response to your Freedom of Information Act (FOIA) request that you sent to this office requesting the following records: 1. "Any and all records related to or generated in connection with a contract involving Savannah River National Lab and any Hanford contractor,

  4. DOE Letterhead

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    19, 2014 Mr. Tom Carpenter Hanford Challenge 219 1 st Avenue South Suite 310 Seattle, Washington 98104 Dear Mr. Carpenter: FREEDOM OF INFORMATION ACT REQUEST (FOI 2014-01094) This letter is an interim response to your Freedom of Information Act (FOIA) request that you sent to this office requesting the following records: 1. "Any and all records related to or generated in connection with a contract involving Savannah River National Lab and any Hanford contractor, including but not limited to

  5. DOE Letterhead

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    22, 2014 Mr. Tom Carpenter Hanford Challenge 219 1 st Avenue South Suite 310 Seattle, Washington 98104 Dear Mr. Carpenter: FREEDOM OF INFORMATION ACT REQUEST (FOI 2014-01094) This letter is our final response to your Freedom of Information Act (FOIA) request that you sent to this office requesting the following records: 1. "Any and all records related to or generated in connection with a contract involving Savannah River National Lab and any Hanford contractor, including but not limited to

  6. DOE Letterhead

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    CERTIFIED MAIL September 29, 2015 Ms. Jackie Peterson Northwest African American Museum 2300 South Massachusetts Avenue Seattle, Washington 98144 Dear Ms. Peterson: FREEDOM OF INFORMATION ACT (FOI 2015-01811) This office is in receipt of your electronic Freedom of Information Act (FOIA) request. In your request you indicated that you were searching the Hanford Declassified Document Retrieval System (DDRS) and located the following photographs: 1) Photograph Accession Number: 124561 DDRS

  7. Richland Operations Office

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Richland, Washington 99352 May 3, 2012 CERTIFIED MAIL Mr. Thomas Carpenter Hanford Challenge 219 1 St Avenue South, Suite 120 Seattle, Washington 98104 Dear Mr. Carpenter: FREEDOM OF INFORMATION ACT REQUEST (FOI 20 12-00870) You requested, pursuant to the Freedom of Information Act (FOLA), the following records generated in connection with a surveillance report entitled, "Review of the 100 K Infrastructure Utilities Upgrade Project:" 1. "A copy of the Surveillance report." 2.

  8. Microsoft Word - FOI 2010-00205 REQUEST.docx

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Administration: Electronic FOIA Request Detail Thank you for your Freedom of Information Act Information Request. Within the next four weeks we will notify you of either how long the search will take to complete or the availability of the information you requested. Name: Brian D. Zeringer Organization: Lane Powell PC Address: 1420 Fifth Avenue, Suite 4100 Seattle, WA 98101 Country: United States Phone Number: 206-223-7073 Fax Number: 206-223-7107 E-mail: zeringerb@lanepowell.com Reasonably

  9. Microsoft Word - FOI 2013-00962.Partial.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    21, 2013 CERTIFIED MAIL Mr. Tom Carpenter Hanford Challenge 219 1 st Avenue South Suite 310 Seattle, Washington 98104 Dear Mr. Carpenter: FREEDOM OF INFORMATION ACT REQUEST (FOI 2013-00962) This letter is in response to your Freedom of Information Act (FOIA) request that you sent to this office requesting agency records relating to or generated in connection with classifying Hanford tank waste as transuranic, or TRU, waste that could be sent to the Waste Isolation Pilot Plant (WIPP) in New

  10. Using RSI format

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Telecentric viewing system for light collection from a z-pinch plasma D. J. Den Hartog a) Sterling Scientific, 2310 Van Hise Avenue, Madison, Wisconsin 53705 R. P. Golingo Department of Aeronautics and Astronautics, University of Washington, Seattle, Washington 98195 ͑Received 24 August 2000; accepted for publication 8 January 2001͒ As part of a Doppler spectroscopy system to measure the radial variation of ion flow and temperature, a pair of telecentric viewing telescopes has been installed

  11. Determination of the original-gas-in-place and aquifer properties in a water-drive reservoir by optimization technique

    SciTech Connect (OSTI)

    Chen, T.L.; Lin, Z.S.; Chen, Y.L.

    1995-10-01

    The purpose of this study was to estimate the original-gas-in-place (OGIP) of a water-drive reservoir using optimization algorithm for Port Arthur field, Texas, US. The properties of the associate aquifer were also obtained. The good agreement, between the results from this study and those from simulation study, would be demonstrated in this paper. In this study, material balance equation for a gas reservoir and van Everdingen-Hurst model for an aquifer were solved simultaneously to calculate cumulative gas production. The result was then compared with cumulative gas production measured in the field that observed at each pressure. The following parameters were manually adjusted to obtain: OGIP, thickness of the aquifer, water encroachment angle, ratio of aquifer to reservoir radius, and aquifer`s permeability. The procedure was then applied with simplex technique, an optimization algorithm, to adjust parameters automatically. When the difference between cumulative gas production calculated and observed was minimal, the parameters used in the model would be the results obtained. A water-drive gas reservoir, ``C`` sand gas reservoir in Port Arthur field, which had produced for about 12 years, was analyzed successfully. The results showed that the OGIP of 60.6 BCF estimated in this study was favorably compared with 56.2 BCF obtained by a numerical simulator in other study. In addition, the aquifer properties that were unavailable from the conventional plotting method can be estimated from this study. The estimated aquifer properties from this study were compared favorably with the core data.

  12. EA-1741: Draft Environmental Assessment

    Broader source: Energy.gov [DOE]

    Seattle Steam Company Combined Heat and Power at Post Street in Downtown Seattle, Washington (June 2010)

  13. Place Based STEM: Leveraging Local Resources to Engage K-12 Teachers in Teaching Integrated STEM and for Addressing the Local STEM Pipeline

    SciTech Connect (OSTI)

    Dr. Louis Nadelson; Anne Louise Seifert; Meagan McKinney

    2014-06-01

    Business, industry, parks, nature settings, government infrastructure, and people, can be invaluable resources for connecting STEM curriculum within context which results in conditions ideal for promoting purposeful learning of authentic STEM content. Thus, community-based STEM resources offer ideal context for teaching STEM content. A benefit of focusing teacher attention on these contextual, content aligned resources is that they are in every community; making place-based STEM education a possibility, regardless of the location of STEM teaching and learning. Further, associating STEM teaching and learning with local resources addresses workforce development and the STEM pipeline by exposing students to STEM careers and applications in their local communities. The desire to align STEM teaching and learning with local STEM related resources guided the design of our week-long integrated STEM K-12 teacher professional development (PD) program, i-STEM. We have completed four years of our i-STEM PD program and have made place-based STEM a major emphasis of our curriculum. This report focuses on the data collected in the fourth year of our program. Our week-long i-STEM PD served over 425 educators last summer (2013), providing them with in depth theme-based integrated STEM short courses which were limited to an average of 15 participants and whole group plenary sessions focused around placed based integrated STEM, inquiry, engineering design, standards and practices of Common Core and 21st Century skills. This state wide PD was distributed in five Idaho community colleges and took place over two weeks. The STEM short courses included topics on engineering for sustainability, using engineering to spark interest in STEM, municipal water systems, health, agriculture, food safety, mining, forestry, energy, and others. Integral to these short courses were field trips designed to connect the K-12 educators to the resources in their local communities that could be leveraged for teaching integrated STEM and provide a relevant context for teaching STEM content. Workplace presentations made by place-based STEM experts and provided teachers field trips to place-base STEM industries and business such as manufacturing plants, waste water treatment systems, mines, nature parks, food processing plants, research, hospitals, and laboratory facilities. We researched the 425 participants’ conceptions of place-based STEM prior to and after their taking part in the summer institutes, which included fieldtrips. Our findings revealed substantial increase in our participants’ knowledge, interest, and plans to use place-based resources for teaching integrated STEM. We detail the data analysis and provide a theoretical foundation and justification for the importance of place-based STEM to address the STEM pipeline for the future workforce.

  14. DOE Zero Energy Ready Home Case Study: Sunroc Builders, Bates Avenue, Lakeland, FL

    Broader source: Energy.gov [DOE]

    Case study of a DOE 2015 Housing Innovation Award winning affordable home in the hot-humid climate that got HERS 57 without PV, with 6.5” SIP walls and 8.25” SIP roof; uninsulated slab foundation; fresh air intake; SEER 16 ducted air source heat pump.

  15. DOE ZERH Case Study: Heirloom Design Build, Euclid Avenue, Atlanta, GA

    SciTech Connect (OSTI)

    none,

    2015-09-01

    Case study of a DOE 2015 Housing Innovation Award winning custom home in the mixed-humid climate that got a HERS 50 without PV, with 2x6 16” on center walls with R-19 ocsf; basement with R-28 ccsf, R-5 rigid foam under slab; sealed attic with R-28 ocsf under roof deck; 22.8 SEER; 12.5 HSPF heat pump.

  16. Existing Homes Retrofit Case Study: SMUD's 32nd Avenue Remodel Demonstration Program, Sacramento, CA

    SciTech Connect (OSTI)

    none,

    2011-03-01

    This case study describes a retrofit project between SMUD and Building America to create a high-performance home.

  17. CRANE CO. 757 THIRD AVENUE NEW YORK. N.Y. THOMAS UNGERLAND ASSOCIATE...

    Office of Legacy Management (LM)

    were moved ten or fifteen years ago to a second building on the Crane property. ... more than seventy-five years at the Chapman facility in Indian Orchard, Massechusettss. ...

  18. DOE Tour of Zero: McCormick Avenue by BrightLeaf Homes | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    This, in turn, is installed over a foundation floor water ... The builder engineered a precise roof pitch (6.2512) to ... to an airtightness level nearly 70% lower than ...

  19. DOE Tour of Zero: McCormick Avenue by BrightLeaf Homes | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    panes, and an advanced low-emissivity coating to block heat loss. 4 of 14 ... The comprehensive draft protection system includes caulking of the subfloor-sill plate ...

  20. DOE ZERH Case Study: BrightLeaf Homes, McCormick Avenue, Brookfield, IL

    SciTech Connect (OSTI)

    none,

    2015-09-01

    Case study of a DOE 2015 Housing Innovation Award winning production home in the cold climate that got a HERS 38 without PV, with staggered 2x4 studs every 8”on a 2x6 plate with dense-packed R-25 cellulose, basement with 3” XPS exterior and 2: XPS under slab; a vented attic with spray foam top plates and R-60 blown cellulose; 96% AFUE furnace, 14 SEER AC, plus fresh air intake.

  1. Existing Homes Retrofit Case Study: SMUD's Jean Avenue Remodel Demonstration Program, Sacramento, CA

    SciTech Connect (OSTI)

    none,

    2011-03-01

    This case study describes how SMUD teamed with Building America partners to retrofit aging, foreclosed homes into high-performance homes.

  2. I HEAVY MINERALS CO. 836 South Michigan Avenue Chic&o-5, Illinois

    Office of Legacy Management (LM)

    Chattanooga, Term. , of 4, 25 per pound of contained thorium oxide (ThOZ), both prices to be subject to a mutually agree- able escalation clause. Very truly yours, HEAVY MINERALS ...

  3. Christopher Lawrence United States Department of Energy 1000 Independence Avenue, SW

    Office of Environmental Management (EM)

    Energy Chicago Business Features Argonne Woman in Nuclear Physics Chicago Business Features Argonne Woman in Nuclear Physics January 9, 2012 - 4:08pm Addthis Kawtar Hafidi is an experimental nuclear physicist, working in the medium energy physics group at Argonne. Image courtesy of Argonne National Laboratory. Kawtar Hafidi is an experimental nuclear physicist, working in the medium energy physics group at Argonne. Image courtesy of Argonne National Laboratory. Chicago Business has the scoop

  4. Photos placed in horizontal position

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    File s ystem Lustre Panasas TradiAonal Network F ile S ystem ( NFS), E xtended F ile s ystem ( EXT), e tc. 4 Tri---Lab t ools Parallel F ile T...

