National Library of Energy BETA

Sample records for automated respondent mailing

  1. Mailing List Subscription

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mail and Distribution Mail and Distribution The DOE Mail Center provides a variety of mail services for all official and other authorized mail for the Department of Energy and its employees. The services provided include the processing of all incoming postal mail, outgoing official mail, internal mail processing, accountable mail processing, pouch mail, a variety of overnight express mail services, directory services, and pick-up and delivery services. The Mail Management Memorandum (pdf)

  2. Electronic Mail Analysis Capability

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    2001-01-08

    Establishes the pilot program to test the Department of Energy (DOE) Electronic Mail Analysis Capability (EMAC), which will be used to monitor and analyze outgoing and incoming electronic mail (e-mail) from the National Nuclear Security Administration (NNSA) and DOE laboratories that are engaged in nuclear weapons design or work involving special nuclear material. No cancellation.

  3. Mail Services User's Manual

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    2000-07-12

    This Manual provides detailed information on using the Department of Energy (DOE) mail services. Canceled by DOE G 573.1-1.

  4. mail_paycheck_111609

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Updated:
11/16/09
 P.O Box 1663 Los Alamos, New Mexico 87544 MAIL PAYCHECK FORM TO: CRAFT PAYROLL DEPARTMENT - P238 FROM: (Please Print) Z# ORG CODE PLEASE MAIL MY PAYCHECK, TO THE ADDRESS ON FILE WITH PAYROLL, FOR THE PAY PERIOD BEGINNING: EMPLOYEE SIGNATURE Z# DATE SUPERVISOR SIGNATURE Z# DATE

  5. Request Repository Mailing List

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Policies User Surveys NERSC Users Group User Announcements Help Staff Blogs Request Repository Mailing List Operations for: Passwords & Off-Hours Status 1-800-66-NERSC, option 1 or 510-486-6821 Account Support https://nim.nersc.gov accounts@nersc.gov 1-800-66-NERSC, option 2 or 510-486-8612 Consulting http://help.nersc.gov consult@nersc.gov 1-800-66-NERSC, option 3 or 510-486-8611 Home » For Users » Request Repository Mailing List Request Repository Mailing List Use this form to request a

  6. Mail and Distribution | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Mail and Distribution Mail and Distribution The DOE Mail Center provides a variety of mail services for all official and other authorized mail for the Department of Energy and its employees. The services provided include the processing of all incoming postal mail, outgoing official mail, internal mail processing, accountable mail processing, pouch mail, a variety of overnight express mail services, directory services, and pick-up and delivery services. The Mail Management Memorandum (pdf)

  7. By Certified Mail May

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    By Certified Mail May 4,2012 Dorothy Riehle FOIA Office U.S. Department of Energy P. O. Box 550 Richland, WA 99352 Re: FOIA RequestLand Transfer Dear Ms. Riehle: Pursuant to the...

  8. By E-Mail

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    By E-Mail May 29, 2012 Dorothy Riehle FOIA Office U.S. Department of Energy P. O. Box 550 Richland, WA 99352 Re: FOIA RequestTank Inventories Dear Ms. Riehle: Pursuant to the...

  9. Mail Services | The Ames Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mail Management Memorandum, July 2, 2010 Mail Management Memorandum, July 2, 2010 Mail Management Memorandum prescribing policy and requirements for the effective, economical, and secure management of incoming, internal, and outgoing mail in Federal agencies. These requirements pertain to all DOE offices, and may also apply to national laboratories and other contractor facilities, depending on whether they qualify as Federal facilities as defined in the regulations. PDF icon Mail Management

  10. PDSF Mailing Lists

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mailing Lists PDSF Mailing Lists pdsf-status@nersc.gov This is voluntary. You have to subscribe to it. This list can be chatty, since major and minor problems are sent to this list. Also multiple status updates will be sent for extended outages. Subscribe: Send email to pdsf-status-request@nersc.gov with subscribe in the subject of the message. Unsubscribe: Send email to pdsf-status-request@nersc.gov with unsubscribe in the subject of the message. pdsf-users@nersc.gov Users are subscribed to

  11. Mail Services User's Guide

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    2005-10-03

    This Guide provides information on using Department of Energy (DOE) mail services in accordance with U.S. Postal Service, General Services Administration (GSA), and DOE regulations. Cancels DOE M 573.1-1. Canceled by DOE N 251.89.

  12. Mailing List Subscription

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mailing List Subscription Jefferson Lab Home Search Contact JLab Descriptions A - C autocad: No description available briefs: On-Target Briefs cctest-alert: No description available clas_drift_chambers: Hall B Drift Chambers Group clas_offline: Discussion group for CLAS RECSIS group clas_slow_control: CLAS slow control working group clas_strangep: Hall B Strange Particles using CLAS discussion group clas_tof: CLAS Time of Flight Collaboration credit-card: List of JLab Credit Card buyers csc_all:

  13. Printing and Mail Managers Exchange Forum Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    May 16, 2013 Mail discussion Joe Whitford opened the meeting by introducing Al Majors to talk about mail related items. 1) Update on the USPS mail name changes. If approved by the Postal Regulatory Commission the following name changes will go into effective July 28, 2013: a. Express Mail will be called Priority Mail Express b. Express Mail International will be Priority Mail International c. Express Mail Corporate Account will become USPS Express Corporate Account Only the names of these

  14. LLNL E-Mail Utilities

    Energy Science and Technology Software Center (OSTI)

    2005-10-31

    The LLNL E-mail Utilities software library is a Java API that simplifies the creation and delivery of email in Java business applications. It consists of a database-driven template engine, various strategies for composing, queuing, dispatching email and a Java Swing GUI for creating and editing email templates.

  15. Mail Management Memorandum, July 2, 2010 | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Mail Management Memorandum, July 2, 2010 Mail Management Memorandum, July 2, 2010 Mail Management Memorandum prescribing policy and requirements for the effective, economical, and ...

  16. Minutes from the Print and Mail Managers Exchange Forum Teleconference...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Minutes from the Print and Mail Managers Exchange Forum Teleconferences Minutes from the Print and Mail Managers Exchange Forum Teleconferences Minutes from the Print and Mail...

  17. Sandia National Laboratories: Research: High Consequence, Automation...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    First responder support Contact Us Questions and comments about High Consequence, Automation, & Robotics? Contact us. Videos T An error occurred. Try watching this video on...

  18. Field Facilities Contacts for Printing and Mail

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Field Facilities Contacts for Printing and Mail Print and Mail Contacts Site Printing Contact Mail Contact NNSA, Albuquerque Deborah Miller (505) 845-6049 Thomas H. Clinkenbeard NNSA Service Center PO Box 5400 Albuquerque, NM 87185-5400 (505) 845-4602 tclinkenbeard@doeal.gov (mailto:tclinkenbeard@doeal.gov) Argonne National Laboratory Doreen Schoening Argonne National Laboratory U.S. Department of Energy 9700 South Cass Avenue Blvd 340 Lemonmt, IL 60439 (630) 840-6399 dschoening@anl.gov

  19. Printing and Mail Managers Exchange Forum Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    November 21, 2013 Mail Managers discussion Joe Whitford opened the meeting by introducing Tony Nellums to talk about mail related items. 1) Mr. Nellums introduced Derek Milner, Policy Advisor from the GSA Office of Government-wide policy. a. Mr. Milner stated that he is being replaced as primary policy contact by Linda Willoughby (Linda.Willoughby@gsa.gov) or (202) 219-1083. b. Initiatives discussed by Mr. Milner included: Upcoming mail reports. The SMART system is online and available now.

  20. responding to emergencies

    National Nuclear Security Administration (NNSA)

    1%2A en Responding to Emergencies http:nnsa.energy.govaboutusourprogramsemergencyoperationscounterterrorismrespondingtoemergencies

  1. responding to emergencies

    National Nuclear Security Administration (NNSA)

    1%2A en Responding to Emergencies http:www.nnsa.energy.govaboutusourprogramsemergencyoperationscounterterrorismrespondingtoemergencies

  2. Program Automation

    Broader source: Energy.gov [DOE]

    Better Buildings Residential Network Data and Evaluation Peer Exchange Call Series: Program Automation, Call Slides and Discussion Summary, November 21, 2013. This data and evaluation peer exchange call discussed program automation.

  3. Minutes from the January 10, 2013 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    January 10, 2013 Mail discussion Al Majors opened the meeting by discussing the Mail Management Report and latest update on status. One final report is yet to be submitted, after which close out will be accomplished. Copies will be provided to the Mail Managers once completed. Al introduced Derrick Miliner, Program Manager from the General Services Administration, Office of Government-wide Policy, and acknowledged Mr. Miliner's role in completing the Mail Management Report. Mail Security Plans A

  4. Field Facilities Contacts for Printing and Mail | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Field Facilities Contacts for Printing and Mail Field Facilities Contacts for Printing and Mail This is the list of DOE field facilities contacts for Printing and Mail as of April 27, 2011. Go to Mail Services Go to Printing Services PDF icon Field_Facilities_Contacts_Print-Mail.pdf More Documents & Publications Director's Perspective by George Miller Tenant Education and Training Fire Safety Committee Membership List

  5. Read Your E-mail | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Read Your E-mail All Argonne employees can read their e-mail through the web. Argonne E-Mail service is a robust, reliable electronic communication solution for supporting day-to-day business activities. Features include e-mail, calendar, task lists, and contact lists. While it is designed to work Microsoft Outlook, it also works with other POP- and IMAP-based clients. All employees can read their e-mail through the web. Use the login link at right to get started. Login to E-mail

  6. T-618: Debian update for exim4: Mail Transport Agent

    Broader source: Energy.gov [DOE]

    It was discovered that Exim, the default mail transport agent in Debian, uses DKIM data obtain from DNS directly in a format string, potentially allowing malicious mail senders to execute arbitrary code.

  7. Minutes from the January 19, 2011 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    January 2010 Printing and Mail Managers Exchange Forum Teleconference Twenty-one individuals participated in the Printing and Mail Managers Exchange Forum, which included Printing and Mail Managers and Contractors Comments/Additions to last Months Minutes No comments. Printing Agenda Items......... Update on the Department-wide FY-2010 Three-Year Plan Dallas Woodruff, Headquarters in formed the group that the Department-wide Printing and Publishing Activities is currently in the concurrence

  8. Minutes from the January 20, 2010 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    , 2010 Printing and Mail Managers Exchange Forum Teleconference Twenty-one individuals participated in the Printing and Mail Managers Exchange Forum, which included Printing and Mail Managers and Contractors. Comments/Additions to last Months Minutes Dallas Woodruff, Headquarters opened the meeting by thanking everyone for participating in the today's teleconference. Printing Agenda Items... Update on the Department-wide Printing and Publishing Activities Report Three-Year Plan. Dallas Woodruff,

  9. Minutes from the July 21, 2010 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    July 21, 2010 Printing and Mail Managers Exchange Forum Teleconference Twenty-one individuals participated in the Printing and Mail Managers Exchange Forum, which included Printing and Mail Managers and Contractors. Comments/Additions to last Months Minutes Dallas Woodruff, Headquarters opened the meeting by thanking everyone for participating in the today's teleconference. Printing Agenda Items... Update on the Government Printing Office revisions to the Standard Form one (SF!), Twenty-five

  10. Minutes from the June 28, 2012 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    June 28, 2012 Mail discussion Al Majors opened the meeting by introducing United Parcel Service (UPS) Representative Shelly Scott. Ms. Scott's contact information is: Shelly Scott shellyscott@ups.com 404 402-9827 (cell) Ms. Scott discussed issues relating to various UPS services available to the department. Next Al introduced Michael R. Sanders, President and Chief Executive Officer of Intra-Mail Network, an innovative, information Technology Company that improves the delivery of mail or email

  11. Minutes from the May 26, 2010 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    26, 2010 Printing and Mail Managers Exchange Forum Teleconference Seventeen individuals participated in the Printing and Mail Managers Exchange Forum, which included Printing and Mail Managers and Contractors. Comments/Additions to last Months Minutes Dallas Woodruff, Headquarters opened the meeting by thanking everyone for participating in the today's teleconference. Printing Agenda Items... Update on the FY 2010, Congressional Joint Committee on Printing Commercial Printing Report "JCP

  12. Minutes from the November 01, 2012 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    November 1, 2012 Mail discussion Al Majors opened the meeting by introducing Derrick Milner, Program Manager from the General Services Administration, Office of Government-wide Policy. Mr. Majors and Mr. Miliner discussed the pending Official Mail Management Report for the FY-2012. The question on where to put data relating to certified and registered mail was addressed. It should be placed under the others section or under first class, standard delivery. Mr. Majors also discussed the pending

  13. Minutes from the November 17, 2010 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    November 17, 2010 Printing and Mail Managers Exchange Forum Teleconference Twenty seven individuals participated in the Printing and Mail Managers Exchange Forum, which included Printing and Mail Managers and Contractors Comments/Additions to last Months Minutes No comments. Printing Agenda Items......... Update on the Department-wide "Three-Year Plan" Dallas Woodruff, Headquarters opened the meeting by thanking everyone for providing their sites Three-Year Plan data to Headquarters in

  14. Minutes from the September 15, 2010 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    September 15, 2010 Printing and Mail Managers Exchange Forum Teleconference Twenty-four individuals participated in the Printing and Mail Managers Exchange Forum, which included Printing and Mail Managers and Contractors. Comments/Additions to last Months Minutes Dallas Woodruff, Headquarters opened the meeting by thanking everyone for participating in the today's teleconference. Printing Agenda Items... Upcoming FY 2010 Department-wide Three-Year Plan Dallas Woodruff, Headquarters informed the

  15. Headquarters Program & Staff Office Mailing Addresses | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Headquarters Program & Staff Office Mailing Addresses Headquarters Program & Staff Office Mailing Addresses The following addresses are for delivery of regular mail and small packages: Delivery to the Headquarters buildings in Washington, DC: Name of Individual Title Routing Symbol/Forrestal Building U.S. Department of Energy 1000 Independence Ave., S.W. Washington, DC 20585 Name of Individual Title Routing Symbol/L'Enfant Plaza Building U.S. Department of Energy 1000

  16. Mail-Order Metal-Organic Frameworks (MOFs): Designing Isoreticular...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mail-Order Metal-Organic Frameworks (MOFs): Designing Isoreticular MOF-5 Analogues Comprising Commercially Available Organic Molecules Previous Next List R. L. Martin, L.-C. Lin,...

  17. Minutes from the Print and Mail Managers Exchange Forum Teleconferences

    Broader source: Energy.gov [DOE]

    Minutes from the Print and Mail Managers Exchange Forum Teleconferences.  Contact the Office of Administrative Management and Support at (202) 586-4318 with any questions.

  18. Minutes from the May 3, 2012 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    http:www.gsa.govmailpolicy (for training options) https:www.intra-mail.com ... discussion Brainstorming discussion on methodsapproaches to reduce printing expenses: ...

  19. Respond to the article | Department of Energy

    Office of Environmental Management (EM)

    the article Tips: Home Office and Electronics. Your response * Your email (optional) Send message Contact Us E-mail: Webmaster Online: Facebook iconconnecttwitter.png Twitter...

  20. Apparatus for responding to an anomalous change in downhole pressure

    DOE Patents [OSTI]

    Hall, David R.; Fox, Joe; Wilde, Tyson; Barlow, Jonathan S.

    2010-04-13

    A method of responding to an anomalous change in downhole pressure in a bore hole comprises detecting the anomalous change in downhole pressure, sending a signal along the segmented electromagnetic transmission path, receiving the signal, and performing a automated response. The anomalous change in downhole pressure is detected at a first location along a segmented electromagnetic transmission path, and the segmented electromagnetic transmission path is integrated into the tool string. The signal is received by at least one receiver in communication with the segmented electromagnetic transmission path. The automated response is performed along the tool string. Disclosed is an apparatus for responding to an anomalous change in downhole pressure in a downhole tool string, comprising a segmented electromagnetic transmission path connecting one or more receivers and at least one pressure sensor.

  1. First Responders and Criticality Accidents

    SciTech Connect (OSTI)

    Valerie L. Putman; Douglas M. Minnema

    2005-11-01

    Nuclear criticality accident descriptions typically include, but do not focus on, information useful to first responders. We studied these accidents, noting characteristics to help (1) first responders prepare for such an event and (2) emergency drill planners develop appropriate simulations for training. We also provide recommendations to help people prepare for such events in the future.

  2. TJ Automation | Open Energy Information

    Open Energy Info (EERE)

    TJ Automation Jump to: navigation, search Name TJ Automation Facility TJ Automation Sector Wind energy Facility Type Small Scale Wind Facility Status In Service Owner TJ Automation...

  3. LANL responds to radiological incident

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    LANL responds to radiological incident LANL responds to radiological incident Multiple tests indicate no health risks to public or employees. August 27, 2012 Aerial view of the Los Alamos Neutron Science Center(LANSCE). Aerial view of the Los Alamos Neutron Science Center (LANSCE). The contamination poses no danger to the public. The Laboratory is investigating the inadvertent spread of Technetium 99 by employees and contractors at the Lujan Neutron Scattering Center August 27, 2012-The

  4. Minutes from the October 26, 2011 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Woodruff also said the files are due back to Headquarters no later November 11, 2011, and the report is due to congress by February 10, 2012. Mail Agenda Items...... Fiscal ...

  5. The Future of Electric Vehicles and Arizona State University's MAIL

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Battery | Department of Energy The Future of Electric Vehicles and Arizona State University's MAIL Battery The Future of Electric Vehicles and Arizona State University's MAIL Battery August 11, 2010 - 4:26pm Addthis Cody Friesen and his team at Arizona State University | Photo Credit Arizona State University Cody Friesen and his team at Arizona State University | Photo Credit Arizona State University Andy Oare Andy Oare Former New Media Strategist, Office of Public Affairs What does this

  6. Minutes from the March 14, 2013 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    March 14, 2013 Mail discussion Al Majors is on leave today. Ellsworth Howell Jr. and Tony Nellums are sitting for Al. There are no agenda items for the Mail portion. A discussion period for questions, comments, or suggestions was opened without response Printing discussion Discussed suggestions for reducing printing expenses Presidential Executive Order 13589 and reducing hard copy printing in favor of electronic publishing Sec. 5. Printing. Agencies are encouraged to limit the publication and

  7. Mailing Addresses and Information Numbers for Operations, Field, and Site

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Offices | Department of Energy About Energy.gov » Mailing Addresses and Information Numbers for Operations, Field, and Site Offices Mailing Addresses and Information Numbers for Operations, Field, and Site Offices Name Telephone Number U.S. Department of Energy Ames Site Office 111 TASF, Iowa State University Ames, Iowa 50011 515-294-9557 U.S. Department of Energy Argonne Site Office 9800 S. Cass Avenue Argonne, IL 60439 630-252-2000 U.S. Department of Energy Berkeley Site Office Berkeley

  8. Emergency First Responders' Experience with Colorimetric Detection...

    Office of Scientific and Technical Information (OSTI)

    Emergency First Responders' Experience with Colorimetric Detection Methods Citation Details In-Document Search Title: Emergency First Responders' Experience with Colorimetric ...

  9. Responder Technology Alert (February 2015) (Technical Report...

    Office of Scientific and Technical Information (OSTI)

    Technical Report: Responder Technology Alert (February 2015) Citation Details In-Document Search Title: Responder Technology Alert (February 2015) As part of technology foraging ...

  10. E-mail et Web : pour une navigation sans risque

    ScienceCinema (OSTI)

    None

    2011-10-06

    Présentation orale en français, support visuel en anglais. À travers des exemples concrets, vous consoliderez vos connaissances et pourrez ainsi réajuster vos habitudes concernant l?utilisation sécurisée de votre boîte e-mail et de votre navigateur Web.

  11. Biodetection Technologies for First Responders

    SciTech Connect (OSTI)

    Baird, Cheryl L.; Seiner, Derrick R.; Ozanich, Richard M.; Bartholomew, Rachel A.; Colburn, Heather A.; Straub, Tim M.; Bruckner-Lea, Cindy J.

    2012-10-24

    In a white powder scenario, there are a large number of field-deployable assays that can be used to determine if the suspicious substance contains biological material and warrants further investigation. This report summarizes commercially available technologies that are considered hand portable and can be used by first responders in the field. This is not meant to be an exhaustive list, nor do the authors endorse any of the technologies described herein. Rather, it is meant to provide useful information about available technologies to help end-users make informed decisions about biodetection technology procurement and use.

  12. DOE Responds to Advisory Board Recommendation

    Broader source: Energy.gov [DOE]

    DOE responds to an ORSSAB recommendation for additional waste disposal capacity on the Oak Ridge Reservation.

  13. Emergency Responder Radioactive Material Quick Reference Sheet

    Broader source: Energy.gov [DOE]

    Transportation Emergency Preparedness Program (TEPP) Emergency Responder Radioactive Material Quick Reference Sheet

  14. Multiplex automated genome engineering

    DOE Patents [OSTI]

    Church, George M; Wang, Harris H; Isaacs, Farren J

    2013-10-29

    The present invention relates to automated methods of introducing multiple nucleic acid sequences into one or more target cells.

  15. V-147: IBM Lotus Notes Mail Client Lets Remote Users Execute...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    7: IBM Lotus Notes Mail Client Lets Remote Users Execute Java Applets V-147: IBM Lotus Notes Mail Client Lets Remote Users Execute Java Applets May 2, 2013 - 6:00am Addthis...

  16. Shoe-String Automation

    SciTech Connect (OSTI)

    Duncan, M.L.

    2001-07-30

    Faced with a downsizing organization, serious budget reductions and retirement of key metrology personnel, maintaining capabilities to provide necessary services to our customers was becoming increasingly difficult. It appeared that the only solution was to automate some of our more personnel-intensive processes; however, it was crucial that the most personnel-intensive candidate process be automated, at the lowest price possible and with the lowest risk of failure. This discussion relates factors in the selection of the Standard Leak Calibration System for automation, the methods of automation used to provide the lowest-cost solution and the benefits realized as a result of the automation.

  17. Mail-Order Metal-Organic Frameworks (MOFs) | Center for Gas

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    SeparationsRelevant to Clean Energy Technologies | Blandine Jerome Mail-Order Metal-Organic Frameworks (MOFs)

  18. Minutes from the February 23, 2012 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Minutes Printing and Mail Managers Exchange Forum Teleconference February 23, 2012 Participants: Headquarters (5) National Energy Technology Laboratory, PA National Security Complex Y-12 (2) Oak Ridge National Laboratory Y-12 Site Office (2) Hanford Site Office Oak Ridge Association University Oak Ridge Operations Office BWXT Pantex Site Office JanTec Corporation, Richland, Washington Los Alamos National Laboratory Chicago Office Bettis Atomic Power Laboratory National Security Technology C1,

  19. Respond to the article | Department of Energy

    Energy Savers [EERE]

    Respond to the article Respond to the article May 27, 2015 - 4:05pm Use the form below to submit a question or comment to Christina Stowers about the article Conserving Water, One...

  20. Respond to the article | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Respond to the article Respond to the article June 20, 2014 - 12:30pm Use the form below to submit a question or comment to Christina Stowers about the article Making the...

  1. Respond to the article | Department of Energy

    Office of Environmental Management (EM)

    Respond to the article Respond to the article April 15, 2014 - 5:30pm Use the form below to submit a question or comment to Ben Dotson about the article LabChat: The Science of...

  2. Respond to the article | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Respond to the article Respond to the article October 5, 2012 - 1:00pm Use the form below to submit a question or comment to Allison Casey about the article October is Energy...

  3. Responding to Emergencies | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    Response Responding to Emergencies emergency response logo NNSA serves as the premier technical leader in responding to and successfully resolving nuclear and radiological threats worldwide. When the need arises, NNSA is prepared to respond immediately to any type of nuclear or radiological accident or incident. Part of NNSA's mission is to protect the public, environment, and emergency responders from both terrorist and non-terrorist events by providing a responsive, flexible, efficient, and

  4. First Responders | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    Emergencies First Responders NNSA's first responders include the Radiological Assistance Program (RAP) and the Search Response Team (SRT). These teams provide specialized national-level first responder technical and operational capabilities, and conduct specialized operations, during the initial phases of a response to a radiological or nuclear incident in coordination with federal, state and local authorities. The first responders conduct detection, identification, and analysis of radiological

  5. and Respond | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    Respond NNSA Releases New Nuclear Prevent, Counter, and Respond Report Comprehensive Overview of NNSA's Nonproliferation and Anti-terror Strategy WASHINGTON, D.C. - The National Nuclear Security Administration (NNSA) released its report on NNSA's efforts to prevent nuclear proliferation and terrorism, Prevent, Counter, and Respond-A Strategic Plan to Reduce Global

  6. Responding to Emergencies | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    Part of NNSA's mission is to protect the public, environment, and emergency responders from both terrorist and non-terrorist events by providing a responsive, flexible, efficient, ...

  7. responding to emergencies | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    Accident Response Group NNSA's Accident Response Group (ARG) provides technical guidance and responds to U.S. nuclear weapons accidents. The team assists in assessing weapons ...

  8. First Responders | National Nuclear Security Administration

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Responders | National Nuclear Security Administration Facebook Twitter Youtube Flickr RSS People Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy...

  9. QTR table of respondents | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    table of respondents QTR table of respondents PDF icon QTR_RFI_Comments_Table _V2.pdf More Documents & Publications Table of QTR comments in response to Federal Register RFI Table of QTR comments in response to Federal Register RFI Table of QTR comments in response to Federal Register RFI

  10. U.S. DEPARTMENT OF ENERGY RECEIPT FOR CONTROLLED MAIL PARCEL SERVICE

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    HQ F 1410.2 (06-93) U.S. DEPARTMENT OF ENERGY RECEIPT FOR CONTROLLED MAIL PARCEL SERVICE (Receipt No.) MAIL STATION: DATE: TO: NAME: ROUTING SYMBOL: FROM: DOE Mail Facility, Office of Administration Services 1. 2. 3. 4. 5. 6. 7. 8. 9. 10. 11. 12. 13. 14. 15. 16. 17. 18. ITEM NO. ITEM NO. ITEM NO. SIGN AND RETURN WITHIN 24 HOURS TO AVOID TRACER ACTION TO DOE MAIL FACILITY (Stamp Location) RECEIVED BY: DATE: Printed with soy ink on recycled paper

  11. U-157: Ruby Mail Gem Directory Traversal and Shell Command Injection Vulnerabilities

    Broader source: Energy.gov [DOE]

    Some vulnerabilities have been reported in the Mail gem for Ruby, which can be exploited by malicious people to manipulate certain data and compromise a vulnerable system.

  12. Criticality Safety Basics for INL Emergency Responders

    SciTech Connect (OSTI)

    Valerie L. Putman

    2012-08-01

    This document is a modular self-study guide about criticality safety principles for Idaho National Laboratory emergency responders. This guide provides basic criticality safety information for people who, in response to an emergency, might enter an area that contains much fissionable (or fissile) material. The information should help responders understand unique factors that might be important in responding to a criticality accident or in preventing a criticality accident while responding to a different emergency.

    This study guide specifically supplements web-based training for firefighters (0INL1226) and includes information for other Idaho National Laboratory first responders. However, the guide audience also includes other first responders such as radiological control personnel.

    For interested readers, this guide includes clearly marked additional information that will not be included on tests. The additional information includes historical examples (Been there. Done that.), as well as facts and more in-depth information (Did you know …).

    INL criticality safety personnel revise this guide as needed to reflect program changes, user requests, and better information. Revision 0, issued May 2007, established the basic text. Revision 1 incorporates operation, program, and training changes implemented since 2007. Revision 1 increases focus on first responders because later responders are more likely to have more assistance and guidance from facility personnel and subject matter experts. Revision 1 also completely reorganized the training to better emphasize physical concepts behind the criticality controls that help keep emergency responders safe. The changes are based on and consistent with changes made to course 0INL1226.

  13. Responder Technology Alert Monthly (January 2015)

    SciTech Connect (OSTI)

    Upton, Jaki F.; Stein, Steven L.

    2015-02-01

    As part of technology foraging for the Responder Technology Alliance, established by the Department of Homeland Science and Technologies First Responders Group, this report summarizes technologies that are relevant in the area of “wearables,” with the potential for use by first responders. The content was collected over the previous month(s) and reproduced from a general Internet search using the term wearables. Additional information is available at the websites provided. This report is not meant to be an exhaustive list nor an endorsement of any technology described herein. Rather, it is meant to provide useful information about current developments in the areas wearable technology.

  14. Responder Technology Alert Monthly (December 2014)

    SciTech Connect (OSTI)

    Upton, Jaki F.; Stein, Steven L.

    2015-02-13

    As part of technology foraging for the Responder Technology Alliance, established by the Department of Homeland Science and Technologies First Responders Group, this report summarizes technologies that are relevant in the area of “wearables,” with the potential for use by first responders. The content was collected over the previous month(s) and reproduced from a general Internet search using the term wearables. Additional information is available at the websites provided. This report is not meant to be an exhaustive list nor an endorsement of any technology described herein. Rather, it is meant to provide useful information about current developments in the areas wearable technology.

  15. Emergency Responder Radioactive Material Quick Reference Sheet

    Broader source: Energy.gov [DOE]

    This job aid is a quick reference to assist emergency responders in identifying preliminary safety precautions that should be taken during the initial response phase after arrival at the scene of...

  16. {open_quotes}Media-On-Demand{close_quotes} multimedia electronic mail: A tool for collaboration on the web

    SciTech Connect (OSTI)

    Tsoi, Kei Nam; Rahman, S.M.

    1996-12-31

    Undoubtedly, multimedia electronic mail has many advantages in exchanging information electronically in a collaborative work. The existing design of e-mail systems architecture is inefficient in exchanging multimedia message which has much larger volume, and requires more bandwidth and storage space than the text-only messages. This paper presents an innovative method for exchanging multimedia mail messages in a heterogeneous environment to support collaborative work over YAW on the Internet. We propose a {open_quotes}Parcel Collection{close_quotes} approach for exchanging multimedia electronic mail messages. This approach for exchanging multimedia electronic mail messages integrates the current WWW technologies with the existing electronic mail systems.

  17. Behavior-dependent Routing: Responding to Anomalies with Automated Low-cost Measures

    SciTech Connect (OSTI)

    Oehmen, Christopher S.; Carroll, Thomas E.; Paulson, Patrick R.; Best, Daniel M.; Noonan, Christine F.; Thompson, Seth R.; Jensen, Jeffrey L.; Fink, Glenn A.; Peterson, Elena S.

    2015-10-12

    This is a conference paper submission describing research and software implementation of a cybersecurity concept that uses behavior models to trigger changes in routing of network traffic. As user behavior deviates more and more from baseline models, traffic is routed through more elevated layers of analysis and control.

  18. Meikle Automation Inc | Open Energy Information

    Open Energy Info (EERE)

    Meikle Automation Inc Jump to: navigation, search Name: Meikle Automation Inc Place: Kitchener, Ontario, Canada Zip: N2E 3Z5 Product: Canadian manufacturer of automation systems...

  19. LANL to certify automated influenza surveillance system

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    LANL to certify automated influenza surveillance system LANL to certify automated influenza surveillance system A compact automated system for surveillance and screening of...

  20. Automated gas chromatography

    DOE Patents [OSTI]

    Mowry, Curtis D.; Blair, Dianna S.; Rodacy, Philip J.; Reber, Stephen D.

    1999-01-01

    An apparatus and process for the continuous, near real-time monitoring of low-level concentrations of organic compounds in a liquid, and, more particularly, a water stream. A small liquid volume of flow from a liquid process stream containing organic compounds is diverted by an automated process to a heated vaporization capillary where the liquid volume is vaporized to a gas that flows to an automated gas chromatograph separation column to chromatographically separate the organic compounds. Organic compounds are detected and the information transmitted to a control system for use in process control. Concentrations of organic compounds less than one part per million are detected in less than one minute.

  1. Automated CCTV Tester

    Energy Science and Technology Software Center (OSTI)

    2000-09-13

    The purpose of an automated CCTV tester is to automatically and continuously monitor multiple perimeter security cameras for changes in a camera's measured resolution and alignment (camera looking at the proper area). It shall track and record the image quality and position of each camera and produce an alarm when a camera is out of specification.

  2. Honeywell Demonstrates Automated Demand Response Benefits for...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Honeywell Demonstrates Automated Demand Response Benefits for Utility, Commercial, and Industrial Customers Honeywell Demonstrates Automated Demand Response Benefits for Utility, ...

  3. Sandia National Laboratories: Research: High Consequence, Automation...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    High-Consequence Automation Robotics Homepage About Robotics Research & Development Advanced Controls Advanced Manipulation Cybernetics High-Consequence Automation Demilitarization...

  4. Automation Status | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Automation Status Automation Status Presented at the NREL Hydrogen and Fuel Cell Manufacturing R&D Workshop in Washington, DC, August 11-12, 2011. PDF icon Automation Status More Documents & Publications PEM Stack Manufacturing: Industry Status 2011 NREL/DOE Hydrogen and Fuel Cell Manufacturing R&D Workshop Report Manufacturing Barriers to High Temperature PEM Commercialization

  5. Data-Driven Mailing Helps Heat Up Untapped Seattle Market | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Data-Driven Mailing Helps Heat Up Untapped Seattle Market Abridged transcript of an interview with Community Power Works Project Manager Ruth Bell and ProgramSystem Analyst Vince ...

  6. Data-Driven Mailing Helps Heat Up Untapped Seattle Market | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Data-Driven Mailing Helps Heat Up Untapped Seattle Market Data-Driven Mailing Helps Heat Up Untapped Seattle Market Abridged transcript of an interview with Community Power Works Project Manager Ruth Bell and Program/System Analyst Vince Schueler of the Washington State University Energy Program. PDF icon Seattle Focus Series More Documents & Publications The Better Buildings Neighborhood View -- January 2013 howtodesignandmarketenergyefficiencyprogramstospecificneighborhoods.doc

  7. Sign Up for E-mail Updates | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    Sign Up for E-mail Updates Materials Sciences and Engineering (MSE) Division MSE Home About Staff What's New Research Areas Reports and Activities Science Highlights Principal Investigators' Meetings BES Home What's New Sign Up for E-mail Updates Print Text Size: A A A FeedbackShare Page The Division has a "Dear Colleague" email list, which is used to circulate general information such as funding opportunity announcements and administrative information such as position openings. To

  8. WIPP First Responders Earn Advanced Training Certifications

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    October 1, 2015 WIPP First Responders Earn Advanced Training Certifications Recovery activities at the Waste Isolation Pilot Plant continue to move in a positive direction. As part of increased emergency response capabilities, the WIPP Fire Department and Emergency Response Team are participating in advanced training, improving overall capabilities and receiving advanced certifications. Training and validation testing has included written examinations, as well as intense physical and practical

  9. Legal and policy issues associated with monitoring employee E-mail

    SciTech Connect (OSTI)

    Segura, M.A.; Rither, A.C.

    1997-01-01

    This paper examines the legal issues involved with employer monitoring of employee e-mail. In addition to identifying pertinent legal issues, the paper provides guidelines that will help the Pacific Northwest National Laboratory (PNNL) establish a program for monitoring outgoing e-mail to insure compliance with company policies, particularly those regarding protection of trade secrets and proprietary information, and to comply with the Department of Energy`s (DOE) procedures for protecting Export Controlled Information (ECI). Electronic communication has allowed companies to enhance efficiency, responsiveness and effectiveness. E-mail allows employees to transmit all types of data to other individuals inside and outside of their companies. The ease with which information can be transmitted by e-mail has placed trade secrets, proprietary information, and other sensitive data at risk from inadvertent disclosure by employees. As employers attempt to protect their interests through measures such as monitoring e-mail, they may expose themselves to liability under federal and state laws for violating employee privacy. Business use of e-mail has proliferated so rapidly that the federal and state legal systems have not been able to adequately address the issues arising out of its use in the workplace.

  10. Engineering an allosteric transcription factor to respond to...

    Office of Scientific and Technical Information (OSTI)

    Engineering an allosteric transcription factor to respond to new ligands Citation Details In-Document Search Title: Engineering an allosteric transcription factor to respond to new ...

  11. Homeowners: Respond to Natural Gas Disruptions | Department of...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Natural Gas Disruptions Homeowners: Respond to Natural Gas Disruptions Homeowners: Respond to Natural Gas Disruptions Because natural gas is distributed through underground ...

  12. Local Leaders: Respond to Natural Gas Disruptions | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Natural Gas Disruptions Local Leaders: Respond to Natural Gas Disruptions Local Leaders: Respond to Natural Gas Disruptions Because natural gas is distributed through underground ...

  13. Homeowners: Respond to Power Outages | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Guidelines Homeowners: Respond to Power Outages Homeowners: Respond to Power Outages ... Learn more Certify your electrical systems-If your house sustains flood or wind damage ...

  14. National Hydrogen Safety Training Resource for Emergency Responders...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Safety Training Resource for Emergency Responders Webinar Slides National Hydrogen Safety Training Resource for Emergency Responders Webinar Slides Presentation slides from the ...

  15. Automated gas chromatography

    DOE Patents [OSTI]

    Mowry, C.D.; Blair, D.S.; Rodacy, P.J.; Reber, S.D.

    1999-07-13

    An apparatus and process for the continuous, near real-time monitoring of low-level concentrations of organic compounds in a liquid, and, more particularly, a water stream. A small liquid volume of flow from a liquid process stream containing organic compounds is diverted by an automated process to a heated vaporization capillary where the liquid volume is vaporized to a gas that flows to an automated gas chromatograph separation column to chromatographically separate the organic compounds. Organic compounds are detected and the information transmitted to a control system for use in process control. Concentrations of organic compounds less than one part per million are detected in less than one minute. 7 figs.

  16. Automated macromolecular crystallization screening

    DOE Patents [OSTI]

    Segelke, Brent W.; Rupp, Bernhard; Krupka, Heike I.

    2005-03-01

    An automated macromolecular crystallization screening system wherein a multiplicity of reagent mixes are produced. A multiplicity of analysis plates is produced utilizing the reagent mixes combined with a sample. The analysis plates are incubated to promote growth of crystals. Images of the crystals are made. The images are analyzed with regard to suitability of the crystals for analysis by x-ray crystallography. A design of reagent mixes is produced based upon the expected suitability of the crystals for analysis by x-ray crystallography. A second multiplicity of mixes of the reagent components is produced utilizing the design and a second multiplicity of reagent mixes is used for a second round of automated macromolecular crystallization screening. In one embodiment the multiplicity of reagent mixes are produced by a random selection of reagent components.

  17. Automated Job Hazards Analysis

    Broader source: Energy.gov [DOE]

    AJHA Program - The Automated Job Hazard Analysis (AJHA) computer program is part of an enhanced work planning process employed at the Department of Energy's Hanford worksite. The AJHA system is routinely used to performed evaluations for medium and high risk work, and in the development of corrective maintenance work packages at the site. The tool is designed to ensure that workers are fully involved in identifying the hazards, requirements, and controls associated with tasks.

  18. Automated Proactive Fault Isolation: A Key to Automated Commissioning

    SciTech Connect (OSTI)

    Katipamula, Srinivas; Brambley, Michael R.

    2007-07-31

    In this paper, we present a generic model for automated continuous commissioing and then delve in detail into one of the processes, proactive testing for fault isolation, which is key to automating commissioning. The automated commissioining process uses passive observation-based fault detction and diagnostic techniques, followed by automated proactive testing for fault isolation, automated fault evaluation, and automated reconfiguration of controls together to continuously keep equipment controlled and running as intended. Only when hard failures occur or a physical replacement is required does the process require human intervention, and then sufficient information is provided by the automated commissioning system to target manual maintenance where it is needed. We then focus on fault isolation by presenting detailed logic that can be used to automatically isolate faults in valves, a common component in HVAC systems, as an example of how automated proactive fault isolation can be accomplished. We conclude the paper with a discussion of how this approach to isolating faults can be applied to other common HVAC components and their automated commmissioning and a summary of key conclusions of the paper.

  19. DOE Responds to Advisory Board Recommendation on Groundwater Studies

    Broader source: Energy.gov [DOE]

    The DOE Office of Environmental Management responds to an ORSSAB recommendation on additional groundwater studies.

  20. Training For Radiation Emergencies, First Responder Operations- Course Presentation

    Broader source: Energy.gov [DOE]

    Presentation slides use in the Training For Radiation Emergencies, First Responder Operations refresher training course.

  1. Automated fiber pigtailing machine

    DOE Patents [OSTI]

    Strand, O.T.; Lowry, M.E.

    1999-01-05

    The Automated Fiber Pigtailing Machine (AFPM) aligns and attaches optical fibers to optoelectronic (OE) devices such as laser diodes, photodiodes, and waveguide devices without operator intervention. The so-called pigtailing process is completed with sub-micron accuracies in less than 3 minutes. The AFPM operates unattended for one hour, is modular in design and is compatible with a mass production manufacturing environment. This machine can be used to build components which are used in military aircraft navigation systems, computer systems, communications systems and in the construction of diagnostics and experimental systems. 26 figs.

  2. Automated fiber pigtailing machine

    DOE Patents [OSTI]

    Strand, Oliver T.; Lowry, Mark E.

    1999-01-01

    The Automated Fiber Pigtailing Machine (AFPM) aligns and attaches optical fibers to optoelectonic (OE) devices such as laser diodes, photodiodes, and waveguide devices without operator intervention. The so-called pigtailing process is completed with sub-micron accuracies in less than 3 minutes. The AFPM operates unattended for one hour, is modular in design and is compatible with a mass production manufacturing environment. This machine can be used to build components which are used in military aircraft navigation systems, computer systems, communications systems and in the construction of diagnostics and experimental systems.

  3. Automated Hazard Analysis

    Energy Science and Technology Software Center (OSTI)

    2003-06-26

    The Automated Hazard Analysis (AHA) application is a software tool used to conduct job hazard screening and analysis of tasks to be performed in Savannah River Site facilities. The AHA application provides a systematic approach to the assessment of safety and environmental hazards associated with specific tasks, and the identification of controls regulations, and other requirements needed to perform those tasks safely. AHA is to be integrated into existing Savannah River site work control andmore » job hazard analysis processes. Utilization of AHA will improve the consistency and completeness of hazard screening and analysis, and increase the effectiveness of the work planning process.« less

  4. Biodetection Technologies for First Responders: 2014 Edition

    SciTech Connect (OSTI)

    Ozanich, Richard M.; Baird, Cheryl L.; Bartholomew, Rachel A.; Colburn, Heather A.; Straub, Tim M.; Bruckner-Lea, Cindy J.

    2014-03-28

    This report summarizes commercially-available, hand-portable technologies that can be used by first responders in the field. This is not meant to be an exhaustive list, nor an endorsement of any technology described herein. Rather, this report is meant to provide useful information about available technologies to help end-users make informed decisions about biodetection technology procurement and use. Information listed in this report is primarily vendor-provided; however, where possible it has been supplemented with additional information obtained from publications, reports, and websites. Manufacturers were given the chance to review summaries of their technologies from August through November 2013 to verify the accuracy of technical specifications, available references, and pricing.

  5. Solar Automation Inc | Open Energy Information

    Open Energy Info (EERE)

    Solar Automation Inc Place: Albuquerque, New Mexico Zip: NM 8110 Product: Produces manufacturing equipment for PV cells. References: Solar Automation Inc1 This article is a...

  6. Brooks Automation Inc | Open Energy Information

    Open Energy Info (EERE)

    Product: Automation equipment supplier, including vacuum pumps for thin film PV manufacturing facilities. References: Brooks Automation Inc1 This article is a stub. You can...

  7. Automated Defect Classification (ADC)

    Energy Science and Technology Software Center (OSTI)

    1998-01-01

    The ADC Software System is designed to provide semiconductor defect feature analysis and defect classification capabilities. Defect classification is an important software method used by semiconductor wafer manufacturers to automate the analysis of defect data collected by a wide range of microscopy techniques in semiconductor wafer manufacturing today. These microscopies (e.g., optical bright and dark field, scanning electron microscopy, atomic force microscopy, etc.) generate images of anomalies that are induced or otherwise appear on wafermore » surfaces as a result of errant manufacturing processes or simple atmospheric contamination (e.g., airborne particles). This software provides methods for analyzing these images, extracting statistical features from the anomalous regions, and applying supervised classifiers to label the anomalies into user-defined categories.« less

  8. Robust automated knowledge capture.

    SciTech Connect (OSTI)

    Stevens-Adams, Susan Marie; Abbott, Robert G.; Forsythe, James Chris; Trumbo, Michael Christopher Stefan; Haass, Michael Joseph; Hendrickson, Stacey M. Langfitt

    2011-10-01

    This report summarizes research conducted through the Sandia National Laboratories Robust Automated Knowledge Capture Laboratory Directed Research and Development project. The objective of this project was to advance scientific understanding of the influence of individual cognitive attributes on decision making. The project has developed a quantitative model known as RumRunner that has proven effective in predicting the propensity of an individual to shift strategies on the basis of task and experience related parameters. Three separate studies are described which have validated the basic RumRunner model. This work provides a basis for better understanding human decision making in high consequent national security applications, and in particular, the individual characteristics that underlie adaptive thinking.

  9. Utilities respond to nuclear station blackout rule

    SciTech Connect (OSTI)

    Rubin, A.M.; Beasley, B.; Tenera, L.P

    1990-02-01

    The authors discuss how nuclear plants in the United States have taken actions to respond to the NRC Station Blackout Rule, 10CFR50.63. The rule requires that each light water cooled nuclear power plant licensed to operate must be able to withstand for a specified duration and recover from a station blackout. Station blackout is defined as the complete loss of a-c power to the essential and non-essential switch-gear buses in a nuclear power plant. A station blackout results from the loss of all off-site power as well as the on-site emergency a-c power system. There are two basic approaches to meeting the station blackout rule. One is to cope with a station blackout independent of a-c power. Coping, as it is called, means the ability of a plant to achieve and maintain a safe shutdown condition. The second approach is to provide an alternate a-c power source (AAC).

  10. Local Leaders: Respond to Fuel Shortages | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Fuel Shortages Local Leaders: Respond to Fuel Shortages Local Leaders: Respond to Fuel Shortages Ensuring adequate fuel supplies is a key component in responding to energy emergencies. Fuel powers backup generators and allows emergency responders and utility workers to drive to where they are needed. Monitor petroleum supplies-Seek out accurate and timely information about petroleum supply, wholesale and retail prices, inventories, and production rates for State and regional refineries. Get in

  11. DOE - NNSA/NFO -- Photo Library First Responder

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    First Responder Training NNSA/NFO Language Options U.S. DOE/NNSA - Nevada Field Office Photo Library - First Responder Training The aim of the First Responder Training is to provide a comprehensive, fully integrated system of facilities and capabilities to meet a wide range of combating terrorism requirements. Users of the First Responder Training can accomplish multiple requirements, conduct training and exercises in a variety of complex scenarios, and test new technologies in realistic

  12. Recommendation 207: Automate the Stewardship Verification Process

    Broader source: Energy.gov [DOE]

    ORSSAB recommends DOE automate the Stewardship Verification Process for the Remediation Effectiveness Report.

  13. Business Owners: Respond to an Energy Emergency | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Respond to an Energy Emergency Business Owners: Respond to an Energy Emergency Business Owners: Respond to an Energy Emergency Ensure your building is safe to occupy-Initially allow only essential, critical-operations staff into restricted areas. Ask your local or State health department for guidance on determining the safety of your building. Decide whether to activate backup power-If your backup generator doesn't automatically turn on during a power outage, you'll have to determine when to

  14. In a mining accident, first responders are working against

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    a mining accident, first responders are working against the clock and against a myriad of dangers such as debris, poisonous gases, flooding, explosive vapors, and unstable structures to assess the situation and rescue trapped miners. These unknown and potentially deadly conditions create a challenge for first responders and often limit their ability to assess the situation and respond in a timely matter. There is a need for a robotic system that could be used to support a mine rescue team,

  15. Local Leaders: Respond to Natural Gas Disruptions | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Natural Gas Disruptions Local Leaders: Respond to Natural Gas Disruptions Local Leaders: Respond to Natural Gas Disruptions Because natural gas is distributed through underground pipelines, delivery disruptions occur less often than electrical outages. Severe storms, flooding, and earthquakes can expose and break pipes, however. When disruptions do occur, it can take weeks or even months to restore. Communicate effectively with the public, and ensure that first responders and gas companies have

  16. Review of Requirements and Capabilities for Analyzing and Responding to

    Energy Savers [EERE]

    Beyond Design Basis Events, August 2011 | Department of Energy Review of Requirements and Capabilities for Analyzing and Responding to Beyond Design Basis Events, August 2011 Review of Requirements and Capabilities for Analyzing and Responding to Beyond Design Basis Events, August 2011 August 2011 Review of Requirements and Capabilities for Analyzing and Responding to Beyond Design Basis Events The U.S. Department of Energy (DOE) has established a rigorous nuclear safety regulatory

  17. HAZMAT Challenge gives regional emergency responders safe, realistic

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    experience HAZMAT Challenge gives regional emergency responders safe, realistic experience Community Connections: Your link to news and opportunities from Los Alamos National Laboratory Latest Issue:May 2016 all issues All Issues » submit HAZMAT Challenge gives regional emergency responders safe, realistic experience This year, 14 teams from multiple states worked to improve their skills September 1, 2013 Simulated disasters give responders an opportunity to improve their skills Simulated

  18. By E-Mail Daniel Cohen Assistant General Counsel for Legislation, Regulation, and Energy Efficiency

    Energy Savers [EERE]

    June 19, 2012 By E-Mail Daniel Cohen Assistant General Counsel for Legislation, Regulation, and Energy Efficiency U.S. Department of Energy Office of the General Counsel 1000 Independence Ave., SW Washington, D.C. 20585 Regulatory.Review@hq.doe.gov Re: Regulatory Burden RFI Dear Mr. Cohen: The Association of Home Appliance Manufacturers (AHAM) respectfully submits the following comments to the Department of Energy (DOE) on its Regulatory Burden RFI, 77 Fed. Reg. 28518 (May 15, 2012). AHAM

  19. Webinar: National Hydrogen Safety Training Resource for Emergency Responders

    Broader source: Energy.gov [DOE]

    Text version and video recording of the Fuel Cell Technologies Office webinar titled "National Hydrogen Safety Training Resource for Emergency Responders," originally presented on March 24, 2015.

  20. National Hydrogen Safety Training Resource for Emergency Responders Webinar Slides

    Broader source: Energy.gov [DOE]

    Presentation slides from the Fuel Cell Technologies Office webinar "National Hydrogen Safety Training Resource for Emergency Responders" held on March 24, 2015.

  1. NNSA helps train first responders in Czech Republic | National...

    National Nuclear Security Administration (NNSA)

    Wendy Pemberton, a scientist from the Nevada National Security Site, recently served as a key trainer for a chemical, biological, radiological and nuclear (CBRN) first responder ...

  2. NNSA Releases New Nuclear Prevent, Counter, and Respond Report...

    National Nuclear Security Administration (NNSA)

    on NNSA's efforts to prevent nuclear proliferation and terrorism, Prevent, Counter, and ... and responding to nuclear weapons proliferation and nuclear and radiological terrorism ...

  3. Anticipates and Responds to System Disturbances (Self-Heals)...

    Open Energy Info (EERE)

    URI: cleanenergysolutions.orgcontentanticipates-and-responds-system-distu Language: English Policies: "Deployment Programs,Financial Incentives,Regulations" is not in...

  4. Secretary of Energy's First Biennial Report to Congress Responding...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Secretary of Energy's First Biennial Report to Congress Responding to Hydrogen and Fuel Cell Technical Advisory Committee (HTAC) Findings and Recommendations during Fiscal Year...

  5. AVTA: Battery Testing - Best Practices for Responding to Emergency...

    Office of Environmental Management (EM)

    The following report describes best practices for responding to emergency incidents involving plug-in electric vehicle batteries, based on the AVTA's testing of PEV batteries. This ...

  6. Extremely High-Frequency Holographic Radar Imaging of Personnel and Mail

    SciTech Connect (OSTI)

    McMakin, Douglas L.; Sheen, David M.; Griffin, Jeffrey W.; Lechelt, Wayne M.

    2006-08-01

    The awareness of terrorists covertly transporting chemical warfare (CW) and biological warfare (BW) agents into government, military, and civilian facilities to harm the occupants has increased dramatically since the attacks of 9/11. Government and civilian security personnel have a need for innovative surveillance technology that can rapidly detect these lethal agents, even when they are hidden away in sealed containers and concealed either under clothing or in hand-carried items such as mailed packages or handbags. Sensor technology that detects BW and CW agents in mail or sealed containers carried under the clothing are under development. One promising sensor technology presently under development to defeat these threats is active millimeter-wave holographic radar imaging, which can readily image concealed items behind paper, cardboard, and clothing. Feasibility imaging studies at frequencies greater than 40 GHz have been conducted to determine whether simulated biological or chemical agents concealed in mail packages or under clothing could be detected using this extremely high-frequency imaging technique. The results of this imaging study will be presented in this paper.

  7. Nearly 3,000 Emergency Responders Receive EM Training

    Broader source: Energy.gov [DOE]

    WASHINGTON, D.C. – The Transportation Emergency Preparedness Program (TEPP) — a DOE program managed by EM’s Office of Packaging and Transportation — ensures federal, state, tribal and local responders have access to the plans, training and technical assistance necessary to safely, efficiently and effectively respond to radiological transportation accidents.

  8. EIA responds to Nature article on shale gas projections

    Reports and Publications (EIA)

    2014-01-01

    EIA has responded to a December 4, 2014 Nature article on projections of shale gas production made by EIA and by the Bureau of Economic Geology of the University of Texas at Austin (BEG/UT) with a letter to the editors of Nature. BEG/UT has also responded to the article in their own letter to the editor.

  9. Electric Vehicle Safety Training for Emergency Responders | Department of

    Broader source: Energy.gov (indexed) [DOE]

    Energy 1 DOE Hydrogen and Fuel Cells Program, and Vehicle Technologies Program Annual Merit Review and Peer Evaluation PDF icon arravt036_ti_klock_2011_p.pdf More Documents & Publications Electric Vehicle Safety Training for Emergency Responders U.S. First Responder Safety Training for Advanced Electric Drive Vehicle Presentation 2009 TEPP Annual Report

  10. Automating Shallow Seismic Imaging

    SciTech Connect (OSTI)

    Steeples, Don W.

    2004-12-09

    This seven-year, shallow-seismic reflection research project had the aim of improving geophysical imaging of possible contaminant flow paths. Thousands of chemically contaminated sites exist in the United States, including at least 3,700 at Department of Energy (DOE) facilities. Imaging technologies such as shallow seismic reflection (SSR) and ground-penetrating radar (GPR) sometimes are capable of identifying geologic conditions that might indicate preferential contaminant-flow paths. Historically, SSR has been used very little at depths shallower than 30 m, and even more rarely at depths of 10 m or less. Conversely, GPR is rarely useful at depths greater than 10 m, especially in areas where clay or other electrically conductive materials are present near the surface. Efforts to image the cone of depression around a pumping well using seismic methods were only partially successful (for complete references of all research results, see the full Final Technical Report, DOE/ER/14826-F), but peripheral results included development of SSR methods for depths shallower than one meter, a depth range that had not been achieved before. Imaging at such shallow depths, however, requires geophone intervals of the order of 10 cm or less, which makes such surveys very expensive in terms of human time and effort. We also showed that SSR and GPR could be used in a complementary fashion to image the same volume of earth at very shallow depths. The primary research focus of the second three-year period of funding was to develop and demonstrate an automated method of conducting two-dimensional (2D) shallow-seismic surveys with the goal of saving time, effort, and money. Tests involving the second generation of the hydraulic geophone-planting device dubbed the ''Autojuggie'' showed that large numbers of geophones can be placed quickly and automatically and can acquire high-quality data, although not under rough topographic conditions. In some easy-access environments, this device could make SSR surveying considerably more efficient and less expensive, particularly when geophone intervals of 25 cm or less are required. The most recent research analyzed the difference in seismic response of the geophones with variable geophone spike length and geophones attached to various steel media. Experiments investigated the azimuthal dependence of the quality of data relative to the orientation of the rigidly attached geophones. Other experiments designed to test the hypothesis that the data are being amplified in much the same way that an organ pipe amplifies sound have so far proved inconclusive. Taken together, the positive results show that SSR imaging within a few meters of the earth's surface is possible if the geology is suitable, that SSR imaging can complement GPR imaging, and that SSR imaging could be made significantly more cost effective, at least in areas where the topography and the geology are favorable. Increased knowledge of the Earth's shallow subsurface through non-intrusive techniques is of potential benefit to management of DOE facilities. Among the most significant problems facing hydrologists today is the delineation of preferential permeability paths in sufficient detail to make a quantitative analysis possible. Aquifer systems dominated by fracture flow have a reputation of being particularly difficult to characterize and model. At chemically contaminated sites, including U.S. Department of Energy (DOE) facilities and others at Department of Defense (DOD) installations worldwide, establishing the spatial extent of the contamination, along with the fate of the contaminants and their transport-flow directions, is essential to the development of effective cleanup strategies. Detailed characterization of the shallow subsurface is important not only in environmental, groundwater, and geotechnical engineering applications, but also in neotectonics, mining geology, and the analysis of petroleum reservoir analogs. Near-surface seismology is in the vanguard of non-intrusive approaches to increase knowledge of the shallow subsurface; our work is a significant departure from conventional seismic-survey field procedures.

  11. Responder Technology Alert Monthly (Oct-Nov 2014)

    SciTech Connect (OSTI)

    Upton, Jaki F.; Stein, Steven L.

    2015-01-21

    As part of technology foraging for the Responder Technology Alliance, established by the Department of Homeland Science and Technologies First Responders Group, this report summarizes technologies that are relevant in the area of “wearables,” with the potential for use by first responders. The content was collected over the previous month(s) and reproduced from a general Internet search using the term wearables. Additional information is available at the websites provided. This report is not meant to be an exhaustive list nor an endorsement of any technology described herein. Rather, it is meant to provide useful information about current developments in the areas wearable technology.

  12. Webinar: National Hydrogen Safety Training Resource for Emergency Responders

    Broader source: Energy.gov [DOE]

    The Energy Department's Fuel Cell Technologies Office announces the launch of a new, free, online national hydrogen safety training resource for emergency responders. This webinar will provide additional details about the emergency response hydrogen training resource.

  13. Specimen coordinate automated measuring machine/fiducial automated measuring machine

    DOE Patents [OSTI]

    Hedglen, Robert E.; Jacket, Howard S.; Schwartz, Allan I.

    1991-01-01

    The Specimen coordinate Automated Measuring Machine (SCAMM) and the Fiducial Automated Measuring Machine (FAMM) is a computer controlled metrology system capable of measuring length, width, and thickness, and of locating fiducial marks. SCAMM and FAMM have many similarities in their designs, and they can be converted from one to the other without taking them out of the hot cell. Both have means for: supporting a plurality of samples and a standard; controlling the movement of the samples in the +/- X and Y directions; determining the coordinates of the sample; compensating for temperature effects; and verifying the accuracy of the measurements and repeating as necessary. SCAMM and FAMM are designed to be used in hot cells.

  14. Local Leaders: Respond to an Energy Emergency | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Respond to an Energy Emergency Local Leaders: Respond to an Energy Emergency Gather information-Tap the energy and emergency contacts you established before the disaster occurred to gather information and assess the nature of the emergency before moving forward with your response. What immediate damage has impacted energy assets? What is the extent of the damage? Who in the community is currently impacted? Is it possible to provide the community access to a place unaffected by the energy

  15. DOE Monitoring Energy Infrastructure, Responds as Isaac Makes Landfall |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy Monitoring Energy Infrastructure, Responds as Isaac Makes Landfall DOE Monitoring Energy Infrastructure, Responds as Isaac Makes Landfall August 29, 2012 - 11:45am Addthis Hurricane Isaac is makes its way toward the Gulf Coast and the Energy Department provides details on the storm’s impact, and the recovery and restoration activities being undertaken. | Photo courtesy of NOAA Hurricane Isaac is makes its way toward the Gulf Coast and the Energy Department provides

  16. RESPONDING TO SOLICITATIONS UNDER DOE WORK FOR OTHERS PROGRAM

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    RESPONDING TO SOLICITATIONS UNDER DOE WORK FOR OTHERS PROGRAM PURPOSE: To provide guidance on the Department's policy related to DOE's laboratories ability to respond to solicitations from non-DOE sponsors under the Work for Others (WFO) program. SCOPE: This chapter provides guidance on the effect of laws, regulations, and statutes to DOE/NNSA WFO policy related to the prohibition of DOE Federally Funded Research and Development Centers (FFRDCs) and other facilities from competing directly with

  17. Homeowners: Respond to Natural Gas Disruptions | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Natural Gas Disruptions Homeowners: Respond to Natural Gas Disruptions Homeowners: Respond to Natural Gas Disruptions Because natural gas is distributed through underground pipelines, delivery disruptions occur less often than electrical outages. Severe storms, flooding, and earthquakes can expose and break pipes, however. When disruptions do occur, it can take weeks or even months to restore. Homeowners should take care in identifying and reporting any problems, as they may pose substantial

  18. Homeowners: Respond to Power Outages | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Power Outages Homeowners: Respond to Power Outages Homeowners: Respond to Power Outages After a disaster, electric utilities and government officials will first work to restore power to critical infrastructure like power plants and transmission lines, water treatment facilities, and telecommunications networks, and also to hospitals, critical care facilities, and emergency response agencies. It may take several days or even weeks to restore power to individual homeowners, but here's what you can

  19. Responder Technology Alert (February 2015) (Technical Report) | SciTech

    Office of Scientific and Technical Information (OSTI)

    Connect Technical Report: Responder Technology Alert (February 2015) Citation Details In-Document Search Title: Responder Technology Alert (February 2015) × You are accessing a document from the Department of Energy's (DOE) SciTech Connect. This site is a product of DOE's Office of Scientific and Technical Information (OSTI) and is provided as a public service. Visit OSTI to utilize additional information resources in energy science and technology. A paper copy of this document is also

  20. NNSA Releases New Nuclear Prevent, Counter, and Respond Report | National

    National Nuclear Security Administration (NNSA)

    Nuclear Security Administration New Nuclear Prevent, Counter, and Respond Report March 23, 2015 Comprehensive Overview of NNSA's Nonproliferation and Anti-terror Strategy WASHINGTON, D.C. - The National Nuclear Security Administration (NNSA) released its report on NNSA's efforts to prevent nuclear proliferation and terrorism, Prevent, Counter, and Respond-A Strategic Plan to Reduce Global Nuclear Threats (FY 2016-FY 2020) (NPCR). It provides a comprehensive overview for the first time in a

  1. Livermore researchers create new technology for first responders | National

    National Nuclear Security Administration (NNSA)

    Nuclear Security Administration researchers create new technology for first responders Wednesday, January 14, 2015 - 3:50pm Training of first responders on the hazards of radiological and nuclear threats has been challenged by the difficulties of adequately representing those threats. Training against such threats would involve the use of hazardous, highly radioactive materials, experiencing actual radiation doses in training, or require the distribution of radioactive material over a large

  2. Methodology for Assessing Radiation Detectors Used by Emergency Responders

    SciTech Connect (OSTI)

    Piotr Wasiolek; April Simpson

    2008-03-01

    The threat of weapons of mass destruction terrorism resulted in the U.S. Department of Homeland Security deploying large quantities of radiation detectors throughout the emergency responder community. However, emergency responders specific needs were not always met by standard health physics instrumentation used in radiation facilities. Several American National Standards Institute standards were developed and approved to evaluate the technical capabilities of detection equipment. Establishing technical capability is a critical step, but it is equally important to emergency responders that the instruments are easy to operate and can withstand the rugged situations they encounter. The System Assessment and Validation for Emergency Responders (SAVER) Program (managed by the U.S. Department of Homeland Security, Office of Grants and Training, Systems Support Division) focuses predominantly on the usability, ergonomics, readability, and other features of the detectors, rather than performance controlled by industry standards and the manufacturers. National Security Technologies, LLC, as a SAVER Technical Agent, conducts equipment evaluations using active emergency responders who are familiar with the detection equipment and knowledgeable of situations encountered in the field, which provides more relevant data to emergency responders.

  3. Automated nutrient analyses in seawater

    SciTech Connect (OSTI)

    Whitledge, T.E.; Malloy, S.C.; Patton, C.J.; Wirick, C.D.

    1981-02-01

    This manual was assembled for use as a guide for analyzing the nutrient content of seawater samples collected in the marine coastal zone of the Northeast United States and the Bering Sea. Some modifications (changes in dilution or sample pump tube sizes) may be necessary to achieve optimum measurements in very pronounced oligotrophic, eutrophic or brackish areas. Information is presented under the following section headings: theory and mechanics of automated analysis; continuous flow system description; operation of autoanalyzer system; cookbook of current nutrient methods; automated analyzer and data analysis software; computer interfacing and hardware modifications; and trouble shooting. The three appendixes are entitled: references and additional reading; manifold components and chemicals; and software listings. (JGB)

  4. Automated Demand Response and Commissioning

    SciTech Connect (OSTI)

    Piette, Mary Ann; Watson, David S.; Motegi, Naoya; Bourassa, Norman

    2005-04-01

    This paper describes the results from the second season of research to develop and evaluate the performance of new Automated Demand Response (Auto-DR) hardware and software technology in large facilities. Demand Response (DR) is a set of activities to reduce or shift electricity use to improve the electric grid reliability and manage electricity costs. Fully-Automated Demand Response does not involve human intervention, but is initiated at a home, building, or facility through receipt of an external communications signal. We refer to this as Auto-DR. The evaluation of the control and communications must be properly configured and pass through a set of test stages: Readiness, Approval, Price Client/Price Server Communication, Internet Gateway/Internet Relay Communication, Control of Equipment, and DR Shed Effectiveness. New commissioning tests are needed for such systems to improve connecting demand responsive building systems to the electric grid demand response systems.

  5. Making the transition to automation

    SciTech Connect (OSTI)

    Christenson, D.J. )

    1992-10-01

    By 1995, the Bureau of Reclamation's hydropower plant near Hungry Horse, Montana, will be remotely operated from Grand Coulee dam (about 300 miles away) in Washington State. Automation at Hungry Horse will eliminate the need for four full-time power plant operators. Between now and then, a transition plan that offers employees choices for retraining, transferring, or taking early retirement will smooth the transition in reducing from five operators to one. The transition plan also includes the use of temporary employees to offset risks of reducing staff too soon. When completed in 1953, the Hungry Horse structure was the world's fourth largest and fourth highest concrete dam. The arch-gravity structure has a crest length of 2,115 feet; it is 3,565 feet above sea level. The four turbine-generator units in the powerhouse total 284 MW, and supply approximately 1 billion kilowatt-hours of electricity annually to the federal power grid managed by the Bonneville Power Administration. In 1988, Reclamation began to automate operations at many of its hydro plants, and to establish centralized control points. The control center concept will increase efficiency. It also will coordinate water movements and power supply throughout the West. In the Pacific Northwest, the Grand Coulee and Black Canyon plants are automated control centers. Several Reclamation-owned facilities in the Columbia River Basin, including Hungry Horse, will be connected to these centers via microwave and telephone lines. When automation is complete, constant monitoring by computer will replace hourly manual readings and equipment checks. Computers also are expected to increase water use efficiency by 1 to 2 percent by ensuring operation for maximum turbine efficiency. Unit efficiency curves for various heads will be programmed into the system.

  6. SimTable key tool for preparing, responding to wildfire

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    SimTable key tool for preparing, responding to wildfire SimTable key tool for preparing, responding to wildfire Camera tracks movement and objects and project them onto a sand table. May 30, 2012 SimTable: Stephen Guerin (L) and Chip Garner (R) with SimTable, a Santa Fe company helping firefighters model and predict where a fire is most likely to spread, received support for their business through Lab economic development programs: VAF, NMSBA, Springboard. SimTable: Stephen Guerin (L) and Chip

  7. LANL to certify automated influenza surveillance system

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    LANL to certify automated influenza surveillance system LANL to certify automated influenza surveillance system A compact automated system for surveillance and screening of potential pandemic strains of influenza and other deadly infectious diseases is a step closer to reality. January 31, 2011 Los Alamos National Laboratory sits on top of a once-remote mesa in northern New Mexico with the Jemez mountains as a backdrop to research and innovation covering multi-disciplines from bioscience,

  8. Automated Transportation Logistics and Analysis System (ATLAS)

    Energy Savers [EERE]

    Department of Energy Automated Office Systems Support (AOSS) Quality Assurance Model Automated Office Systems Support (AOSS) Quality Assurance Model A quality assurance model, including checklists, for activity relative to network and desktop computer support. PDF icon Automated Office Systems Support (AOSS) Quality Assurance Model More Documents & Publications Audit Report: CR-B-97-04 CITSS Project Plan Quality Assurance Checklist Insulated Cladding Systems | Department of Energy

  9. Sandia National Laboratories: Research: High Consequence, Automation...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    About Robotics Robotic arm With more than 25 years of experience and hundreds of ... HCAR has been developing high-consequence automation solutions for more than 25 years. ...