  5. Finding Funding in Unexpected Places

    Broader source: Energy.gov [DOE]

    We hear a lot of questions from consumers who want to know what they can do to improve their homes, and what money, tax credits, and the like are out there.

  6. Better Place | Open Energy Information

    Open Energy Info (EERE)

    Bay Area Sector: Vehicles Product: Electric vehicle infrastructure company building a battery swap out network Website: www.betterplace.com Coordinates: 37.3949615,...

  7. Montana Board of Oil and Gas Conservation | Open Energy Information

    Open Energy Info (EERE)

    Oil and Gas Conservation Jump to: navigation, search Name: Montana Board of Oil and Gas Conservation Address: 2535 St. Johns Avenue Place: Montana Zip: 59102 Website:...

  8. Montana Department of Transportation | Open Energy Information

    Open Energy Info (EERE)

    Transportation Name: Montana Department of Transportation Address: 2701 Prospect Avenue P.O. Box 201001 Place: Helena, Montana Zip: 59620 Website: www.mdt.mt.gov Coordinates:...

  9. Panich + Noel Architects | Open Energy Information

    Open Energy Info (EERE)

    Avenue, Suite 301 Place: Athens, Ohio Zip: 45701 Sector: Buildings, Efficiency, Solar Product: Consulting; Engineeringarchitecturaldesign Phone Number: 740-592-2420 Website:...

  10. Entero Energy | Open Energy Information

    Open Energy Info (EERE)

    823 Congress Avenue Place: Austin, Texas Zip: 78701 Region: Texas Area Sector: Solar Product: Design and develop renewable energy facilities with a focus on solar Website:...

  11. Public Utility Commission of Texas | Open Energy Information

    Open Energy Info (EERE)

    Public Utility Commission of Texas Name: Public Utility Commission of Texas Address: 1701 N. Congress Avenue Place: Austin, Texas Zip: 78701 Year Founded: 1975 Website:...

  12. Johnson Controls | Open Energy Information

    Open Energy Info (EERE)

    Controls Jump to: navigation, search Logo: Johnson Controls Name: Johnson Controls Address: 5757 N. Green Bay Avenue Place: Milwaukee, Wisconsin Zip: 53201 Sector: Efficiency...

  13. Cielo Wind Power | Open Energy Information

    Open Energy Info (EERE)

    Cielo Wind Power Jump to: navigation, search Name: Cielo Wind Power Address: 823 Congress Avenue Place: Austin, Texas Zip: 78701 Region: Texas Area Sector: Wind energy Product:...

  14. Real Goods Solar Campbell | Open Energy Information

    Open Energy Info (EERE)

    Goods Solar Campbell Jump to: navigation, search Logo: Real Goods Solar Campbell Name: Real Goods Solar Campbell Address: 1624 Dell Avenue Place: Campbell, California Zip: 95008...

  15. Biodiesel Coalition of Texas | Open Energy Information

    Open Energy Info (EERE)

    Coalition of Texas Jump to: navigation, search Logo: Biodiesel Coalition of Texas Name: Biodiesel Coalition of Texas Address: 100 Congress Avenue Place: Austin, Texas Zip: 78701...

  16. University of Minnesota Hydrodynamics | Open Energy Information

    Open Energy Info (EERE)

    Hydrodynamics Jump to: navigation, search Hydro | Hydrodynamic Testing Facilities Name University of Minnesota Address St. Anthony Falls Laboratory, 2 Third Avenue SE Place...

  17. University of Michigan Hydrodynamics | Open Energy Information

    Open Energy Info (EERE)

    Michigan Hydrodynamics Jump to: navigation, search Hydro | Hydrodynamic Testing Facilities Name University of Michigan Address 1085 South University Avenue Place Ann Arbor,...

  18. New Jersey's Clean Energy Program | Open Energy Information

    Open Energy Info (EERE)

    Clean Energy Program Jump to: navigation, search Logo: New Jersey's Clean Energy Program Name: New Jersey's Clean Energy Program Address: 44 South Clinton Avenue Place: Trenton,...

  19. Wyoming Department of Agriculture | Open Energy Information

    Open Energy Info (EERE)

    Agriculture Jump to: navigation, search Name: Wyoming Department of Agriculture Address: 2219 Carey Avenue Place: Cheyenne, Wyoming Zip: 82002 Phone Number: 307-777-7321 Website:...

  20. Applied Materials | Open Energy Information

    Open Energy Info (EERE)

    Jump to: navigation, search Name: Applied Materials Address: 3050 Bowers Avenue Place: Santa Clara, California Zip: 95054 Sector: Solar Website: www.appliedmaterials.com...

  1. Real Goods Solar Santa Cruz | Open Energy Information

    Open Energy Info (EERE)

    Cruz Jump to: navigation, search Logo: Real Goods Solar Santa Cruz Name: Real Goods Solar Santa Cruz Address: 1115 Thompson Avenue, 1 Place: Santa Cruz, California Zip: 95062...

  2. Applied Ventures LLC | Open Energy Information

    Open Energy Info (EERE)

    Applied Ventures LLC Name: Applied Ventures LLC Address: 3050 Bowers Avenue Place: Santa Clara, California Zip: 95054 Region: Southern CA Area Product: Venture capital. Number...

  3. Marathon Capital LLC (California) | Open Energy Information

    Open Energy Info (EERE)

    Marathon Capital LLC (California) Name: Marathon Capital LLC (California) Address: 42 Miller Avenue Place: Mill Valley, California Zip: 94941 Region: Bay Area Product: Investment...

  4. Bucknell University | Open Energy Information

    Open Energy Info (EERE)

    University Address Civil & Mechanical Engineering Departments, Hydraulic Flume, 701 Moore Avenue, Dana Engineering Building Place Lewisburg, PA Zip 17837 Sector Hydro Phone...

  5. Alstom Energy Systems | Open Energy Information

    Open Energy Info (EERE)

    Alstom Energy Systems Jump to: navigation, search Name: Alstom Energy Systems Address: 3 avenue Andr Malraux Place: Levallois-Perret Cedex, France Website: www.alstom.com...

  6. Stoel Rives, LLP | Open Energy Information

    Open Energy Info (EERE)

    Address: 900 SW Fifth Avenue, Suite 2600 Place: Portland, Oregon Zip: 97204 Sector: Bioenergy, Biofuels, Biomass, Geothermal energy, Hydro, Ocean, Renewable energy, Services,...

  7. Geothermal Energy Association | Open Energy Information

    Open Energy Info (EERE)

    Association (Redirected from GEA) Jump to: navigation, search Logo: Geothermal Energy Association Name: Geothermal Energy Association Address: 209 Pennsylvania Avenue SE Place:...

  8. Geothermal Energy Association | Open Energy Information

    Open Energy Info (EERE)

    Association Jump to: navigation, search Logo: Geothermal Energy Association Name: Geothermal Energy Association Address: 209 Pennsylvania Avenue SE Place: Washington, DC Zip: 20003...

  9. Document

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    PLACE: Hyatt Regency (Valley Forge Room), 400 New Jersey Avenue, NW., Washington, DC 20001. (Metro Stop: Union Station). AGENDA: The Commission will receive the following reports: ...

  10. New York Solar Energy Industries Association | Open Energy Information

    Open Energy Info (EERE)

    New York Solar Energy Industries Association Name: New York Solar Energy Industries Association Address: 533 Woodford Avenue Place: Endicott, New York Zip: 13760 Region: Northeast...

  11. Aclara Software | Open Energy Information

    Open Energy Info (EERE)

    Aclara Software Jump to: navigation, search Name: Aclara Software Address: 16 Laurel Avenue Place: Wellesley, Massachusetts Zip: 02481 Region: Greater Boston Area Sector:...

  12. Rowan Energy Integration | Open Energy Information

    Open Energy Info (EERE)

    12 West Avenue Place: Bryn Mawr, Pennsylvania Zip: 19010 Region: Northeast - NY NJ CT PA Area Sector: Vehicles Product: Vehicle to Grid technologies Year Founded: 2009 Phone...

  13. GeoPeak Energy | Open Energy Information

    Open Energy Info (EERE)

    285 Davidson Avenue Place: Somerset, New Jersey Zip: 08873 Region: Northeast - NY NJ CT PA Area Sector: Solar Product: Residential and Commercial PV Solar Installations Phone...

  14. Clean Edge | Open Energy Information

    Open Energy Info (EERE)

    789 28th Avenue Place: San Francisco, California Zip: 94121 Region: Bay Area Sector: Services Product: Consulting firm Website: www.cleanedge.com Coordinates: 37.774531,...

  15. Virtus Energy Research Association | Open Energy Information

    Open Energy Info (EERE)

    906 12 Congress Avenue Place: Austin, Texas Zip: 78701 Region: Texas Area Sector: Services Product: Photovoltaic, solar thermal, wind siteresource assessment, project...

  16. Aptera Motors | Open Energy Information

    Open Energy Info (EERE)

    Aptera Motors Jump to: navigation, search Name: Aptera Motors Address: 2778 Loker Avenue West Place: Carlsbad, California Zip: 92008 Region: Southern CA Area Sector: Vehicles...

  17. Abound Solar | Open Energy Information

    Open Energy Info (EERE)

    Abound Solar Jump to: navigation, search Logo: Abound Solar Name: Abound Solar Address: 2695 Rocky Mountain Avenue, Suite 100 Place: Loveland, Colorado Zip: 80538 Region: Rockies...

  18. Solar Energy Squared, LLC | Open Energy Information

    Open Energy Info (EERE)

    Squared, LLC Jump to: navigation, search Logo: Solar Energy Squared, LLC Name: Solar Energy Squared, LLC Address: 116 Ottenheimer Plaza, President Clinton Avenue Place: Little...

  19. Wyoming State Historic Preservation Office | Open Energy Information

    Open Energy Info (EERE)

    Historic Preservation Office Jump to: navigation, search Name: Wyoming State Historic Preservation Office Abbreviation: SHPO Address: 2301 Central Avenue Place: Cheyenne, Wyoming...

  20. Cobalt Biofuels | Open Energy Information

    Open Energy Info (EERE)

    Cobalt Biofuels Jump to: navigation, search Logo: Cobalt Biofuels Name: Cobalt Biofuels Address: 500 Clyde Avenue Place: Mountain View, California Zip: 94043 Region: Bay Area...

  1. Biofuels Digest | Open Energy Information

    Open Energy Info (EERE)

    Digest Jump to: navigation, search Name: Biofuels Digest Address: 801 Brickell Avenue Suite 900 Place: Miami, Florida Zip: 33131 Sector: Services Product: Information Year Founded:...

  2. Cora Capital Advisors | Open Energy Information

    Open Energy Info (EERE)

    Cora Capital Advisors Jump to: navigation, search Logo: Cora Capital Advisors Name: Cora Capital Advisors Address: 445 Park Avenue, 9th Floor Place: New York Zip: 10022 Region:...

  3. The University of Wyoming | Open Energy Information

    Open Energy Info (EERE)

    Wyoming Jump to: navigation, search Name: The University of Wyoming Abbreviation: UW Address: 1000 East University Avenue Place: Laramie, Wyoming Zip: 82071 Phone Number:...

  4. Architectural Energy Corporation | Open Energy Information

    Open Energy Info (EERE)

    2540 Frontier Avenue Place: Boulder, Colorado Zip: 80301 Region: Rockies Area Sector: Buildings Product: Energy efficiency services for buildings Website: www.archenergy.com...

  5. The Ohio Environmental Council | Open Energy Information

    Open Energy Info (EERE)

    Ohio Environmental Council Jump to: navigation, search Name: The Ohio Environmental Council Address: 1207 Grandview Avenue, Suite 201 Place: Columbus, Ohio Zip: 43212-3449 Website:...

  6. BLM National Training Center | Open Energy Information

    Open Energy Info (EERE)

    National Training Center Jump to: navigation, search Logo: BLM National Training Center Name: BLM National Training Center Address: 9828 North 31st Avenue Place: Phoenix, AZ Zip:...

  7. MIT- Center for Transportation and Logistics | Open Energy Information

    Open Energy Info (EERE)

    MIT- Center for Transportation and Logistics Address: 77 Massachusetts Avenue Place: Cambridge, Massachusetts Zip: 02139 Region: Greater Boston Area Website: ctl.mit.edu...

  8. MIT- Center for 21st Century Energy | Open Energy Information

    Open Energy Info (EERE)

    Name: MIT- Center for 21st Century Energy Address: 77 Massachusetts Avenue Place: Cambridge, Massachusetts Zip: 02139 Region: Greater Boston Area Website: web.mit.educ21ce...

  9. MIT- Earth Resources Laboratory | Open Energy Information

    Open Energy Info (EERE)

    Name: MIT- Earth Resources Laboratory Address: 77 Massachusetts Avenue Place: Cambridge, Massachusetts Zip: 02139 Region: Greater Boston Area Website: eaps.mit.eduerl...

  10. MIT- Electrochemical Energy Laboratory | Open Energy Information

    Open Energy Info (EERE)

    Name: MIT- Electrochemical Energy Laboratory Address: 77 Massachusetts Avenue Place: Cambridge, Massachusetts Zip: 02139 Region: Greater Boston Area Website: web.mit.edueel...

  11. Greentech Media | Open Energy Information

    Open Energy Info (EERE)

    navigation, search Name: Greentech media Address: 1132 massachusetts avenue Place: Cambridge, Massachusetts Zip: 02138 Region: Greater Boston Area Number of Employees: 11-50...

  12. MIT-Alliance for Global Sustainability | Open Energy Information

    Open Energy Info (EERE)

    Name: MIT-Alliance for Global Sustainability Address: 77 Massachusetts Avenue Place: Cambridge, Massachusetts Zip: 02139 Region: Greater Boston Area Website: globalsustainability....

  13. Massachusetts Institute of Technology Hydrodynamics | Open Energy...

    Open Energy Info (EERE)

    Name Massachusetts Institute of Technology Address 77 Massachusetts Avenue Place Cambridge, Massachusetts Zip 02139 Sector Hydro Phone number (617) 254-4348 Website http:...

  14. MIT- Deshpande Center for Technological Innovation | Open Energy...

    Open Energy Info (EERE)

    Deshpande Center for Technological Innovation Address: 77 Massachusetts Avenue Place: Cambridge, Massachusetts Zip: 02139 Region: Greater Boston Area Website: web.mit.edu...

  15. Harvard - The Clean Energy Project | Open Energy Information

    Open Energy Info (EERE)

    Name: Harvard - The Clean Energy Project Address: 1400 Massachusetts Avenue Place: Cambridge, Massachusetts Zip: 02138 Region: Greater Boston Area Website: cleanenergy.harvard.e...

  16. NGEN Partners LLC (Silicon Valley) | Open Energy Information

    Open Energy Info (EERE)

    University Avenue Place: Palo Alto, California Zip: 94301 Region: Bay Area Product: Invest in early to late-stage clean energy businesses. Year Founded: 2001 Phone Number: (650)...

  17. Empower Energy Technology | Open Energy Information

    Open Energy Info (EERE)

    Empower Energy Technology Jump to: navigation, search Logo: Empower Energy Technology Name: Empower Energy Technology Address: 245 N. Highland Avenue, Suite 230.162 Place: Atlanta,...

  18. Technology Partners | Open Energy Information

    Open Energy Info (EERE)

    Partners Jump to: navigation, search Logo: Technology Partners Name: Technology Partners Address: 550 University Avenue Place: Palo Alto, California Zip: 94301 Region: Bay Area...

  19. ReliOn | Open Energy Information

    Open Energy Info (EERE)

    E. Euclid Avenue Place: Spokane, WA Zip: 99216 Region: Pacific Northwest Area Sector: Hydrogen Product: Fuel cells for backup and grid-supplement power Number of Employees:...

  20. Ballard Power Systems | Open Energy Information

    Open Energy Info (EERE)

    Avenue Place: Lowell, Massachusetts Zip: 01851 Region: Greater Boston Area Sector: Hydrogen Product: Designs and manufactures fuel cell systems Website: www.ballard.com...

  1. Wanzek Construction | Open Energy Information

    Open Energy Info (EERE)

    Wanzek Construction Jump to: navigation, search Logo: Wanzek Construction Name: Wanzek Construction Address: 2028 2nd Avenue NW Place: West Fargo, ND Country: United States Zip:...

  2. Carbon Capture Corporation | Open Energy Information

    Open Energy Info (EERE)

    Corporation Jump to: navigation, search Name: Carbon Capture Corporation Address: 7825 Fay Avenue Place: La Jolla, California Zip: 92037 Region: Southern CA Area Sector: Carbon...

  3. Low Carbon Research Institute | Open Energy Information

    Open Energy Info (EERE)

    Research Institute Jump to: navigation, search Logo: Low Carbon Research Institute Name: Low Carbon Research Institute Address: King Edward VII Avenue CF10 3NB Place: Cardiff,...

  4. Earth Day Coalition | Open Energy Information

    Open Energy Info (EERE)

    Day Coalition Jump to: navigation, search Name: Earth Day Coalition Address: 3606 Bridge Avenue, Suite 4 Place: Cleveland, Ohio Zip: 44113 Coordinates: 41.4829135, -81.7117416...

  5. Pivotal Investments | Open Energy Information

    Open Energy Info (EERE)

    Pivotal Investments Jump to: navigation, search Logo: Pivotal Investments Name: Pivotal Investments Address: 433 NW 4th Avenue, Suite 200 Place: Portland, Oregon Zip: 97209 Region:...

  6. Pivotal Investments Fund | Open Energy Information

    Open Energy Info (EERE)

    Pivotal Investments Fund Jump to: navigation, search Name: Pivotal Investments Fund Address: 433 NW 4th Avenue Place: Portland, Oregon Zip: 97209 Region: Pacific Northwest Area...

  7. Texas Water Development Board | Open Energy Information

    Open Energy Info (EERE)

    Development Board Jump to: navigation, search Logo: Texas Water Development Board Name: Texas Water Development Board Abbreviation: TWDB Address: 1700 North Congress Avenue Place:...

  8. First Wind (Formerly UPC Wind) (Oregon) | Open Energy Information

    Open Energy Info (EERE)

    First Wind (Formerly UPC Wind) Address: 1001 S.W. Fifth Avenue Place: Portland, Oregon Zip: 97204 Region: Pacific Northwest Area Sector: Wind energy Product: Wind power developer...

  9. Wyoming Department of State Parks and Cultural Resources | Open...

    Open Energy Info (EERE)

    Cultural Resources Jump to: navigation, search Name: Wyoming Department of State Parks and Cultural Resources Abbreviation: SPCR Address: 2301 Central Avenue Place: Cheyenne,...

  10. MAHYTEC | Open Energy Information

    Open Energy Info (EERE)

    Name: MAHYTEC Address: 210 Avenue de Verdun Place: Dole, France Zip: 39100 Sector: Hydrogen Product: Hydrogen storage solutions : hydride tank and high-pressure tank Year...

  11. United States Department of Commerce | Open Energy Information

    Open Energy Info (EERE)

    Commerce Jump to: navigation, search Name: United States Department of Commerce Address: 1401 Constitution Avenue, NW Place: Washington, DC Zip: 20230 Website: www.commerce.gov...

  12. Global Industry Analysts | Open Energy Information

    Open Energy Info (EERE)

    search Name: Global Industry Analysts Address: 6150 Hellyer Avenue Place: San Jose, California Zip: 95138 Region: Bay Area Product: Market research services Year Founded:...

  13. BLM Arizona State Office | Open Energy Information

    Open Energy Info (EERE)

    Arizona Address: One North Central Avenue, Suite 800 Place: Phoenix, AZ Zip: 85004 Phone Number: 602-417-9200 ParentHolding Organization: Bureau of Land Management...

  14. Builders Challenge High Performance Builder Spotlight - Martha Rose Construction, Inc., Seattle, Washington

    SciTech Connect (OSTI)

    2008-01-01

    Building America/Builders Challenge fact sheet on Martha Rose Construction, an energy-efficient home builder in marine climate using the German Passiv Haus design, improved insulation, and solar photovoltaics.

  15. Reference Buildings by Climate Zone and Representative City: 4C Seattle, Washington

    Broader source: Energy.gov [DOE]

    In addition to the ZIP file for each building type, you can directly view the "scorecard" spreadsheet that summarizes the inputs and results for each location. This Microsoft Excel spreadsheet is also included in the ZIP file. For version 1.4, only the IDF file is included.

  16. Incentives to stimulate solar energy use- a proceedings of the second Seattle workshop

    SciTech Connect (OSTI)

    Cole, R.J.; Cone, B.W.; Sheppard, W.J.; Sommers, P.; Marcus, A.; Lenerz, D.

    1981-06-01

    Nineteen papers are included. A separate abstract was prepared for each one. Summaries of workshop discussions on types of incentives are also included. (MHR)

  17. DOE Zero Energy Ready Home Case Study: TC Legend Homes, Seattle, Washington

    SciTech Connect (OSTI)

    none,

    2013-09-01

    This house incorporates slab-on-grade, EPS roof, and radiant heating with an air-to-water heat pump that also preheats domestic hot water. Without counting in the solar panels, the home earns a home energy rating system (HERS) score of 37, with projected utility bills of about $740 a year. With the 6.4-kW photovoltaic power system installed on the roof, the home’s HERS scores drops to -1 and utility bills for the all-electric home drop to zero. This home was awarded a 2013 Housing Innovation Award in the affordable builder category.

  18. DOE Zero Energy Ready Home Case Study 2013: TC Legend, Seattle...

    Energy Savers [EERE]

    ... The radiant heating system consists of PEX tubing in the first-floor slab, which circulates water that is heated by an air-to-water heat pump. The 3-ton heat pump has a capacity of ...

  19. Microsoft Word - Seattle Steam Draft EA for concurrence-6-16...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    ... or detectable impacts on land use; geology and soils; ... would require more natural gas (or diesel fuel in times of ... DOE must meet these requirements before it can make a ...

  20. DOE Zero Energy Ready Home Case Study: TC Legend, Seattle, WA...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    and roof, R-20 XPS under the slab, triple-pane windows, an air to water heat pump for radiant heat, and balanced ventilation with timer-controlled fans to bring in and exhaust air. ...

  1. Tax Credits, Rebates & Savings | Department of Energy

    Broader source: Energy.gov (indexed) [DOE]

    Equipment, Commercial Cooking Equipment, Commercial Refrigeration Equipment Seattle City Light- Commercial Energy Efficiency Rebate Programs Seattle City Light offers a...