  10. Investigating Potential Strategies for Automating Commissioning Activities

    SciTech Connect (OSTI)

    Brambley, Michael R.; Briggs, Robert S.; Katipamula, Srinivas; Dasher, Carolyn; Luskay, Larry; Irvine, Linda

    2002-05-31

    This paper provides summary results from a project on automated and continuous commissioning currently underway for the Air-Conditioning & Refrigeration Technology Institute (ARTI). The project focuses on developing methods for automating parts of the commissioning of heating, ventilating and air-conditioning (HVAC) equipment in newly-built, as well as existing, commercial buildings. This paper provides a summary of work completed to date, which has focused on selecting building systems; operation problems; and parts of the commissioning process where automation is likely to provide the greatest benefits. It also includes an overview of the approach planned for development and demonstration of methods for automating the selected areas.

  11. Distributed Automated Demand Response - Energy Innovation Portal

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Energy Analysis Energy Analysis Electricity Transmission Electricity Transmission Find More Like This Return to Search Distributed Automated Demand Response Lawrence Livermore ...

  12. Ditec Automation Group | Open Energy Information

    Open Energy Info (EERE)

    Name: Ditec Automation Group Place: Mexico City, Mexico Product: Mexico City-based manufacturing and installation company. Focused on material handling, industrial ovens,...

  13. Automated High Throughput Drug Target Crystallography

    SciTech Connect (OSTI)

    Rupp, B

    2005-02-18

    The molecular structures of drug target proteins and receptors form the basis for 'rational' or structure guided drug design. The majority of target structures are experimentally determined by protein X-ray crystallography, which as evolved into a highly automated, high throughput drug discovery and screening tool. Process automation has accelerated tasks from parallel protein expression, fully automated crystallization, and rapid data collection to highly efficient structure determination methods. A thoroughly designed automation technology platform supported by a powerful informatics infrastructure forms the basis for optimal workflow implementation and the data mining and analysis tools to generate new leads from experimental protein drug target structures.

  14. Sandia National Laboratories: Research: High Consequence, Automation...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    timing studies, observe layouts, and help estimate project costs. In the flexible automation pilot plant, robots are used to open and remove munitions from containers. The...

  15. Automation Alley Technology Center | Open Energy Information

    Open Energy Info (EERE)

    Alley Technology Center Jump to: navigation, search Name: Automation Alley Technology Center Place: United States Sector: Services Product: General Financial & Legal Services (...

  16. Sandia National Laboratories: Research: High Consequence, Automation...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    team knew they needed a robot for the job and called Sandia's High Consequence, Automation, & Robotics (HCAR) team. Mighty Mouse Challenge Typically the cylinder moved back...

  17. Automated fuel pin loading system

    DOE Patents [OSTI]

    Christiansen, David W. (Kennewick, WA); Brown, William F. (West Richland, WA); Steffen, Jim M. (Richland, WA)

    1985-01-01

    An automated loading system for nuclear reactor fuel elements utilizes a gravity feed conveyor which permits individual fuel pins to roll along a constrained path perpendicular to their respective lengths. The individual lengths of fuel cladding are directed onto movable transports, where they are aligned coaxially with the axes of associated handling equipment at appropriate production stations. Each fuel pin can be reciprocated axially and/or rotated about its axis as required during handling steps. The fuel pins are inserted as a batch prior to welding of end caps by one of two disclosed welding systems.

  18. Automated fuel pin loading system

    DOE Patents [OSTI]

    Christiansen, D.W.; Brown, W.F.; Steffen, J.M.

    An automated loading system for nuclear reactor fuel elements utilizes a gravity feed conveyor which permits individual fuel pins to roll along a constrained path perpendicular to their respective lengths. The individual lengths of fuel cladding are directed onto movable transports, where they are aligned coaxially with the axes of associated handling equipment at appropriate production stations. Each fuel pin can be be reciprocated axially and/or rotated about its axis as required during handling steps. The fuel pins are inerted as a batch prior to welding of end caps by one of two disclosed welding systems.

  19. Training For Radiation Emergencies, First Responder Operations- Student Guide

    Broader source: Energy.gov [DOE]

    The purpose of this program is to provide refresher operations training, as well as in-depth training in radiation, to fire fighters who are currently trained to the National Fire Protection Association (NFPA) Standard for Professional Competence of Responders to Hazardous Materials (NFPA 472).

  20. Training For Radiation Emergencies, First Responder Operations- Instructors Guide

    Broader source: Energy.gov [DOE]

    The purpose of this program is to provide refresher operations training, as well as in-depth training in radiation, to fire fighters who are currently trained to the National Fire Protection Association (NFPA) Standard for Professional Competence of Responders to Hazardous Materials (NFPA 472).

  1. Automated Centrifugal Chiller Diagnostician - Energy Innovation Portal

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Energy Analysis Energy Analysis Find More Like This Return to Search Automated Centrifugal Chiller Diagnostician Pacific Northwest National Laboratory Contact PNNL About This Technology Centrifugal chiller display Centrifugal chiller display Typical diagnostic display Typical diagnostic display Technology Marketing Summary Researchers and engineers at PNNL have developed an automated, sophisticated, multi-level, real-time centrifugal chiller diagnostician with diagnostics available under partial

  2. Responding to solicitations under DOE's Work for Others Program (WFO)

    Broader source: Energy.gov [DOE]

    Under the WFO program, DOE provides access to and use of its contractor and facility resources to non-DOE sources. DOE has developed policies and procedures to ensure compliance with applicable laws, regulations and statutes. DOE prohibits its facilities from competing with the private sector in the performance of this work. This chapter provides guidance on the effect of the competition restrictions to DOE's ability to respond to solicitations from non-DOE sponsors. Particular emphasis is placed on responses to Broad Agency Announcements, financial assistance solicitations, Program Research and Development Announcements, and similar solicitations from other Federal agencies or non-Federal entities while providing additional policy guidance related to participation in and responding to Requests for Proposals.

  3. Automation of the longwall mining system

    SciTech Connect (OSTI)

    Zimmerman, W.; Aster, R.; Harris, J.; High, J.

    1982-11-01

    The longwall automation study presented is the first phase of a study to evaluate mining automation opportunities. The objective was to identify cost-effective, safe, and technologically sound applications of automation technology to understand coal mining. The prime automation candidates resulting from the industry experience and survey were: (1) the shearer operation, (2) shield and conveyor pan-line advance, (3) a management information system to allow improved mine logistics support, and (4) component fault isolation and diagnostics to reduce untimely maintenance delays. A system network analysis indicated that a 40% improvement in productivity was feasible if system delays associated with all of the above four areas were removed. A technology assessment and conceptual system design of each of the four automation candidate areas showed that state-of-the-art digital computer, servomechanism, and actuator technologies could be applied to automate the longwall system. The final cost benefit analysis of all of the automation areas indicated a total net national benefit (profit) of roughly $200 million to the longwall mining industry if all automation candidates were installed. This cost benefit represented an approximate order of magnitude payback on the research and development (R and D) investment. In conclusion, it is recommended that the shearer operation be automated first because it provides a large number of other sensor inputs required for face alignment (i.e., shields and conveyor). Automation of the shield and conveyor pan-line advance is suggested as the next step since both the shearer and face alignment operations contributed the greatest time delays to the overall system downtime.

  4. Microsoft Word - Wireless Automation World for OE FINAL.doc

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Automation World Features New White Paper on Wireless Security, Interviews Authors April 16, 2009 The April 2009 issue of Automation World magazine features the white paper ...

  5. ISA Approves Standard for Wireless Automation in Process Control...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Wireless Automation in Process Control Applications September 22, 2009 On September 9, the Standards and Practices Board of the International Society for Automation (ISA) approved ...

  6. Small- and Medium-Size Building Automation and Control System...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Small- and Medium-Size Building Automation and Control System Needs: Scoping Study Small- and Medium-Size Building Automation and Control System Needs: Scoping Study Michael ...

  7. ISA Approves Standard for Wireless Automation in Process Control...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ISA Approves Standard for Wireless Automation in Process Control Applications On September 9, the Standards and Practices Board of the International Society for Automation (ISA) ...

  8. U-047: Siemens Automation License Manager Bugs Let Remote Users...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    7: Siemens Automation License Manager Bugs Let Remote Users Deny Service or Execute Arbitrary Code U-047: Siemens Automation License Manager Bugs Let Remote Users Deny Service or...

  9. Multiplex automated genome engineering Church, George M; Wang...

    Office of Scientific and Technical Information (OSTI)

    Multiplex automated genome engineering Church, George M; Wang, Harris H; Isaacs, Farren J The present invention relates to automated methods of introducing multiple nucleic acid...

  10. National SCADA Test Bed Substation Automation Evaluation Report...

    Office of Scientific and Technical Information (OSTI)

    Technical Report: National SCADA Test Bed Substation Automation Evaluation Report Citation Details In-Document Search Title: National SCADA Test Bed Substation Automation ...

  11. Hirschmann Automation and Control GmbH | Open Energy Information

    Open Energy Info (EERE)

    Hirschmann Automation and Control GmbH Jump to: navigation, search Name: Hirschmann Automation and Control GmbH Place: Neckartenzlingen, Baden-Wrttemberg, Germany Zip: 72654...

  12. DA (Distribution Automation) (Smart Grid Project) | Open Energy...

    Open Energy Info (EERE)

    DA (Distribution Automation) (Smart Grid Project) Jump to: navigation, search Project Name DA (Distribution Automation) Country Netherlands Coordinates 52.132633, 5.291266...

  13. Belden Deutschland GmbH Lumberg Automation | Open Energy Information

    Open Energy Info (EERE)

    Belden Deutschland GmbH Lumberg Automation Jump to: navigation, search Name: Belden Deutschland GmbH - Lumberg Automation Place: Schalksmuhle, North Rhine-Westphalia, Germany Zip:...

  14. Global health response more accurate with automated influenza...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Global health response more accurate with automated influenza surveillance Global health response more accurate with automated influenza surveillance Public health officials will...

  15. Highly Insulating Residential Windows Using Smart Automated Shading...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Highly Insulating Residential Windows Using Smart Automated Shading Highly Insulating Residential Windows Using Smart Automated Shading Addthis 1 of 3 Residential Smart Window with ...

  16. Small- and Medium-Size Building Automation and Control System...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Small- and Medium-Size Building Automation and Control System Needs: Scoping Study Small- and Medium-Size Building Automation and Control System Needs: Scoping Study Emerging ...

  17. Reference Model for Control and Automation Systems in Electrical...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Model for Control and Automation Systems in Electrical Power (October 2005) Reference Model for Control and Automation Systems in Electrical Power (October 2005) Modern ...

  18. Challenges for Early Responders to a Nuclear / Radiological Terrorism Incident

    SciTech Connect (OSTI)

    Wells, M.A.; Stearns, L.J.; Davie, A.D.; Day, E.

    2007-07-01

    Even in the best of circumstances, most municipalities would face severe challenges in providing effective incident response to a large scale radiation release caused by nuclear terrorism or accident. Compounding obvious complexities, the effectiveness of first and early responders to a radiological emergency may also be hampered by an insufficient distribution of radiation detection and monitoring equipment, local policies concerning triage and field decontamination of critical victims, malfunctioning communications, inadequate inter-agency agility, and the psychological 'fear' impact on early responders. This paper examines several issues impeding the early response to nuclear terrorism incidents with specific consideration given to the on-going and forward-thinking preparedness efforts currently being developed in the Sacramento, California region. Specific recommendations are provided addressing hot zone protocols, radiation detection and monitoring equipment, hasty patient packaging techniques, vertically and horizontally integrated pre-event training, mitigating psychological fear, and protocols for the effective 'hand-off' from first responders to subsequent early response-recovery teams. (authors)

  19. Automated Fresnel lens tester system

    SciTech Connect (OSTI)

    Phipps, G.S.

    1981-07-01

    An automated data collection system controlled by a desktop computer has been developed for testing Fresnel concentrators (lenses) intended for solar energy applications. The system maps the two-dimensional irradiance pattern (image) formed in a plane parallel to the lens, whereas the lens and detector assembly track the sun. A point detector silicon diode (0.5-mm-dia active area) measures the irradiance at each point of an operator-defined rectilinear grid of data positions. Comparison with a second detector measuring solar insolation levels results in solar concentration ratios over the image plane. Summation of image plane energies allows calculation of lens efficiencies for various solar cell sizes. Various graphical plots of concentration ratio data help to visualize energy distribution patterns.

  20. U.S. First Responder Safety Training for Advanced Electric Drive...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    First Responder Safety Training for Advanced Electric Drive Vehicle Presentation U.S. First Responder Safety Training for Advanced Electric Drive Vehicle Presentation 2010 DOE...

  1. Open Automated Demand Response Technologies for Dynamic Pricing and Smart Grid

    SciTech Connect (OSTI)

    Ghatikar, Girish; Mathieu, Johanna L.; Piette, Mary Ann; Kiliccote, Sila

    2010-06-02

    We present an Open Automated Demand Response Communications Specifications (OpenADR) data model capable of communicating real-time prices to electricity customers. We also show how the same data model could be used to for other types of dynamic pricing tariffs (including peak pricing tariffs, which are common throughout the United States). Customers participating in automated demand response programs with building control systems can respond to dynamic prices by using the actual prices as inputs to their control systems. Alternatively, prices can be mapped into"building operation modes," which can act as inputs to control systems. We present several different strategies customers could use to map prices to operation modes. Our results show that OpenADR can be used to communicate dynamic pricing within the Smart Grid and that OpenADR allows for interoperability with existing and future systems, technologies, and electricity markets.

  2. Fueling Robot Automates Hydrogen Hose Reliability Testing (Fact Sheet)

    SciTech Connect (OSTI)

    Harrison, K.

    2014-01-01

    Automated robot mimics fueling action to test hydrogen hoses for durability in real-world conditions.

  3. Security barriers with automated reconnaissance

    DOE Patents [OSTI]

    McLaughlin, James O; Baird, Adam D; Tullis, Barclay J; Nolte, Roger Allen

    2015-04-07

    An intrusion delaying barrier includes primary and secondary physical structures and can be instrumented with multiple sensors incorporated into an electronic monitoring and alarm system. Such an instrumented intrusion delaying barrier may be used as a perimeter intrusion defense and assessment system (PIDAS). Problems with not providing effective delay to breaches by intentional intruders and/or terrorists who would otherwise evade detection are solved by attaching the secondary structures to the primary structure, and attaching at least some of the sensors to the secondary structures. By having multiple sensors of various types physically interconnected serves to enable sensors on different parts of the overall structure to respond to common disturbances and thereby provide effective corroboration that a disturbance is not merely a nuisance or false alarm. Use of a machine learning network such as a neural network exploits such corroboration.

  4. MASS: An automated accountability system

    SciTech Connect (OSTI)

    Erkkila, B.H.; Kelso, F.

    1994-08-01

    All Department of Energy contractors who manage accountable quantities of nuclear materials are required to implement an accountability system that tracks, and records the activities associated with those materials. At Los Alamos, the automated accountability system allows data entry on computer terminals and data base updating as soon as the entry is made. It is also able to generate all required reports in a timely Fashion. Over the last several years, the hardware and software have been upgraded to provide the users with all the capability needed to manage a large variety of operations with a wide variety of nuclear materials. Enhancements to the system are implemented as the needs of the users are identified. The system has grown with the expanded needs of the user; and has survived several years of changing operations and activity. The user community served by this system includes processing, materials control and accountability, and nuclear material management personnel. In addition to serving the local users, the accountability system supports the national data base (NMMSS). This paper contains a discussion of several details of the system design and operation. After several years of successful operation, this system provides an operating example of how computer systems can be used to manage a very dynamic data management problem.

  5. Automated Parallel Capillary Electrophoretic System

    DOE Patents [OSTI]

    Li, Qingbo; Kane, Thomas E.; Liu, Changsheng; Sonnenschein, Bernard; Sharer, Michael V.; Kernan, John R.

    2000-02-22

    An automated electrophoretic system is disclosed. The system employs a capillary cartridge having a plurality of capillary tubes. The cartridge has a first array of capillary ends projecting from one side of a plate. The first array of capillary ends are spaced apart in substantially the same manner as the wells of a microtitre tray of standard size. This allows one to simultaneously perform capillary electrophoresis on samples present in each of the wells of the tray. The system includes a stacked, dual carousel arrangement to eliminate cross-contamination resulting from reuse of the same buffer tray on consecutive executions from electrophoresis. The system also has a gel delivery module containing a gel syringe/a stepper motor or a high pressure chamber with a pump to quickly and uniformly deliver gel through the capillary tubes. The system further includes a multi-wavelength beam generator to generate a laser beam which produces a beam with a wide range of wavelengths. An off-line capillary reconditioner thoroughly cleans a capillary cartridge to enable simultaneous execution of electrophoresis with another capillary cartridge. The streamlined nature of the off-line capillary reconditioner offers the advantage of increased system throughput with a minimal increase in system cost.

  6. A Simple Evacuation Modeling and Simulation Tool for First Responders

    SciTech Connect (OSTI)

    Koch, Daniel B; Payne, Patricia W

    2015-01-01

    Although modeling and simulation of mass evacuations during a natural or man-made disaster is an on-going and vigorous area of study, tool adoption by front-line first responders is uneven. Some of the factors that account for this situation include cost and complexity of the software. For several years, Oak Ridge National Laboratory has been actively developing the free Incident Management Preparedness and Coordination Toolkit (IMPACT) to address these issues. One of the components of IMPACT is a multi-agent simulation module for area-based and path-based evacuations. The user interface is designed so that anyone familiar with typical computer drawing tools can quickly author a geospatially-correct evacuation visualization suitable for table-top exercises. Since IMPACT is designed for use in the field where network communications may not be available, quick on-site evacuation alternatives can be evaluated to keep pace with a fluid threat situation. Realism is enhanced by incorporating collision avoidance into the simulation. Statistics are gathered as the simulation unfolds, including most importantly time-to-evacuate, to help first responders choose the best course of action.

  7. Role of Standard Demand Response Signals for Advanced Automated Aggregation

    SciTech Connect (OSTI)

    Lawrence Berkeley National Laboratory; Kiliccote, Sila

    2011-11-18

    Emerging standards such as OpenADR enable Demand Response (DR) Resources to interact directly with Utilities and Independent System Operators to allow their facility automation equipment to respond to a variety of DR signals ranging from day ahead to real time ancillary services. In addition, there are Aggregators in today’s markets who are capable of bringing together collections of aggregated DR assets and selling them to the grid as a single resource. However, in most cases these aggregated resources are not automated and when they are, they typically use proprietary technologies. There is a need for a framework for dealing with aggregated resources that supports the following requirements: • Allows demand-side resources to participate in multiple DR markets ranging from wholesale ancillary services to retail tariffs without being completely committed to a single entity like an Aggregator; • Allow aggregated groups of demand-side resources to be formed in an ad hoc fashion to address specific grid-side issues and support the optimization of the collective response of an aggregated group along a number of different dimensions. This is important in order to taylor the aggregated performance envelope to the needs to of the grid; • Allow aggregated groups to be formed in a hierarchical fashion so that each group can participate in variety of markets from wholesale ancillary services to distribution level retail tariffs. This paper explores the issues of aggregated groups of DR resources as described above especially within the context of emerging smart grid standards and the role they will play in both the management and interaction of various grid-side entities with those resources.

  8. Demonstration of automated price response in large customers in New York City using Auto-DR and OpenADR

    SciTech Connect (OSTI)

    Kim, Joyce Jihyun; Schetrit, Oren; Yin, Rongxin; Kiliccote, Sila

    2014-05-01

    Demand response (DR) – allowing customers to respond to reliability requests and market prices by changing electricity use from their normal consumption pattern – continues to be seen as an attractive means of demand-side management and a fundamental smart-grid improvement that links supply and demand. From October 2011 to December 2013, the Demand Response Research Center at Lawrence Berkeley National Laboratory, the New York State Energy Research and Development Authority, and partners Honeywell and Akuacom, have conducted a demonstration project enabling Automated Demand Response (Auto-DR) in large commercial buildings located in New York City using Open Automated Demand Response (OpenADR) communication protocols. In particular, this project focuses on demonstrating how the OpenADR platform, enabled by Akuacom, can automate and simplify interactions between buildings and various stakeholders in New York State and enable the automation of customers’ price response to yield bill savings under dynamic pricing. In this paper, the cost control opportunities under day-ahead hourly pricing and Auto-DR control strategies are presented for four demonstration buildings; present the breakdown of Auto-DR enablement costs; summarize the field test results and their load impact; and show potential bill savings by enabling automated price response under Consolidated Edison’s Mandatory Hourly Pricing (MHP) tariff. For one of the sites, the potential bill savings at the site’s current retail rate are shown. Facility managers were given granular equipment-level opt-out capability to ensure full control of the sites during the Auto-DR implementation. The expected bill savings ranged from 1.1% to 8.0% of the total MHP bill. The automation and enablement costs ranged from $70 to $725 per kW shed. The results show that OpenADR can facilitate the automation of price response, deliver savings to the customers and opt-out capability of the implementation retains control of the sites by facility managers.

  9. Automated Sorting of Transuranic Waste

    SciTech Connect (OSTI)

    Shurtliff, Rodney Marvin

    2001-03-01

    The HANDSS-55 Transuranic Waste Sorting Module is designed to sort out items found in 55-gallon drums of waste as determined by an operator. Innovative imaging techniques coupled with fast linear motor-based motion systems and a flexible end-effector system allow the operator to remove items from the waste stream by a touch of the finger. When all desired items are removed from the waste stream, the remaining objects are automatically moved to a repackaging port for removal from the glovebox/cell. The Transuranic Waste Sorting Module consists of 1) a high accuracy XYZ Stereo Measurement and Imaging system, 2) a vibrating/tilting sorting table, 3) an XY Deployment System, 4) a ZR Deployment System, 5) several user-selectable end-effectors, 6) a waste bag opening system, 7) control and instrumentation, 8) a noncompliant waste load-out area, and 9) a Human/Machine Interface (HMI). The system is modular in design to accommodate database management tools, additional load-out ports, and other enhancements. Manually sorting the contents of a 55-gallon drum takes about one day per drum. The HANDSS-55 Waste Sorting Module is designed to significantly increase the throughput of this sorting process by automating those functions that are strenuous and tiresome for an operator to perform. The Waste Sorting Module uses the inherent ability of an operator to identify the items that need to be segregated from the waste stream and then, under computer control, picks that item out of the waste and deposits it in the appropriate location. The operator identifies the object by locating the visual image on a large color display and touches the image on the display with his finger. The computer then determines the location of the object, and performing a highspeed image analysis determines its size and orientation, so that a robotic gripper can be deployed to pick it up. Following operator verification by voice or function key, the object is deposited into a specified location.

  10. Automated imaging system for single molecules

    DOE Patents [OSTI]

    Schwartz, David Charles; Runnheim, Rodney; Forrest, Daniel

    2012-09-18

    There is provided a high throughput automated single molecule image collection and processing system that requires minimal initial user input. The unique features embodied in the present disclosure allow automated collection and initial processing of optical images of single molecules and their assemblies. Correct focus may be automatically maintained while images are collected. Uneven illumination in fluorescence microscopy is accounted for, and an overall robust imaging operation is provided yielding individual images prepared for further processing in external systems. Embodiments described herein are useful in studies of any macromolecules such as DNA, RNA, peptides and proteins. The automated image collection and processing system and method of same may be implemented and deployed over a computer network, and may be ergonomically optimized to facilitate user interaction.

  11. B&W Y-12 Responds to IG Report; Puts WSI on Notice | Y-12 National...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Responds to IG ... B&W Y-12 Responds to IG Report; Puts WSI on Notice Posted: September 5, 2012 - 12:01pm In the weeks since the security incursion at the Y-12 National Security...

  12. B&W Y-12 responds to NNSA's show cause letter | Y-12 National...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    responds to ... B&W Y-12 responds to NNSA's show cause letter Posted: September 12, 2012 - 3:29pm On September 10, B&W Y-12 provided its response to the National Nuclear Security...

  13. Site Office Contracting Officer E-mail address Ames Site Office Jackie York Jacquelyn.york@ch.doe.gov

    National Nuclear Security Administration (NNSA)

    Site Office Contracting Officer E-mail address Ames Site Office Jackie York Jacquelyn.york@ch.doe.gov Argonne Site Office Jacquelyn York Jacquelyn.york@ch.doe.gov Brookhaven Site Office Evelyn Landini Jennifer Hartmann elandini@bnl.gov jhartmann@bnl.gov Idaho Site Office Paul Allen allenph@id.doe.gov Kansas City Site Office Ralph Tennant rtennant@kcp.gov Lawrence Livermore Site Office Homer Williamson homer.williamson@nnsa.doe.gov Los Alamos Site Office Barbara Romero Robert M. Poole

  14. Microsoft Word - WD Proposed Plan D5 R8 MASTER 10-29-14 _final with reply mail_ rev 1

    Energy Savers [EERE]

    WD-PLN-0034, Rev. 8 1 DOE/PPPO/03-0312&D5 Aerial photo of the Portsmouth Gaseous Diffusion Plant showing the three large process buildings (center of photo) and other support facilities, facing southwest PUBLIC COMMENT PERIOD NOVEMBER 12, 2014 TO JANUARY 10, 2015 HOW YOU CAN PARTICIPATE Read this Proposed Plan and review related documents in the Administrative Record. Comment on this Proposed Plan by mail, email, or fax to: Ms. Kristi Wiehle Department of Energy P.O. Box 370 Piketon, Ohio

  15. Open Automated Demand Response Dynamic Pricing Technologies and Demonstration

    SciTech Connect (OSTI)

    Ghatikar, Girish; Mathieu, Johanna L.; Piette, Mary Ann; Koch, Ed; Hennage, Dan

    2010-08-02

    This study examines the use of OpenADR communications specification, related data models, technologies, and strategies to send dynamic prices (e.g., real time prices and peak prices) and Time of Use (TOU) rates to commercial and industrial electricity customers. OpenADR v1.0 is a Web services-based flexible, open information model that has been used in California utilities' commercial automated demand response programs since 2007. We find that data models can be used to send real time prices. These same data models can also be used to support peak pricing and TOU rates. We present a data model that can accommodate all three types of rates. For demonstration purposes, the data models were generated from California Independent System Operator's real-time wholesale market prices, and a California utility's dynamic prices and TOU rates. Customers can respond to dynamic prices by either using the actual prices, or prices can be mapped into"operation modes," which can act as inputs to control systems. We present several different methods for mapping actual prices. Some of these methods were implemented in demonstration projects. The study results demonstrate show that OpenADR allows interoperability with existing/future systems/technologies and can be used within related dynamic pricing activities within Smart Grid.

  16. Beyond Commissioning: The Role of Automation

    SciTech Connect (OSTI)

    Brambley, Michael R.; Katipamula, Srinivas

    2005-02-01

    This article takes a brief look at the benefits of commissioning and describes a vision of the future where most of the objectives of commissioning will be accomplished automatically by capabilities built into the building systems themselves. Commissioning will become an activity that's performed continuously rather than periodically, and only repairs requiring replacement or overhaul of equipment will require manual intervention. The article then identifies some of the technologies that will be needed to realize this vision and ends with a call for all involved in the enterprise of building commissioning and automation to embrace and dedicate themselves to a future of automated commissioning.

  17. Preliminary Framework for Human-Automation Collaboration

    SciTech Connect (OSTI)

    Oxstrand, Johanna Helene; Le Blanc, Katya Lee; Spielman, Zachary Alexander

    2015-09-01

    The Department of Energy’s Advanced Reactor Technologies Program sponsors research, development and deployment activities through its Next Generation Nuclear Plant, Advanced Reactor Concepts, and Advanced Small Modular Reactor (aSMR) Programs to promote safety, technical, economical, and environmental advancements of innovative Generation IV nuclear energy technologies. The Human Automation Collaboration (HAC) Research Project is located under the aSMR Program, which identifies developing advanced instrumentation and controls and human-machine interfaces as one of four key research areas. It is expected that the new nuclear power plant designs will employ technology significantly more advanced than the analog systems in the existing reactor fleet as well as utilizing automation to a greater extent. Moving towards more advanced technology and more automation does not necessary imply more efficient and safer operation of the plant. Instead, a number of concerns about how these technologies will affect human performance and the overall safety of the plant need to be addressed. More specifically, it is important to investigate how the operator and the automation work as a team to ensure effective and safe plant operation, also known as the human-automation collaboration (HAC). The focus of the HAC research is to understand how various characteristics of automation (such as its reliability, processes, and modes) effect an operator’s use and awareness of plant conditions. In other words, the research team investigates how to best design the collaboration between the operators and the automated systems in a manner that has the greatest positive impact on overall plant performance and reliability. This report addresses the Department of Energy milestone M4AT-15IN2302054, Complete Preliminary Framework for Human-Automation Collaboration, by discussing the two phased development of a preliminary HAC framework. The framework developed in the first phase was used as the basis for selecting topics to be investigated in more detail. The results and insights gained from the in-depth studies conducted during the second phase were used to revise the framework. This report describes the basis for the framework developed in phase 1, the changes made to the framework in phase 2, and the basis for the changes. Additional research needs are identified and presented in the last section of the report.

  18. Middleware Automated Deployment Utilities - MRW Suite

    Energy Science and Technology Software Center (OSTI)

    2014-09-18

    The Middleware Automated Deployment Utilities consists the these three components: MAD: Utility designed to automate the deployment of java applications to multiple java application servers. The product contains a front end web utility and backend deployment scripts. MAR: Web front end to maintain and update the components inside database. MWR-Encrypt: Web utility to convert a text string to an encrypted string that is used by the Oracle Weblogic application server. The encryption is done usingmore » the built in functions if the Oracle Weblogic product and is mainly used to create an encrypted version of a database password.« less

  19. Nationwide: National Fire Protection Association Provides Training to First Responders on EVs/PEVs

    Office of Energy Efficiency and Renewable Energy (EERE)

    DOE is helping develop a strong workforce to support the adoption of plug-in electric vehicles, including first responders.

  20. KSL Kuttler Automation Systems GmbH | Open Energy Information

    Open Energy Info (EERE)

    KSL Kuttler Automation Systems GmbH Jump to: navigation, search Name: KSL-Kuttler Automation Systems GmbH Place: Dauchingen, Baden-Wrttemberg, Germany Zip: 78083 Sector: Solar...

  1. U.S. Customs and Border Protection (CBP) Announces Automation...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Customs and Border Protection (CBP) Announces Automation of Form I-94 ArrivalDeparture Record U.S. Customs and Border Protection (CBP) will begin automation of the I-94 records on...

  2. V-132: IBM Tivoli System Automation Application Manager Multiple

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Vulnerabilities | Department of Energy 2: IBM Tivoli System Automation Application Manager Multiple Vulnerabilities V-132: IBM Tivoli System Automation Application Manager Multiple Vulnerabilities April 12, 2013 - 6:00am Addthis PROBLEM: IBM has acknowledged multiple vulnerabilities in IBM Tivoli System Automation Application Manager PLATFORM: The vulnerabilities are reported in IBM Tivoli System Automation Application Manager versions 3.1, 3.2, 3.2.1, and 3.2.2 ABSTRACT: Multiple security

  3. Automated Transportation Logistics and Analysis System (ATLAS) | Department

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    of Energy Services » Waste Management » Packaging and Transportation » Automated Transportation Logistics and Analysis System (ATLAS) Automated Transportation Logistics and Analysis System (ATLAS) The Department of Energy's (DOE's) Automated Transportation Logistics and Analysis System is an integrated web-based logistics management system allowing users to manage inbound and outbound freight shipments by highway, rail, and air. PDF icon Automated Transportation Logistics and Analysis

  4. Automation World Features New White Paper on Wireless Security | Department

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    of Energy Automation World Features New White Paper on Wireless Security Automation World Features New White Paper on Wireless Security The April 2009 issue of Automation World magazine features the white paper Wireless Systems Considerations When Implementing NERC Critical Infrastructure Protection Standards. PDF icon Automation World Features New White Paper on Wireless Security More Documents & Publications Wireless System Considerations When Implementing NERC Critical Infrastructure

  5. ISA Approves Standard for Wireless Automation in Process Control

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Applications | Department of Energy ISA Approves Standard for Wireless Automation in Process Control Applications ISA Approves Standard for Wireless Automation in Process Control Applications On September 9, the Standards and Practices Board of the International Society for Automation (ISA) approved the ISA-100.11a wireless standard, "Wireless Systems for Industrial Automation: Process Control and Related Applications," making it an official ISA standard. PDF icon ISA Approves

  6. Reference Model for Control and Automation Systems in Electrical Power

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    (October 2005) | Department of Energy Model for Control and Automation Systems in Electrical Power (October 2005) Reference Model for Control and Automation Systems in Electrical Power (October 2005) Modern infrastructure automation systems are threatened by cyber attack. Their higher visibility in recent years and the increasing use of modern information technology (IT) components contribute to increased security risk. A means of analyzing these infrastructure automation systems is needed

  7. Classified Automated Information System Security Program

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    1994-07-15

    To establish uniform requirements, policies, responsibilities, and procedures for the development and implementation of a Department of Energy (DOE) Classified Computer Security Program to ensure the security of classified information in automated data processing (ADP) systems. Cancels DOE O 5637.1. Canceled by DOE O 471.2.

  8. Apparatus for automated testing of biological specimens

    DOE Patents [OSTI]

    Layne, Scott P.; Beugelsdijk, Tony J.

    1999-01-01

    An apparatus for performing automated testing of infections biological specimens is disclosed. The apparatus comprise a process controller for translating user commands into test instrument suite commands, and a test instrument suite comprising a means to treat the specimen to manifest an observable result, and a detector for measuring the observable result to generate specimen test results.