  2. file://L:\DOE-hanford.gov\public\boards\hab\advice\advice06.htm

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    1, 1994 John Wagoner, Manager Department of Energy, Richland Operations Office PO Box 550 (A7-50) Richland, WA 99352 Chuck Clarke, Regional Administrator U.S. Environmental Protection Agency, Region 10 1200 Sixth Avenue Seattle, WA 98101 Mary Riveland, Director Department of Ecology State of Washington PO Box 47600 Olympia, WA 98504-7600 Dear Messrs. Wagoner and Clarke and Ms. Riveland: On behalf of the Hanford Advisory Board, I am pleased to forward to you the advice the Board adopted at its

  3. file://L:\DOE-hanford.gov\public\boards\hab\advice\advice106.ht

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    7, 2000 Chuck Clarke, Regional Administrator U.S. Environmental Protection Agency, Region 10 1200 Sixth Avenue Seattle, WA 98101 Tom Fitzsimmons, Director Washington Department of Ecology P.O. Box 47600 Olympia, WA 98504-7600 Keith Klein, Manager U.S. Department of Energy, Richland Operations P.O. Box 550 (A7-50) Richland, WA 99352 Subject: 618-10 and 618-11 Burial Grounds Dear Messrs. Clarke, Fitzsimmons, and Klein: The Hanford Advisory Board (HAB) has an acute concern with regard to the

  4. file://L:\DOE-hanford.gov\public\boards\hab\advice\advice75.htm

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    1997 Chuck Clarke, Regional Administrator U.S. Environmental Protection Agency, Region 10 1200 Sixth Avenue Seattle, WA 98101 Tom Fitzsimmons, Director Washington Department of Ecology P.O. Box 47600 Olympia, WA 98504-7600 John Wagoner, Manager U.S. Department of Energy, Richland Operations P.O. Box 550 (A7-50) Richland, WA 99352 Subject: ERDF Expansion Dear Messrs. Clarke, Fitzsimmons and Wagoner: The U.S. Environmental Protection Agency, the Washington State Department of Ecology, and the U.S.

  5. file://L:\DOE-hanford.gov\public\boards\hab\advice\advice91.htm

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    2, 1999 Chuck Clarke, Regional Administrator U.S. Environmental Protection Agency, Region 10 1200 Sixth Avenue Seattle, WA 98101 Tom Fitzsimmons, Director Washington Department of Ecology P.O. Box 47600 Olympia, WA 98504-7600 James Hall, Acting Manager U.S. Department of Energy, Richland Operations P.O. Box 550 (A7-50) Richland, WA 99352 Subject: Plutonium Finishing Plant Dear Messrs. Clarke, Fitzsimmons and Hall: The Plutonium Finishing Plant (PFP) contains 17.8 metric tons of plutonium bearing

  6. file://L:\DOE-hanford.gov\public\boards\hab\advice\advice93.htm

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    1200 Sixth Avenue Seattle, WA 98101 Tom Fitzsimmons, Director Washington Department of Ecology P.O. Box 47600 Olympia, WA 98504-7600 James Hall, Acting Manager U.S. Department of Energy, Richland Operations P.O. Box 550 (A7-50) Richland, WA 99352 Subject: Tri-Party Agreement Milestones and Public Involvement Dear Messrs. Clarke, Fitzsimmons and Hall: The safe treatment and disposal of Hanford's tank waste remains a top priority of the Hanford Advisory Board (HAB). This advice recommends both

  7. file://L:\DOE-hanford.gov\public\boards\hab\advice\advice94a.ht

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Chuck Clarke, Regional Administrator U.S. Environmental Protection Agency, Region 10 1200 Sixth Avenue Seattle, WA 98101 Tom Fitzsimmons, Director Washington Department of Ecology P.O. Box 47600 Olympia, WA 98504-7600 James Hall, Acting Manager U.S. Department of Energy, Richland Operations P.O. Box 550 (A7-50) Richland, WA 99352 Subject: U.S. Department of Energy Fiscal Year 2001 Budget Dear Messrs. Clarke, Fitzsimmons and Hall: The Hanford Advisory Board (HAB) has completed its review of the

  8. http://www.hanford.gov/boards/hab/response/092b.htm

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Region 10 1200 Sixth Avenue Seattle, Washington 98101 Advice # 92 From: Michael F. Gearheard Ms. Merilyn Reeves, Chair Hanford Advisory Board 723 The Parkway, Suite 200 Richland, Washington 99352 May 24, 1999 Re: EPA Response to Consensus Advice #92 Dear Ms. Reeves: Thank you for the advice on the Tri-Parties Response to Public Comments. In the spirit of your advice, I want to start by saying we agree with the points you raised. In addition, I want to know I have taken the liverty of

  9. DRAFT ADVICE - UNACCEPTABLE PROGRAM IMPACTS UNDER FY 97 BUDGET

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    7, 2001 Keith Klein, Manager U.S. Department of Energy, Richland Operations P.O. Box 550 (A7-50) Richland, WA 99352 Harry Boston, Manager U.S. Department of Energy, Office of River Protection 2440 Stevens Richland, WA 99352 Chuck Findley, Acting Regional Administrator U.S. Environmental Protection Agency, Region 10 1200 Sixth Avenue Seattle, WA 98101 Tom Fitzsimmons, Director Washington Department of Ecology P.O. Box 47600 Olympia, WA 98504-7600 Re: Community Relations Plan Dear Messrs. Klein,

  10. DRAFT ADVICE - UNACCEPTABLE PROGRAM IMPACTS UNDER FY 97 BUDGET

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Keith Klein, Manager U.S. Department of Energy, Richland Operations P.O. Box 550 (A7-50) Richland, WA 99352 John Iani, Regional Administrator U.S. Environmental Protection Agency, Region 10 1200 Sixth Avenue Seattle, WA 98101 Tom Fitzsimmons, Director Washington State Department of Ecology P.O. Box 47600 Olympia, WA 98504-7600 Re: 100/300 Area Change Package Dear Messrs. Klein, Iani, and Fitzsimmons The Hanford Advisory Board applauds the Tri-Party agencies for reaching agreement on a proposed

  11. TOj

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    TOj Department of Energy Richland Operations Office P.O. Box 550 TES Richland, Washington 99352 CERTIFIED MAIL NOV 1 2009 Mr. Brian Zeringer Lane Powell, P.C. 1420 Fifth Avenue, Suite 4100 Seattle, Washington 98101 Dear Mr. Zeringer: FREEDOM OF INFORMATION ACT REQUEST (FOI 2010-00205) Pursuant to the Freedom of Information Act, you requested five items regarding the Hanford Site. Each item of your request is re-stated below and is followed by our response: 1 . "Contracts pertaining to sheet

  12. Microsoft Word - FOI 2013-00932.Final.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    2, 2013 CERTIFIED MAIL Mr. Tom Carpenter Hanford Challenge 219 1 st Avenue South Suite 310 Seattle, Washington 98104 Dear Mr. Carpenter: FREEDOM OF INFORMATION ACT REQUEST (FOI 2013-00932) This letter is in response to your Freedom of Information Act (FOIA) request that you sent to this office requesting a copy of the Tank Waste Information Network System (TWINS) database. In an e-mail message dated May 6, 2013, you narrowed the scope of this request to include the following categories of

  13. Microsoft Word - HABAdv #170 Hanford Buried Waste.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    70 Subject: Hanford Buried Waste Adopted: March 4, 2005 Page 1 March 4, 2005 Keith Klein, Manager U.S. Department of Energy, Richland Operations P.O. Box 550 (A7-50) Richland, WA 99352 Roy Schepens, Manager U.S. Department of Energy, Office of River Protection P.O. Box 450 (H6-60) Richland, WA 99352 Ron Kreizenbeck, Regional Administrator U.S. Environmental Protection Agency, Region 10 1200 Sixth Avenue Seattle, WA 98101 Jay Manning, Director Washington State Department of Ecology P.O. Box 47600

  14. MACDoNALD HOACUE BAYLESS

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    MA-60 Org chart MA-60 Org chart Updated May 5, 2016 File OAM Org Chart (MA-60) v21.pptx More Documents & Publications Office of Management Organization Chart 2015 DOE Acquisition and Project Management (APM) Workshop Presentations Agenda_2015 APM Workshop_Final

    MACDoNALD HOACUE & BAYLESS 81m ATTORNEYS AND COUNSELORS AT LAW 705 Second Avenue Suite 1500 Seattle. Washington 98104-1745 Alec Bayless (1921-1991) Francis Hoague (1909-1993) March 26,2012 Miguel A. Bocanegra Andrea Brenneke

  15. HABAdv#1671.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    6 Subject: U Plant Closure Plan Adopted: September 10, 2004 Page 1 September 10, 2004 Keith Klein, Manager U.S. Department of Energy, Richland Operations P.O. Box 550 (A7-50) Richland, WA 99352 Linda Hoffman, Director Washington State Department of Ecology P.O. Box 47600 Olympia, WA 98504-7600 Ron Kreizeneeck, Acting Regional Administrator U.S. Environmental Protection Agency, Region 10 1200 Sixth Avenue Seattle, WA 98101 Subject: U Plant Closure Plan Dear Mssrs. Klein, Kreizeneeck, and Ms.

  16. Habadv#165 RCBRA.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    5 Subject: River Corridor Baseline Risk Assessment (RCBRA) Adopted: September 10, 2004 Page 1 September 10, 2004 Keith Klein, Manager U.S. Department of Energy, Richland Operations P.O. Box 550 (A7-50) Richland, WA 99352 Ron Kreizeneeck, Regional Administrator U.S. Environmental Protection Agency, Region 10 1200 Sixth Avenue Seattle, WA 98101 Linda Hoffman, Director Washington State Department of Ecology P.O. Box 47600 Olympia, WA 98504-7600 Subject: Risk Assessment Work Plan for the 100 Area

  17. Habadv-119.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    9 Subject: B Reactor Engineering Evaluation and Cost Analysis Adopted: June 8, 2001 Page 1 June 8, 2001 Keith Klein, Manager U.S. Department of Energy, Richland Operations P.O. Box 550 (A7-50) Richland, WA 99352 Chuck Findley, Acting Regional Administrator U.S. Environmental Protection Agency, Region 10 1200 Sixth Avenue Seattle, WA 98101 Tom Fitzsimmons, Director Washington Department of Ecology P.O. Box 47600 Olympia, WA 98504-7600 Re: B Reactor Engineering Evaluation and Cost Analysis Dear

  18. Final Report: Part 1. In-Place Filter Testing Instrument for Nuclear Material Containers. Part 2. Canister Filter Test Standards for Aerosol Capture Rates.

    SciTech Connect (OSTI)

    Brown, Austin Douglas; Runnels, Joel T.; Moore, Murray E.; Reeves, Kirk Patrick

    2014-11-02

    A portable instrument has been developed to assess the functionality of filter sand o-rings on nuclear material storage canisters, without requiring removal of the canister lid. Additionally, a set of fifteen filter standards were procured for verifying aerosol leakage and pressure drop measurements in the Los Alamos Filter Test System. The US Department of Energy uses several thousand canisters for storing nuclear material in different chemical and physical forms. Specialized filters are installed into canister lids to allow gases to escape, and to maintain an internal ambient pressure while containing radioactive contaminants. Diagnosing the condition of container filters and canister integrity is important to ensure worker and public safety and for determining the handling requirements of legacy apparatus. This report describes the In-Place-Filter-Tester, the Instrument Development Plan and the Instrument Operating Method that were developed at the Los Alamos National Laboratory to determine the “as found” condition of unopened storage canisters. The Instrument Operating Method provides instructions for future evaluations of as-found canisters packaged with nuclear material. Customized stainless steel canister interfaces were developed for pressure-port access and to apply a suction clamping force for the interface. These are compatible with selected Hagan-style and SAVY-4000 storage canisters that were purchased from NFT (Nuclear Filter Technology, Golden, CO). Two instruments were developed for this effort: an initial Los Alamos POC (Proof-of-Concept) unit and the final Los Alamos IPFT system. The Los Alamos POC was used to create the Instrument Development Plan: (1) to determine the air flow and pressure characteristics associated with canister filter clogging, and (2) to test simulated configurations that mimicked canister leakage paths. The canister leakage scenarios included quantifying: (A) air leakage due to foreign material (i.e. dust and hair) fouling of o-rings, (B) leakage through simulated cracks in o-rings, and (C) air leakage due to inadequately tightened canister lids. The Los Alamos POC instrument determined pertinent air flow and pressure quantities, and this knowledge was used to specify a customized Isaac® (Z axis, Salt Lake City, UT) leak test module. The final Los Alamos IPFT (incorporating the Isaac® leak test module) was used to repeat the tests in the Instrument Development Plan (with simulated filter clogging tests and canister leak pathway tests). The Los Alamos IPFT instrument is capable of determining filter clogging and leak rate conditions, without requiring removal of the container lid. The IPFT measures pressure decay rate from 1.7E-03 in WC/sec to 1.7E-01 in WC/sec. On the same unit scale, helium leak testing of canisters has a range from 5.7E-07 in WC/sec to 1.9E-03 in WC/sec. For a 5-quart storage canister, the IPFT measures equivalent leak flow rates from 0.03 to 3.0 cc/sec. The IPFT does not provide the same sensitivity as helium leak testing, but is able to gauge the assembled condition of as-found and in-situ canisters.

  19. Radiological assessment report for the University of Rochester Annex, 400 Elmwood Avenue, Rochester, New York, April-May 1984

    SciTech Connect (OSTI)

    Wynveen, R.A.; Smith, W.H.; Sholeen, C.M.; Flynn, K.F.

    1984-12-01

    In light of the results of the comprehensive radiological assessment of the annex and auxiliary facilities, the following conclusions can be made: There is no immediate hazard from the elevated levels of radioactivity detected; however, some of these levels are above criteria. The radon, thoron, actinon, long-lived particulates, and tritium in the air are all below criteria for unrestricted use. Some ductwork has been identified as being contaminated. All ductwork must, therefore, be considered potentially contaminated. Since several floor drains were found to exhibit elevated readings, and the samples had elevated concentrations of radionuclides, it must be concluded that the drain and sewer systems of the Annex are contaminated with radioactive material. Since the samples collected from the storm and sewer systems outside the building also had elevated concentrations of radionuclides, these systems are also considered contaminated with radioactive material. The grounds around the Annex have exhibited background concentrations of radionuclides. Two rooms, B-330 and B-332, were inaccessible for survey due to the presence of stored furniture and equipment. Therefore, no comment about their radiological status can be made. At the common baseboard for Room C-12 and C-16 and on the floor below the tile in Room C-40, contamination appeared to be masked by construction modifications. Other areas of the Annex must also be considered potentially contaminated where modifications may have masked the contamination.

  20. Final Site Specific Decommissioning Inspection Report #2 for the University of Washington Research and Test Reactor, Seattle, Washington

    SciTech Connect (OSTI)

    S.J. Roberts

    2007-03-20

    During the period of August through November 2006, ORISE performed a comprehensive IV at the University of Washington Research and Test Reactor Facility. The objective of the ORISE IV was to validate the licensee’s final status survey processes and data, and to assure the requirements of the DP and FSSP were met.

  1. Template:ExperimentalPlace | Open Energy Information

    Open Energy Info (EERE)

    Feedback Contact needs updating Image needs updating Reference needed Missing content Broken link Other Additional Comments Cancel Submit Category: Experimental Templates...

  2. FGD gypsum's place in American agriculture

    SciTech Connect (OSTI)

    Haynes, C.

    2007-07-01

    Surface cracks and soil clumps form when saline-sodic, high-clay soil dries out. Treatment with FGD gypsum and irrigation water flowing into these cracks leaches salts until the aggregates swell and the cracks close up. The article describes research projects to develop agricultural uses of FGD gypsum from coal-fired power plants that have been conducted by university researchers and USDA-Agricultural Research Service scientists.

  3. Category:Places | Open Energy Information

    Open Energy Info (EERE)

    Agenda, Kansas Agenda, Wisconsin Agoura Hills, California Agra, Kansas Agra, Oklahoma Agua Dulce, Texas Agua Fria, New Mexico Aguilar, Colorado Ahmeek, Michigan Ahnapee,...

  4. Property:Place | Open Energy Information

    Open Energy Info (EERE)

    CB Richard Ellis CBD Energy Ltd CCBI, Inc. CCLRC Rutherford Appleton Laboratory CCT Solar CDH Energy CDI Corporation CDM Accreditation Panel CDM AP CDM Center of Excellence...

  5. Partnering Institution Name Partnering Institution Name Place...

    Open Energy Info (EERE)

    Boise Idaho Test Evaluation Partner Electricity Resources Building Systems Integration Solar Systems Solar Systems Abbotsford Australia Electricity Resources Building Systems...

  6. City of Two Harbors, Minnesota (Utility Company) | Open Energy...

    Open Energy Info (EERE)

    Two Harbors Address: 503 20th Avenue Place: Two Harbors, MN Zip: 55616 Phone Number: 218-834-8811 Outage Hotline: 218-834-8810 References: EIA Form EIA-861 Final Data File for 2010...

  7. FreEner-g | Open Energy Information

    Open Energy Info (EERE)

    FreEner-g Jump to: navigation, search Logo: FreEner-g Name: FreEner-g Address: 2740 31st Avenue South Place: Minneapolis, Minnesota Zip: 55406 Sector: Solar Product: solar electric...

  8. Oregon Environmental Quality Commission | Open Energy Information

    Open Energy Info (EERE)

    Commission Jump to: navigation, search Name: Oregon Environmental Quality Commission Address: 811 SW 6th Avenue Place: Portland, Oregon Zip: 97204-1390 Phone Number: 503-229-5301...

  9. Cleveland Green Building Coalition | Open Energy Information

    Open Energy Info (EERE)

    Lorain Avenue, Suite 303 Place: Cleveland, Ohio Zip: 44113 Website: www.neogbc.orgindex.php References: http:www.neogbc.orgindex.php This article is a stub. You can help OpenEI...

  10. Susan Martindale

    Office of Environmental Management (EM)

    ... Avenue, S.W. Washington, DC 20585 (202) 586-9117 Gary.Lanthrum@rw.doe.gov Douglas Larson (Doug), Executive Director Western Interstate Energy Board 1515 Cleveland Place, Suite ...

  11. BioEnergy of America Inc | Open Energy Information

    Open Energy Info (EERE)

    America Inc Jump to: navigation, search Name: BioEnergy of America Inc Address: 30 Executive Avenue Place: Edison, New Jersey Zip: 08817 Region: Northeast - NY NJ CT PA Area...

  12. Best Buy | Open Energy Information

    Open Energy Info (EERE)

    Buy Jump to: navigation, search Name: Best Buy Address: 7601 Penn Avenue Place: Richfield, Minnesota Zip: 55423 Website: www.bestbuy.com Coordinates: 44.8638835, -93.306112...

  13. Good Energies (New York) | Open Energy Information

    Open Energy Info (EERE)

    Avenue, 29th Floor Place: New York, New York Zip: 10172 Region: Northeast - NY NJ CT PA Area Product: Global investor in renewable energy and energy efficiency industries Year...

  14. Rochester Gas and Electric | Open Energy Information

    Open Energy Info (EERE)

    Avenue Place: Rochester, New York Zip: 14649 Region: Northeast - NY NJ CT PA Area Sector: Services Product: Green Power Marketer Website: www.rge.com Coordinates: 43.156495,...

  15. Bonneville Environmental Foundation | Open Energy Information

    Open Energy Info (EERE)

    SW 1st Avenue Place: Portland, Oregon Zip: 97204 Region: Pacific Northwest Area Sector: Services Product: Green Power Marketer Website: www.b-e-f.org Coordinates: 45.520495,...

  16. BLM Oregon State Office | Open Energy Information

    Open Energy Info (EERE)

    Oregon State Office Jump to: navigation, search Logo: BLM Oregon State Office Name: BLM Oregon State Office Abbreviation: Oregon Address: 333 S.W. 1st Avenue Place: Portland, OR...

  17. Marathon Capital LLC (New York) | Open Energy Information

    Open Energy Info (EERE)

    Marathon Capital LLC (New York) Name: Marathon Capital LLC (New York) Address: 245 Park Avenue, 24th Floor Place: New York, New York Zip: 10167 Region: Northeast - NY NJ CT PA Area...

  18. Capital Equity Partners LLC | Open Energy Information

    Open Energy Info (EERE)

    Partners LLC Jump to: navigation, search Name: Capital Equity Partners LLC Address: 410 Park Avenue Place: New York, New York Zip: 10022 Region: Northeast - NY NJ CT PA Area...

  19. AER NY Kinetics LLC | Open Energy Information

    Open Energy Info (EERE)

    AER NY Kinetics LLC Jump to: navigation, search Name: AER NY Kinetics LLC Address: PO Box 585 21 Entrance Avenue Place: Ogdensburg Zip: 13669 Region: United States Sector: Marine...

  20. Southern Minnesota Mun P Agny | Open Energy Information

    Open Energy Info (EERE)

    Address: 500 First Avenue SW Place: Rochester, Minnesota Zip: 55902-3303 Year Founded: 1977 Website: www.smmpa.com References: EIA Form EIA-861 Final Data File for 2010 -...

  1. Wabash County Rural E M C | Open Energy Information

    Open Energy Info (EERE)

    Wabash County Rural E M C Jump to: navigation, search Name: Heartland Rural E M C Address: 350 Wedcor Avenue Place: Wabash, Indiana Phone Number: (260) 563-2146 Website:...

  2. SUN (re)construction | Open Energy Information

    Open Energy Info (EERE)

    SUN (re)construction Jump to: navigation, search Logo: SUN (re)construction Name: SUN (re)construction Address: 1351 Harker Avenue Place: Palo Alto, California Zip: 94301 Region:...

  3. Eugene Water and Electric Board | Open Energy Information

    Open Energy Info (EERE)

    Eugene Water and Electric Board Jump to: navigation, search Logo: Eugene Water and Electric Board Name: Eugene Water and Electric Board Address: 500 East 4th Avenue Place: Eugene,...

  4. Policy Matters Ohio | Open Energy Information

    Open Energy Info (EERE)

    Matters Ohio Jump to: navigation, search Name: Policy Matters Ohio Address: 3631 Perkins Avenue - Suite 4C-East Place: Cleveland, Ohio Zip: 44114 Website: www.policymattersohio.org...

  5. Sec. 999 Annual Plan 2012 | Department of Energy

    Energy Savers [EERE]

    Data Dashboard Seattle Data Dashboard The data dashboard for Seattle, Washington, a partner in the Better Buildings Neighborhood Program. File Seattle Data Dashboard More Documents & Publications Cincinnati Data Dashboard Austin Energy Data Dashboard Massachusetts -- SEP Data Dashboard

    Summary of Reported Data Seattle Summary of Reported Data Summary of data reported by Better Buildings Neighborhood Program partner Seattle, Washington. PDF icon Seattle Summary of Reported Data More

  6. Tax Credits, Rebates & Savings | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Others pending approval, Other EE, Insulation, Food Service Equipment Seattle City Light- Commercial Energy Efficiency Rebate Programs Seattle City Light offers a variety of...

  7. Tax Credits, Rebates & Savings | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Others pending approval, Other EE, Food Service Equipment, LED Lighting Seattle City Light- Commercial Energy Efficiency Rebate Programs Seattle City Light offers a variety of...

  8. Tax Credits, Rebates & Savings | Department of Energy

    Broader source: Energy.gov (indexed) [DOE]

    Seattle City Light- Commercial Energy Efficiency Rebate Programs Seattle City Light offers a variety of rebates to commercial and industrial customers through the Energy Smart...

  9. Tax Credits, Rebates & Savings | Department of Energy

    Broader source: Energy.gov (indexed) [DOE]

    Seattle City Light- Built Smart Program for Builders and Architects Seattle City Light provides incentives for builders, developers, and architects who construct energy efficient...

  10. Tax Credits, Rebates & Savings | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    EE, LED Lighting Seattle City Light- Commercial Energy Efficiency Rebate Programs Seattle City Light offers a variety of rebates to commercial and industrial customers through the...

  11. Tax Credits, Rebates & Savings | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Equipment Seattle City Light- Commercial Energy Efficiency Rebate Programs Seattle City Light offers a variety of rebates to commercial and industrial customers through the...