  9. Automated Office Systems Support (AOSS) Quality Assurance Model |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy Automated Office Systems Support (AOSS) Quality Assurance Model Automated Office Systems Support (AOSS) Quality Assurance Model A quality assurance model, including checklists, for activity relative to network and desktop computer support. PDF icon Automated Office Systems Support (AOSS) Quality Assurance Model More Documents & Publications Audit Report: CR-B-97-04 CITSS Project Plan Quality Assurance Checklist

  10. Fast Responding Voltage Regulator and Dynamic VAR Compensator

    SciTech Connect (OSTI)

    Divan, Deepak; Moghe, Rohit; Tholomier, Damien

    2014-12-31

    The objectives of this project were to develop a dynamic VAR compensator (DVC) for voltage regulation through VAR support to demonstrate the ability to achieve greater levels of voltage control on electricity distribution networks, and faster response compared to existing grid technology. The goal of the project was to develop a prototype Fast Dynamic VAR Compensator (Fast DVC) hardware device, and this was achieved. In addition to developing the dynamic VAR compensator device, Varentec in partnership with researchers at North Carolina State University (NCSU) successfully met the objectives to model the potential positive impact of such DVCs on representative power networks. This modeling activity validated the ability of distributed dynamic VAR compensators to provide fast voltage regulation and reactive power control required to respond to grid disturbances under high penetration of fluctuating and intermittent distributed energy resources (DERs) through extensive simulation studies. Specifically the following tasks were set to be accomplished: 1) Development of dynamic VAR compensator to support dynamic voltage variations on the grid through VAR control 2) Extensive testing of the DVC in the lab environment 3) Present the operational DVC device to the DOE at Varentec’s lab 4) Formulation of a detailed specification sheet, unit assembly document, test setup document, unit bring-up plan, and test plan 5) Extensive simulations of the DVC in a system with high PV penetration. Understanding the operation with many DVC on a single distribution system 6) Creation and submittal of quarterly and final reports conveying the design documents, unit performance data, modeling simulation charts and diagrams, and summary explanations of the satisfaction of program goals. This report details the various efforts that led to the development of the Fast DVC as well as the modeling & simulation results. The report begins with the introduction in Section II which outlines the problems associated with increasing penetration of renewable resources on the grid and what are the challenges in solving these issues. Section III provides a brief summary of the initial concepts that were explored before the final Fast DVC prototype was developed. Section IV and V present the hardware, controls, communication, and mechanical architecture and features of the Fast DVC. Section VI presents the procedure for assembling the Fast DVC. The test plan and lab setup are expounded in Section VII and VIII. Section IX presents the results from testing the Fast DVC in the lab, several results are presented along with some pictures of the developed unit. Section X details the pilot demonstration activities. Finally, section XI showcases the efforts associated with the simulation and modeling of the Fast DVC in various scenarios with DERs and its impact in all these scenarios.

  11. Automation of Capacity Bidding with an Aggregator Using Open Automated Demand Response

    SciTech Connect (OSTI)

    Kiliccote, Sila; Piette, Mary Ann

    2008-10-01

    This report summarizes San Diego Gas& Electric Company?s collaboration with the Demand Response Research Center to develop and test automation capability for the Capacity Bidding Program in 2007. The report describes the Open Automated Demand Response architecture, summarizes the history of technology development and pilot studies. It also outlines the Capacity Bidding Program and technology being used by an aggregator that participated in this demand response program. Due to delays, the program was not fully operational for summer 2007. However, a test event on October 3, 2007, showed that the project successfully achieved the objective to develop and demonstrate how an open, Web?based interoperable automated notification system for capacity bidding can be used by aggregators for demand response. The system was effective in initiating a fully automated demand response shed at the aggregated sites. This project also demonstrated how aggregators can integrate their demand response automation systems with San Diego Gas& Electric Company?s Demand Response Automation Server and capacity bidding program.

  12. Saturn facility oil transfer automation system

    SciTech Connect (OSTI)

    Joseph, Nathan R.; Thomas, Rayburn Dean; Lewis, Barbara Ann; Malagon, Hector M.

    2014-02-01

    The Saturn accelerator, owned by Sandia National Laboratories, has been in operation since the early 1980s and still has many of the original systems. A critical legacy system is the oil transfer system which transfers 250,000 gallons of transformer oil from outside storage tanks to the Saturn facility. The oil transfer system was iden- ti ed for upgrade to current technology standards. Using the existing valves, pumps, and relay controls, the system was automated using the National Instruments cRIO FGPA platform. Engineered safety practices, including a failure mode e ects analysis, were used to develop error handling requirements. The uniqueness of the Saturn Oil Automated Transfer System (SOATS) is in the graphical user interface. The SOATS uses an HTML interface to communicate to the cRIO, creating a platform independent control system. The SOATS was commissioned in April 2013.

  13. Automated diagnostic kiosk for diagnosing diseases

    DOE Patents [OSTI]

    Regan, John Frederick; Birch, James Michael

    2014-02-11

    An automated and autonomous diagnostic apparatus that is capable of dispensing collection vials and collections kits to users interesting in collecting a biological sample and submitting their collected sample contained within a collection vial into the apparatus for automated diagnostic services. The user communicates with the apparatus through a touch-screen monitor. A user is able to enter personnel information into the apparatus including medical history, insurance information, co-payment, and answer a series of questions regarding their illness, which is used to determine the assay most likely to yield a positive result. Remotely-located physicians can communicate with users of the apparatus using video tele-medicine and request specific assays to be performed. The apparatus archives submitted samples for additional testing. Users may receive their assay results electronically. Users may allow the uploading of their diagnoses into a central databank for disease surveillance purposes.

  14. Automated Auditing Tool for Retrofit Building Projects

    Energy Science and Technology Software Center (OSTI)

    2011-06-23

    Building energy auditors regularly use notepads, physical forms, or simple spreadsheets to inventory energy consuming devices in buildings and audit overall performance. Mobile computing devices such as smart phones or tablet computers with camera inputs may be used to automatically capture relevant information and format audit input in a way that streamlines work flows and reduces the likelihood of error. As an example. an auditor could walk through a space holding a mobile device, whichmore » automatically identifies and appliances, windows, etc. This information would automatically be added to a mobile database associated with the building for later integration with a larger building audit database. The user experience would require little or no manual input, and could integrate with tools to automate used to automate data collection for building energy modeling.« less

  15. Flow through electrode with automated calibration

    DOE Patents [OSTI]

    Szecsody, James E [Richland, WA; Williams, Mark D [Richland, WA; Vermeul, Vince R [Richland, WA

    2002-08-20

    The present invention is an improved automated flow through electrode liquid monitoring system. The automated system has a sample inlet to a sample pump, a sample outlet from the sample pump to at least one flow through electrode with a waste port. At least one computer controls the sample pump and records data from the at least one flow through electrode for a liquid sample. The improvement relies upon (a) at least one source of a calibration sample connected to (b) an injection valve connected to said sample outlet and connected to said source, said injection valve further connected to said at least one flow through electrode, wherein said injection valve is controlled by said computer to select between said liquid sample or said calibration sample. Advantages include improved accuracy because of more frequent calibrations, no additional labor for calibration, no need to remove the flow through electrode(s), and minimal interruption of sampling.

  16. Automated Algorithm for MFRSR Data Analysis

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Automated Algorithm for MFRSR Data Analysis M. D. Alexandrov and B. Cairns Columbia University and National Aeronautics and Space Administration Goddard Institute for Space Studies New York, New York A. A. Lacis and B. E. Carlson National Aeronautics and Space Administration Goddard Institute for Space Studies New York, New York A. Marshak National Aeronautics and Space Administration Goddard Space Flight Center Greenbelt, Maryland We present a substantial upgrade of our previously developed

  17. Letter Responding to Requests for Information Made by Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    (DOE) Personnel About Restarting Potomac River After a Shutdown. | Department of Energy Responding to Requests for Information Made by Department of Energy (DOE) Personnel About Restarting Potomac River After a Shutdown. Letter Responding to Requests for Information Made by Department of Energy (DOE) Personnel About Restarting Potomac River After a Shutdown. Docket No. EO-05-01: This letter responds to requests for information made by Department of Energy (DOE) personnel at our meeting about

  18. Direct versus Facility Centric Load Control for Automated Demand Response

    SciTech Connect (OSTI)

    Koch, Ed; Piette, Mary Ann

    2009-11-06

    Direct load control (DLC) refers to the scenario where third party entities outside the home or facility are responsible for deciding how and when specific customer loads will be controlled in response to Demand Response (DR) events on the electric grid. Examples of third parties responsible for performing DLC may be Utilities, Independent System Operators (ISO), Aggregators, or third party control companies. DLC can be contrasted with facility centric load control (FCLC) where the decisions for how loads are controlled are made entirely within the facility or enterprise control systems. In FCLC the facility owner has more freedom of choice in how to respond to DR events on the grid. Both approaches are in use today in automation of DR and both will continue to be used in future market segments including industrial, commercial and residential facilities. This paper will present a framework which can be used to differentiate between DLC and FCLC based upon where decisions are made on how specific loads are controlled in response to DR events. This differentiation is then used to compare and contrast the differences between DLC and FCLC to identify the impact each has on:(1)Utility/ISO and third party systems for managing demand response, (2)Facility systems for implementing load control, (3)Communications networks for interacting with the facility and (4)Facility operators and managers. Finally a survey of some of the existing DR related specifications and communications standards is given and their applicability to DLC or FCLC. In general FCLC adds more cost and responsibilities to the facilities whereas DLC represents higher costs and complexity for the Utility/ISO. This difference is primarily due to where the DR Logic is implemented and the consequences that creates. DLC may be more certain than FCLC because it is more predictable - however as more loads have the capability to respond to DR signals, people may prefer to have their own control of end-use loads and FCLC systems. Research is needed to understand the predictability of FCLC which is related to the perceived value of the DR from the facility manager or home owner's perspective.

  19. An advanced power distribution automation model system

    SciTech Connect (OSTI)

    Niwa, Shigeharu; Kanoi, Minoru; Nishijima, Kazuo; Hayami, Mitsuo

    1995-12-31

    An advanced power distribution automation (APDA) model system has been developed on the present basis of the automated distribution systems in Japan, which have been used for remote switching operations and for urgent supply restorations during faults. The increased use of electronic apparatuses sensitive to supply interruption requires very high supply reliability, and the final developed system is expected to be useful for this purpose. The developed model system adopts pole circuit breakers and remote termination units connected through 64kbps optical fibers to the computer of the automated system in the control center. Immediate switching operations for supply restorations during faults are possible through the restoration procedures, prepared beforehand, by the computer and by fast telecommunications using optical fibers. So, protection by the feeder circuit breaker in the substation can be avoided, which would otherwise cause the blackout of the whole distribution line. The test results show the effectiveness of model the system: successful fault locations and reconfiguration for supply restoration including separation of the fault sections (without blackout for the ground faults and with a short period (within 1 s) of blackout for the short-circuit faults).

  20. Automating Ontological Annotation with WordNet

    SciTech Connect (OSTI)

    Sanfilippo, Antonio P.; Tratz, Stephen C.; Gregory, Michelle L.; Chappell, Alan R.; Whitney, Paul D.; Posse, Christian; Paulson, Patrick R.; Baddeley, Bob L.; Hohimer, Ryan E.; White, Amanda M.

    2006-01-22

    Semantic Web applications require robust and accurate annotation tools that are capable of automating the assignment of ontological classes to words in naturally occurring text (ontological annotation). Most current ontologies do not include rich lexical databases and are therefore not easily integrated with word sense disambiguation algorithms that are needed to automate ontological annotation. WordNet provides a potentially ideal solution to this problem as it offers a highly structured lexical conceptual representation that has been extensively used to develop word sense disambiguation algorithms. However, WordNet has not been designed as an ontology, and while it can be easily turned into one, the result of doing this would present users with serious practical limitations due to the great number of concepts (synonym sets) it contains. Moreover, mapping WordNet to an existing ontology may be difficult and requires substantial labor. We propose to overcome these limitations by developing an analytical platform that (1) provides a WordNet-based ontology offering a manageable and yet comprehensive set of concept classes, (2) leverages the lexical richness of WordNet to give an extensive characterization of concept class in terms of lexical instances, and (3) integrates a class recognition algorithm that automates the assignment of concept classes to words in naturally occurring text. The ensuing framework makes available an ontological annotation platform that can be effectively integrated with intelligence analysis systems to facilitate evidence marshaling and sustain the creation and validation of inference models.

  1. Education of First Responders at Yale | U.S. DOE Office of Science...

    Office of Science (SC) Website

    Education of First Responders at Yale Nuclear Physics (NP) NP Home About Research Facilities Science Highlights Benefits of NP Applications of Nuclear Science Applications of ...

  2. Home Network Technologies and Automating Demand Response

    SciTech Connect (OSTI)

    McParland, Charles

    2009-12-01

    Over the past several years, interest in large-scale control of peak energy demand and total consumption has increased. While motivated by a number of factors, this interest has primarily been spurred on the demand side by the increasing cost of energy and, on the supply side by the limited ability of utilities to build sufficient electricity generation capacity to meet unrestrained future demand. To address peak electricity use Demand Response (DR) systems are being proposed to motivate reductions in electricity use through the use of price incentives. DR systems are also be design to shift or curtail energy demand at critical times when the generation, transmission, and distribution systems (i.e. the 'grid') are threatened with instabilities. To be effectively deployed on a large-scale, these proposed DR systems need to be automated. Automation will require robust and efficient data communications infrastructures across geographically dispersed markets. The present availability of widespread Internet connectivity and inexpensive, reliable computing hardware combined with the growing confidence in the capabilities of distributed, application-level communications protocols suggests that now is the time for designing and deploying practical systems. Centralized computer systems that are capable of providing continuous signals to automate customers reduction of power demand, are known as Demand Response Automation Servers (DRAS). The deployment of prototype DRAS systems has already begun - with most initial deployments targeting large commercial and industrial (C & I) customers. An examination of the current overall energy consumption by economic sector shows that the C & I market is responsible for roughly half of all energy consumption in the US. On a per customer basis, large C & I customers clearly have the most to offer - and to gain - by participating in DR programs to reduce peak demand. And, by concentrating on a small number of relatively sophisticated energy consumers, it has been possible to improve the DR 'state of the art' with a manageable commitment of technical resources on both the utility and consumer side. Although numerous C & I DR applications of a DRAS infrastructure are still in either prototype or early production phases, these early attempts at automating DR have been notably successful for both utilities and C & I customers. Several factors have strongly contributed to this success and will be discussed below. These successes have motivated utilities and regulators to look closely at how DR programs can be expanded to encompass the remaining (roughly) half of the state's energy load - the light commercial and, in numerical terms, the more important residential customer market. This survey examines technical issues facing the implementation of automated DR in the residential environment. In particular, we will look at the potential role of home automation networks in implementing wide-scale DR systems that communicate directly to individual residences.

  3. Webinar March 24: National Hydrogen Safety Training Resource for Emergency Responders

    Broader source: Energy.gov [DOE]

    The Fuel Cell Technologies Office will present a live webinar titled "National Hydrogen Safety Training Resource for Emergency Responders" on Tuesday, March 24, from 12 to 1 p.m. Eastern Daylight Time. This webinar will describe a new, free, online national hydrogen safety training resource for emergency responders.

  4. Multiplex automated genome engineering (Patent) | SciTech Connect

    Office of Scientific and Technical Information (OSTI)

    Multiplex automated genome engineering Citation Details In-Document Search Title: Multiplex automated genome engineering The present invention relates to automated methods of introducing multiple nucleic acid sequences into one or more target cells. Authors: Church, George M ; Wang, Harris H ; Isaacs, Farren J Publication Date: 2013-10-29 OSTI Identifier: 1107638 Report Number(s): 8,569,041 13/411,712 DOE Contract Number: FG02-02ER63445 Resource Type: Patent Research Org: Harvard University,

  5. Building America Expert Meeting: Minutes from Automated Home Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Management System | Department of Energy Minutes from Automated Home Energy Management System Building America Expert Meeting: Minutes from Automated Home Energy Management System These meeting minutes are from the U.S. Department of Energy Building America program expert meeting titled "Automated Home Energy Management System," held on October 1-2, 2010 in Denver, Colorado. PDF icon ahem_expert_meeting_minutes.pdf More Documents & Publications 2012 Smart Grid Peer Review

  6. Honeywell Demonstrates Automated Demand Response Benefits for Utility,

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Commercial, and Industrial Customers | Department of Energy Honeywell Demonstrates Automated Demand Response Benefits for Utility, Commercial, and Industrial Customers Honeywell Demonstrates Automated Demand Response Benefits for Utility, Commercial, and Industrial Customers September 22, 2014 - 5:59pm Addthis Honeywell's Smart Grid Investment Grant (SGIG) project demonstrates utility-scale performance of a hardware/software platform for automated demand response (ADR). This project stands

  7. Automated Home Energy Management (AHEM) Standing Technical Committee

    Energy Savers [EERE]

    Strategic Plan - February 2012 | Department of Energy Home Energy Management (AHEM) Standing Technical Committee Strategic Plan - February 2012 Automated Home Energy Management (AHEM) Standing Technical Committee Strategic Plan - February 2012 This report outlines the gaps, barriers, and opportunities in automated home energy management tools, as outlined by the Building America Standing Technical Committee. PDF icon strategic_plan_ahem_2_12.pdf More Documents & Publications Automated

  8. Aescusoft GmbH Automation | Open Energy Information

    Open Energy Info (EERE)

    Name: Aescusoft GmbH Automation Place: Ettenheim, Germany Zip: 77955 Product: Offers PV cell testing lines. Coordinates: 48.256309, 7.813654 Show Map Loading map......

  9. Demonstrations of Integrated Advanced RTU Controls and Automated...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Demonstrations of Integrated Advanced RTU Controls and Automated Fault Detection and ... of smart monitoring and diagnostic system in the field and lessons learned; 131...

  10. V-132: IBM Tivoli System Automation Application Manager Multiple...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    V-132: IBM Tivoli System Automation Application Manager Multiple Vulnerabilities April 12, ... T-694: IBM Tivoli Federated Identity Manager Products Multiple Vulnerabilities V-145: IBM ...

  11. Automated Home Energy Management (AHEM) Standing Technical Committee...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Home Energy Management (AHEM) Standing Technical Committee Strategic Plan - February 2012 Automated Home Energy Management (AHEM) Standing Technical Committee Strategic Plan - ...

  12. Automation and security of Supply (Smart Grid Project) | Open...

    Open Energy Info (EERE)

    and security of Supply (Smart Grid Project) Jump to: navigation, search Project Name Automation and security of Supply Country Denmark Coordinates 56.26392, 9.501785 Loading...

  13. Multiplex automated genome engineering (Patent) | SciTech Connect

    Office of Scientific and Technical Information (OSTI)

    The present invention relates to automated methods of introducing multiple nucleic acid sequences into one or more target cells. Authors: Church, George M ; Wang, Harris H ; ...

  14. The present invention relates to automated methods of introducing...

    Office of Scientific and Technical Information (OSTI)

    The present invention relates to automated methods of introducing multiple nucleic acid sequences into one or more target cells. Authors: Church, George M. 1 ; Wang, Harris H. ...

  15. V-205: IBM Tivoli System Automation for Multiplatforms Java Multiple...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Automation Application Manager Multiple Vulnerabilities V-145: IBM Tivoli Federated Identity Manager Products Java Multiple Vulnerabilities V-122: IBM Tivoli Application...

  16. Automated inspection of hot steel slabs

    DOE Patents [OSTI]

    Martin, Ronald J.

    1985-01-01

    The disclosure relates to a real time digital image enhancement system for performing the image enhancement segmentation processing required for a real time automated system for detecting and classifying surface imperfections in hot steel slabs. The system provides for simultaneous execution of edge detection processing and intensity threshold processing in parallel on the same image data produced by a sensor device such as a scanning camera. The results of each process are utilized to validate the results of the other process and a resulting image is generated that contains only corresponding segmentation that is produced by both processes.

  17. Automated inspection of hot steel slabs

    DOE Patents [OSTI]

    Martin, R.J.

    1985-12-24

    The disclosure relates to a real time digital image enhancement system for performing the image enhancement segmentation processing required for a real time automated system for detecting and classifying surface imperfections in hot steel slabs. The system provides for simultaneous execution of edge detection processing and intensity threshold processing in parallel on the same image data produced by a sensor device such as a scanning camera. The results of each process are utilized to validate the results of the other process and a resulting image is generated that contains only corresponding segmentation that is produced by both processes. 5 figs.

  18. Automated macromolecular crystal detection system and method

    DOE Patents [OSTI]

    Christian, Allen T.; Segelke, Brent; Rupp, Bernard; Toppani, Dominique

    2007-06-05

    An automated macromolecular method and system for detecting crystals in two-dimensional images, such as light microscopy images obtained from an array of crystallization screens. Edges are detected from the images by identifying local maxima of a phase congruency-based function associated with each image. The detected edges are segmented into discrete line segments, which are subsequently geometrically evaluated with respect to each other to identify any crystal-like qualities such as, for example, parallel lines, facing each other, similarity in length, and relative proximity. And from the evaluation a determination is made as to whether crystals are present in each image.

  19. Automated Expert Modeling and Student Evaluation

    Energy Science and Technology Software Center (OSTI)

    2012-09-12

    AEMASE searches a database of recorded events for combinations of events that are of interest. It compares matching combinations to a statistical model to determine similarity to previous events of interest and alerts the user as new matching examples are found. AEMASE is currently used by weapons tactics instructors to find situations of interest in recorded tactical training scenarios. AEMASE builds on a sub-component, the Relational Blackboard (RBB), which is being released as open-source software.more » AEMASE builds on RBB adding interactive expert model construction (automated knowledge capture) and re-evaluation of scenario data.« less

  20. Automated Knowledge Annotation for Dynamic Collaborative Environments

    SciTech Connect (OSTI)

    Cowell, Andrew J.; Gregory, Michelle L.; Marshall, Eric J.; McGrath, Liam R.

    2009-05-19

    This paper describes the Knowledge Encapsulation Framework (KEF), a suite of tools to enable automated knowledge annotation for modeling and simulation projects. This framework can be used to capture evidence (e.g., facts extracted from journal articles and government reports), discover new evidence (from similar peer-reviewed material as well as social media), enable discussions surrounding domain-specific topics and provide automatically generated semantic annotations for improved corpus investigation. The current KEF implementation is presented within a wiki environment, providing a simple but powerful collaborative space for team members to review, annotate, discuss and align evidence with their modeling frameworks.

  1. Automated fluid analysis apparatus and techniques

    DOE Patents [OSTI]

    Szecsody, James E.

    2004-03-16

    An automated device that couples a pair of differently sized sample loops with a syringe pump and a source of degassed water. A fluid sample is mounted at an inlet port and delivered to the sample loops. A selected sample from the sample loops is diluted in the syringe pump with the degassed water and fed to a flow through detector for analysis. The sample inlet is also directly connected to the syringe pump to selectively perform analysis without dilution. The device is airtight and used to detect oxygen-sensitive species, such as dithionite in groundwater following a remedial injection to treat soil contamination.

  2. AUTOMATED PROCESS MONITORING: APPLYING PROVEN AUTOMATION TECHNIQUES TO INTERNATIONAL SAFEGUARDS NEEDS

    SciTech Connect (OSTI)

    O'Hara, Matthew J.; Durst, Philip C.; Grate, Jay W.; Devol, Timothy A.; Egorov, Oleg; Clements, John P.

    2008-07-13

    Identification and quantification of specific alpha- and beta-emitting radionuclides in complex liquid matrices is highly challenging, and is typically accomplished through laborious wet chemical sample preparation and separations followed by analysis using a variety of detection methodologies (e.g., liquid scintillation, gas proportional counting, alpha energy analysis, mass spectrometry). Analytical results may take days or weeks to report. Chains of custody and sample security measures may also complicate or slow the analytical process. When an industrial process-scale plant requires the monitoring of specific radionuclides as an indication of the composition of its feed stream or of plant performance, radiochemical measurements must be fast, accurate, and reliable. Scientists at Pacific Northwest National Laboratory have assembled a fully automated prototype Process Monitor instrument capable of a variety of tasks: automated sampling directly from a feed stream, sample digestion / analyte redox adjustment, chemical separations, radiochemical detection and data analysis / reporting. The system is compact, its components are fluidically inter-linked, and analytical results could be immediately transmitted to on- or off-site locations. The development of a rapid radiochemical Process Monitor for 99Tc in Hanford tank waste processing streams, capable of performing several measurements per hour, will be discussed in detail. More recently, the automated platform was modified to perform measurements of 90Sr in Hanford tank waste stimulant. The system exemplifies how automation could be integrated into reprocessing facilities to support international nuclear safeguards needs.

  3. Task automation in a successful industrial telerobot

    SciTech Connect (OSTI)

    Spelt, P.F.; Jones, S.L.

    1994-01-01

    In this paper, we discuss cooperative work by Oak Ridge National Laboratory and Remotec{trademark}, Inc., to automate components of the operator`s workload using Remotec`s Andros telerobot, thereby providing an enhanced user interface which can be retroll to existing fielded units as well as being incorporated into now production units. Remotec`s Andros robots are presently used by numerous electric utilities to perform tasks in reactors where substantial exposure to radiation exists, as well as by the armed forces and numerous law enforcement agencies. The automation of task components, as well as the video graphics display of the robot`s position in the environment, will enhance all tasks performed by these users, as well as enabling performance in terrain where the robots cannot presently perform due to lack of knowledge about, for instance, the degree of tilt of the robot. Enhanced performance of a successful industrial mobile robot leads to increased safety and efficiency of performances in hazardous environments. The addition of these capabilities will greatly enhance the utility of the robot, as well as its marketability.

  4. Sandia National Laboratories: Research: High Consequence, Automation, &

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Robotics: Advanced Controls Controls Robotics Homepage About Robotics Research & Development Advanced Controls One-Control Many Swarm Control Technology Multi-Robot Cooperative Behavior Advanced Manipulation Cybernetics High-Consequence Automation Perception and Decision Tools Unique Mobility Facilities Publications and Factsheets Robotics Image Gallery Robotics Videos Contact Robotics Research Advanced Controls Swarm Sandia's High Consequence, Automation, & Robotics (HCAR) team

  5. Sandia National Laboratories: Research: High Consequence, Automation, &

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Robotics: Facilities High Consequence, Automation, & Robotics Robotics Homepage About Robotics Research & Development Advanced Controls Advanced Manipulation Cybernetics High-Consequence Automation Perception and Decision Tools Unique Mobility Facilities Publications and Factsheets Robotics Image Gallery Robotics Videos Contact Robotics Research Facilities Advancing the evolution of robotic & intelligent system technologies Robot Vehicle Range A cutting-edge outdoor test &

  6. Microsoft Word - Wireless Automation World for OE FINAL.doc

    Energy Savers [EERE]

    Automation World Features New White Paper on Wireless Security, Interviews Authors April 16, 2009 The April 2009 issue of Automation World magazine features the white paper Wireless Systems Considerations When Implementing NERC Critical Infrastructure Protection Standards. The paper addresses wireless protection issues arising from requirements of the Critical Infrastructure Protection (CIP) Standards for the electricity sector, developed by the North American Electric Reliability Corporation

  7. RESPONDENT INFORMATION

    U.S. Energy Information Administration (EIA) Indexed Site

    Version No: 2015.001 OMB No. 1905-0057 Expiration Date: 7312016 ANNUAL REPORT OF THE ORIGIN OF NATURAL GAS LIQUIDS PRODUCTION FORM EIA-64A REPORT YEAR 2015 2015 Use Area of ...

  8. and Respond

    National Nuclear Security Administration (NNSA)

    nuclear materials and the security implications of the global deployment of civil nuclear power.

    The FY 2015 NPCR is available for download

  9. RESPONDENT INFORMATION

    U.S. Energy Information Administration (EIA) Indexed Site

    This report is mandatory under Public Law 93-275. Failure to comply may result in criminal fines, civil penalties and other sanctions as provided by law. For the sanctions and the ...

  10. Guide on Preventing and Responding to All Forms of Violence in the Workplace

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    2015-04-22

    This guide is a broad overview of the basic tools for development of site specific procedures for responding to workplace violence. Supports implementation of DOE P 444.1. Does not cancel/supersede other directives.

  11. NEW - DOE G 444.1 1, Guide on Preventing and Responding to All...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    NEW - DOE G 444.1 1, Guide on Preventing and Responding to All Forms of Violence in the Workplace by Website Administrator This guide is a broad overview of the basic tools for a...

  12. Guide on Preventing and Responding to All Forms of Violence in...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    G 444.1-1, Guide on Preventing and Responding to All Forms of Violence in the Workplace by Beau Newman Functional areas: Violence, Workplace Safety This guide is a broad overview...

  13. Two New Studies Show How Energy Consumers Respond to Smart Grid Technology

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    | Department of Energy New Studies Show How Energy Consumers Respond to Smart Grid Technology Two New Studies Show How Energy Consumers Respond to Smart Grid Technology February 14, 2011 - 3:24pm Addthis Home-energy display mobile phone application that shows how much energy an appliance is consuming. | Photo courtesy of Pecan Street Project. Home-energy display mobile phone application that shows how much energy an appliance is consuming. | Photo courtesy of Pecan Street Project. Matt

  14. Prevent, Counter, and Respond-A Strategic Plan to Reduce Global Nuclear

    National Nuclear Security Administration (NNSA)

    Threats | National Nuclear Security Administration Programs / Nonproliferation Prevent, Counter, and Respond-A Strategic Plan to Reduce Global Nuclear Threats The Department of Energy's National Nuclear Security Administration (DOE/NNSA) is pleased to submit an update to Prevent, Counter, and Respond-A Strategic Plan to Reduce Global Nuclear Threats (FY 2016-FY 2020). This report, along with DOE/NNSA's Stockpile Stewardship and Management Plan, informs our planning and program activities to

  15. Automated interferometric alignment system for paraboloidal mirrors

    DOE Patents [OSTI]

    Maxey, L. Curtis

    1993-01-01

    A method is described for a systematic method of interpreting interference fringes obtained by using a corner cube retroreflector as an alignment aid when aigning a paraboloid to a spherical wavefront. This is applicable to any general case where such alignment is required, but is specifically applicable in the case of aligning an autocollimating test using a diverging beam wavefront. In addition, the method provides information which can be systematically interpreted such that independent information about pitch, yaw and focus errors can be obtained. Thus, the system lends itself readily to automation. Finally, although the method is developed specifically for paraboloids, it can be seen to be applicable to a variety of other aspheric optics when applied in combination with a wavefront corrector that produces a wavefront which, when reflected from the correctly aligned aspheric surface will produce a collimated wavefront like that obtained from the paraboloid when it is correctly aligned to a spherical wavefront.

  16. Automated interferometric alignment system for paraboloidal mirrors

    DOE Patents [OSTI]

    Maxey, L.C.

    1993-09-28

    A method is described for a systematic method of interpreting interference fringes obtained by using a corner cube retroreflector as an alignment aid when aligning a paraboloid to a spherical wavefront. This is applicable to any general case where such alignment is required, but is specifically applicable in the case of aligning an autocollimating test using a diverging beam wavefront. In addition, the method provides information which can be systematically interpreted such that independent information about pitch, yaw and focus errors can be obtained. Thus, the system lends itself readily to automation. Finally, although the method is developed specifically for paraboloids, it can be seen to be applicable to a variety of other aspheric optics when applied in combination with a wavefront corrector that produces a wavefront which, when reflected from the correctly aligned aspheric surface will produce a collimated wavefront like that obtained from the paraboloid when it is correctly aligned to a spherical wavefront. 14 figures.

  17. An automated neutron monitor maintenance system

    SciTech Connect (OSTI)

    Moore, F.S.; Griffin, J.C.; Odell, D.M.C.

    1996-09-01

    Neutron detectors are commonly used by the nuclear materials processing industry to monitor fissile materials in process vessels and tanks. The proper functioning of these neutron monitors must be periodically evaluated. We have developed and placed in routine use a PC-based multichannel analyzer (MCA) system for on-line BF3 and He-3 gas-filled detector function testing. The automated system: 1) acquires spectral data from the monitor system, 2) analyzes the spectrum to determine the detector`s functionality, 3) makes suggestions for maintenance or repair, as required, and 4) saves the spectrum and results to disk for review. The operator interface has been designed to be user-friendly and to minimize the training requirements of the user. The system may also be easily customized for various applications

  18. Automated DNA Base Pair Calling Algorithm

    Energy Science and Technology Software Center (OSTI)

    1999-07-07

    The procedure solves the problem of calling the DNA base pair sequence from two channel electropherogram separations in an automated fashion. The core of the program involves a peak picking algorithm based upon first, second, and third derivative spectra for each electropherogram channel, signal levels as a function of time, peak spacing, base pair signal to noise sequence patterns, frequency vs ratio of the two channel histograms, and confidence levels generated during the run. Themore » ratios of the two channels at peak centers can be used to accurately and reproducibly determine the base pair sequence. A further enhancement is a novel Gaussian deconvolution used to determine the peak heights used in generating the ratio.« less

  19. Automated eXpert Spectral Image Analysis

    Energy Science and Technology Software Center (OSTI)

    2003-11-25

    AXSIA performs automated factor analysis of hyperspectral images. In such images, a complete spectrum is collected an each point in a 1-, 2- or 3- dimensional spatial array. One of the remaining obstacles to adopting these techniques for routine use is the difficulty of reducing the vast quantities of raw spectral data to meaningful information. Multivariate factor analysis techniques have proven effective for extracting the essential information from high dimensional data sets into a limtedmore » number of factors that describe the spectral characteristics and spatial distributions of the pure components comprising the sample. AXSIA provides tools to estimate different types of factor models including Singular Value Decomposition (SVD), Principal Component Analysis (PCA), PCA with factor rotation, and Alternating Least Squares-based Multivariate Curve Resolution (MCR-ALS). As part of the analysis process, AXSIA can automatically estimate the number of pure components that comprise the data and can scale the data to account for Poisson noise. The data analysis methods are fundamentally based on eigenanalysis of the data crossproduct matrix coupled with orthogonal eigenvector rotation and constrained alternating least squares refinement. A novel method for automatically determining the number of significant components, which is based on the eigenvalues of the crossproduct matrix, has also been devised and implemented. The data can be compressed spectrally via PCA and spatially through wavelet transforms, and algorithms have been developed that perform factor analysis in the transform domain while retaining full spatial and spectral resolution in the final result. These latter innovations enable the analysis of larger-than core-memory spectrum-images. AXSIA was designed to perform automated chemical phase analysis of spectrum-images acquired by a variety of chemical imaging techniques. Successful applications include Energy Dispersive X-ray Spectroscopy, X-ray Fluorescence Spectroscopy, Laser-Induced Fluorescence Spectroscopy and Time-of-Flight Secondary Ion Mass Spectroscopy.« less

  20. MailedForm.pptx

    National Nuclear Security Administration (NNSA)

    Businesses using high-activity radioactive sources (Cesium-137, Cobalt-60, Americium-241, ... to: Kristina Hatcher, U.S. Department of Energy, 1000 Independence Ave., S.W., ...