  12. Tax Credits, Rebates & Savings | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    & Savings Seattle City Light- Commercial Energy Efficiency Rebate Programs Seattle City Light offers a variety of rebates to commercial and industrial customers through the...

  13. Tax Credits, Rebates & Savings | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    LED Lighting Seattle City Light- Commercial Energy Efficiency Rebate Programs Seattle City Light offers a variety of rebates to commercial and industrial customers through the...

  14. Tax Credits, Rebates & Savings | Department of Energy

    Broader source: Energy.gov (indexed) [DOE]

    Service Equipment, Vending Machine Controls, Commercial Refrigeration Equipment Seattle City Light- Built Smart Program for Builders and Architects Seattle City Light provides...

  15. Tax Credits, Rebates & Savings | Department of Energy

    Broader source: Energy.gov (indexed) [DOE]

    CustomOthers pending approval, Other EE, Commercial Refrigeration Equipment Seattle City Light- Built Smart Program for Builders and Architects Seattle City Light provides...

  16. Tax Credits, Rebates & Savings | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Reflective Roofs Seattle City Light- Commercial Energy Efficiency Rebate Programs Seattle City Light offers a variety of rebates to commercial and industrial customers through the...

  17. Ensemble Properties of Comets in the Sloan Digital Sky Survey...

    Office of Scientific and Technical Information (OSTI)

    Chicago ; Ivezic, Zeljko ; Washington U., Seattle, Astron. Dept. ; Juric, Mario ; Harvard Coll. Observ. ; Becker, Andrew C. ; Washington U., Seattle, Astron. Dept. ; Jones,...

  18. CyVolt Energy Systems | Open Energy Information

    Open Energy Info (EERE)

    Seattle, Washington Zip: 98104 Product: Seattle-based developer fuel cell-powered battery systems for portable, hand-held consumer electronics Coordinates: 47.60356,...

  19. Tax Credits, Rebates & Savings | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    & Savings Tax Credits, Rebates & Savings Seattle City Light- Commercial Energy Efficiency Rebate Programs Seattle City Light offers a variety of rebates to commercial and...

  20. Assessing UST corrective action technologies: Lessons learned about in situ air sparging at the Denison Avenue Site, Cleveland, Ohio. Project report

    SciTech Connect (OSTI)

    Clark, T.R.; Chaudet, R.E.; Johnson, R.L.

    1994-12-01

    In situ air sparging (IAS) has been used at an increasing number of sites to address groundwater contamination. Because of the lack of substantive performance data, however, the actual effectiveness of the system is not known. The EPA Office of Research and Development Risk reduction Engineering Laboratory (ORD RREL) with the EPA Region 5 Office of Underground Storage Tanks, the Ohio State Fire Marshal, and BP Exploration & Oil, Inc. (BP) participated in a field evaluation of an IAS system at a petroleum leaking UST site in Cleveland, Ohio. The purpose of the study was to provide performance data that will be independently evaluated by EPA to better understand IAS effectiveness. The report presents the site and monitoring data provided by BP over a 2-year period. The chemical data indicated an overall decrease of BTEX concentrations in groundwater to nondetectable levels shortly after startup of the IAS system. Variability in the chemical and process data also precludes making any definitive link between the decrease in contaminant concentrations and IAS performance at this site.

  1. MULTI-PV INVERTER UTILITY INTERCONNECTION EVALUATIONS Sigifredo...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    islanding Paper presented at the 36th IEEE Photovoltaic Specialists Conference, Seattle, WA (2011)...

  2. MULTI-PV INVERTER UTILITY INTERCONNECTION EVALUATIONS Sigifredo Gonzalez

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    islanding Paper presented at the 36th IEEE Photovoltaic Specialists Conference, Seattle, WA (2011)

  3. Climate Action Champion: Technical

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    betterbuildings Climate Action Champion: Technical Assistance to the City of Seattle Planning for Seattle's new Building Energy Code Overview The City of Seattle, identified as a Climate Action Champion (CAC) by the Department of Energy (DOE), is revising its 2012 Energy Code, already one of the most progressive in the country. Seattle has made a pledge to be carbon neutral by 2050. Seattle received technical assistance from the Pacific Northwest National Laboratory in order to develop a

  4. Property:Incentive/Cont4Place | Open Energy Information

    Open Energy Info (EERE)

    Rock, Arkansas + M Mandatory Shoreland Zoning Act (Maine) + Presque Isle, Maine + O OTEC - Agricultural Energy Efficiency Rebate Programs (Oregon) + La Grande, Oregon + OTEC -...

  5. Template:InfoForPlace | Open Energy Information

    Open Energy Info (EERE)

    Feedback Contact needs updating Image needs updating Reference needed Missing content Broken link Other Additional Comments Cancel Submit Category: Experimental...

  6. Template:ListsForPlace | Open Energy Information

    Open Energy Info (EERE)

    Feedback Contact needs updating Image needs updating Reference needed Missing content Broken link Other Additional Comments Cancel Submit Category: Experimental...

  7. Property:Incentive/AddlPlaceCity | Open Energy Information

    Open Energy Info (EERE)

    Zone Building Permits (District of Columbia) + District of Columbia + G Ground Water Management Act (Virginia) + Chesapeake, Virginia +, Franklin, Virginia +, Hampton,...

  8. Design and put in place institutional structures and processes...

    Open Energy Info (EERE)

    public and private sector capacity to support initiatives 2.4. Assess and improve the national GHG inventory and other economic and resource data as needed for LEDS development...

  9. Property:Incentive/AddlPlaceStates | Open Energy Information

    Open Energy Info (EERE)

    Energy Development Fund (Kentucky) + Kentucky + Alternative Energy Zone (Ohio) + Ohio + Alternative Renewable Fuels 'Plus' Research and Development Fund (Ontario, Canada) +...

  10. Property:AdditionalBenefitPlaces | Open Energy Information

    Open Energy Info (EERE)

    + Georgia + F FirstEnergy Service Company Smart Grid Project + Pennsylvania + I ISO New England, Incorporated Smart Grid Project + Connecticut +, Maine +, New Hampshire +,...

  11. Organization Organization Address Place Zip Notes Website Region

    Open Energy Info (EERE)

    Boston Massachusetts http cleantechboston com Greater Boston Area Consortium for Energy Efficiency Consortium for Energy Efficiency North Washington St Boston Massachusetts http...

  12. Locating Climate Insecurity: Where Are the Most Vulnerable Places...

    Open Energy Info (EERE)

    in Africa? AgencyCompany Organization: The Robert Strauss Center Topics: Co-benefits assessment, Background analysis Resource Type: Publications Website: ccaps.strausscenter.o...

  13. Name Address Place Zip Sector Product Stock Symbol Year founded...

    Open Energy Info (EERE)

    Energy Inc Suite Inco Innovation Centre Memorial University of Newfoundland PO Box St John s A1C S7 Marine and Hydrokinetic http http www greyislandenergy com Canada Gulfstream...

  14. Do nuclear reactions take place under chemical stimulation?

    SciTech Connect (OSTI)

    Bockris, J.O.; Lin, G.H.; Bush, R.T.

    1996-09-01

    Several examples of nuclear reactions occurring under the stimulation of chemical type energies are given. The production of tritium from deuterium in Pd has more than 100 published confirmations. Three models suggest circumstances such that barriers between nucleii may become transparent. 24 refs.

  15. Greensburg, Kansas: A Better, Greener Place to Live

    SciTech Connect (OSTI)

    2009-10-01

    The brochure highlights efforts to rebuild green in Greensburg, KS, and mentions DOE's role in rebuilding. The layout is designed to be used as a template for other cities in similar situations.

  16. Greensburg, Kansas: A Better, Greener Place to Live (Revised) (Brochure)

    SciTech Connect (OSTI)

    Not Available

    2009-10-01

    This Brochure is for Greensburg city leadership (Chamber of Commerce, Mayor's Office, and others) to use to attract visitors and businesses to Greensburg, and to ensure the city?s commitment to sustainability. Content includes EERE subject matter and mentions DOE's role in rebuilding. The layout is designed to be used as a template for other cities in similar situations.

  17. Sheltering in Place | Y-12 National Security Complex

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    everyone inside (including pets). Close all doors and windows. Turn off and close all ventilation systems, including: Air conditioning Attic & exhaust fans Furnaces Fireplace...

  18. From the Lab to the Market Place to Standards

    SciTech Connect (OSTI)

    Rosenfeld, Arthur

    2007-02-05

    Energy efficiency is the cheapest, faster, most reliable way to reduce the emissions of CO2. It won't solve the entire problem, but it will get us half way there, and profitably.

  19. National Science Bowl Second Place Winners Explore Colorado

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    National Science Bowl Regional Roundup National Science Bowl Regional Roundup March 18, 2015 - 2:33pm Addthis Photo courtesy of National Renewable Energy Laboratory. Photo courtesy of National Renewable Energy Laboratory. Pat Adams Pat Adams Digital Content Specialist, Office of Public Affairs National Science Bowl Regional Roundup It's like March Madness for science students. Storified by Energy Department * Tue, May 05 2015 15:08:26 2015ScienceBowl125 * National Renewable Energy Lab To quote

  20. Property:Incentive/AddlPlaceCounty | Open Energy Information

    Open Energy Info (EERE)

    + Anne Arundel County, Maryland + B Baltimore County - Solar and Geothermal Equipment Property Tax Credit (Maryland) + Baltimore County, Maryland + Baltimore County - Wind...

  1. Appropriate Use of USGS Volumetric "Heat in Place" Method and...

    Open Energy Info (EERE)

    capacity of a geothermal system. The methodology consists of combining probability density functions for uncertain estimates of the temperature, area, and thickness of a...

  2. A Reexamination of USGS Volumetric "Heat in Place" Method | Open...

    Open Energy Info (EERE)

    capacity of a geothermal system. The methodology consists of combining probability density functions for uncertain estimates of the temperature, area, thickness, and thermal...

  3. Company Name Company Name Address Place Zip Sector Product Website

    Open Energy Info (EERE)

    operates a number of power stations including the largest coal fired power station in the world as well as the Koeberg nuclear power station Esmeralda Energy Company Esmeralda...

  4. Company Name Company Name Address Place Zip Sector Product Website

    Open Energy Info (EERE)

    manufacturing and marketing of display products typically OLED Organic Light Emitting Diode Display Vista International Inc Vista International Inc Englewood Colorado...

  5. Company Name Company Name Address Place Zip Sector Product Website

    Open Energy Info (EERE)

    domestic heating systems combining solar passive wood burning geothermal heat pumps and fossil fuel Elemental Energy Elemental Energy SW nd Ave Portland Oregon United States...

  6. Property:Incentive/AddlPlaceUtility | Open Energy Information

    Open Energy Info (EERE)

    Canada) + Maritime Electric + N Net Metering (New Brunswick, Canada) + NB Power + Nuclear Power Plant Construction Support (North Carolina) + North Carolina + R Renewable and...

  7. Boise State University Places First in DOE's Collegiate Wind...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Las Vegas, Nevada, where they were tasked with designing, testing, and constructing a lightweight, transportable wind turbine that could be used to power small electronic devices. ...

  8. Company Name Company Name Address Place Zip Sector Product Website

    Open Energy Info (EERE)

    com Genifuel Genifuel Carrigan Cir Salt Lake City Utah Biofuels Renewable Natural Gas http www genifuel com Rockies Area Gevo Inc Gevo Inc Inverness Drive South Englewood...

  9. CERN and LHC - their place in global science

    ScienceCinema (OSTI)

    None

    2011-10-06

    The Large Hadron Collider (LHC) is the largest scientific instrument in the world. It brings into collision intense beams of protons and ions to explore the structure of matter and investigate the forces of nature at an unprecedented energy scale, thus serving a community of some 7,000 particle physicists from all over the world.

  10. Property:Incentive/ContPlace | Open Energy Information

    Open Energy Info (EERE)

    - Commercial Solutions Program (Texas) + Austin, Texas + AEP Texas Central Company - ENERGY STAR New Home Program (Texas) + Austin, Texas + (previous 25) (next 25) Retrieved...

  11. United Indigenous Voices Address Sustainability: Climate Change and Traditional Places

    Broader source: Energy.gov [DOE]

    At the First Stewards Symposium, over 300 industry and policy leaders from around the nation will discuss four main themes generated from the 2012 First Stewards Symposium that address issues...

  12. From the Lab to the Market Place to Standards

    SciTech Connect (OSTI)

    Arthur Rosenfeld

    2007-02-05

    Yes, thats Billions, not Millions. Its equivalent to avoiding 35 million barrels/day of oil (out of World daily use of 85 Mbod), or getting 1 Billion cars off the road (but the world has only 600 Million cars). And California is doing even better than the US. All this was so easy and few people even noticed. Energy efficiency is the cheapest, faster, most reliable way to reduce the emissions of CO2. It wont solve the entire problem, but it will get us half way there, and profitably.

  13. Placing UESC Task Orders Under the GSA Areawide

    Broader source: Energy.gov [DOE]

    Webinar provides attendees with an overview of the contracting options and services available from their local utility companies to engineer, finance and install cost effective energy and water savings projects.

  14. Placing UESC Task Orders Under the GSA Areawide Contract

    Broader source: Energy.gov [DOE]

    Webinar provides attendees with an overview of the contracting options and services available from their local utility companies to engineer, finance, and install cost effective energy- and water-savings projects.

  15. Company Name Company Name Address Place Zip Sector Product Website

    Open Energy Info (EERE)

    Avenida De La Playa La Jolla California Efficiency Created high power yellow amber red LED light technology http www quanlight com Southern CA Area QuantaSol Limited...

  16. Company Name Company Name Address Place Zip Sector Product Website

    Open Energy Info (EERE)

    com Texas Area HelioVolt Inc HelioVolt Inc E Riverside Dr Austin Texas Solar Thin film solar panel producer http www heliovolt net Texas Area Horizon Wind Energy Horizon Wind...

  17. Company Name Company Name Address Place Zip Sector Product Website

    Open Energy Info (EERE)

    environmental costs Gaiam Real Goods Gaiam Real Goods W So Boulder Rd Boulder Colorado Solar PV panel efficient lighting distributor http www gaiam com realgoods Rockies Area...

  18. Company Name Company Name Address Place Zip Sector Product Website

    Open Energy Info (EERE)

    CREATIVE ELECTRO POWER CREATIVE ELECTRO POWER kazipara mirpur Dhaka Solar IPS CONTROLLER Solar panel http www smmbd com Southern CA Area Caprock Roofing Caprock Roofing Lewisville...

  19. Company Name Company Name Address Place Zip Sector Product Website

    Open Energy Info (EERE)

    Research Center Brookpark Rd Cleveland Ohio Biofuels Carbon Efficiency Renewable Energy Solar Wind energy Research and development http www nasa gov centers glenn home index html...

  20. Company Name Company Name Address Place Zip Sector Product Website

    Open Energy Info (EERE)

    integrates services including the research development production sales of polysilicon solar panel CEEG Shanghai Solar Science Technology CEEG Shanghai Solar Science Technology...

  1. Property:Incentive/AddlPlace | Open Energy Information

    Open Energy Info (EERE)

    (Massachusetts) + Chicopee Electric Light Department + City and County of Denver - Solar Panel Permitting (Colorado) + City and County of Denver + City of Austin - Zoning...

  2. Company Name Company Name Address Place Zip Sector Product Website

    Open Energy Info (EERE)

    Point Drive Fort Collins Colorado Solar Solar cell passive solar architectural glass solar grid tie inverter semiconductor flat panel display data storage http www advanced...

  3. Placing power linres : GIS helps site energy corridors.

    SciTech Connect (OSTI)

    Kuiper, J. A.; Cantwell, B.; Hlohowskyj, I.; Moore, H. R.

    2011-08-01

    Turn the lights on when you enter a room, then turn the lights off when you leave. Most of us repeat this sequence many times each day, and never give it another thought. But that seemingly simple light switch on the wall connects us to one of the most complex systems in the world: the electrical grid. Most of the United States is served by a highly reliable and adequate supply of electrical power, which is distributed through a grid of thousands of miles of electricity-transmission lines. However, as the electricity-supply infrastructure ages and consumer demand for electricity grows, the capacity to deliver electrical power hasn't kept pace with demand, and upgrading the electrical-transmission grid has become a more pressing need. From 1988-1998, demand for transmission grew by 30 percent while transmission grew by only 15 percent. From 1999-2009, demand grew by 20 percent and transmission by only 3 percent Despite a short-term decline related to the economic downturn and improved efficiency, U.S. energy consumption is expected to increase by 14 percent between 2008 and 2035. This growth will drive the need to develop viable routes for new transmission lines. Because transmission lines extend over large distances, they typically cross many federal, tribal, state, local and private land jurisdictions, each with a complex and varying set of siting issues and land-management practices. And as the existing grid needs improvement to meet growing demand, the U.S. is rapidly developing renewable energy sources, particularly solar and wind energy, often in areas far removed from existing electricity-transmission infrastructure and energy-consumption areas.

  4. Is your stormwater pollution prevention plan in place

    SciTech Connect (OSTI)

    Sparks, C.J. )

    1994-05-01

    Some of the uncertainty surrounding the National Pollutant Discharge Elimination System (NPDES) stormwater requirements were clarified by the general permits issued by the Environmental Protection Agency (EPA) and by a number of states. However, many questions remain. This paper explains what Stormwater Pollution Prevention Plans requirements are; how to get started; and follow-through.

  5. Company Name Company Name Address Place Zip Sector Product Website

    Open Energy Info (EERE)

    Industries GmbH SunCoal Industries GmbH K nigs Wusterhausen Germany Producer of bio coal SunConnex International BV SunConnex International BV Amsterdam Netherlands Solar Dutch...

  6. The place for sodars in a high-technology environment.

    SciTech Connect (OSTI)

    Coulter, R. L.

    1998-06-12

    In an era of increasingly complex technology, some of the atmospheric quantities most difficult to measure and observe are yielding their secrets to increasingly complex instruments and combinations of instruments. For example, water vapor profiles, a long-time nemesis to detailed examination, have become measurable with the use of Raman lidar; temperature profile measurements are becoming relatively routine with radio acoustic sounding systems (RASSs) or infrared Fourier transform instrumentation such as the atmospheric emitted radiance interferometer (AERI); and radar, lidar, or combinations of the two are enabling wind profile measurements to increasing altitudes. What, then, is the role of the relatively pedestrian sodar in such an era? Because the sodar's propagation speed in the atmosphere is six orders of magnitude smaller than that of its electromagnetic counterparts (3 x 10{sup 2} vs. 3 x 10{sup 8} m/s), severely limiting its rate of interrogation, and because the sodar's signal limit frequency modulation techniques, many high-technology advances associated with enormous increases in computation speed and available memory have had relatively little direct impact on acoustic remote sensing. However, the principal elements of acoustic remote sensing continue to make it a useful, even essential, tool for obtaining a better understanding of the physics of the lower atmosphere. The sodar's ''slow'' propagation speed provides relatively easy access to the region between 10 m and several hundred meters above the surface that is often inaccessible to other instruments. This is the region of the atmosphere where conditions often change radically with height, the ''matching'' region between large-scale forcing and small-scale surface heterogeneities that can have large effects on human activity. The atmosphere provides signals for sodars that are rich in content because the phase speed of sound is dependent on the atmosphere itself and is tied directly to the atmosphere's temperature and wind structure. Hence, the signals from acoustic remote sensing instruments can provide boundary conditions crucial for the proper operation of numerical models of the atmosphere whose output is becoming increasingly important in individual and business decision making.

  7. Name Name Address Place Zip Category Sector Telephone number...

    Open Energy Info (EERE)

    Hydro Marine and Hydrokinetic http acep uaf edu facilities tanana river hydrokinetic test site aspx Alden Research Laboratory Inc Alden Research Laboratory Inc Shrewsbury Street...

  8. Company Name Company Name Address Place Zip Sector Product Website

    Open Energy Info (EERE)

    EV Drive Train and Services http www aevehicles com Rockies Area American Wind Power Hydrogen LLC American Wind Power Hydrogen LLC New York New York Hydro Hydrogen Vehicles AWP H...

  9. Company Name Company Name Address Place Zip Sector Product Website

    Open Energy Info (EERE)

    ANV Partners ANV Partners Denver Colorado Hydro Hydrogen Services Solar Wind energy AQWON Motors AQWON Motors Speinshart Germany Hydro Hydrogen AQWON Motors has developed the first...

  10. Property:Incentive/Cont3Place | Open Energy Information

    Open Energy Info (EERE)

    Gunnison, Lake, and Pitkin Counties - Energy Smart Colorado Loan Program (Colorado) + Avon, Colorado + El Paso Electric Company - Residential Solutions Program (Texas) + Texas +...

  11. DepoNet

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    DRAFT TANK CLOSURE AND WASTE MANAGEMENT ENVIORNMENTAL IMPACT STATEMENT PUBLIC HEARING March 8, 2010 6:00 p.m. Seattle Center 305 Harrison Street Seattle, Washington 98109 Mr. ...

  12. DOE Zero Energy Ready Home Case Study: Dwell Development, Reclaimed...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Seattle, WA, Systems Home DOE Zero Energy Ready Home: Montlake Modern - Seattle, Washington DOE Zero Energy Ready Home Case Study: Palo Duro Homes, Via del Cielo, Santa Fe, NM

  13. E3 Energy Partners | Open Energy Information

    Open Energy Info (EERE)

    Seattle, Washington Zip: 98109 Sector: Biomass, Renewable Energy Product: Seattle-based chemical, R&D and full-service engineering company serving biomass and waste-to-energy...

  14. Lincoln Park shoreline erosion control project: Monitoring for surface substrate, infaunal bivalves and eelgrass, 1993

    SciTech Connect (OSTI)

    Antrim, L.D.; Thom, R.M.; Gardiner, W.W.

    1993-09-01

    In 1988, the US Army Corps of Engineers and the City of Seattle placed material on the upper beach at Lincoln Park, in West Seattle, Washington. The fill served to mitigate shoreline erosion that had caused undercutting and collapse of the seawall in several places. A series of pre- and post-construction studies have been conducted to assess the impacts to marine biota of fill placement and movement of surface substrate. This study was designed to monitor infaunal bivalves and eelgrass from intertidal areas in and adjacent to the area of original fill placement. Findings from this survey were compared to previous survey results to determine (1) if recruitment of infaunal bivalves to the fill area has occurred, (2) if infaunal bivalve densities outside the fill area are stable, and (3) if eelgrass distribution and abundance have remained stable along the adjacent shoreline. To maximize comparability of findings from this survey with previous studies, sampling techniques, transects, and tidal elevations were consistent with previous studies at this site.

  15. Browse by Discipline -- E-print Network Subject Pathways: Physics...

    Office of Scientific and Technical Information (OSTI)

    ... of Washington at Seattle Meseguer, Alvaro (Alvaro Meseguer) - Departament de Fsica Aplicada, Universitat Politcnica de Catalunya Messalem, Rami (Rami Messalem) - ...