  1. Model-centric distribution automation: Capacity, reliability, and efficiency

    DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

    Onen, Ahmet; Jung, Jaesung; Dilek, Murat; Cheng, Danling; Broadwater, Robert P.; Scirbona, Charlie; Cocks, George; Hamilton, Stephanie; Wang, Xiaoyu

    2016-02-26

    A series of analyses along with field validations that evaluate efficiency, reliability, and capacity improvements of model-centric distribution automation are presented. With model-centric distribution automation, the same model is used from design to real-time control calculations. A 14-feeder system with 7 substations is considered. The analyses involve hourly time-varying loads and annual load growth factors. Phase balancing and capacitor redesign modifications are used to better prepare the system for distribution automation, where the designs are performed considering time-varying loads. Coordinated control of load tap changing transformers, line regulators, and switched capacitor banks is considered. In evaluating distribution automation versus traditionalmore » system design and operation, quasi-steady-state power flow analysis is used. In evaluating distribution automation performance for substation transformer failures, reconfiguration for restoration analysis is performed. In evaluating distribution automation for storm conditions, Monte Carlo simulations coupled with reconfiguration for restoration calculations are used. As a result, the evaluations demonstrate that model-centric distribution automation has positive effects on system efficiency, capacity, and reliability.« less

  2. Identifying Requirements for Effective Human-Automation Teamwork

    SciTech Connect (OSTI)

    Jeffrey C. Joe; John O'Hara; Heather D. Medema; Johanna H. Oxstrand

    2014-06-01

    Previous studies have shown that poorly designed human-automation collaboration, such as poorly designed communication protocols, often leads to problems for the human operators, such as: lack of vigilance, complacency, and loss of skills. These problems often lead to suboptimal system performance. To address this situation, a considerable amount of research has been conducted to improve human-automation collaboration and to make automation function better as a team player. Much of this research is based on an understanding of what it means to be a good team player from the perspective of a human team. However, the research is often based on a simplified view of human teams and teamwork. In this study, we sought to better understand the capabilities and limitations of automation from the standpoint of human teams. We first examined human teams to identify the principles for effective teamwork. We next reviewed the research on integrating automation agents and human agents into mixed agent teams to identify the limitations of automation agents to conform to teamwork principles. This research resulted in insights that can lead to more effective human-automation collaboration by enabling a more realistic set of requirements to be developed based on the strengths and limitations of all agents.

  3. EERE Success Story—Nationwide: National Fire Protection Association Provides Training to First Responders on EVs/PEVs

    Broader source: Energy.gov [DOE]

    DOE is helping develop a strong workforce to support the adoption of plug-in electric vehicles, including first responders.

  4. Overview of Hazard Assessment and Emergency Planning Software of Use to RN First Responders

    SciTech Connect (OSTI)

    Waller, E; Millage, K; Blakely, W F; Ross, J A; Mercier, J R; Sandgren, D J; Levine, I H; Dickerson, W E; Nemhauser, J B; Nasstrom, J S; Sugiyama, G; Homann, S; Buddemeier, B R; Curling, C A; Disraelly, D S

    2008-08-26

    There are numerous software tools available for field deployment, reach-back, training and planning use in the event of a radiological or nuclear (RN) terrorist event. Specialized software tools used by CBRNe responders can increase information available and the speed and accuracy of the response, thereby ensuring that radiation doses to responders, receivers, and the general public are kept as low as reasonably achievable. Software designed to provide health care providers with assistance in selecting appropriate countermeasures or therapeutic interventions in a timely fashion can improve the potential for positive patient outcome. This paper reviews various software applications of relevance to radiological and nuclear (RN) events that are currently in use by first responders, emergency planners, medical receivers, and criminal investigators.

  5. Data for First Responder Use of Photoionization Detectors for Vapor Chemical Constituents

    SciTech Connect (OSTI)

    Keith A. Daum; Matthew G. Watrous; M. Dean Neptune; Daniel I. Michael; Kevin J. Hull; Joseph D. Evans

    2006-11-01

    First responders need appropriate measurement technologies for evaluating incident scenes. This report provides information about photoionization detectors (PIDs), obtained from manufacturers and independent laboratory tests, and the use of PIDs by first responders, obtained from incident commanders in the United States and Canada. PIDs are valued for their relatively low cost, light weight, rapid detection response, and ease of use. However, it is clear that further efforts are needed to provide suitable instruments and decision tools to incident commanders and first responders for assessing potential hazardous chemical releases. Information provided in this report indicates that PIDs should always be part of a decision-making context in which other qualitative and more definitive tests and instruments are used to confirm a finding. Possible amelioratory actions ranging from quick and relatively easy fixes to those requiring significant additional effort are outlined in the report.

  6. Automated soil gas monitoring chamber (Patent) | SciTech Connect

    Office of Scientific and Technical Information (OSTI)

    Title: Automated soil gas monitoring chamber A chamber for trapping soil gases as they evolve from the soil without disturbance to the soil and to the natural microclimate within ...

  7. Automated Home Energy Management Standing Technical Committee Presentation

    Broader source: Energy.gov [DOE]

    This presentation outlines the goals of the Automated Home Energy Management Standing Technical Committee, as presented at the Building America Spring 2012 Stakeholder meeting on February 29, 2012, in Austin, Texas.

  8. Building America Expert Meeting: Minutes from Automated Home...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    are from the U.S. Department of Energy Building America program expert meeting titled "Automated Home Energy Management System," held on October 1-2, 2010 in Denver, Colorado. ...

  9. Manz Automation India Pvt Ltd | Open Energy Information

    Open Energy Info (EERE)

    India Pvt Ltd Jump to: navigation, search Name: Manz Automation India Pvt Ltd Place: New Delhi, Delhi (NCT), India Product: JV set up to sell cell and module manufacturing and test...

  10. Automated Design Space Exploration with Aspen

    DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

    Spafford, Kyle L.; Vetter, Jeffrey S.

    2015-01-01

    Architects and applications scientists often use performance models to explore a multidimensional design space of architectural characteristics, algorithm designs, and application parameters. With traditional performance modeling tools, these explorations forced users to first develop a performance model and then repeatedly evaluate and analyze the model manually. These manual investigations proved laborious and error prone. More importantly, the complexity of this traditional process often forced users to simplify their investigations. To address this challenge of design space exploration, we extend our Aspen (Abstract Scalable Performance Engineering Notation) language with three new language constructs: user-defined resources, parameter ranges, and a collection ofmore » costs in the abstract machine model. Then, we use these constructs to enable automated design space exploration via a nonlinear optimization solver. We show how four interesting classes of design space exploration scenarios can be derived from Aspen models and formulated as pure nonlinear programs. The analysis tools are demonstrated using examples based on Aspen models for a three-dimensional Fast Fourier Transform, the CoMD molecular dynamics proxy application, and the DARPA Streaming Sensor Challenge Problem. Our results show that this approach can compose and solve arbitrary performance modeling questions quickly and rigorously when compared to the traditional manual approach.« less

  11. Automated radiotherapy treatment plan integrity verification

    SciTech Connect (OSTI)

    Yang Deshan; Moore, Kevin L.

    2012-03-15

    Purpose: In our clinic, physicists spend from 15 to 60 min to verify the physical and dosimetric integrity of radiotherapy plans before presentation to radiation oncology physicians for approval. The purpose of this study was to design and implement a framework to automate as many elements of this quality control (QC) step as possible. Methods: A comprehensive computer application was developed to carry out a majority of these verification tasks in the Philips PINNACLE treatment planning system (TPS). This QC tool functions based on both PINNACLE scripting elements and PERL sub-routines. The core of this technique is the method of dynamic scripting, which involves a PERL programming module that is flexible and powerful for treatment plan data handling. Run-time plan data are collected, saved into temporary files, and analyzed against standard values and predefined logical rules. The results were summarized in a hypertext markup language (HTML) report that is displayed to the user. Results: This tool has been in clinical use for over a year. The occurrence frequency of technical problems, which would cause delays and suboptimal plans, has been reduced since clinical implementation. Conclusions: In addition to drastically reducing the set of human-driven logical comparisons, this QC tool also accomplished some tasks that are otherwise either quite laborious or impractical for humans to verify, e.g., identifying conflicts amongst IMRT optimization objectives.

  12. Automation Enhancement of Multilayer Laue Lenses

    SciTech Connect (OSTI)

    Lauer K. R.; Conley R.

    2010-12-01

    X-ray optics fabrication at Brookhaven National Laboratory has been facilitated by a new, state of the art magnetron sputtering physical deposition system. With its nine magnetron sputtering cathodes and substrate carrier that moves on a linear rail via a UHV brushless linear servo motor, the system is capable of accurately depositing the many thousands of layers necessary for multilayer Laue lenses. I have engineered a versatile and automated control program from scratch for the base system and many subsystems. Its main features include a custom scripting language, a fully customizable graphical user interface, wireless and remote control, and a terminal-based interface. This control system has already been successfully used in the creation of many types of x-ray optics, including several thousand layer multilayer Laue lenses.Before reaching the point at which a deposition can be run, stencil-like masks for the sputtering cathodes must be created to ensure the proper distribution of sputtered atoms. Quality of multilayer Laue lenses can also be difficult to measure, given the size of the thin film layers. I employ my knowledge of software and algorithms to further ease these previously painstaking processes with custom programs. Additionally, I will give an overview of an x-ray optic simulator package I helped develop during the summer of 2010. In the interest of keeping my software free and open, I have worked mostly with the multiplatform Python and the PyQt application framework, utilizing C and C++ where necessary.

  13. Chip breaking system for automated machine tool

    DOE Patents [OSTI]

    Arehart, Theodore A.; Carey, Donald O.

    1987-01-01

    The invention is a rotary selectively directional valve assembly for use in an automated turret lathe for directing a stream of high pressure liquid machining coolant to the interface of a machine tool and workpiece for breaking up ribbon-shaped chips during the formation thereof so as to inhibit scratching or other marring of the machined surfaces by these ribbon-shaped chips. The valve assembly is provided by a manifold arrangement having a plurality of circumferentially spaced apart ports each coupled to a machine tool. The manifold is rotatable with the turret when the turret is positioned for alignment of a machine tool in a machining relationship with the workpiece. The manifold is connected to a non-rotational header having a single passageway therethrough which conveys the high pressure coolant to only the port in the manifold which is in registry with the tool disposed in a working relationship with the workpiece. To position the machine tools the turret is rotated and one of the tools is placed in a material-removing relationship of the workpiece. The passageway in the header and one of the ports in the manifold arrangement are then automatically aligned to supply the machining coolant to the machine tool workpiece interface for breaking up of the chips as well as cooling the tool and workpiece during the machining operation.

  14. Automated D/3 to Visio Analog Diagrams

    Energy Science and Technology Software Center (OSTI)

    2000-08-10

    ADVAD1 reads an ASCII file containing the D/3 DCS MDL input for analog points for a D/3 continuous database. It uses the information in the files to create a series of Visio files representing the structure of each analog chain, one drawing per Visio file. The actual drawing function is performed by Visio (requires Visio version 4.5+). The user can configure the program to select which fields in the database are shown on the diagrammore » and how the information is to be presented. This gives a visual representation of the structure of the analog chains, showing selected fields in a consistent manner. Updating documentation can be done easily and the automated approach eliminates human error in the cadding process. The program can also create the drawings far faster than a human operator is capable, able to create approximately 270 typical diagrams in about 8 minutes on a Pentium II 400 MHz PC. The program allows for multiple option sets to be saved to provide different settings (i.e., different fields, different field presentations, and /or different diagram layouts) for various scenarios or facilities on one workstation. Option sets may be exported from the Windows registry to allow duplication of settings on another workstation.« less

  15. Highly Insulating Residential Windows Using Smart Automated Shading |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy Highly Insulating Residential Windows Using Smart Automated Shading Highly Insulating Residential Windows Using Smart Automated Shading Addthis 1 of 3 Residential Smart Window with integrated sensors, control logic and a motorized shade between glass panes. Image: Lawrence Berkeley National Laboratory 2 of 3 Residential Smart Window with integrated sensors, control logic and a motorized shade between glass panes. Image: Lawrence Berkeley National Laboratory 3 of 3

  16. Automated Process for the Fabrication of Highly Customized Thermally

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Insulated Cladding Systems | Department of Energy Automated Process for the Fabrication of Highly Customized Thermally Insulated Cladding Systems Automated Process for the Fabrication of Highly Customized Thermally Insulated Cladding Systems 1 of 2 Resin casting prototype Image: Worcester Polytechnic Institute 2 of 2 A project member completes cuts foam insulating via a process known as computer numerically controlled (CNC) foam cutting. Image: Worcester Polytechnic Institute Lead Performer:

  17. NREL: Energy Systems Integration - ESIF Fueling Robot Automates Hydrogen

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Hose Reliability Testing ESIF Fueling Robot Automates Hydrogen Hose Reliability Testing Watch how an automated robot in the Energy Systems Integration Facility (ESIF) mimics fueling action to test hydrogen hoses for durability in real-world conditions. Text version Learn more about this work in this fact sheet. Printable Version Energy Systems Integration Home Capabilities Research & Development Facilities Working with Us Publications News Newsletter Energy Systems Integration News

  18. Sandia National Laboratories: Research: High Consequence, Automation, &

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Robotics: One-Control Many One-Control Many One Control Many Diagram As unmanned systems (UMS) are increasingly used in the battlefield, advantages provided by strategy, tactics, and training must be translated into UMS control systems. It's a challenge to effectively control large numbers of UMS. The human operator must focus on high-level perception, tactics, and strategy while the system automates lower-level functions. High Consequence, Automation, & Robotics (HCAR) is working to

  19. Scalable HPC monitoring and analysis for understanding and automated

    Office of Scientific and Technical Information (OSTI)

    response. (Conference) | SciTech Connect Scalable HPC monitoring and analysis for understanding and automated response. Citation Details In-Document Search Title: Scalable HPC monitoring and analysis for understanding and automated response. No abstract prepared. Authors: Mayo, Jackson R. ; Chen, Frank Xiaoxiao ; Pebay, Philippe Pierre ; Wong, Matthew H. ; Thompson, David ; Gentile, Ann C. ; Roe, Diana C. ; De Sapio, Vincent ; Brandt, James M. Publication Date: 2010-10-01 OSTI Identifier:

  20. Global health response more accurate with automated influenza surveillance

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Global health response more accurate with automated influenza surveillance Global health response more accurate with automated influenza surveillance Public health officials will be able to determine whether an outbreak of an infectious disease comes from a pandemic strain or one less virulent. January 31, 2011 Lance Green of LANL tests an earlier version of a modular laboratory like the ones that will be part of the High-Throughput Laboratory Network Lance Green of LANL tests an earlier version

  1. Automated Process for the Fabrication of Highly Customized Thermally

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Insulated Cladding Systems | Department of Energy Automated Process for the Fabrication of Highly Customized Thermally Insulated Cladding Systems Automated Process for the Fabrication of Highly Customized Thermally Insulated Cladding Systems Addthis 1 of 2 Resin casting prototype Image: Worcester Polytechnic Institute 2 of 2 A project member completes cuts foam insulating via a process known as computer numerically controlled (CNC) foam cutting. Image: Worcester Polytechnic Institute

  2. Automated Steel Cleanliness Analysis Tool (ASCAT) | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Automated Steel Cleanliness Analysis Tool (ASCAT) Automated Steel Cleanliness Analysis Tool (ASCAT) New Microscopy System Improves Steel Mill Performance and Allows Production of Higher Quality Steel Inclusions are particles of insoluble impurities formed during steelmaking and casting operations that are entrapped during solidification of metal. Characterizing inclusions is important because of an increasing demand for cleaner steels with low inclusion (defect) content. The composition, and

  3. Automated Demand Response Opportunities in Wastewater Treatment Facilities

    SciTech Connect (OSTI)

    Thompson, Lisa; Song, Katherine; Lekov, Alex; McKane, Aimee

    2008-11-19

    Wastewater treatment is an energy intensive process which, together with water treatment, comprises about three percent of U.S. annual energy use. Yet, since wastewater treatment facilities are often peripheral to major electricity-using industries, they are frequently an overlooked area for automated demand response opportunities. Demand response is a set of actions taken to reduce electric loads when contingencies, such as emergencies or congestion, occur that threaten supply-demand balance, and/or market conditions occur that raise electric supply costs. Demand response programs are designed to improve the reliability of the electric grid and to lower the use of electricity during peak times to reduce the total system costs. Open automated demand response is a set of continuous, open communication signals and systems provided over the Internet to allow facilities to automate their demand response activities without the need for manual actions. Automated demand response strategies can be implemented as an enhanced use of upgraded equipment and facility control strategies installed as energy efficiency measures. Conversely, installation of controls to support automated demand response may result in improved energy efficiency through real-time access to operational data. This paper argues that the implementation of energy efficiency opportunities in wastewater treatment facilities creates a base for achieving successful demand reductions. This paper characterizes energy use and the state of demand response readiness in wastewater treatment facilities and outlines automated demand response opportunities.

  4. Process development for automated solar-cell and module production. Task 4. Automated array assembly. Quarterly report No. 3

    SciTech Connect (OSTI)

    Hagerty, J. J.; Gifford, M.

    1981-04-15

    The Automated Lamination Station is mechanically complete and is currently undergoing final wiring. The high current driver and isolator boards have been completed and installed, and the main interface board is under construction. The automated vacuum chamber has had a minor redesign to increase stiffness and improve the cover open/close mechanism. Design of the Final Assembly Station has been completed and construction is underway.

  5. Youngjin Kim | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Youngjin Kim Postdoctoral Appointee E-mail kimy@anl.gov Projects Distribution Automation

  6. Guide on Preventing and Responding to All Forms of Violence in the Workplace

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    2014-10-21

    To ensure all sites have the tools to implement processes, we have created this guide. Each site is expected to develop its own site specific set of procedures/process to implement DOE Policy 444.1 Preventing and Responding to all forms of violence in the Workplace.

  7. Automated Cache Performance Analysis And Optimization

    SciTech Connect (OSTI)

    Mohror, Kathryn

    2013-12-23

    While there is no lack of performance counter tools for coarse-grained measurement of cache activity, there is a critical lack of tools for relating data layout to cache behavior to application performance. Generally, any nontrivial optimizations are either not done at all, or are done by hand requiring significant time and expertise. To the best of our knowledge no tool available to users measures the latency of memory reference instructions for partic- ular addresses and makes this information available to users in an easy-to-use and intuitive way. In this project, we worked to enable the Open|SpeedShop performance analysis tool to gather memory reference latency information for specific instructions and memory ad- dresses, and to gather and display this information in an easy-to-use and intuitive way to aid performance analysts in identifying problematic data structures in their codes. This tool was primarily designed for use in the supercomputer domain as well as grid, cluster, cloud-based parallel e-commerce, and engineering systems and middleware. Ultimately, we envision a tool to automate optimization of application cache layout and utilization in the Open|SpeedShop performance analysis tool. To commercialize this soft- ware, we worked to develop core capabilities for gathering enhanced memory usage per- formance data from applications and create and apply novel methods for automatic data structure layout optimizations, tailoring the overall approach to support existing supercom- puter and cluster programming models and constraints. In this Phase I project, we focused on infrastructure necessary to gather performance data and present it in an intuitive way to users. With the advent of enhanced Precise Event-Based Sampling (PEBS) counters on recent Intel processor architectures and equivalent technology on AMD processors, we are now in a position to access memory reference information for particular addresses. Prior to the introduction of PEBS counters, cache behavior could only be measured reliably in the ag- gregate across tens or hundreds of thousands of instructions. With the newest iteration of PEBS technology, cache events can be tied to a tuple of instruction pointer, target address (for both loads and stores), memory hierarchy, and observed latency. With this information we can now begin asking questions regarding the efficiency of not only regions of code, but how these regions interact with particular data structures and how these interactions evolve over time. In the short term, this information will be vital for performance analysts understanding and optimizing the behavior of their codes for the memory hierarchy. In the future, we can begin to ask how data layouts might be changed to improve performance and, for a particular application, what the theoretical optimal performance might be. The overall benefit to be produced by this effort was a commercial quality easy-to- use and scalable performance tool that will allow both beginner and experienced parallel programmers to automatically tune their applications for optimal cache usage. Effective use of such a tool can literally save weeks of performance tuning effort. Easy to use. With the proposed innovations, finding and fixing memory performance issues would be more automated and hide most to all of the performance engineer exper- tise under the hood of the Open|SpeedShop performance tool. One of the biggest public benefits from the proposed innovations is that it makes performance analysis more usable to a larger group of application developers. Intuitive reporting of results. The Open|SpeedShop performance analysis tool has a rich set of intuitive, yet detailed reports for presenting performance results to application developers. Our goal was to leverage this existing technology to present the results from our memory performance addition to Open|SpeedShop. Suitable for experts as well as novices. Application performance is getting more difficult to measure as the hardware platforms they run on become more complicated. This makes life dif

  8. Automated Proactive Techniques for Commissioning Air-Handling Units

    SciTech Connect (OSTI)

    Katipamula, Srinivas ); Brambley, Michael R. ); Luskay, Larry

    2003-08-30

    Many buildings today use sophisticated building automation systems (BASs) to manage a wide and varied range of building systems. Although the capabilities of the BASs seem to have increased over time, many buildings still are not properly commissioned, operated or maintained. Lack of or improper commissioning, the inability of the building operators to grasp the complex controls, and lack of proper maintenance leads to inefficient operations and reduced lifetimes of the equipment. If regularly scheduled manual maintenance or re-commissioning practices are adopted, they can be expensive and time consuming. Automated proactive commissioning and diagnostic technologies address two of the main barriers to commissioning: cost and schedules. Automated proactive continuous commissioning tools can reduce both the cost and time associated with commissioning, as well as enhance the persistence of commissioning fixes. In the long run, automation even offers the potential for automatically correcting problems by reconfiguring controls or changing control algorithms dynamically. This paper will discuss procedures and processes that can be used to automate and continuously commission the economizer operation and outdoor-air ventilation systems of an air-handling unit.

  9. Open Automated Demand Response Communications Specification (Version 1.0)

    SciTech Connect (OSTI)

    Piette, Mary Ann; Ghatikar, Girish; Kiliccote, Sila; Koch, Ed; Hennage, Dan; Palensky, Peter; McParland, Charles

    2009-02-28

    The development of the Open Automated Demand Response Communications Specification, also known as OpenADR or Open Auto-DR, began in 2002 following the California electricity crisis. The work has been carried out by the Demand Response Research Center (DRRC), which is managed by Lawrence Berkeley National Laboratory. This specification describes an open standards-based communications data model designed to facilitate sending and receiving demand response price and reliability signals from a utility or Independent System Operator to electric customers. OpenADR is one element of the Smart Grid information and communications technologies that are being developed to improve optimization between electric supply and demand. The intention of the open automated demand response communications data model is to provide interoperable signals to building and industrial control systems that are preprogrammed to take action based on a demand response signal, enabling a demand response event to be fully automated, with no manual intervention. The OpenADR specification is a flexible infrastructure to facilitate common information exchange between the utility or Independent System Operator and end-use participants. The concept of an open specification is intended to allow anyone to implement the signaling systems, the automation server or the automation clients.

  10. Framework for Human-Automation Collaboration: Conclusions from Four Studies

    SciTech Connect (OSTI)

    Johanna Oxstrand; Katya L. Le Blanc; John O'Hara; Jeffrey C. Joe; April M. Whaley; Heather Medema

    2013-11-01

    The Human Automation Collaboration (HAC) research project is investigating how advanced technologies that are planned for Advanced Small Modular Reactors (AdvSMR) will affect the performance and the reliability of the plant from a human factors and human performance perspective. The HAC research effort investigates the consequences of allocating functions between the operators and automated systems. More specifically, the research team is addressing how to best design the collaboration between the operators and the automated systems in a manner that has the greatest positive impact on overall plant performance and reliability. Oxstrand et al. (2013 - March) describes the efforts conducted by the researchers to identify the research needs for HAC. The research team reviewed the literature on HAC, developed a model of HAC, and identified gaps in the existing knowledge of human-automation collaboration. As described in Oxstrand et al. (2013 – June), the team then prioritized the research topics identified based on the specific needs in the context of AdvSMR. The prioritization was based on two sources of input: 1) The preliminary functions and tasks, and 2) The model of HAC. As a result, three analytical studies were planned and conduced; 1) Models of Teamwork, 2) Standardized HAC Performance Measurement Battery, and 3) Initiators and Triggering Conditions for Adaptive Automation. Additionally, one field study was also conducted at Idaho Falls Power.

  11. Integrated, Automated Distributed Generation Technologies Demonstration

    SciTech Connect (OSTI)

    Jensen, Kevin

    2014-09-30

    The purpose of the NETL Project was to develop a diverse combination of distributed renewable generation technologies and controls and demonstrate how the renewable generation could help manage substation peak demand at the ATK Promontory plant site. The Promontory plant site is located in the northwestern Utah desert approximately 25 miles west of Brigham City, Utah. The plant encompasses 20,000 acres and has over 500 buildings. The ATK Promontory plant primarily manufactures solid propellant rocket motors for both commercial and government launch systems. The original project objectives focused on distributed generation; a 100 kW (kilowatt) wind turbine, a 100 kW new technology waste heat generation unit, a 500 kW energy storage system, and an intelligent system-wide automation system to monitor and control the renewable energy devices then release the stored energy during the peak demand time. The original goal was to reduce peak demand from the electrical utility company, Rocky Mountain Power (RMP), by 3.4%. For a period of time we also sought to integrate our energy storage requirements with a flywheel storage system (500 kW) proposed for the Promontory/RMP Substation. Ultimately the flywheel storage system could not meet our project timetable, so the storage requirement was switched to a battery storage system (300 kW.) A secondary objective was to design/install a bi-directional customer/utility gateway application for real-time visibility and communications between RMP, and ATK. This objective was not achieved because of technical issues with RMP, ATK Information Technology Department’s stringent requirements based on being a rocket motor manufacturing facility, and budget constraints. Of the original objectives, the following were achieved: • Installation of a 100 kW wind turbine. • Installation of a 300 kW battery storage system. • Integrated control system installed to offset electrical demand by releasing stored energy from renewable sources during peak hours of the day. Control system also monitors the wind turbine and battery storage system health, power output, and issues critical alarms. Of the original objectives, the following were not achieved: • 100 kW new technology waste heat generation unit. • Bi-directional customer/utility gateway for real time visibility and communications between RMP and ATK. • 3.4% reduction in peak demand. 1.7% reduction in peak demand was realized instead.

  12. Education of First Responders at Yale | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    Education of First Responders at Yale Nuclear Physics (NP) NP Home About Research Facilities Science Highlights Benefits of NP Applications of Nuclear Science Applications of Nuclear Science Archives Small Business Innovation Research / Small Business Technology Transfer Funding Opportunities Nuclear Science Advisory Committee (NSAC) Community Resources Contact Information Nuclear Physics U.S. Department of Energy SC-26/Germantown Building 1000 Independence Ave., SW Washington, DC 20585 P: (301)

  13. Development and Demonstration of the Open Automated Demand Response Standard for the Residential Sector

    SciTech Connect (OSTI)

    Herter, Karen; Rasin, Josh; Perry, Tim

    2009-11-30

    The goal of this study was to demonstrate a demand response system that can signal nearly every customer in all sectors through the integration of two widely available and non- proprietary communications technologies--Open Automated Demand Response (OpenADR) over lnternet protocol and Utility Messaging Channel (UMC) over FM radio. The outcomes of this project were as follows: (1) a software bridge to allow translation of pricing signals from OpenADR to UMC; and (2) a portable demonstration unit with an lnternet-connected notebook computer, a portfolio of DR-enabling technologies, and a model home. The demonstration unit provides visitors the opportunity to send electricity-pricing information over the lnternet (through OpenADR and UMC) and then watch as the model appliances and lighting respond to the signals. The integration of OpenADR and UMC completed and demonstrated in this study enables utilities to send hourly or sub-hourly electricity pricing information simultaneously to the residential, commercial and industrial sectors.

  14. HEADLINE: DOE Pursues Automation in West Virginia Lab

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    HEADLINE: DOE Pursues Automation in West Virginia Lab By Elizabeth McGowan Hakan Inan can envision a day in the near future when electric utilities will be able to find and isolate faults, then restore service-in record time and without human intervention. His goal is to create a model for automating the process of locating a fault and reconfiguring the feeder. And in utility circles, it's considered very tricky because nobody has yet perfected the process, even though the hardware and software

  15. Automated Steel Cleanliness Analysis Tool (ASCAT)

    SciTech Connect (OSTI)

    Gary Casuccio; Michael Potter; Fred Schwerer; Dr. Richard J. Fruehan; Dr. Scott Story

    2005-12-30

    The objective of this study was to develop the Automated Steel Cleanliness Analysis Tool (ASCATTM) to permit steelmakers to evaluate the quality of the steel through the analysis of individual inclusions. By characterizing individual inclusions, determinations can be made as to the cleanliness of the steel. Understanding the complicating effects of inclusions in the steelmaking process and on the resulting properties of steel allows the steel producer to increase throughput, better control the process, reduce remelts, and improve the quality of the product. The ASCAT (Figure 1) is a steel-smart inclusion analysis tool developed around a customized next-generation computer controlled scanning electron microscopy (NG-CCSEM) hardware platform that permits acquisition of inclusion size and composition data at a rate never before possible in SEM-based instruments. With built-in customized ''intelligent'' software, the inclusion data is automatically sorted into clusters representing different inclusion types to define the characteristics of a particular heat (Figure 2). The ASCAT represents an innovative new tool for the collection of statistically meaningful data on inclusions, and provides a means of understanding the complicated effects of inclusions in the steel making process and on the resulting properties of steel. Research conducted by RJLG with AISI (American Iron and Steel Institute) and SMA (Steel Manufactures of America) members indicates that the ASCAT has application in high-grade bar, sheet, plate, tin products, pipes, SBQ, tire cord, welding rod, and specialty steels and alloys where control of inclusions, whether natural or engineered, are crucial to their specification for a given end-use. Example applications include castability of calcium treated steel; interstitial free (IF) degasser grade slag conditioning practice; tundish clogging and erosion minimization; degasser circulation and optimization; quality assessment/steel cleanliness; slab, billet or bloom disposition; and alloy development. Additional benefits of ASCAT include the identification of inclusions that tend to clog nozzles or interact with refractory materials. Several papers outlining the benefits of the ASCAT have been presented and published in the literature. The paper entitled ''Inclusion Analysis to Predict Casting Behavior'' was awarded the American Iron and Steel Institute (AISI) Medal in 2004 for special merit and importance to the steel industry. The ASCAT represents a quantum leap in inclusion analysis and will allow steel producers to evaluate the quality of steel and implement appropriate process improvements. In terms of performance, the ASCAT (1) allows for accurate classification of inclusions by chemistry and morphological parameters, (2) can characterize hundreds of inclusions within minutes, (3) is easy to use (does not require experts), (4) is robust, and (5) has excellent image quality for conventional SEM investigations (e.g., the ASCAT can be utilized as a dual use instrument). In summary, the ASCAT will significantly advance the tools of the industry and addresses an urgent and broadly recognized need of the steel industry. Commercialization of the ASCAT will focus on (1) a sales strategy that leverages our Industry Partners; (2) use of ''technical selling'' through papers and seminars; (3) leveraging RJ Lee Group's consulting services, and packaging of the product with a extensive consulting and training program; (4) partnering with established SEM distributors; (5) establishing relationships with professional organizations associated with the steel industry; and (6) an individualized plant by plant direct sales program.

  16. ETM (Distribution Network Automation on 10 kV cable line stations...

    Open Energy Info (EERE)

    ETM (Distribution Network Automation on 10 kV cable line stations) (Smart Grid Project) Jump to: navigation, search Project Name ETM (Distribution Network Automation on 10 kV cable...

  17. Automated deduction for first-order logic with equality

    Energy Science and Technology Software Center (OSTI)

    2001-06-01

    Otter 3.2 is the current version of ANL's automated deduction system designed to search for proofs and countermodels of conjectures stated in first-order logic with equality. It is used mostly for research in mathematics and logic and also for various applications requiring deductive data processing.

  18. Automated deduction for first-order logic with equality

    Energy Science and Technology Software Center (OSTI)

    2003-09-01

    Otter 3.3 is the current version of ANL's automated deduction system designed to search for proofs and countermodels of conjectures stated in first-order logic with equality. It is used mostly for research in mathematics and logic and also for various applications requiring deductive data processing.

  19. Sandia National Laboratories: Research: High Consequence, Automation, &

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Robotics: Advanced Manipulation Manipulation Robotics Homepage About Robotics Research & Development Advanced Controls Advanced Manipulation Mighty Mouse (M2) Sandia Hand Cybernetics High-Consequence Automation Perception and Decision Tools Unique Mobility Facilities Publications and Factsheets Robotics Image Gallery Robotics Videos Contact Robotics Research Advanced Manipulation Addressing robotics challenges The Sandia Hand has overcome issues that have prevented widespread adoption of

  20. Ideas that Work!. Retuning the Building Automation System

    SciTech Connect (OSTI)

    Parker, Steven

    2015-03-01

    A building automation system (BAS) can save considerable energy by effectively and efficiently operating building energy systems (fans, pumps, chillers boilers, etc.), but only when the BAS is properly set up and operated. Tuning, or retuning, the BAS is a cost effective process worthy of your time and attention.

  1. National SCADA Test Bed Substation Automation Evaluation Report

    SciTech Connect (OSTI)

    Kenneth Barnes; Briam Johnson

    2009-10-01

    Increased awareness of the potential for cyber attack has recently resulted in improved cyber security practices associated with the electrical power grid. However, the level of practical understanding and deployment of cyber security practices has not been evenly applied across all business sectors. Much of the focus has been centered on information technology business centers and control rooms. This report explores the current level of substation automation, communication, and cyber security protection deployed in electrical substations throughout existing utilities in the United States. This report documents the evaluation of substation automation implementation and associated vulnerabilities. This evaluation used research conducted by Newton-Evans Research Company for some of its observations and results. The Newton Evans Report aided in the determination of what is the state of substation automation in North American electric utilities. Idaho National Laboratory cyber security experts aided in the determination of what cyber vulnerabilities may pose a threat to electrical substations. This report includes cyber vulnerabilities as well as recommended mitigations. It also describes specific cyber issues found in typical substation automation configurations within the electric utility industry. The evaluation report was performed over a 5-month period starting in October 2008

  2. Automated Energy Distribution and Reliability System (AEDR): Final Report

    SciTech Connect (OSTI)

    Buche, D. L.

    2008-07-01

    This report describes Northern Indiana Public Service Co. project efforts to develop an automated energy distribution and reliability system. The purpose of this project was to implement a database-driven GIS solution that would manage all of the company's gas, electric, and landbase objects.

  3. Automating Nuclear-Safety-Related SQA Procedures with Custom Applications

    DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

    Freels, James D.

    2016-01-01

    Nuclear safety-related procedures are rigorous for good reason. Small design mistakes can quickly turn into unwanted failures. Researchers at Oak Ridge National Laboratory worked with COMSOL to define a simulation app that automates the software quality assurance (SQA) verification process and provides results in less than 24 hours.

  4. ARES: automated response function code. Users manual. [HPGAM and LSQVM

    SciTech Connect (OSTI)

    Maung, T.; Reynolds, G.M.

    1981-06-01

    This ARES user's manual provides detailed instructions for a general understanding of the Automated Response Function Code and gives step by step instructions for using the complete code package on a HP-1000 system. This code is designed to calculate response functions of NaI gamma-ray detectors, with cylindrical or rectangular geometries.