  16. Climate Action Champions: Fact Sheets | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Fact Sheets Climate Action Champions: Fact Sheets PDF icon FACT SHEET: Blue Lake Rancheria Tribe's Energy Performance PDF icon FACT SHEET: Seattle's New Building Energy Code PDF icon FACT SHEET: Seattle's Transition to High Efficiency Space Heating PDF icon FACT SHEET: Seattle's Net Zero Performance Analysis PDF icon FACT SHEET: Seattle's Cost-Effectiveness of Deep Green Alterations of Multi-family Buildings PDF icon FACT SHEET: Sault Saint Marie Tribe's Net Zero Retrofit Analysis More Documents

  17. SEB Secretariat and Knowledge Manager | Department of Energy

    Energy Savers [EERE]

    SEAD-Fact-Sheet.pdf SEAD-Fact-Sheet.pdf PDF icon SEAD-Fact-Sheet.pdf More Documents & Publications International Cooperation on Advancing Equipment and Appliance Efficiency Clean Energy Ministerial Press Fact Sheet CEM_Metrics_and_Technical_Note_7_14_10.pdf Energy

    SEATTLE HELPS COMMUNITIES POWER BUILDINGS EFFICIENTLY SEATTLE HELPS COMMUNITIES POWER BUILDINGS EFFICIENTLY SEATTLE HELPS COMMUNITIES POWER BUILDINGS EFFICIENTLY Seattle, Washington, is a diverse, environmentally aware city

  18. Browse by Discipline -- E-print Network Subject Pathways: Physics...

    Office of Scientific and Technical Information (OSTI)

    ... of Electrical Engineering, University of Washington at Seattle Jansen, Kenneth E. (Kenneth E. Jansen) - Scientific Computation Research Center, Rensselaer Polytechnic ...

  19. Washington/Transmission | Open Energy Information

    Open Energy Info (EERE)

    Avista, Pacificorp, Puget Sound Energy, Tacoma Public Utilities, Bonneville Power Administration, Columbia Grid, Northern Tier Transmission Group, and Seattle City...

  20. Instrumentation for Monitoring around Marine Renewable Energy Converters: Workshop Final Report

    SciTech Connect (OSTI)

    Copping, Andrea E.; Polagye, Brian

    2014-01-31

    Report on workshop held in Seattle for DOE WWPTO on instrument needs for monitoring marine energy devices

  1. Media Advisory: Jefferson Lab Signs Partnership Agreement With Virginia

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    STEAM Academy | Jefferson Lab Advisory: Jefferson Lab Signs Partnership Agreement With Virginia STEAM Academy Media Advisory: Jefferson Lab Signs Partnership Agreement With Virginia STEAM Academy Date: Monday, Nov. 26, 2012 Time: The signing will take place at 2:30 p.m. Place: CEBAF Center at Jefferson Lab, 12000 Jefferson Avenue, Newport News, VA 23606 Event: Jefferson Science Associates/Jefferson Lab will sign a Memorandum of Understanding (MOU) with the Virginia Science Technology

  2. Baseline risk assessment for exposure to contaminants at the St. Louis Site, St. Louis, Missouri

    SciTech Connect (OSTI)

    Not Available

    1993-11-01

    The St. Louis Site comprises three noncontiguous areas in and near St. Louis, Missouri: the St. Louis Downtown Site (SLDS), the St. Louis Airport Storage Site (SLAPS), and the Latty Avenue Properties. The main site of the Latty Avenue Properties includes the Hazelwood Interim Storage Site (HISS) and the Futura Coatings property, which are located at 9200 Latty Avenue. Contamination at the St. Louis Site is the result of uranium processing and disposal activities that took place from the 1940s through the 1970s. Uranium processing took place at the SLDS from 1942 through 1957. From the 1940s through the 1960s, SLAPS was used as a storage area for residues from the manufacturing operations at SLDS. The materials stored at SLAPS were bought by Continental Mining and Milling Company of Chicago, Illinois, in 1966, and moved to the HISS/Futura Coatings property at 9200 Latty Avenue. Vicinity properties became contaminated as a result of transport and movement of the contaminated material among SLDS, SLAPS, and the 9200 Latty Avenue property. This contamination led to the SLAPS, HISS, and Futura Coatings properties being placed on the National Priorities List (NPL) of the US Environmental Protection Agency (EPA). The US Department of Energy (DOE) is responsible for cleanup activities at the St. Louis Site under its Formerly Utilized Sites Remedial Action Program (FUSRAP). The primary goal of FUSRAP is the elimination of potential hazards to human health and the environment at former Manhattan Engineer District/Atomic Energy Commission (MED/AEC) sites so that, to the extent possible, these properties can be released for use without restrictions. To determine and establish cleanup goals for the St. Louis Site, DOE is currently preparing a remedial investigation/feasibility study-environmental impact statement (RI/FS-EIS). This baseline risk assessment (BRA) is a component of the process; it addresses potential risk to human health and the environment associated wi

  3. Jefferson Lab Hosts Science Poster Session | Jefferson Lab

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    July 31, 2009 Time: 11:45 a.m. - 2 p.m. Place: CEBAF Center Lobby, 12000 Jefferson Avenue, Newport News, VA Event: High school and college interns and middle school science teachers that participated in Jefferson Lab's summer science enrichment programs will share their summer experiences and projects during a Poster Session. Participating in this summer's poster session are: Seven (7) Hampton Roads-area high school seniors who participated in the Lab's Summer Honors internship program;

  4. Employee Concerns Program

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Contract » ECP Employee Concerns Program Employees Concern Program provides a place for lab employees to report concerns without fear. Los Alamos National Laboratory established an ECP to provide Laboratory employees and subcontractors with a mechanism to report employee concerns without fear of retaliation and to have those concerns addressed through an independent, objective evaluation. Employees can initiate concerns to the ECP through the following avenues: Call ECP 24-Hour Helpline: (505)

  5. Microsoft Word - EM SSAB Chairs Letter Reclamation of Asset Metals 070909.doc

    Office of Environmental Management (EM)

    July 9, 2009 Inés R. Triay Assistant Secretary for Environmental Management U.S. Department of Energy, EM-1 1000 Independence Avenue, SW Washington, DC 20585 Dear Assistant Secretary Triay: On January 12, 2000, the Department of Energy (DOE) placed a moratorium on the free release of volumetrically contaminated metals pending a decision by the Nuclear Regulatory Commission (NRC) on establishment of national standards. The NRC continues to review this issue, and the moratorium remains in effect.

  6. Media Advisory - Jefferson Lab Hosts Summer Intern Science Poster Session |

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Jefferson Lab July 30, 2010 Time: 11:45 a.m. - 2 p.m. Place: Jefferson Lab, CEBAF Center Lobby, 12000 Jefferson Avenue, Newport News, VA 23606 Event: More than 35 high school and college interns that participated in Jefferson Lab's summer science enrichment programs will share their summer experiences and projects during a Poster Session. Participating in this summer's poster session are: Six (6) Hampton Roads-area high school students who participated in the laboratory's Summer Honors

  7. Media Advisory: Poster Session Highlights Projects, Research Carried Out by

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Summer Interns at Jefferson Lab | Jefferson Lab Aug. 1, 2014 Time: 11:45 a.m. - 1 p.m. Place: The CEBAF Center lobby at Jefferson Lab, 12000 Jefferson Avenue, Newport News, VA 23606 Event: More than 40 high school students and college undergraduates who participated in summer science internship programs at the Department of Energy's Thomas Jefferson National Accelerator Facility, or Jefferson Lab, will share with invited guests and members of the lab community results from their respective

  8. Meetings | U.S. DOE Office of Science (SC)

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Meetings High Energy Physics Advisory Panel (HEPAP) HEPAP Home Meetings Previous Meetings 2016 HEPAP Membership Charges/Reports Charter .pdf file (44KB) HEP Committees of Visitors Federal Advisory Committees HEP Home Meetings Print Text Size: A A A FeedbackShare Page The next HEPAP meeting will take place March 31- April 1, 2016, at the Doubletree by Hilton Hotel Bethesda External link , 8120 Wisconsin Avenue, Bethesda, Maryland 20814. Agenda .pdf file (81KB) Presentations Instructions for

  9. 2011 Municipal Consortium Northwest Region Workshop Materials | Department

    Energy Savers [EERE]

    of Energy Northwest Region Workshop Materials 2011 Municipal Consortium Northwest Region Workshop Materials This page provides links to the presentations given at the DOE Municipal Solid-State Street Lighting Consortium Northwest Region Workshop, held in Seattle July 15, 2011. Presentations and Materials Workshop Agenda Seattle City Light: LED Streetlight Program Case Study Edward Smalley, Seattle City Light; Lok Chan, DKS Associates SSL Not As Simple As It Seems: Things to Know and Things

  10. Database for Regional Geology, Phase 1- A Tool for informing Regional

    Energy Savers [EERE]

    Energy Data-Driven Mailing Helps Heat Up Untapped Seattle Market Data-Driven Mailing Helps Heat Up Untapped Seattle Market Abridged transcript of an interview with Community Power Works Project Manager Ruth Bell and Program/System Analyst Vince Schueler of the Washington State University Energy Program. PDF icon Seattle Focus Series More Documents & Publications The Better Buildings Neighborhood View -- January 2013 howtodesignandmarketenergyefficiencyprogramstospecificneighborhoods.doc

  11. Community Power Works for Small Business | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Works for Small Business Community Power Works for Small Business Information on Community Power Works in Seattle and their small business offerings, Capitol Hill Chamber of Commerce, April 24, 2012. PDF icon Community Power Works for Small Business More Documents & Publications Spotlight on Seattle, Washington: Community Partnerships Work to Extend Program Reach Community Power Works: Good Jobs, Green Jobs Conference Seattle Summary of Reported Data

  12. Community Power Works Final Report and Conclusions

    SciTech Connect (OSTI)

    Baumel, Christie

    2015-03-09

    This is the final technical report for the City of Seattle's Community Power Works program, funded through the US DOE Better Buildings grant program.

  13. Hydrogen Infrastructure Expansion: Consumer Demand and Cost-Reduction...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Discrete Choice Consumer Survey * Received 500 responses from each city: * Los Angeles, CA * Atlanta, GA * Minneapolis, MN * Seattle, WA * Two choices: 1. Conventional vehicle 2. ...

  14. Clean Cities: Western Washington Clean Cities coalition

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Studies where her studies focused on policies to stimulate the growth of renewable energy. 1904 Third Ave, Ste 105 Seattle, WA 98101 Western Washington Success Stories Watch...

  15. Microsoft Word - Final Rainfall in Washington newsletter_2010...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    England and Southern Scotland The eastern coasts of large islands like Australia and Madagascar Areas in the northwestern United States near the Great Lakes Seattle, Washington,...

  16. Microsoft Word - EIA-111 Form for 2018 FINAL 071015 with Picklists...

    Gasoline and Diesel Fuel Update (EIA)

    hours EIA-111 QUARTERLY ELECTRICITY IMPORTS AND EXPORTS REPORT ... Puget Sound Energy, Inc. PSEI Salt River Project Agricultural Improvement and Power District SRP Seattle City ...

  17. Washington: Community Power Works is Building a More Efficient...

    Broader source: Energy.gov (indexed) [DOE]

    the awe-inspiring Puget Sound, Seattle has a legacy of environmental stewardship and a culture of innovation. Combined with thoughtful leadership on climate change, these are the...

  18. DOE FACT SHEET: Transition to High Efficiency Space Heating

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    DOE FACT SHEET: Transition to High Efficiency Space Heating Overview The City of Seattle ... in spring of 2015 of advanced efficient space heating options available for commercial ...

  19. LSST Science Book, Version 2.0 (Journal Article) | SciTech Connect

    Office of Scientific and Technical Information (OSTI)

    Julius ; Alabama A-M ; Anderson, Scott F. ; Washington U., Seattle ; Andrew, ... Barth, Aaron J. ; UC, Irvine ; Bartlett, James G. ; Diderot U., Paris ; Becker, Andrew ...

  20. Microsoft PowerPoint - Sadiki - SW Regional Hydropower Conference...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    ... Administration Contracts Manitoba Hydro New Brunswick Power Corporation New York Power Authority Ontario Power Generation Pacific Gas & Electric Company Seattle City Light ...