  5. When is the "Day of Reckoning" and How Will the Industry Respond?

    U.S. Energy Information Administration (EIA) Indexed Site

    Conference John R. Auers, P.E. Executive Vice President July 14, 2014 Washington, D. C. When is the "Day of Reckoning" and how will the industry respond? 0 10 20 30 40 50 60 70 80 90 Refinery Utilization U.S. Production Canadian Imports Saudi Imports Other Light & Medium WB Imports Heavy Waterborne Imports Pre U.S. Crude Boom (~2007/2008) 2 Export regulations irrelevant. Declining U.S. crude production replaced by increasing imports - exceed 10 MM BPD Light & Medium waterborne

  6. A Simulation Learning Approach to Training First Responders for Radiological Emergencies ? A Continuation of Work

    SciTech Connect (OSTI)

    Lake, Joe E; Cross, Butch; Sanders, Robert Lon

    2008-01-01

    Real-time gaming engines, such as Epic Game's Unreal Engine[1], provide an excellent resource as a training environment. These engines provide an alternate reality that can accurately depict not only real world geometry, but they can also achieve realistic physical effects such as radiation fields and blast physics. The real time photorealistic graphics available through the Unreal Engine add to its applicability to this project's needs. Moreover, this engine provides a very efficient means to modify the game's physics modeling, visual effects, and game play structure to fit the ever-evolving needs of a training curriculum. To this end, we have worked to extend the Unreal Engine to incorporate radiation effects dependent on distance from a radiological source, similar to what one would experience in the real world. In order to help better prepare first responders for using the radiological detection equipment vital for mission success, we have continued work, previously described by Sanders and Rhodes [2], on a Geiger counter readout display being implemented and added to the interface's Heads Up Display (HUD) as well as incorporating a physically accurate model within the engine that will allow the first responder to acclimate themselves to the sounds and possible size of the device. Moreover, the Karma Physics Engine, which works in conjunction with the Unreal Engine 2, accurately simulates fluid physics, blast effects, and basic player movements. It is this physics engine that has been the focus of our continued efforts and has been extended to include realistic modeling of radiological effects.

  7. NEW - DOE G 444.1 1, Guide on Preventing and Responding to All Forms of Violence in the Workplace

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    This guide is a broad overview of the basic tools for a site to develop its site specific procedures for responding to workplace violence. Supports implementation of DOE P 444.1.

  8. Automating the determination of 3D protein structure

    SciTech Connect (OSTI)

    Rayl, K.D.

    1993-12-31

    The creation of an automated method for determining 3D protein structure would be invaluable to the field of biology and presents an interesting challenge to computer science. Unfortunately, given the current level of protein knowledge, a completely automated solution method is not yet feasible, therefore, our group has decided to integrate existing databases and theories to create a software system that assists X-ray crystallographers in specifying a particular protein structure. By breaking the problem of determining overall protein structure into small subproblems, we hope to come closer to solving a novel structure by solving each component. By generating necessary information for structure determination, this method provides the first step toward designing a program to determine protein conformation automatically.

  9. Tritium Irrigation Facility & Automated Vadose Zone Monitoring System |

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Savannah River Ecology Laboratory Tritium Irrigation Facility and Automated Vadose Monitoring System The opportunity to study tritium movement in a natural system presents a rare opportunity for both physical and biological research. Researchers may take advantage of tritium's properties as a conservative tracer for modeling contaminant transport, as a radioactive tracer for examining biological processes involving water, or as an example of radionuclide contaminant behavior in natural

  10. Sandia National Laboratories: Research: High Consequence, Automation, &

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Robotics: Neural Control of Prosthetics Neural Control of Prosthetics Advanced prosthetics Researchers in High Consequence, Automation, & Robotics are working on ways to improve amputees' control over prosthetics with direct help from their own nervous systems. Neural interfaces operate where the nervous system and an artificial device intersect. Interfaces can monitor nerve signals or provide inputs that let amputees control prosthetic devices by direct neural signals, the same way they

  11. Optical Method for Automated Real Time Control of Elemental Composition,

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Distribution, and Film Thickness in CIGS Solar Cell Production - Energy Innovation Portal Find More Like This Return to Search Optical Method for Automated Real Time Control of Elemental Composition, Distribution, and Film Thickness in CIGS Solar Cell Production National Renewable Energy Laboratory Contact NREL About This Technology Technology Marketing Summary The solar industry has shown significant growth over the past decade. From 2002 to 2007 the market for Copper Indium Gallium

  12. Reference Model for Control and Automation Systems in Electrical Power

    Energy Savers [EERE]

    Reference Model for Control and Automation Systems in Electrical Power Version 1.2 October 12, 2005 Prepared by: Sandia National Laboratories' Center for SCADA Security Jason Stamp, Technical Lead Michael Berg, Co-Technical Lead Michael Baca, Project Lead This work was conducted for the DOE Office of Electricity Delivery and Energy Reliability under Contract M64SCADSNL Sandia is a multiprogram laboratory operated by Sandia Corporation, a Lockheed Martin Company, for the United States Department

  13. Sandia National Laboratories: Research: High Consequence, Automation, &

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Robotics: Guided Bullet Technology Guided Bullet Technology Robotics Facility Leveraging the capabilities of the High Consequence, Automation, & Robotics Precision Micro Assembly Lab, we have designed a self-guided .50 caliber projectile that utilizes a laser designated target and is configured to be fired from a small caliber, smooth bore gun barrel. Self-guided projectiles increase the probability of hit at targets at long range. Design The self-guided projectile utilizes a laser

  14. Automated defect spatial signature analysis for semiconductor manufacturing process

    DOE Patents [OSTI]

    Tobin, Jr., Kenneth W.; Gleason, Shaun S.; Karnowski, Thomas P.; Sari-Sarraf, Hamed

    1999-01-01

    An apparatus and method for performing automated defect spatial signature alysis on a data set representing defect coordinates and wafer processing information includes categorizing data from the data set into a plurality of high level categories, classifying the categorized data contained in each high level category into user-labeled signature events, and correlating the categorized, classified signature events to a present or incipient anomalous process condition.

  15. Automated closure system for nuclear reactor fuel assemblies

    DOE Patents [OSTI]

    Christiansen, David W. (Kennewick, WA); Brown, William F. (West Richland, WA)

    1985-01-01

    A welder for automated closure of fuel pins by a pulsed magnetic process in which the open end of a length of cladding is positioned within a complementary tube surrounded by a pulsed magnetic welder. Seals are provided at each end of the tube, which can be evacuated or can receive tag gas for direct introduction to the cladding interior. Loading of magnetic rings and end caps is accomplished automatically in conjunction with the welding steps carried out within the tube.

  16. Automated Measurement and Signaling Systems for the Transactional Network |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy Measurement and Signaling Systems for the Transactional Network Automated Measurement and Signaling Systems for the Transactional Network The Transactional Network Project is a multi-lab activity funded by the U.S. Department of Energy's Building Technologies Office. The project team included staff from Lawrence Berkeley National Laboratory, Pacific Northwest National Laboratory, and Oak Ridge National Laboratory. The team designed, prototyped, and tested a transactional

  17. Automated Sealing of Home Enclosures with Aerosol Particles | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Sealing of Home Enclosures with Aerosol Particles Automated Sealing of Home Enclosures with Aerosol Particles This presentation was delivered during a Building America webinar on October 14, 2011, by the Building Industry Research Alliance team member Mark Modera. PDF icon bira_webinar_10_14_11.pdf More Documents & Publications Building America Technology Solutions for New and Existing Homes: Apartment Compartmentalization with an Aerosol-Based Sealing Process Building America

  18. Automated Image Analysis of Fibers - Energy Innovation Portal

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Startup America Startup America Industrial Technologies Industrial Technologies Advanced Materials Advanced Materials Find More Like This Return to Search Automated Image Analysis of Fibers Automatic Nanofiber Characterization and Recognition Software Argonne National Laboratory Contact ANL About This Technology Image with recognized fiber edges<br /> <br /> Diameter - Measure between each yellow and red tail. Image with recognized fiber edges Diameter - Measure between each yellow

  19. Automated Surface Sampling Probe for Mass Spectrometry - Energy Innovation

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Portal Advanced Materials Advanced Materials Find More Like This Return to Search Automated Surface Sampling Probe for Mass Spectrometry Mass Spectrometry Imaging for Drug Discovery and Pharmaceutical Research Oak Ridge National Laboratory Contact ORNL About This Technology Technology Marketing SummaryDr. Gary Van Berkel and colleagues have developed a liquid microjunction surface sampling probe (LMJ?SSP). The LMJ?SSP provides mass spectrometry with a simple and efficient ambient surface

  20. Automated Testing Instrument for Verification of Complex Computational

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Systems | Princeton Plasma Physics Lab Automated Testing Instrument for Verification of Complex Computational Systems Verifying the functionality and proper operation of both hardware and software of complex, low, medium and high speed, Real-Time Instrumentation, Acquisition, Control and Protection systems is typically time consuming and costly. When these systems are expanded, modified, enhanced with new features or software 'bugs' corrected, re-verification of correct operation must be

  1. Automated hybridization/imaging device for fluorescent multiplex DNA sequencing

    DOE Patents [OSTI]

    Weiss, R.B.; Kimball, A.W.; Gesteland, R.F.; Ferguson, F.M.; Dunn, D.M.; Di Sera, L.J.; Cherry, J.L.

    1995-11-28

    A method is disclosed for automated multiplex sequencing of DNA with an integrated automated imaging hybridization chamber system. This system comprises an hybridization chamber device for mounting a membrane containing size-fractionated multiplex sequencing reaction products, apparatus for fluid delivery to the chamber device, imaging apparatus for light delivery to the membrane and image recording of fluorescence emanating from the membrane while in the chamber device, and programmable controller apparatus for controlling operation of the system. The multiplex reaction products are hybridized with a probe, the enzyme (such as alkaline phosphatase) is bound to a binding moiety on the probe, and a fluorogenic substrate (such as a benzothiazole derivative) is introduced into the chamber device by the fluid delivery apparatus. The enzyme converts the fluorogenic substrate into a fluorescent product which, when illuminated in the chamber device with a beam of light from the imaging apparatus, excites fluorescence of the fluorescent product to produce a pattern of hybridization. The pattern of hybridization is imaged by a CCD camera component of the imaging apparatus to obtain a series of digital signals. These signals are converted by the controller apparatus into a string of nucleotides corresponding to the nucleotide sequence an automated sequence reader. The method and apparatus are also applicable to other membrane-based applications such as colony and plaque hybridization and Southern, Northern, and Western blots. 9 figs.

  2. Automated hybridization/imaging device for fluorescent multiplex DNA sequencing

    DOE Patents [OSTI]

    Weiss, Robert B.; Kimball, Alvin W.; Gesteland, Raymond F.; Ferguson, F. Mark; Dunn, Diane M.; Di Sera, Leonard J.; Cherry, Joshua L.

    1995-01-01

    A method is disclosed for automated multiplex sequencing of DNA with an integrated automated imaging hybridization chamber system. This system comprises an hybridization chamber device for mounting a membrane containing size-fractionated multiplex sequencing reaction products, apparatus for fluid delivery to the chamber device, imaging apparatus for light delivery to the membrane and image recording of fluorescence emanating from the membrane while in the chamber device, and programmable controller apparatus for controlling operation of the system. The multiplex reaction products are hybridized with a probe, then an enzyme (such as alkaline phosphatase) is bound to a binding moiety on the probe, and a fluorogenic substrate (such as a benzothiazole derivative) is introduced into the chamber device by the fluid delivery apparatus. The enzyme converts the fluorogenic substrate into a fluorescent product which, when illuminated in the chamber device with a beam of light from the imaging apparatus, excites fluorescence of the fluorescent product to produce a pattern of hybridization. The pattern of hybridization is imaged by a CCD camera component of the imaging apparatus to obtain a series of digital signals. These signals are converted by the controller apparatus into a string of nucleotides corresponding to the nucleotide sequence an automated sequence reader. The method and apparatus are also applicable to other membrane-based applications such as colony and plaque hybridization and Southern, Northern, and Western blots.

  3. The rotary zone thermal cycler: A low-power system enabling automated rapid

    Office of Scientific and Technical Information (OSTI)

    PCR (Journal Article) | DOE PAGES The rotary zone thermal cycler: A low-power system enabling automated rapid PCR « Prev Next » Title: The rotary zone thermal cycler: A low-power system enabling automated rapid PCR In this study, advances in molecular biology, microfluidics, and laboratory automation continue to expand the accessibility and applicability of these methods beyond the confines of conventional, centralized laboratory facilities and into point of use roles in clinical,

  4. Automation for industrial wastewater treatment. (Latest citations from Pollution abstracts). Published Search

    SciTech Connect (OSTI)

    1996-02-01

    The bibliography contains citations concerning automated monitoring and purification of wastewater. The design and development of new automated systems and improvements to existing applications are described. The citations examine the benefits of automation, including more efficient use of chemicals, continuous operation, and early warning of equipment failure. Disadvantages are addressed, as well, including increased cost of energy, the need for sophisticated hardware and software, and inability to maintain operation during electric power failure. Case histories of operating automated industrial and municipal systems are presented. (Contains 50-250 citations and includes a subject term index and title list.) (Copyright NERAC, Inc. 1995)

  5. Automation systems for Demand Response, ForskEL (Smart Grid Project...

    Open Energy Info (EERE)

    systems for Demand Response, ForskEL (Smart Grid Project) Jump to: navigation, search Project Name Automation systems for Demand Response, ForskEL Country Denmark Coordinates...

  6. AUTOMATING GROUNDWATER SAMPLING AT HANFORD THE NEXT STEP

    SciTech Connect (OSTI)

    CONNELL CW; CONLEY SF; HILDEBRAND RD; CUNNINGHAM DE; R_D_Doug_Hildebrand@rl.gov; DeVon_E_Cunningham@rl.gov

    2010-01-21

    Historically, the groundwater monitoring activities at the Department of Energy's Hanford Site in southeastern Washington State have been very "people intensive." Approximately 1500 wells are sampled each year by field personnel or "samplers." These individuals have been issued pre-printed forms showing information about the well(s) for a particular sampling evolution. This information is taken from 2 official electronic databases: the Hanford Well information System (HWIS) and the Hanford Environmental Information System (HEIS). The samplers used these hardcopy forms to document the groundwater samples and well water-levels. After recording the entries in the field, the samplers turned the forms in at the end of the day and other personnel posted the collected information onto a spreadsheet that was then printed and included in a log book. The log book was then used to make manual entries of the new information into the software application(s) for the HEIS and HWIS databases. A pilot project for automating this extremely tedious process was lauched in 2008. Initially, the automation was focused on water-level measurements. Now, the effort is being extended to automate the meta-data associated with collecting groundwater samples. The project allowed electronic forms produced in the field by samplers to be used in a work flow process where the data is transferred to the database and electronic form is filed in managed records - thus eliminating manually completed forms. Elimating the manual forms and streamlining the data entry not only improved the accuracy of the information recorded, but also enhanced the efficiency and sampling capacity of field office personnel.

  7. Opportunities for Automated Demand Response in California Wastewater Treatment Facilities

    SciTech Connect (OSTI)

    Aghajanzadeh, Arian; Wray, Craig; McKane, Aimee

    2015-08-30

    Previous research over a period of six years has identified wastewater treatment facilities as good candidates for demand response (DR), automated demand response (Auto-­DR), and Energy Efficiency (EE) measures. This report summarizes that work, including the characteristics of wastewater treatment facilities, the nature of the wastewater stream, energy used and demand, as well as details of the wastewater treatment process. It also discusses control systems and automated demand response opportunities. Furthermore, this report summarizes the DR potential of three wastewater treatment facilities. In particular, Lawrence Berkeley National Laboratory (LBNL) has collected data at these facilities from control systems, submetered process equipment, utility electricity demand records, and governmental weather stations. The collected data were then used to generate a summary of wastewater power demand, factors affecting that demand, and demand response capabilities. These case studies show that facilities that have implemented energy efficiency measures and that have centralized control systems are well suited to shed or shift electrical loads in response to financial incentives, utility bill savings, and/or opportunities to enhance reliability of service. In summary, municipal wastewater treatment energy demand in California is large, and energy-­intensive equipment offers significant potential for automated demand response. In particular, large load reductions were achieved by targeting effluent pumps and centrifuges. One of the limiting factors to implementing demand response is the reaction of effluent turbidity to reduced aeration at an earlier stage of the process. Another limiting factor is that cogeneration capabilities of municipal facilities, including existing power purchase agreements and utility receptiveness to purchasing electricity from cogeneration facilities, limit a facility’s potential to participate in other DR activities.

  8. Meeting Minutes from Automated Home Energy Management System Expert Meeting

    Energy Savers [EERE]

    Automated Home Energy Management System Expert Meeting October 1-2, 2009 AGENDA - Day 1 8:30 - 8:45 Welcome and Debriefing of Building America and Home Energy Management Research- Lew Pratsch, DOE 8:45 - 9:15 Utilities Trends- Smart Grid Projects and Integration With Home Controls - Mike Keesee, SMUD 9:15 - 9:45 Thoughts on Controls System Performance Requirements - Rich Brown, LBL 9:45 - 10:15 Efficiency Trends in Consumer Electronics - Kurtis McKenney, TIAX 10:15 - 10:30 Session Break 10:30 -

  9. Automated Vulnerability Detection for Compiled Smart Grid Software

    SciTech Connect (OSTI)

    Prowell, Stacy J; Pleszkoch, Mark G; Sayre, Kirk D; Linger, Richard C

    2012-01-01

    While testing performed with proper experimental controls can provide scientifically quantifiable evidence that software does not contain unintentional vulnerabilities (bugs), it is insufficient to show that intentional vulnerabilities exist, and impractical to certify devices for the expected long lifetimes of use. For both of these needs, rigorous analysis of the software itself is essential. Automated software behavior computation applies rigorous static software analysis methods based on function extraction (FX) to compiled software to detect vulnerabilities, intentional or unintentional, and to verify critical functionality. This analysis is based on the compiled firmware, takes into account machine precision, and does not rely on heuristics or approximations early in the analysis.

  10. Automated Comparison of Building Energy Simulation Engines (Presentation)

    SciTech Connect (OSTI)

    Polly, B.; Horowitz, S.; Booten, B.; Kruis, N.; Christensen, C.

    2012-08-01

    This presentation describes the BEopt comparative test suite, which is a tool that facilitates the automated comparison of building energy simulation engines. It also demonstrates how the test suite is improving the accuracy of building energy simulation programs. Building energy simulation programs inform energy efficient design for new homes and energy efficient upgrades for existing homes. Stakeholders rely on accurate predictions from simulation programs. Previous research indicates that software tends to over-predict energy usage for poorly-insulated leaky homes. NREL is identifying, investigating, and resolving software inaccuracy issues. Comparative software testing is one method of many that NREL uses to identify potential software issues.

  11. Highly insulating Residential Windows Using Smart Automated Shading

    Energy Savers [EERE]

    Highly insulating Residential Windows Using Smart Automated Shading 2015 Building Technologies Office Peer Review Robert Hart, rghart@lbl.gov Stephen Selkowitz, seselkowitz@lbl.gov Lawrence Berkeley National Laboratory Kevin Gaul, GaulKJ@pella.com Pella Corporation Project Summary Timeline: Start date: 04/01/2013 Planned end date: 03/31/2016 Key Milestones 1. Measured thermal performance of static prototype windows is within 0.03 Btu/hr-ft2F (NFRC tolerance) of design specifications 09/30/2014

  12. Operating and maintenance benefits of automated oven wall temperature measurement

    SciTech Connect (OSTI)

    Leuchtmann, K.P.; Hinz, D.; Bergbau, D.; Platts, M.

    1997-12-31

    For a very long time and regardless of all shortcomings associated with it, the manual measurement of the heating flue temperature has been the only method of monitoring the temperature prevailing in a coke oven battery and discovering weak points in the heating system. In the course of the last few years a number of automated temperature measuring systems have been developed that are intended to replace or supplement the manual heating flue measurement system. These measuring systems and their advantages/disadvantages are briefly described in this paper. Additionally, operational experience gathered with the oven chamber wall temperature measuring system is discussed in detail.

  13. Automated process for solvent separation of organic/inorganic substance

    DOE Patents [OSTI]

    Schweighardt, Frank K. (Upper Macungie, PA)

    1986-01-01

    There is described an automated process for the solvent separation of organic/inorganic substances that operates continuously and unattended and eliminates potential errors resulting from subjectivity and the aging of the sample during analysis. In the process, metered amounts of one or more solvents are passed sequentially through a filter containing the sample under the direction of a microprocessor control apparatus. The mixture in the filter is agitated by ultrasonic cavitation for a timed period and the filtrate is collected. The filtrate of each solvent extraction is collected individually and the residue on the filter element is collected to complete the extraction process.

  14. Automated titration method for use on blended asphalts

    DOE Patents [OSTI]

    Pauli, Adam T.; Robertson, Raymond E.; Branthaver, Jan F.; Schabron, John F.

    2012-08-07

    A system for determining parameters and compatibility of a substance such as an asphalt or other petroleum substance uses titration to highly accurately determine one or more flocculation occurrences and is especially applicable to the determination or use of Heithaus parameters and optimal mixing of various asphalt stocks. In a preferred embodiment, automated titration in an oxygen gas exclusive system and further using spectrophotometric analysis (2-8) of solution turbidity is presented. A reversible titration technique enabling in-situ titration measurement of various solution concentrations is also presented.

  15. Automated process for solvent separation of organic/inorganic substance

    DOE Patents [OSTI]

    Schweighardt, F.K.

    1986-07-29

    There is described an automated process for the solvent separation of organic/inorganic substances that operates continuously and unattended and eliminates potential errors resulting from subjectivity and the aging of the sample during analysis. In the process, metered amounts of one or more solvents are passed sequentially through a filter containing the sample under the direction of a microprocessor control apparatus. The mixture in the filter is agitated by ultrasonic cavitation for a timed period and the filtrate is collected. The filtrate of each solvent extraction is collected individually and the residue on the filter element is collected to complete the extraction process. 4 figs.

  16. Experience in automating the Title V permit application

    SciTech Connect (OSTI)

    Ashcraft, T.; O`Brien, J.

    1995-12-31

    Title V of the Clean Air Act Amendments of 1990 requires that the owners and operators of certain types of industrial plants obtain a federal operating permit. In general, any plant that meets the definition of a major source must either obtain a Title V Operating permit, or take actions to ``act out`` of the Title V program. This Technical Paper describes the experience of the authors in designing and implementing a computer system for data management and reporting of Clean Air Act Title V Permit information. Recommendations are also provided to guide companies and industry groups who are planning to undertake similar automation projects.

  17. Method and apparatus for automated, modular, biomass power generation

    DOE Patents [OSTI]

    Diebold, James P; Lilley, Arthur; Browne, III, Kingsbury; Walt, Robb Ray; Duncan, Dustin; Walker, Michael; Steele, John; Fields, Michael; Smith, Trevor

    2013-11-05

    Method and apparatus for generating a low tar, renewable fuel gas from biomass and using it in other energy conversion devices, many of which were designed for use with gaseous and liquid fossil fuels. An automated, downdraft gasifier incorporates extensive air injection into the char bed to maintain the conditions that promote the destruction of residual tars. The resulting fuel gas and entrained char and ash are cooled in a special heat exchanger, and then continuously cleaned in a filter prior to usage in standalone as well as networked power systems.

  18. Method and apparatus for automated, modular, biomass power generation

    DOE Patents [OSTI]

    Diebold, James P.; Lilley, Arthur; Browne, Kingsbury III; Walt, Robb Ray; Duncan, Dustin; Walker, Michael; Steele, John; Fields, Michael; Smith, Trevor

    2011-03-22

    Method and apparatus for generating a low tar, renewable fuel gas from biomass and using it in other energy conversion devices, many of which were designed for use with gaseous and liquid fossil fuels. An automated, downdraft gasifier incorporates extensive air injection into the char bed to maintain the conditions that promote the destruction of residual tars. The resulting fuel gas and entrained char and ash are cooled in a special heat exchanger, and then continuously cleaned in a filter prior to usage in standalone as well as networked power systems.

  19. Automated identification and indexing of dislocations in crystal interfaces

    SciTech Connect (OSTI)

    Stukowski, Alexander; Bulatov, Vasily V.; Arsenlis, Athanasios

    2012-10-31

    Here, we present a computational method for identifying partial and interfacial dislocations in atomistic models of crystals with defects. Our automated algorithm is based on a discrete Burgers circuit integral over the elastic displacement field and is not limited to specific lattices or dislocation types. Dislocations in grain boundaries and other interfaces are identified by mapping atomic bonds from the dislocated interface to an ideal template configuration of the coherent interface to reveal incompatible displacements induced by dislocations and to determine their Burgers vectors. Additionally, the algorithm generates a continuous line representation of each dislocation segment in the crystal and also identifies dislocation junctions.

  20. Automated edge finishing using an active XY table

    DOE Patents [OSTI]

    Loucks, Clifford S.; Starr, Gregory P.

    1993-01-01

    The disclosure is directed to an apparatus and method for automated edge finishing using hybrid position/force control of an XY table. The disclosure is particularly directed to learning the trajectory of the edge of a workpiece by "guarded moves". Machining is done by controllably moving the XY table, with the workpiece mounted thereon, along the learned trajectory with feedback from a force sensor. Other similar workpieces can be mounted, without a fixture on the XY table, located and the learned trajectory adjusted

  1. Automated Multivariate Optimization Tool for Energy Analysis: Preprint

    SciTech Connect (OSTI)

    Ellis, P. G.; Griffith, B. T.; Long, N.; Torcellini, P. A.; Crawley, D.

    2006-07-01

    Building energy simulations are often used for trial-and-error evaluation of ''what-if'' options in building design--a limited search for an optimal solution, or ''optimization''. Computerized searching has the potential to automate the input and output, evaluate many options, and perform enough simulations to account for the complex interactions among combinations of options. This paper describes ongoing efforts to develop such a tool. The optimization tool employs multiple modules, including a graphical user interface, a database, a preprocessor, the EnergyPlus simulation engine, an optimization engine, and a simulation run manager. Each module is described and the overall application architecture is summarized.

  2. Northwest Open Automated Demand Response Technology Demonstration Project

    SciTech Connect (OSTI)

    Kiliccote, Sila; Piette, Mary Ann; Dudley, Junqiao

    2010-03-17

    The Lawrence Berkeley National Laboratory (LBNL) Demand Response Research Center (DRRC) demonstrated and evaluated open automated demand response (OpenADR) communication infrastructure to reduce winter morning and summer afternoon peak electricity demand in commercial buildings the Seattle area. LBNL performed this demonstration for the Bonneville Power Administration (BPA) in the Seattle City Light (SCL) service territory at five sites: Seattle Municipal Tower, Seattle University, McKinstry, and two Target stores. This report describes the process and results of the demonstration. OpenADR is an information exchange model that uses a client-server architecture to automate demand-response (DR) programs. These field tests evaluated the feasibility of deploying fully automated DR during both winter and summer peak periods. DR savings were evaluated for several building systems and control strategies. This project studied DR during hot summer afternoons and cold winter mornings, both periods when electricity demand is typically high. This is the DRRC project team's first experience using automation for year-round DR resources and evaluating the flexibility of commercial buildings end-use loads to participate in DR in dual-peaking climates. The lessons learned contribute to understanding end-use loads that are suitable for dispatch at different times of the year. The project was funded by BPA and SCL. BPA is a U.S. Department of Energy agency headquartered in Portland, Oregon and serving the Pacific Northwest. BPA operates an electricity transmission system and markets wholesale electrical power at cost from federal dams, one non-federal nuclear plant, and other non-federal hydroelectric and wind energy generation facilities. Created by the citizens of Seattle in 1902, SCL is the second-largest municipal utility in America. SCL purchases approximately 40% of its electricity and the majority of its transmission from BPA through a preference contract. SCL also provides ancillary services within its own balancing authority. The relationship between BPA and SCL creates a unique opportunity to create DR programs that address both BPA's and SCL's markets simultaneously. Although simultaneously addressing both market could significantly increase the value of DR programs for BPA, SCL, and the end user, establishing program parameters that maximize this value is challenging because of complex contractual arrangements and the absence of a central Independent System Operator or Regional Transmission Organization in the northwest.

  3. Modular Automated Processing System (MAPS) for analysis of biological samples.

    SciTech Connect (OSTI)

    Gil, Geun-Cheol; Chirica, Gabriela S.; Fruetel, Julia A.; VanderNoot, Victoria A.; Branda, Steven S.; Schoeniger, Joseph S.; Throckmorton, Daniel J.; Brennan, James S.; Renzi, Ronald F.

    2010-10-01

    We have developed a novel modular automated processing system (MAPS) that enables reliable, high-throughput analysis as well as sample-customized processing. This system is comprised of a set of independent modules that carry out individual sample processing functions: cell lysis, protein concentration (based on hydrophobic, ion-exchange and affinity interactions), interferent depletion, buffer exchange, and enzymatic digestion of proteins of interest. Taking advantage of its unique capacity for enclosed processing of intact bioparticulates (viruses, spores) and complex serum samples, we have used MAPS for analysis of BSL1 and BSL2 samples to identify specific protein markers through integration with the portable microChemLab{trademark} and MALDI.

  4. Integration of Real-Time Data Into Building Automation Systems

    SciTech Connect (OSTI)

    Mark J. Stunder; Perry Sebastian; Brenda A. Chube; Michael D. Koontz

    2003-04-16

    The project goal was to investigate the possibility of using predictive real-time information from the Internet as an input to building management system algorithms. The objectives were to identify the types of information most valuable to commercial and residential building owners, managers, and system designers. To comprehensively investigate and document currently available electronic real-time information suitable for use in building management systems. Verify the reliability of the information and recommend accreditation methods for data and providers. Assess methodologies to automatically retrieve and utilize the information. Characterize equipment required to implement automated integration. Demonstrate the feasibility and benefits of using the information in building management systems. Identify evolutionary control strategies.

  5. Automated identification and indexing of dislocations in crystal interfaces

    DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

    Stukowski, Alexander; Bulatov, Vasily V.; Arsenlis, Athanasios

    2012-10-31

    Here, we present a computational method for identifying partial and interfacial dislocations in atomistic models of crystals with defects. Our automated algorithm is based on a discrete Burgers circuit integral over the elastic displacement field and is not limited to specific lattices or dislocation types. Dislocations in grain boundaries and other interfaces are identified by mapping atomic bonds from the dislocated interface to an ideal template configuration of the coherent interface to reveal incompatible displacements induced by dislocations and to determine their Burgers vectors. Additionally, the algorithm generates a continuous line representation of each dislocation segment in the crystal andmore » also identifies dislocation junctions.« less

  6. Method and apparatus for globally-accessible automated testing

    DOE Patents [OSTI]

    Layne, Scott P.; Beugelsdijk, Tony J.

    1998-01-01

    A method and apparatus for sharing integrated testing services with a plurality of autonomous remote clients is disclosed. In the disclosed method, in response to an access request message, a process controller transmits an access enabling message to the remote client. The access enabling message includes instructions performable by a remote client to generate test equipment commands. A process controller interprets and transforms these commands into automated test instrument suite commands, which are provided to laboratory modules to perform the indicated tests. Test data results are then obtained and transmitted to the remote client.

  7. Automated Grid Disruption Response System: Robust Adaptive Topology Control (RATC)

    SciTech Connect (OSTI)

    2012-03-01

    GENI Project: The RATC research team is using topology control as a mechanism to improve system operations and manage disruptions within the electric grid. The grid is subject to interruption from cascading faults caused by extreme operating conditions, malicious external attacks, and intermittent electricity generation from renewable energy sources. The RATC system is capable of detecting, classifying, and responding to grid disturbances by reconfiguring the grid in order to maintain economically efficient operations while guaranteeing reliability. The RATC system would help prevent future power outages, which account for roughly $80 billion in losses for businesses and consumers each year. Minimizing the time it takes for the grid to respond to expensive interruptions will also make it easier to integrate intermittent renewable energy sources into the grid.

  8. Open Automated Demand Response for Small Commerical Buildings

    SciTech Connect (OSTI)

    Dudley, June Han; Piette, Mary Ann; Koch, Ed; Hennage, Dan

    2009-05-01

    This report characterizes small commercial buildings by market segments, systems and end-uses; develops a framework for identifying demand response (DR) enabling technologies and communication means; and reports on the design and development of a low-cost OpenADR enabling technology that delivers demand reductions as a percentage of the total predicted building peak electric demand. The results show that small offices, restaurants and retail buildings are the major contributors making up over one third of the small commercial peak demand. The majority of the small commercial buildings in California are located in southern inland areas and the central valley. Single-zone packaged units with manual and programmable thermostat controls make up the majority of heating ventilation and air conditioning (HVAC) systems for small commercial buildings with less than 200 kW peak electric demand. Fluorescent tubes with magnetic ballast and manual controls dominate this customer group's lighting systems. There are various ways, each with its pros and cons for a particular application, to communicate with these systems and three methods to enable automated DR in small commercial buildings using the Open Automated Demand Response (or OpenADR) communications infrastructure. Development of DR strategies must consider building characteristics, such as weather sensitivity and load variability, as well as system design (i.e. under-sizing, under-lighting, over-sizing, etc). Finally, field tests show that requesting demand reductions as a percentage of the total building predicted peak electric demand is feasible using the OpenADR infrastructure.

  9. Methods for Automated and Continuous Commissioning of Building Systems

    SciTech Connect (OSTI)

    Larry Luskay; Michael Brambley; Srinivas Katipamula

    2003-04-30

    Avoidance of poorly installed HVAC systems is best accomplished at the close of construction by having a building and its systems put ''through their paces'' with a well conducted commissioning process. This research project focused on developing key components to enable the development of tools that will automatically detect and correct equipment operating problems, thus providing continuous and automatic commissioning of the HVAC systems throughout the life of a facility. A study of pervasive operating problems reveled the following would most benefit from an automated and continuous commissioning process: (1) faulty economizer operation; (2) malfunctioning sensors; (3) malfunctioning valves and dampers, and (4) access to project design data. Methodologies for detecting system operation faults in these areas were developed and validated in ''bare-bones'' forms within standard software such as spreadsheets, databases, statistical or mathematical packages. Demonstrations included flow diagrams and simplified mock-up applications. Techniques to manage data were demonstrated by illustrating how test forms could be populated with original design information and the recommended sequence of operation for equipment systems. Proposed tools would use measured data, design data, and equipment operating parameters to diagnosis system problems. Steps for future research are suggested to help more toward practical application of automated commissioning and its high potential to improve equipment availability, increase occupant comfort, and extend the life of system equipment.

  10. PR-PR: Cross-Platform Laboratory Automation System

    SciTech Connect (OSTI)

    Linshiz, G; Stawski, N; Goyal, G; Bi, CH; Poust, S; Sharma, M; Mutalik, V; Keasling, JD; Hillson, NJ

    2014-08-01

    To enable protocol standardization, sharing, and efficient implementation across laboratory automation platforms, we have further developed the PR-PR open-source high-level biology-friendly robot programming language as a cross-platform laboratory automation system. Beyond liquid-handling robotics, PR-PR now supports microfluidic and microscopy platforms, as well as protocol translation into human languages, such as English. While the same set of basic PR-PR commands and features are available for each supported platform, the underlying optimization and translation modules vary from platform to platform. Here, we describe these further developments to PR-PR, and demonstrate the experimental implementation and validation of PR-PR protocols for combinatorial modified Golden Gate DNA assembly across liquid-handling robotic, microfluidic, and manual platforms. To further test PR-PR cross-platform performance, we then implement and assess PR-PR protocols for Kunkel DNA mutagenesis and hierarchical Gibson DNA assembly for microfluidic and manual platforms.

  11. AUTOMATED, HIGHLY ACCURATE VERIFICATION OF RELAP5-3D

    SciTech Connect (OSTI)

    George L Mesina; David Aumiller; Francis Buschman

    2014-07-01

    Computer programs that analyze light water reactor safety solve complex systems of governing, closure and special process equations to model the underlying physics. In addition, these programs incorporate many other features and are quite large. RELAP5-3D[1] has over 300,000 lines of coding for physics, input, output, data management, user-interaction, and post-processing. For software quality assurance, the code must be verified and validated before being released to users. Verification ensures that a program is built right by checking that it meets its design specifications. Recently, there has been an increased importance on the development of automated verification processes that compare coding against its documented algorithms and equations and compares its calculations against analytical solutions and the method of manufactured solutions[2]. For the first time, the ability exists to ensure that the data transfer operations associated with timestep advancement/repeating and writing/reading a solution to a file have no unintended consequences. To ensure that the code performs as intended over its extensive list of applications, an automated and highly accurate verification method has been modified and applied to RELAP5-3D. Furthermore, mathematical analysis of the adequacy of the checks used in the comparisons is provided.

  12. Opportunities for Automated Demand Response in California Agricultural Irrigation

    SciTech Connect (OSTI)

    Olsen, Daniel; Aghajanzadeh, Arian; McKane, Aimee

    2015-08-01

    Pumping water for agricultural irrigation represents a significant share of California’s annual electricity use and peak demand. It also represents a large source of potential flexibility, as farms possess a form of storage in their wetted soil. By carefully modifying their irrigation schedules, growers can participate in demand response without adverse effects on their crops. This report describes the potential for participation in demand response and automated demand response by agricultural irrigators in California, as well as barriers to widespread participation. The report first describes the magnitude, timing, location, purpose, and manner of energy use in California. Typical on-­farm controls are discussed, as well as common impediments to participation in demand response and automated demand response programs. Case studies of demand response programs in California and across the country are reviewed, and their results along with overall California demand estimates are used to estimate statewide demand response potential. Finally, recommendations are made for future research that can enhance the understanding of demand response potential in this industry.

  13. DRAFT - DOE G 444.1-1, Guide on Preventing and Responding to All Forms of Violence in the Workplace

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    To ensure all sites have the tools to implement processes, we have created this guide. Each site is expected to develop its own site specific set of procedures/process to implement DOE Policy 444.1 Preventing and Responding to all forms of violence in the Workplace.

  14. Responding to Terrorist Incidents in Your Community: Flammable-Liquid Fire Fighting Techniques for Municipal and Rural Firefighters

    SciTech Connect (OSTI)

    Denise Baclawski

    2010-03-08

    The University of Nevada, Reno Fire Science Academy (FSA) applied for grant funding to develop and deliver programs for municipal, rural, and volunteer firefighters. The FSA specializes in preparing responders for a variety of emergency events, including flammable liquid fires resulting from accidents, intentional acts, or natural disasters. Live fire training on full scale burnable props is the hallmark of FSA training, allowing responders to practice critical skills in a realistic, yet safe environment. Unfortunately, flammable liquid live fire training is often not accessible to municipal, rural, or volunteer firefighters due to limited department training budgets, even though most department personnel will be exposed to flammable liquid fire incidents during the course of their careers. In response to this training need, the FSA developed a course during the first year of the grant (Year One), Responding to Terrorist Incidents in Your Community: Flammable-Liquid Fire Fighting Techniques for Municipal and Rural Firefighters. During the three years of the grant, a total of 2,029 emergency responders received this training. In Year Three, two new courses, a train-the-trainer for Responding to Terrorist Incidents in Your Community and Management of Large-Scale Disasters for Public Officials were developed and pilot tested during the Real-World Disaster Management Conference held at the FSA in June of 2007. Two research projects were conducted during Years Two and Three. The first, conducted over a two year period, evaluated student surveys regarding the value of the flammable liquids training received. The second was a needs assessment conducted for rural Nevada. Both projects provided important feedback and a basis for curricula development and improvements.

  15. Evaluate fundamental approaches to longwall dust control: Subprogram D, Longwall automation technology

    SciTech Connect (OSTI)

    Ludlow, J.; Ruggieri, S.

    1990-05-01

    The use of automated equipment on longwall faces can offer significant benefits by the dust exposures of face personnel can be reduced by removing them from areas of high dust concentrations. While the advantages are clear, and sufficiently mature, and developments have been commercially available, the application of automated systems on US longwalls has met with limited success. The objective of this subprogram was to determine the engineering and economic restraints on the implementation and acceptance of longwall automation technology and to study the potential dust control benefits offered by the technology. Two of the more highly developed automation techniques were chosen for detailed investigation: automated shield advance and shearer remote control. This report discusses the manufacturer surveys, mining company surveys and underground evaluations conducted as part of this effort. Specific conclusions and recommendations are offered regarding the use of the techniques. 4 figs., 5 tabs.

  16. The present invention relates to automated methods of introducing multiple nucleic acid sequences into one or more target cells.

    DOE Patents [OSTI]

    Church, George M. (Brookline, MA); Wang, Harris H. (Cambridge, MA); Isaacs, Farren J. (Brookline, MA)

    2012-04-10

    The present invention relates to automated methods of introducing multiple nucleic acid sequences into one or more target cells.

  17. Automated event generation for loop-induced processes

    SciTech Connect (OSTI)

    Hirschi, Valentin; Mattelaer, Olivier

    2015-10-22

    We present the first fully automated implementation of cross-section computation and event generation for loop-induced processes. This work is integrated in the MadGraph5_aMC@NLO framework. We describe the optimisations implemented at the level of the matrix element evaluation, phase space integration and event generation allowing for the simulation of large multiplicity loop-induced processes. Along with some selected differential observables, we illustrate our results with a table showing inclusive cross-sections for all loop-induced hadronic scattering processes with up to three final states in the SM as well as for some relevant 2 → 4 processes. Furthermore, many of these are computed here for the first time.

  18. Automated event generation for loop-induced processes

    DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

    Hirschi, Valentin; Mattelaer, Olivier

    2015-10-22

    We present the first fully automated implementation of cross-section computation and event generation for loop-induced processes. This work is integrated in the MadGraph5_aMC@NLO framework. We describe the optimisations implemented at the level of the matrix element evaluation, phase space integration and event generation allowing for the simulation of large multiplicity loop-induced processes. Along with some selected differential observables, we illustrate our results with a table showing inclusive cross-sections for all loop-induced hadronic scattering processes with up to three final states in the SM as well as for some relevant 2 → 4 processes. Furthermore, many of these are computed heremore » for the first time.« less

  19. Automated ultrasonic inspection of turbine blade tenons results summary

    SciTech Connect (OSTI)

    Kotteakos, B.

    1996-12-31

    Cracks occurring in turbine blade tenons have the possibility of producing severe damage if not detected. Undetected cracks can propagate to a critical size, resulting in loss of shroud, excessive vibration and consequential unit shut down. Advances in the development of ultrasonic techniques have provided Southern California Edison Company (SCE) with an effective method of detecting tenon cracking prior to crack propagation to critical size. The ultrasonic system utilized by SCE incorporates focused array technology and automated scanning techniques and provides many advantages over the conventional manual scanning techniques. This paper addresses the system utilized by the company and the results of inspections since the introduction of the equipment to the power generation industry.

  20. Northwest Open Automated Demand Response Technology Demonstration Project

    SciTech Connect (OSTI)

    Kiliccote, Sila; Dudley, Junqiao Han; Piette, Mary Ann

    2009-08-01

    Lawrence Berkeley National Laboratory (LBNL) and the Demand Response Research Center (DRRC) performed a technology demonstration and evaluation for Bonneville Power Administration (BPA) in Seattle City Light's (SCL) service territory. This report summarizes the process and results of deploying open automated demand response (OpenADR) in Seattle area with winter morning peaking commercial buildings. The field tests were designed to evaluate the feasibility of deploying fully automated demand response (DR) in four to six sites in the winter and the savings from various building systems. The project started in November of 2008 and lasted 6 months. The methodology for the study included site recruitment, control strategy development, automation system deployment and enhancements, and evaluation of sites participation in DR test events. LBNL subcontracted McKinstry and Akuacom for this project. McKinstry assisted with recruitment, site survey collection, strategy development and overall participant and control vendor management. Akuacom established a new server and enhanced its operations to allow for scheduling winter morning day-of and day-ahead events. Each site signed a Memorandum of Agreement with SCL. SCL offered each site $3,000 for agreeing to participate in the study and an additional $1,000 for each event they participated. Each facility and their control vendor worked with LBNL and McKinstry to select and implement control strategies for DR and developed their automation based on the existing Internet connectivity and building control system. Once the DR strategies were programmed, McKinstry commissioned them before actual test events. McKinstry worked with LBNL to identify control points that can be archived at each facility. For each site LBNL collected meter data and trend logs from the energy management and control system. The communication system allowed the sites to receive day-ahead as well as day-of DR test event signals. Measurement of DR was conducted using three different baseline models for estimation peak load reductions. One was three-in-ten baseline, which is based on the site electricity consumption from 7 am to 10 am for the three days with the highest consumption of the previous ten business days. The second model, the LBNL outside air temperature (OAT) regression baseline model, is based on OAT data and site electricity consumption from the previous ten days, adjusted using weather regressions from the fifteen-minute electric load data during each DR test event for each site. A third baseline that simply averages the available load data was used for sites less with less than 10 days of historical meter data. The evaluation also included surveying sites regarding any problems or issues that arose during the DR test events. Question covered occupant comfort, control issues and other potential problems.

  1. Automated cassette-to-cassette substrate handling system

    DOE Patents [OSTI]

    Kraus, Joseph Arthur; Boyer, Jeremy James; Mack, Joseph; DeChellis, Michael; Koo, Michael

    2014-03-18

    An automated cassette-to-cassette substrate handling system includes a cassette storage module for storing a plurality of substrates in cassettes before and after processing. A substrate carrier storage module stores a plurality of substrate carriers. A substrate carrier loading/unloading module loads substrates from the cassette storage module onto the plurality of substrate carriers and unloads substrates from the plurality of substrate carriers to the cassette storage module. A transport mechanism transports the plurality of substrates between the cassette storage module and the plurality of substrate carriers and transports the plurality of substrate carriers between the substrate carrier loading/unloading module and a processing chamber. A vision system recognizes recesses in the plurality of substrate carriers corresponding to empty substrate positions in the substrate carrier. A processor receives data from the vision system and instructs the transport mechanism to transport substrates to positions on the substrate carrier in response to the received data.

  2. Digital microfluidic hub for automated nucleic acid sample preparation.

    SciTech Connect (OSTI)

    He, Jim; Bartsch, Michael S.; Patel, Kamlesh D.; Kittlaus, Eric A.; Remillared, Erin M.; Pezzola, Genevieve L.; Renzi, Ronald F.; Kim, Hanyoup

    2010-07-01

    We have designed, fabricated, and characterized a digital microfluidic (DMF) platform to function as a central hub for interfacing multiple lab-on-a-chip sample processing modules towards automating the preparation of clinically-derived DNA samples for ultrahigh throughput sequencing (UHTS). The platform enables plug-and-play installation of a two-plate DMF device with consistent spacing, offers flexible connectivity for transferring samples between modules, and uses an intuitive programmable interface to control droplet/electrode actuations. Additionally, the hub platform uses transparent indium-tin oxide (ITO) electrodes to allow complete top and bottom optical access to the droplets on the DMF array, providing additional flexibility for various detection schemes.

  3. Measurement and evaluation techniques for automated demand response demonstration

    SciTech Connect (OSTI)

    Motegi, Naoya; Piette, Mary Ann; Watson, David S.; Sezgen, Osman; ten Hope, Laurie

    2004-08-01

    The recent electricity crisis in California and elsewhere has prompted new research to evaluate demand response strategies in large facilities. This paper describes an evaluation of fully automated demand response technologies (Auto-DR) in five large facilities. Auto-DR does not involve human intervention, but is initiated at a facility through receipt of an external communications signal. This paper summarizes the measurement and evaluation of the performance of demand response technologies and strategies in five large facilities. All the sites have data trending systems such as energy management and control systems (EMCS) and/or energy information systems (EIS). Additional sub-metering was applied where necessary to evaluate the facility's demand response performance. This paper reviews the control responses during the test period, and analyzes demand savings achieved at each site. Occupant comfort issues are investigated where data are available. This paper discusses methods to estimate demand savings and results from demand response strategies at five large facilities.

  4. Automated Pre-processing for NMR Assignments with Reduced Tedium

    Energy Science and Technology Software Center (OSTI)

    2004-05-11

    An important rate-limiting step in the reasonance asignment process is accurate identification of resonance peaks in MNR spectra. NMR spectra are noisy. Hence, automatic peak-picking programs must navigate between the Scylla of reliable but incomplete picking, and the Charybdis of noisy but complete picking. Each of these extremes complicates the assignment process: incomplete peak-picking results in the loss of essential connectivities, while noisy picking conceals the true connectivities under a combinatiorial explosion of false positives.more » Intermediate processing can simplify the assignment process by preferentially removing false peaks from noisy peak lists. This is accomplished by requiring consensus between multiple NMR experiments, exploiting a priori information about NMR spectra, and drawing on empirical statistical distributions of chemical shift extracted from the BioMagResBank. Experienced NMR practitioners currently apply many of these techniques "by hand", which is tedious, and may appear arbitrary to the novice. To increase efficiency, we have created a systematic and automated approach to this process, known as APART. Automated pre-processing has three main advantages: reduced tedium, standardization, and pedagogy. In the hands of experienced spectroscopists, the main advantage is reduced tedium (a rapid increase in the ratio of true peaks to false peaks with minimal effort). When a project is passed from hand to hand, the main advantage is standardization. APART automatically documents the peak filtering process by archiving its original recommendations, the accompanying justifications, and whether a user accepted or overrode a given filtering recommendation. In the hands of a novice, this tool can reduce the stumbling block of learning to differentiate between real peaks and noise, by providing real-time examples of how such decisions are made.« less

  5. Automated Controlled-Potential Coulometer for the IAEA

    SciTech Connect (OSTI)

    Cordaro, J.V.; Holland, M.K.; Fields, T.

    1998-01-29

    An automated controlled-potential coulometer has been developed at the Savannah River Site (SRS) for the determination of plutonium for use at the International Atomic Energy Agency`s (IAEA) Safeguards Analytical Laboratory in Siebersdorf, Austria. The system is functionally the same as earlier systems built for use at the Savannah River Site`s Analytical Laboratory. All electronic circuits and printed circuits boards have been upgraded with state-of-the-art components. A higher amperage potentiostat with improved control stability has been developed. The system achieves electronic calibration accuracy and linearity of better than 0.01 percent, with a precision and accuracy better than 0.1 percent has been demonstrated. This coulometer features electrical calibration of the integration system, electrolysis current background corrections, and control-potential adjustment capabilities. These capabilities allow application of the system to plutonium measurements without chemical standards, achieving traceability to the international measurement system through electrical standards and Faraday`s constant. the chemist is provided with the capability to perform measurements without depending upon chemical standards, which is a significant advantage for applications such as characterization of primary and secondary standards. Additional benefits include reducing operating cost to procure, prepare and measure calibration standards and the corresponding decrease in radioactive waste generation. The design and documentation of the automated instrument are provided herein. Each individual module`s operation, wiring, layout, and alignment are described. Interconnection of the modules and system calibration are discussed. A complete set of prints and a list of associated parts are included.

  6. King has no clothes: The role of the military in responding to a terrorist chemical/biological attack. Final report

    SciTech Connect (OSTI)

    Osterman, J.L.

    1996-06-14

    The United States has begun a program of counterproliferation in order to preempt the use of WMD by such elements, however, the ability to respond to the terrorist employment of biological/chemical weapons is absent. Given the structure, capability and technical expertise in the Federal Emergency Management Agency (FEMA) and the Federal Bureau of Investigation (FBI), the Department of Defense (DoD) will be tasked to conduct the response to such an incident. The geographical Commander in Chief (CINC) and the appointed Joint Task Force (JTF) commander will ultimately be assigned the response mission. Planning, training and coordination is required to develop a force capable of responding in a timely and coordinated manner.

  7. How Do I Know? A Guide to the Selection of Personal Protective Equipment for Use in Responding to A Release of Chemical Warfare Agents

    SciTech Connect (OSTI)

    Foust, C.B.

    1999-05-01

    An incident involving chemical warfare agents requires a unique hazardous materials (HAZMAT) response. As with an HAZMAT event, federal regulations prescribe that responders must be protected from exposure to the chemical agents. But unlike other HAZMAT events, special considerations govern selection of personal protective equipment (PPE). PPE includes all clothing, respirators and monitoring devices used to respond to a chemical release. PPE can differ depending on whether responders are military or civilian personnel.

  8. Ning Kang | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Ning Kang Eng Systems Modeling-Simulation-Analysis 2 E-mail nkang@anl.gov Projects Distribution Automation

  9. Ravindra Singh | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Ravindra Singh Eng Systems Modeling-Simulation-Analysis 3 E-mail ravindra.singh@anl.gov Projects Distribution Automation

  10. Request for Proposal No. DE-SOL-0007749 SECTION L INSTRUCTIONS, CONDITIONS, AND NOTICES TO OFFERORS OR RESPONDENTS

    National Nuclear Security Administration (NNSA)

    SECTION L INSTRUCTIONS, CONDITIONS, AND NOTICES TO OFFERORS OR RESPONDENTS TABLE OF CONTENTS L-1 FAR 52.204-7 SYSTEM FOR AWARD MANAGEMENT (JUL 2013) ................................................... 1 L-2 FAR 52.215-1 INSTRUCTIONS TO OFFERORS -- COMPETITIVE ACQUISITION (JAN 2004) ... 3 L-3 FAR 52.216-1 TYPE OF CONTRACT (APR 1984) ................................................................................... 8 L-4 FAR 52.222-24 PREAWARD ON-SITE EQUAL OPPORTUNITY COMPLIANCE EVALUATION (FEB

  11. AVTA: Battery Testing- Best Practices for Responding to Emergency Incidents in Plug-in Electric Vehicles (EV)

    Broader source: Energy.gov [DOE]

    The Vehicle Technologies Office's Advanced Vehicle Testing Activity carries out testing on a wide range of advanced vehicles and technologies on dynamometers, closed test tracks, and on-the-road. These results provide benchmark data that researchers can use to develop technology models and guide future research and development. The following report describes best practices for responding to emergency incidents involving plug-in electric vehicle batteries, based on the AVTA's testing of PEV batteries. This research was conducted by Idaho National Laboratory.

  12. AUTOMATED UTILITY SERVICE AREA ASSESSMENT UNDER EMERGENCY CONDITIONS

    SciTech Connect (OSTI)

    G. TOOLE; S. LINGER

    2001-01-01

    All electric utilities serve power to their customers through a variety of functional levels, notably substations. The majority of these components consist of distribution substations operating at lower voltages while a small fraction are transmission substations. There is an associated geographical area that encompasses customers who are served, defined as the service area. Analysis of substation service areas is greatly complicated by several factors: distribution networks are often highly interconnected which allows a multitude of possible switching operations; also, utilities dynamically alter the network topology in order to respond to emergency events. As a result, the service area for a substation can change radically. A utility will generally attempt to minimize the number of customers outaged by switching effected loads to alternate substations. In this manner, all or a portion of a disabled substation's load may be served by one or more adjacent substations. This paper describes a suite of analytical tools developed at Los Alamos National Laboratory (LANL), which address the problem of determining how a utility might respond to such emergency events. The estimated outage areas derived using the tools are overlaid onto other geographical and electrical layers in a geographic information system (GIS) software application. The effects of a power outage on a population, other infrastructures, or other physical features, can be inferred by the proximity of these features to the estimated outage area.

  13. FEMP Presents Its Newest On-Demand eTraining Course on Building Automation

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Systems | Department of Energy Presents Its Newest On-Demand eTraining Course on Building Automation Systems FEMP Presents Its Newest On-Demand eTraining Course on Building Automation Systems November 19, 2013 - 12:00am Addthis The U.S. Department of Energy (DOE) Federal Energy Management Program (FEMP) has launched its latest eTraining Course, Building Automation Systems for Existing Federal Facilities for no-cost, on-demand access. In this course, FEMP Technical Lead Brad Gustafson offers

  14. INITIATORS AND TRIGGERING CONDITIONS FOR ADAPTIVE AUTOMATION IN ADVANCED SMALL MODULAR REACTORS

    SciTech Connect (OSTI)

    Katya L Le Blanc; Johanna h Oxstrand

    2014-04-01

    It is anticipated that Advanced Small Modular Reactors (AdvSMRs) will employ high degrees of automation. High levels of automation can enhance system performance, but often at the cost of reduced human performance. Automation can lead to human out-of the loop issues, unbalanced workload, complacency, and other problems if it is not designed properly. Researchers have proposed adaptive automation (defined as dynamic or flexible allocation of functions) as a way to get the benefits of higher levels of automation without the human performance costs. Adaptive automation has the potential to balance operator workload and enhance operator situation awareness by allocating functions to the operators in a way that is sensitive to overall workload and capabilities at the time of operation. However, there still a number of questions regarding how to effectively design adaptive automation to achieve that potential. One of those questions is related to how to initiate (or trigger) a shift in automation in order to provide maximal sensitivity to operator needs without introducing undesirable consequences (such as unpredictable mode changes). Several triggering mechanisms for shifts in adaptive automation have been proposed including: operator initiated, critical events, performance-based, physiological measurement, model-based, and hybrid methods. As part of a larger project to develop design guidance for human-automation collaboration in AdvSMRs, researchers at Idaho National Laboratory have investigated the effectiveness and applicability of each of these triggering mechanisms in the context of AdvSMR. Researchers reviewed the empirical literature on adaptive automation and assessed each triggering mechanism based on the human-system performance consequences of employing that mechanism. Researchers also assessed the practicality and feasibility of using the mechanism in the context of an AdvSMR control room. Results indicate that there are tradeoffs associated with each mechanism, but that some are more applicable to the AdvSMR domain. The two mechanisms that consistently improve performance in laboratory studies are operator initiated adaptive automation based on hierarchical task delegation and the Electroencephalogram(EEG) based measure of engagement. Current EEG methods are intrusive and require intensive analysis; therefore it is not recommended for an AdvSMR control rooms at this time. Researchers also discuss limitations in the existing empirical literature and make recommendations for further research.

  15. A DISTRIBUTED INTELLIGENT AUTOMATED DEMAND RESPONSE BUILDING MANAGEMENT SYSTEM

    SciTech Connect (OSTI)

    Auslander, David; Culler, David; Wright, Paul; Lu, Yan; Piette, Mary

    2013-12-30

    The goal of the 2.5 year Distributed Intelligent Automated Demand Response (DIADR) project was to reduce peak electricity load of Sutardja Dai Hall at UC Berkeley by 30% while maintaining a healthy, comfortable, and productive environment for the occupants. We sought to bring together both central and distributed control to provide “deep” demand response1 at the appliance level of the building as well as typical lighting and HVAC applications. This project brought together Siemens Corporate Research and Siemens Building Technology (the building has a Siemens Apogee Building Automation System (BAS)), Lawrence Berkeley National Laboratory (leveraging their Open Automated Demand Response (openADR), Auto-­Demand Response, and building modeling expertise), and UC Berkeley (related demand response research including distributed wireless control, and grid-­to-­building gateway development). Sutardja Dai Hall houses the Center for Information Technology Research in the Interest of Society (CITRIS), which fosters collaboration among industry and faculty and students of four UC campuses (Berkeley, Davis, Merced, and Santa Cruz). The 141,000 square foot building, occupied in 2009, includes typical office spaces and a nanofabrication laboratory. Heating is provided by a district heating system (steam from campus as a byproduct of the campus cogeneration plant); cooling is provided by one of two chillers: a more typical electric centrifugal compressor chiller designed for the cool months (Nov-­ March) and a steam absorption chiller for use in the warm months (April-­October). Lighting in the open office areas is provided by direct-­indirect luminaries with Building Management System-­based scheduling for open areas, and occupancy sensors for private office areas. For the purposes of this project, we focused on the office portion of the building. Annual energy consumption is approximately 8053 MWh; the office portion is estimated as 1924 MWh. The maximum peak load during the study period was 1175 kW. Several new tools facilitated this work, such as the Smart Energy Box, the distributed load controller or Energy Information Gateway, the web-­based DR controller (dubbed the Central Load-­Shed Coordinator or CLSC), and the Demand Response Capacity Assessment & Operation Assistance Tool (DRCAOT). In addition, an innovative data aggregator called sMAP (simple Measurement and Actuation Profile) allowed data from different sources collected in a compact form and facilitated detailed analysis of the building systems operation. A smart phone application (RAP or Rapid Audit Protocol) facilitated an inventory of the building’s plug loads. Carbon dioxide sensors located in conference rooms and classrooms allowed demand controlled ventilation. The extensive submetering and nimble access to this data provided great insight into the details of the building operation as well as quick diagnostics and analyses of tests. For example, students discovered a short-­cycling chiller, a stuck damper, and a leaking cooling coil in the first field tests. For our final field tests, we were able to see how each zone was affected by the DR strategies (e.g., the offices on the 7th floor grew very warm quickly) and fine-­tune the strategies accordingly.

  16. Harnessing Vehicle Automation for Public Mobility -- An Overview of Ongoing Efforts

    SciTech Connect (OSTI)

    Young, Stanley E.

    2015-11-05

    This presentation takes a look at the efforts to harness automated vehicle technology for public transport. The European CityMobil2 is the leading demonstration project in which automated shuttles were, or are planned to be, demonstrated in several cities and regions. The presentation provides a brief overview of the demonstrations at Oristano, Italy (July 2014), LaRochelle, France (Dec 2014), Lausanne, Switzerland (Apr 2015), Vantaa, Finland (July 2015), and Trikala, Greece (Sept 2015). In addition to technology exposition, the objectives included generating a legal framework for operation in each location and gaging the reaction of the public to unmanned shuttles, both of which were successfully achieved. Several such demonstrations are planned throughout the world, including efforts in North America in conjunction with the GoMentum Station in California. These early demonstration with low-speed automated shuttles provide a glimpse of the possible with a fully automated fleet of driverless vehicle providing a public transit service.

  17. Pilon: Automated Assembly Improvement Software (Seventh Annual Sequencing, Finishing, Analysis in the Future (SFAF) Meeting 2012)

    ScienceCinema (OSTI)

    Walker, Bruce (Broad Institute)

    2013-02-11

    Bruce Walker on "Pilon: Automated Assembly Improvement Software" at the 2012 Sequencing, Finishing, Analysis in the Future Meeting held June 5-7, 2012 in Santa Fe, New Mexico.

  18. Automation of a high-speed imaging setup for differential viscosity measurements

    SciTech Connect (OSTI)

    Hurth, C.; Duane, B.; Whitfield, D.; Smith, S.; Nordquist, A.; Zenhausern, F.

    2013-12-28

    We present the automation of a setup previously used to assess the viscosity of pleural effusion samples and discriminate between transudates and exudates, an important first step in clinical diagnostics. The presented automation includes the design, testing, and characterization of a vacuum-actuated loading station that handles the 2 mm glass spheres used as sensors, as well as the engineering of electronic Printed Circuit Board (PCB) incorporating a microcontroller and their synchronization with a commercial high-speed camera operating at 10 000 fps. The hereby work therefore focuses on the instrumentation-related automation efforts as the general method and clinical application have been reported earlier [Hurth et al., J. Appl. Phys. 110, 034701 (2011)]. In addition, we validate the performance of the automated setup with the calibration for viscosity measurements using water/glycerol standard solutions and the determination of the viscosity of an “unknown” solution of hydroxyethyl cellulose.

  19. Disposable and removable nucleic acid extraction and purification cartridges for automated flow-through systems

    DOE Patents [OSTI]

    Regan, John Frederick

    2014-09-09

    Removable cartridges are used on automated flow-through systems for the purpose of extracting and purifying genetic material from complex matrices. Different types of cartridges are paired with specific automated protocols to concentrate, extract, and purifying pathogenic or human genetic material. Their flow-through nature allows large quantities sample to be processed. Matrices may be filtered using size exclusion and/or affinity filters to concentrate the pathogen of interest. Lysed material is ultimately passed through a filter to remove the insoluble material before the soluble genetic material is delivered past a silica-like membrane that binds the genetic material, where it is washed, dried, and eluted. Cartridges are inserted into the housing areas of flow-through automated instruments, which are equipped with sensors to ensure proper placement and usage of the cartridges. Properly inserted cartridges create fluid- and air-tight seals with the flow lines of an automated instrument.

  20. Scientific Data Management Integrated Software Infrastructure Center (SDM/ISIC): Scientific Process Automation (SPA), FINAL REPORT

    SciTech Connect (OSTI)

    Bertram Ludaescher; Ilkay Altintas

    2012-07-03

    This is the final report from SDSC and UC Davis on DE-FC02-01ER25486, Scientific Data Management Integrated Software Infrastructure Center (SDM/ISIC): Scientific Process Automation (SPA).

  1. A Semi-Automated Functional Test Data Analysis Tool

    SciTech Connect (OSTI)

    Xu, Peng; Haves, Philip; Kim, Moosung

    2005-05-01

    The growing interest in commissioning is creating a demand that will increasingly be met by mechanical contractors and less experienced commissioning agents. They will need tools to help them perform commissioning effectively and efficiently. The widespread availability of standardized procedures, accessible in the field, will allow commissioning to be specified with greater certainty as to what will be delivered, enhancing the acceptance and credibility of commissioning. In response, a functional test data analysis tool is being developed to analyze the data collected during functional tests for air-handling units. The functional test data analysis tool is designed to analyze test data, assess performance of the unit under test and identify the likely causes of the failure. The tool has a convenient user interface to facilitate manual entry of measurements made during a test. A graphical display shows the measured performance versus the expected performance, highlighting significant differences that indicate the unit is not able to pass the test. The tool is described as semiautomated because the measured data need to be entered manually, instead of being passed from the building control system automatically. However, the data analysis and visualization are fully automated. The tool is designed to be used by commissioning providers conducting functional tests as part of either new building commissioning or retro-commissioning, as well as building owners and operators interested in conducting routine tests periodically to check the performance of their HVAC systems.

  2. Automated management of radioactive sources in Saudi Arabia

    SciTech Connect (OSTI)

    Al-Kheliewi, Abdullah S.; Jamil, M. F.; Basar, M. R.; Tuwaili, W. R.

    2014-09-30

    For usage of radioactive substances, any facility has to register and take license from relevant authority of the country in which such facility is operating. In the Kingdom of Saudi Arabia (KSA), the authority for managing radioactive sources and providing licenses to organizations for its usage is the National Center of Radiation Protection (NCRP). This paper describes the system that automates registration and licensing process of the National Center of Radiation Protection. To provide 247 accesses to all the customers of NCRP, system is developed as web-based application that provide facility to online register, request license, renew license, check request status, view historical data and reports etc. and other features are provided as Electronic Services that would be accessible to users via internet. The system also was designed to streamline and optimize internal operations of NCRP besides providing ease of access to its customers by implementing a defined workflow through which every registration and license request will be routed. In addition to manual payment option, the system would also be integrated with SADAD (online payment system) that will avoid lengthy and cumbersome procedures associated with manual payment mechanism. Using SADAD payment option license fee could be paid through internet/ATM machine or branch of any designated bank, Payment will be instantly notified to NCRP hence delay in funds transfer and verification of invoice could be avoided, SADAD integration is discussed later in the document.

  3. Intelligent Control in Automation Based on Wireless Traffic Analysis

    SciTech Connect (OSTI)

    Kurt Derr; Milos Manic

    2007-09-01

    Wireless technology is a central component of many factory automation infrastructures in both the commercial and government sectors, providing connectivity among various components in industrial realms (distributed sensors, machines, mobile process controllers). However wireless technologies provide more threats to computer security than wired environments. The advantageous features of Bluetooth technology resulted in Bluetooth units shipments climbing to five million per week at the end of 2005 [1, 2]. This is why the real-time interpretation and understanding of Bluetooth traffic behavior is critical in both maintaining the integrity of computer systems and increasing the efficient use of this technology in control type applications. Although neuro-fuzzy approaches have been applied to wireless 802.11 behavior analysis in the past, a significantly different Bluetooth protocol framework has not been extensively explored using this technology. This paper presents a new neurofuzzy traffic analysis algorithm of this still new territory of Bluetooth traffic. Further enhancements of this algorithm are presented along with the comparison against the traditional, numerical approach. Through test examples, interesting Bluetooth traffic behavior characteristics were captured, and the comparative elegance of this computationally inexpensive approach was demonstrated. This analysis can be used to provide directions for future development and use of this prevailing technology in various control type applications, as well as making the use of it more secure.

  4. Intelligent Control in Automation Based on Wireless Traffic Analysis

    SciTech Connect (OSTI)

    Kurt Derr; Milos Manic

    2007-08-01

    Wireless technology is a central component of many factory automation infrastructures in both the commercial and government sectors, providing connectivity among various components in industrial realms (distributed sensors, machines, mobile process controllers). However wireless technologies provide more threats to computer security than wired environments. The advantageous features of Bluetooth technology resulted in Bluetooth units shipments climbing to five million per week at the end of 2005 [1, 2]. This is why the real-time interpretation and understanding of Bluetooth traffic behavior is critical in both maintaining the integrity of computer systems and increasing the efficient use of this technology in control type applications. Although neuro-fuzzy approaches have been applied to wireless 802.11 behavior analysis in the past, a significantly different Bluetooth protocol framework has not been extensively explored using this technology. This paper presents a new neurofuzzy traffic analysis algorithm of this still new territory of Bluetooth traffic. Further enhancements of this algorithm are presented along with the comparison against the traditional, numerical approach. Through test examples, interesting Bluetooth traffic behavior characteristics were captured, and the comparative elegance of this computationally inexpensive approach was demonstrated. This analysis can be used to provide directions for future development and use of this prevailing technology in various control type applications, as well as making the use of it more secure.

  5. Automated video screening for unattended background monitoring in dynamic environments.

    SciTech Connect (OSTI)

    Carlson, Jeffrey J.

    2004-03-01

    This report addresses the development of automated video-screening technology to assist security forces in protecting our homeland against terrorist threats. A threat of specific interest to this project is the covert placement and subsequent remote detonation of bombs (e.g., briefcase bombs) inside crowded public facilities. Different from existing video motion detection systems, the video-screening technology described in this report is capable of detecting changes in the static background of an otherwise, dynamic environment - environments where motion and human activities are persistent. Our goal was to quickly detect changes in the background - even under conditions when the background is visible to the camera less than 5% of the time. Instead of subtracting the background to detect movement or changes in a scene, we subtracted the dynamic scene variations to produce an estimate of the static background. Subsequent comparisons of static background estimates are used to detect changes in the background. Detected changes can be used to alert security forces of the presence and location of potential threats. The results of this research are summarized in two MS Power-point presentations included with this report.

  6. Defect Prevention and Detection in Software for Automated Test Equipment

    SciTech Connect (OSTI)

    E. Bean

    2006-11-30

    Software for automated test equipment can be tedious and monotonous making it just as error-prone as other software. Active defect prevention and detection are also important for test applications. Incomplete or unclear requirements, a cryptic syntax used for some test applicationsespecially script-based test sets, variability in syntax or structure, and changing requirements are among the problems encountered in one tester. Such problems are common to all software but can be particularly problematic in test equipment software intended to test another product. Each of these issues increases the probability of error injection during test application development. This report describes a test application development tool designed to address these issues and others for a particular piece of test equipment. By addressing these problems in the development environment, the tool has powerful built-in defect prevention and detection capabilities. Regular expressions are widely used in the development tool as a means of formally defining test equipment requirements for the test application and verifying conformance to those requirements. A novel means of using regular expressions to perform range checking was developed. A reduction in rework and increased productivity are the results. These capabilities are described along with lessons learned and their applicability to other test equipment software. The test application development tool, or application builder, is known as the PT3800 AM Creation, Revision and Archiving Tool (PACRAT).

  7. Automated Tracing of Horizontal Neuron Processes During Retinal Development

    SciTech Connect (OSTI)

    Kerekes, Ryan A [ORNL; Martins, Rodrigo [St. Jude Children's Research Hospital; Dyer, Michael A [ORNL; Gleason, Shaun Scott [ORNL; Karakaya, Mahmut [ORNL; Davis, Denise [St. Jude Children's Research Hospital

    2011-01-01

    In the developing mammalian retina, horizontal neurons undergo a dramatic reorganization oftheir processes shortly after they migrate to their appropriate laminar position. This is an importantprocess because it is now understood that the apical processes are important for establishing theregular mosaic of horizontal cells in the retina and proper reorganization during lamination isrequired for synaptogenesis with photoreceptors and bipolar neurons. However, this process isdifficult to study because the analysis of horizontal neuron anatomy is labor intensive and time-consuming. In this paper, we present a computational method for automatically tracing the three-dimensional (3-D) dendritic structure of horizontal retinal neurons in two-photon laser scanningmicroscope (TPLSM) imagery. Our method is based on 3-D skeletonization and is thus able topreserve the complex structure of the dendritic arbor of these cells. We demonstrate theeffectiveness of our approach by comparing our tracing results against two sets of semi-automatedtraces over a set of 10 horizontal neurons ranging in age from P1 to P5. We observe an averageagreement level of 81% between our automated trace and the manual traces. This automatedmethod will serve as an important starting point for further refinement and optimization.

  8. Semi-Automated Discovery of Application Session Structure

    SciTech Connect (OSTI)

    Kannan, J.; Jung, J.; Paxson, V.; Koksal, C.

    2006-09-07

    While the problem of analyzing network traffic at the granularity of individual connections has seen considerable previous work and tool development, understanding traffic at a higher level---the structure of user-initiated sessions comprised of groups of related connections---remains much less explored. Some types of session structure, such as the coupling between an FTP control connection and the data connections it spawns, have prespecified forms, though the specifications do not guarantee how the forms appear in practice. Other types of sessions, such as a user reading email with a browser, only manifest empirically. Still other sessions might exist without us even knowing of their presence, such as a botnet zombie receiving instructions from its master and proceeding in turn to carry them out. We present algorithms rooted in the statistics of Poisson processes that can mine a large corpus of network connection logs to extract the apparent structure of application sessions embedded in the connections. Our methods are semi-automated in that we aim to present an analyst with high-quality information (expressed as regular expressions) reflecting different possible abstractions of an application's session structure. We develop and test our methods using traces from a large Internet site, finding diversity in the number of applications that manifest, their different session structures, and the presence of abnormal behavior. Our work has applications to traffic characterization and monitoring, source models for synthesizing network traffic, and anomaly detection.

  9. Operations of the Automated Radioxenon Sampler/Analyzer - ARSA

    SciTech Connect (OSTI)

    Hayes, James C.; Abel, Keith H.; Bowyer, Ted W.; Heimbigner, Tom R.; Panisko, Mark E.; Reeder, Paul L.; McIntyre, Justin I.; Thompson, Robert C.; Todd, Lindsay C.; Warner, Ray A.

    1999-09-01

    The Automated Radioxenon Sampler/ Analyzer (ARSA), designed and built by Pacific Northwest National Laboratory (PNNL), for the Department of Energy, has exceeded measurement requirements for noble gas measurement systems established by the Comprehensive Nuclear-Test-Ban Treaty. Two units, one at PNNL and a second, sent to DME Corp. of Florida, were built and extensively tested. Both systems have successfully demonstrated stable xenon yields greater than 1.5 cm3 for an eight-hour collection period, corresponding to minimum detectable concentrations for 133Xe on the order of 0.1 mBq/m3 three times per day. High stable xenon yields are critical in obtaining these low minimum detectable concentrations. A history of testing and results that led to the high xenon yields of the ARSA system is presented. A compilation of field tests, laboratory tests and baseline tests that led to cost reduction, power savings and size reduction of the ARSA are also discussed. Lastly, the type of data generated from the ARSA of interest to data center personnel are discussed.

  10. PaR-PaR Laboratory Automation Platform

    SciTech Connect (OSTI)

    Linshiz, G; Stawski, N; Poust, S; Bi, CH; Keasling, JD; Hilson, NJ

    2013-05-01

    Labor-intensive multistep biological tasks, such as the construction and cloning of DNA molecules, are prime candidates for laboratory automation. Flexible and biology-friendly operation of robotic equipment is key to its successful integration in biological laboratories, and the efforts required to operate a robot must be much smaller than the alternative manual lab work. To achieve these goals, a simple high-level biology-friendly robot programming language is needed. We have developed and experimentally validated such a language: Programming a Robot (PaR-PaR). The syntax and compiler for the language are based on computer science principles and a deep understanding of biological workflows. PaR-PaR allows researchers to use liquid-handling robots effectively, enabling experiments that would not have been considered previously. After minimal training, a biologist can independently write complicated protocols for a robot within an hour. Adoption of PaR-PaR as a standard cross-platform language would enable hand-written or software-generated robotic protocols to be shared across laboratories.

  11. Automated genome mining of ribosomal peptide natural products

    SciTech Connect (OSTI)

    Mohimani, Hosein; Kersten, Roland; Liu, Wei; Wang, Mingxun; Purvine, Samuel O.; Wu, Si; Brewer, Heather M.; Pasa-Tolic, Ljiljana; Bandeira, Nuno; Moore, Bradley S.; Pevzner, Pavel A.; Dorrestein, Pieter C.

    2014-07-31

    Ribosomally synthesized and posttranslationally modified peptides (RiPPs), especially from microbial sources, are a large group of bioactive natural products that are a promising source of new (bio)chemistry and bioactivity (1). In light of exponentially increasing microbial genome databases and improved mass spectrometry (MS)-based metabolomic platforms, there is a need for computational tools that connect natural product genotypes predicted from microbial genome sequences with their corresponding chemotypes from metabolomic datasets. Here, we introduce RiPPquest, a tandem mass spectrometry database search tool for identification of microbial RiPPs and apply it for lanthipeptide discovery. RiPPquest uses genomics to limit search space to the vicinity of RiPP biosynthetic genes and proteomics to analyze extensive peptide modifications and compute p-values of peptide-spectrum matches (PSMs). We highlight RiPPquest by connection of multiple RiPPs from extracts of Streptomyces to their gene clusters and by the discovery of a new class III lanthipeptide, informatipeptin, from Streptomyces viridochromogenes DSM 40736 as the first natural product to be identified in an automated fashion by genome mining. The presented tool is available at cy-clo.ucsd.edu.

  12. Automated-In-Motion Vehicle Evaluation Environment (AIMVEE)

    Energy Science and Technology Software Center (OSTI)

    2006-05-04

    The AIMVEE/WIM system electronically retrieves deployment information, identifies vehicle automatically, and determines total weight, individual wheel weight, individual axle weights, axle spacing, and center-of-balance for any wheeled vehicle in motion. The AIMVEE/WIM system can also perform these functions statically for both wheel vehicles and cargo with information. The AIMVEE/WIM system incorporates digital images and applies cubing algorithms to determine length, width, height for cubic dimensions of both vehicle and cargo. Once all this information ismore » stored, it electronically links to data collection and dissemination systems to provide “actual” weight and measurement information for planning, deployment, and in-transit visibility. The Static Scale Conversion (SSC) system is an unique enhancement to the AIMVEE/WIM system. It enables a SSC to weigh and measure vehicles and cargo dynamically (i.e., as they pass over the large scale and is included in the AIMVEE computer code base. The material to be copyrighted is the Automated-In-Motion Vehicle Evaluation Environment (AIMVEE)/Weigh-In-Motion User Training and Testing material. It includes instructional material in the set-up, operation and tear-down of the AIMVEE/WIM system. It also includes a final exam associated with the training.« less

  13. Pilot-plant automation for catalytic hydrotreating of heavy residua

    SciTech Connect (OSTI)

    Akimoto, O.; Iwamoto, Y.; Kodama, S.; Takeuchi, C.

    1983-08-01

    The research and development center of Chiyoda Chemical Engineering and Construction Co. has been investigating the catalytic hydrotreating of heavy residua via pilot plant technology. Chiyoda's 52 microreactors. bench-scale test units and pilot plants are each used depending on the purpose of the process development for heavy oil upgrading. The microreactors are effective for catalyst screening. Heavier fractions such as asphaltene and sludge materials often disturbed steady state operation. Many unique devices for the test units and improvement of operation procedures make extended operation easy as well as increasing reliability. The computerized data acquisition and data filing systems minimize the work not only for operators but for all research personnel. Currently, about 40 pilot plant units are continuously running while the others are in preparation. Fully automated operation requires only three for data checking at night. In the daytime, seven operators take care of feed supply, product removal and condition changes. For start-up and shut-down, one operator can handle three microreactos, but only one bench-scale unit or pilot plant. Planning is underway for an improved start-up system for the pilot plants using personal computers. This system automatically sets feed rate and raises reactor temperature. (JMT)

  14. Pilot-plant automation for catalytic hydrotreating of heavy residua

    SciTech Connect (OSTI)

    Akimoto, O.; Iwamoto, Y.; Kodama, S.; Takeuchi, C.

    1983-08-01

    Chiyoda's 52 microreactors, bench-scale test units and pilot plants are each used depending on the purpose of the process development for heavy oil upgrading. The microreactors are effective for catalyst screening. Heavier fractions such as asphaltene and sludge materials often disturbed steady state operation. Many unique devices for the test units and improvement of operation procedures make extended operation easy as well as increasing reliability. The computerized data acquisition and data filing systems minimize the work not only for operators but for all research personnel. Currently, about 40 pilot plant units are continuously running while the others are in preparation. Fully automated operation requires only three for data checking at night. In the daytime, seven operators take care of feed supply, product removal and condition changes. For start-up and shut-down, one operator can handle three microreactors, but only one bench-scale unit or pilot plant. Planning is underway for an improved start-up system for the pilot plants using personal computers. This system automatically sets feed rate and raises reactor temperature.

  15. Assessment Study on Sensors and Automation in the Industries of the Future. Reports on Industrial Controls, Information Processing, Automation, and Robotics

    SciTech Connect (OSTI)

    Bennett, Bonnie; Boddy, Mark; Doyle, Frank; Jamshidi, Mo; Ogunnaike, Tunde

    2004-11-01

    This report presents the results of an expert study to identify research opportunities for Sensors & Automation, a sub-program of the U.S. Department of Energy (DOE) Industrial Technologies Program (ITP). The research opportunities are prioritized by realizable energy savings. The study encompasses the technology areas of industrial controls, information processing, automation, and robotics. These areas have been central areas of focus of many Industries of the Future (IOF) technology roadmaps. This report identifies opportunities for energy savings as a direct result of advances in these areas and also recognizes indirect means of achieving energy savings, such as product quality improvement, productivity improvement, and reduction of recycle.

  16. Small- and Medium-Size Building Automation and Control System Needs:

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Scoping Study | Department of Energy Small- and Medium-Size Building Automation and Control System Needs: Scoping Study Small- and Medium-Size Building Automation and Control System Needs: Scoping Study Emerging Technologies Project for the 2013 Building Technologies Office's Program Peer Review PDF icon emrgtech05_brambley_040213.pdf More Documents & Publications Advanced Building Control Solutions PNNL: VOLTTRON Commercialization (CBI/ET Open Call) - 2015 Peer Review U.S. Industrial

  17. Automated Eukaryotic Gene Structure Annotation Using EVidenceModeler and the Program to Assemble Spliced Alignments

    SciTech Connect (OSTI)

    Haas, B J; Salzberg, S L; Zhu, W; Pertea, M; Allen, J E; Orvis, J; White, O; Buell, C R; Wortman, J R

    2007-12-10

    EVidenceModeler (EVM) is presented as an automated eukaryotic gene structure annotation tool that reports eukaryotic gene structures as a weighted consensus of all available evidence. EVM, when combined with the Program to Assemble Spliced Alignments (PASA), yields a comprehensive, configurable annotation system that predicts protein-coding genes and alternatively spliced isoforms. Our experiments on both rice and human genome sequences demonstrate that EVM produces automated gene structure annotation approaching the quality of manual curation.

  18. A Standard Analysis Method (SAM) for the automated analysis of polychlorinated biphenyls (PCBs) in soils using the chemical analysis automation (CAA) paradigm: Validation and performance

    SciTech Connect (OSTI)

    Rzeszutko, C.; Johnson, C.R.; Monagle, M.; Klatt, L.N.

    1997-11-01

    The Chemical Analysis Automation (CAA) program is developing a standardized modular automation strategy for chemical analysis. In this automation concept, analytical chemistry is performed with modular building blocks that correspond to individual elements of the steps in the analytical process. With a standardized set of behaviors and interactions, these blocks can be assembled in a plug-and-play manner into a complete analysis system. These building blocks, which are referred to as Standard laboratory Modules (SLM), interface to a host control system that orchestrates the entire analytical process, from sample preparation through data interpretation. The integrated system is called a Standard Analysis Method (SAM). A SAM for the automated determination of polychlorinated biphenyls (PCBs) in soils, assembled in a mobile laboratory, is undergoing extensive testing and validation. The SAM consists of the following SLMs: a four-channel Soxhlet extractor, a high-volume concentration, a column clean-up, a gas chromatography, a PCB data-interpretation module, a robot, and a human-computer interface. The SAM is configured to meet the requirements specified in the US Environmental Protection Agency`s (EPA) SW-846 methods 3541/3620A/8082 for the analysis of PCBs in soils. The PCB SAM will be described along with the developmental test plan. Performance data obtained during developmental testing will also be discussed.

  19. A standard analysis method (SAM) for the automated analysis of polychlorinated biphenyls (PCBs) in soils using the chemical analysis automation (CAA) paradigm: validation and performance

    SciTech Connect (OSTI)

    Rzeszutko, C.; Johnson, C.R.; Monagle, M.; Klatt, L.N.

    1997-10-01

    The Chemical Analysis Automation (CAA) program is developing a standardized modular automation strategy for chemical analysis. In this automation concept, analytical chemistry is performed with modular building blocks that correspond to individual elements of the steps in the analytical process. With a standardized set of behaviors and interactions, these blocks can be assembled in a `plug and play` manner into a complete analysis system. These building blocks, which are referred to as Standard Laboratory Modules (SLM), interface to a host control system that orchestrates the entire analytical process, from sample preparation through data interpretation. The integrated system is called a Standard Analysis Method (SAME). A SAME for the automated determination of Polychlorinated Biphenyls (PCB) in soils, assembled in a mobile laboratory, is undergoing extensive testing and validation. The SAME consists of the following SLMs: a four channel Soxhlet extractor, a High Volume Concentrator, column clean up, a gas chromatograph, a PCB data interpretation module, a robot, and a human- computer interface. The SAME is configured to meet the requirements specified in U.S. Environmental Protection Agency`s (EPA) SW-846 Methods 3541/3620A/8082 for the analysis of pcbs in soils. The PCB SAME will be described along with the developmental test plan. Performance data obtained during developmental testing will also be discussed.

  20. Automated matching and segmentation of lymphoma on serial CT examinations

    SciTech Connect (OSTI)

    Yan Jiayong; Zhao Binsheng; Curran, Sean; Zelenetz, Andrew; Schwartz, Lawrence H.

    2007-01-15

    In patients with lymphoma, identification and quantification of the tumor extent on serial CT examinations is critical for assessing tumor response to therapy. In this paper, we present a computer method to automatically match and segment lymphomas in follow-up CT images. The method requires that target lymph nodes in baseline CT images be known. A fast, approximate alignment technique along the x, y, and axial directions is developed to provide a good initial condition for the subsequent fast free form deformation (FFD) registration of the baseline and the follow-up images. As a result of the registration, the deformed lymph node contours from the baseline images are used to automatically determine internal and external markers for the marker-controlled watershed segmentation performed in the follow-up images. We applied this automated registration and segmentation method retrospectively to 29 lymph nodes in 9 lymphoma patients treated in a clinical trial at our cancer center. A radiologist independently delineated all lymph nodes on all slices in the follow-up images and his manual contours served as the ''gold standard'' for evaluation of the method. Preliminary results showed that 26/29 (89.7%) lymph nodes were correctly matched; i.e., there was a geometrical overlap between the deformed lymph node from the baseline and its corresponding mass in the follow-up images. Of the matched 26 lymph nodes, 22 (84.6%) were successfully segmented; for these 22 lymph nodes, several metrics were calculated to quantify the method's performance. Among them, the average distance and the Hausdorff distance between the contours generated by the computer and those generated by the radiologist were 0.9 mm (stdev. 0.4 mm) and 3.9 mm (stdev. 2.1 mm), respectively.

  1. Grid collector: An event catalog with automated file management

    SciTech Connect (OSTI)

    Wu, Kesheng; Zhang, Wei-Ming; Sim, Alexander; Gu, Junmin; Shoshani, Arie

    2003-10-17

    High Energy Nuclear Physics (HENP) experiments such as STAR at BNL and ATLAS at CERN produce large amounts of data that are stored as files on mass storage systems in computer centers. In these files, the basic unit of data is an event. Analysis is typically performed on a selected set of events. The files containing these events have to be located, copied from mass storage systems to disks before analysis, and removed when no longer needed. These file management tasks are tedious and time consuming. Typically, all events contained in the files are read into memory before a selection is made. Since the time to read the events dominate the overall execution time, reading the unwanted event needlessly increases the analysis time. The Grid Collector is a set of software modules that works together to address these two issues. It automates the file management tasks and provides ''direct'' access to the selected events for analyses. It is currently integrated with the STAR analysis framework. The users can select events based on tags, such as, ''production date between March 10 and 20, and the number of charged tracks > 100.'' The Grid Collector locates the files containing relevant events, transfers the files across the Grid if necessary, and delivers the events to the analysis code through the familiar iterators. There has been some research efforts to address the file management issues, the Grid Collector is unique in that it addresses the event access issue together with the file management issues. This makes it more useful to a large variety of users.

  2. Development of Automated Production Line Processes for Solar Brightfield Modules: Final Report, 1 June 2003-30 November 2007

    SciTech Connect (OSTI)

    Nowlan, M.

    2008-04-01

    Summary of progress by Spire Corporation under NREL's PV Manufacturing R&D Project to develop new automated systems for fabricating very large photovoltaic modules.

  3. WORKSHEET AND RESPONDENT QUESTIONS

    Gasoline and Diesel Fuel Update (EIA)

    ... Answer0 E36 Are these mainly inkjet or laser printers? If Activity (B2)Retail, Food sales, or Food service PRNTYP8 E36 1. Inkje 2. Laser 3. ** IF VOLUNTEERED ** 4. ** IF ...

  4. Building public trust: Actions to respond to the report of the Advisory Committee on human radiation experiments

    SciTech Connect (OSTI)

    1997-03-01

    Democratic government requires trust: people need to know and believe that the government is telling the truth. Without information about what the government is doing and why, citizens cannot exercise democratic control over government institutions. During his first year in office, President Clinton became concerned about reports that the government had conducted unethical secret human radiation experiments during the Cold War. To address this issue, in January 1994, President Clinton established the Advisory Committee on Human Radiation Experiments (ACHRE), chaired by bioethicist Dr. Ruth Faden of Johns Hopkins University. The President also directed all Federal agencies to search for records related to human subjects radiation research and provide them to the Advisory Committee. This report presents the Administration`s actions to respond to the ACHRE`s findings and recommendations.

  5. Drivers` activities and information needs in an automated highway system. Working paper, August 1995-May 1996

    SciTech Connect (OSTI)

    Levitan, L.; Bloomfield, J.

    1996-10-01

    In most visions of the AHS--including that of the National Automated Highway System Consortium--it has been assumed that when a vehicle was under automated control, the driver would be allowed to engage in any of a variety of activities not related to driving (e.g, working, reading, sleeping). The objective of the first study reported here--one of the noncommuter studies--was to determine what drivers do when traveling under automated control, and whether the age of and/gender or the driver and/or the intrastring gap have an influence on those activities. One the objectives of the commuter experiment--of relevance for this report--was to determine whether what drivers do when traveling under automated control changes as a function of experience with the AHS (i.e., across trials). As conceptualization of the AHS proceeds, the details of the interface between the driver and the in-vehicle system will become more important. One part of that interface will be information supplied by the AHS to the driver, perhaps about such things as traffic conditions ahead predicted trip time to the driver`s selected exit, and so on. To maximize the utility of that information, it is important to determine what it is that drivers would like to know when traveling under automated control. The objective of the third study reported here--the second of the five noncommuter experiments--was to provide a first investigation of that issue.

  6. Automation of MCDOR at NMT-3 Los Alamos National Laboratory. Final report

    SciTech Connect (OSTI)

    Shahinpoor, M.

    1997-01-01

    The automation of various parts of multiple--cycle direct oxide reduction (MCDOR) at LANL`s NMT-3 was the goal of this research and development activities. In particular, originally the following goals were assigned to the author by the NMT-3 technical staff leaders (Greg Bird, Jim McNeese, Joel Williams): (1) Design and fabricate an automation set up; (2) Step-wise automation is preferred; (3) Step 1 involves automatic metering and mixing of powders; and (4) Step 2-automatic transport of powder to furnace location The initial task assigned in May 91 was to get the appropriate design developed and order equipment and parts to automatically weight powders. In fact the work statement read {open_quotes}Create an experimental automation set up in the ME Department at UNM to automatically weigh powders using an electronic balance. Further, design the set up such that the electronic balance is reprogrammable for specific weight set points. Thus, when a set point in weight is reached by means of a vibratory feeder feeding a container on the balance, the electronic balance will send an electronic signal out to switch off the vibratory feeder{close_quotes}. The automation of the reduction of plutonium oxide to plutonium is described.

  7. CRDIAC: Coupled Reactor Depletion Instrument with Automated Control

    SciTech Connect (OSTI)

    Steven K. Logan

    2012-08-01

    When modeling the behavior of a nuclear reactor over time, it is important to understand how the isotopes in the reactor will change, or transmute, over that time. This is especially important in the reactor fuel itself. Many nuclear physics modeling codes model how particles interact in the system, but do not model this over time. Thus, another code is used in conjunction with the nuclear physics code to accomplish this. In our code, Monte Carlo N-Particle (MCNP) codes and the Multi Reactor Transmutation Analysis Utility (MRTAU) were chosen as the codes to use. In this way, MCNP would produce the reaction rates in the different isotopes present and MRTAU would use cross sections generated from these reaction rates to determine how the mass of each isotope is lost or gained. Between these two codes, the information must be altered and edited for use. For this, a Python 2.7 script was developed to aid the user in getting the information in the correct forms. This newly developed methodology was called the Coupled Reactor Depletion Instrument with Automated Controls (CRDIAC). As is the case in any newly developed methodology for modeling of physical phenomena, CRDIAC needed to be verified against similar methodology and validated against data taken from an experiment, in our case AFIP-3. AFIP-3 was a reduced enrichment plate type fuel tested in the ATR. We verified our methodology against the MCNP Coupled with ORIGEN2 (MCWO) method and validated our work against the Post Irradiation Examination (PIE) data. When compared to MCWO, the difference in concentration of U-235 throughout Cycle 144A was about 1%. When compared to the PIE data, the average bias for end of life U-235 concentration was about 2%. These results from CRDIAC therefore agree with the MCWO and PIE data, validating and verifying CRDIAC. CRDIAC provides an alternative to using ORIGEN-based methodology, which is useful because CRDIAC's depletion code, MRTAU, uses every available isotope in its depletion, unlike ORIGEN, which only depletes the isotopes specified by the user. This means that depletions done by MRTAU more accurately reflect reality. MRTAU also allows the user to build new isotope data sets, which means any isotope with nuclear data could be depleted, something that would help predict the outcomes of nuclear reaction testing in materials other than fuel, like beryllium or gold.

  8. Development of an Automated Security Risk Assessment Methodology Tool for Critical Infrastructures.

    SciTech Connect (OSTI)

    Jaeger, Calvin D.; Roehrig, Nathaniel S.; Torres, Teresa M.

    2008-12-01

    This document presents the security automated Risk Assessment Methodology (RAM) prototype tool developed by Sandia National Laboratories (SNL). This work leverages SNL's capabilities and skills in security risk analysis and the development of vulnerability assessment/risk assessment methodologies to develop an automated prototype security RAM tool for critical infrastructures (RAM-CITM). The prototype automated RAM tool provides a user-friendly, systematic, and comprehensive risk-based tool to assist CI sector and security professionals in assessing and managing security risk from malevolent threats. The current tool is structured on the basic RAM framework developed by SNL. It is envisioned that this prototype tool will be adapted to meet the requirements of different CI sectors and thereby provide additional capabilities.

  9. Scalable Distributed Automation System: Scalable Real-time Decentralized Volt/VAR Control

    SciTech Connect (OSTI)

    2012-03-01

    GENI Project: Caltech is developing a distributed automation system that allows distributed generators—solar panels, wind farms, thermal co-generation systems—to effectively manage their own power. To date, the main stumbling block for distributed automation systems has been the inability to develop software that can handle more than 100,000 distributed generators and be implemented in real time. Caltech’s software could allow millions of generators to self-manage through local sensing, computation, and communication. Taken together, localized algorithms can support certain global objectives, such as maintaining the balance of energy supply and demand, regulating voltage and frequency, and minimizing cost. An automated, grid-wide power control system would ease the integration of renewable energy sources like solar power into the grid by quickly transmitting power when it is created, eliminating the energy loss associated with the lack of renewable energy storage capacity of the grid.

  10. Modeling the Energy Use of a Connected and Automated Transportation System (Poster)

    SciTech Connect (OSTI)

    Gonder, J.; Brown, A.

    2014-07-01

    Early research points to large potential impacts of connected and automated vehicles (CAVs) on transportation energy use - dramatic savings, increased use, or anything in between. Due to a lack of suitable data and integrated modeling tools to explore these complex future systems, analyses to date have relied on simple combinations of isolated effects. This poster proposes a framework for modeling the potential energy implications from increasing penetration of CAV technologies and for assessing technology and policy options to steer them toward favorable energy outcomes. Current CAV modeling challenges include estimating behavior change, understanding potential vehicle-to-vehicle interactions, and assessing traffic flow and vehicle use under different automation scenarios. To bridge these gaps and develop a picture of potential future automated systems, NREL is integrating existing modeling capabilities with additional tools and data inputs to create a more fully integrated CAV assessment toolkit.

  11. Automated work packages architecture: An initial set of human factors and instrumentation and controls requirements

    SciTech Connect (OSTI)

    Agarwal, Vivek; Oxstrand, Johanna H.; Le Blanc, Katya L.

    2014-09-01

    The work management process in current fleets of national nuclear power plants is so highly dependent on large technical staffs and quality of work instruction, i.e., paper-based, that this puts nuclear energy at somewhat of a long-term economic disadvantage and increase the possibility of human errors. Technologies like mobile portable devices and computer-based procedures can play a key role in improving the plant work management process, thereby increasing productivity and decreasing cost. Automated work packages are a fundamentally an enabling technology for improving worker productivity and human performance in nuclear power plants work activities because virtually every plant work activity is accomplished using some form of a work package. As part of this year’s research effort, automated work packages architecture is identified and an initial set of requirements identified, that are essential and necessary for implementation of automated work packages in nuclear power plants.

  12. Automated Commissioning for Lower-cost, Widely Deployed Building Commissioning of the Future

    SciTech Connect (OSTI)

    Brambley, Michael R.; Katipamula, Srinivas

    2011-08-16

    This chapter takes a brief look at the benefits of commissioning and describes a vision of the future where most of the objectives of commissioning will be accomplished automatically by capabilities built into the building systems themselves. Commissioning will become an activity that is performed continuously rather than periodically, and only repairs requiring replacement or overhaul of equipment will require manual intervention. This chapter then identifies some of the technologies that will be needed to realize this vision and ends with a call for all involved in the enterprise of building commissioning and automation to embrace and dedicate themselves to a future of automated commissioning.

  13. Integrated automation of the New Waddell Dam performance data acquisition system

    SciTech Connect (OSTI)

    Welch, L.R.; Fields, P.E.

    1999-07-01

    New Waddell Dam, a key feature of the US Bureau of Reclamation's Central Arizona Project, had elements of its dam safety data acquisition system incorporated into the design and construction. The instrumentation array is a reflection of the dam's large size and foundation complexity. Much of the instrumentation is automated. This automation was accomplished while maintaining independent communication connections to major divisions of the instrument array. Fiber optic cables are used to provide high Quality data, free from voltage surges that could originate in a nearby powerplant switchyard or from lightning. The system has been working well but there are concerns with a lack of continued equipment manufacturer support.

  14. Distributed Microprocessor Automation Network for Synthesizing Radiotracers Used in Positron Emission Tomography [PET

    DOE R&D Accomplishments [OSTI]

    Russell, J. A. G.; Alexoff, D. L.; Wolf, A. P.

    1984-09-01

    This presentation describes an evolving distributed microprocessor network for automating the routine production synthesis of radiotracers used in Positron Emission Tomography. We first present a brief overview of the PET method for measuring biological function, and then outline the general procedure for producing a radiotracer. The paper identifies several reasons for our automating the syntheses of these compounds. There is a description of the distributed microprocessor network architecture chosen and the rationale for that choice. Finally, we speculate about how this network may be exploited to extend the power of the PET method from the large university or National Laboratory to the biomedical research and clinical community at large. (DT)

  15. An Automated Implementation of On-shell Methods for One-Loop Amplitudes

    Office of Scientific and Technical Information (OSTI)

    (Journal Article) | SciTech Connect Journal Article: An Automated Implementation of On-shell Methods for One-Loop Amplitudes Citation Details In-Document Search Title: An Automated Implementation of On-shell Methods for One-Loop Amplitudes Authors: Berger, C.F. ; Bern, Z. ; Dixon, L.J. ; Febres Cordero, F. ; Forde, D. ; Ita, H. ; Kosower, D.A. ; Maitre, D. ; /MIT, LNS /Santa Barbara, KITP /SLAC /UCLA /Saclay Publication Date: 2008-04-11 OSTI Identifier: 927069 Report Number(s):

  16. The Stanford Automated Mounter: Pushing the limits of sample exchange at the SSRL macromolecular crystallography beamlines

    DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

    Russi, Silvia; Song, Jinhu; McPhillips, Scott E.; Cohen, Aina E.

    2016-02-24

    The Stanford Automated Mounter System, a system for mounting and dismounting cryo-cooled crystals, has been upgraded to increase the throughput of samples on the macromolecular crystallography beamlines at the Stanford Synchrotron Radiation Lightsource. This upgrade speeds up robot maneuvers, reduces the heating/drying cycles, pre-fetches samples and adds an air-knife to remove frost from the gripper arms. As a result, sample pin exchange during automated crystal quality screening now takes about 25 s, five times faster than before this upgrade.

  17. Automation of the New Brunswick Laboratory controlled-potential coulometric method for plutonium

    SciTech Connect (OSTI)

    Mitchell, W.G.; Troutman, D.; Lewis, K.

    1988-11-01

    The development and evolution of the automated coulometric analysis of plutonium at the New Brunswick Laboratory is described. The importance of maintaining electrical calibration of the analysis so that the results are traceable to the Faraday is discussed. The innovations which were necessary to achieve the desired accuracy and precision are explained. The experimental tests to qualify the instruments for use in sample analysis at New Brunswick Laboratory are detailed. Details of the calculations performed by the automated coulometer system are given in the Appendix. 21 refs., 16 figs., 4 tabs.

  18. Y-12 Plant decontamination and decommissioning Technology Logic Diagram for Building 9201-4: Volume 3, Technology evaluation data sheets: Part B, Decontamination; robotics/automation; waste management

    SciTech Connect (OSTI)

    1994-09-01

    This volume consists of the Technology Logic Diagrams (TLDs) for the decontamination, robotics/automation, and waste management areas.

  19. NREL Research and Thoughts on Connected and Automated Vehicle Energy Impacts; NREL (National Renewable Energy Laboratory)

    SciTech Connect (OSTI)

    Gonder, Jeff; Wood, Eric; Lammert, Michael

    2014-12-09

    Jeff was invited to brief the EPA Mobile Sources Technical Review Subcommittee on considerations regarding potential energy and environmental considerations for connected and automated vehicles. For more information about the MSTRS see http://www2.epa.gov/caaac/mobile-sources-technical-review-subcommittee-mstrs-caaac.

  20. Development and evaluation of an automated reflectance microscope system for the petrographic characterization of bituminous coals

    SciTech Connect (OSTI)

    Hoover, D. S.; Davis, A.

    1980-10-01

    The development of automated coal petrographic techniques will lessen the demands on skilled personnel to do routine work. This project is concerned with the development and successful testing of an instrument which will meet these needs. The fundamental differences in reflectance of the three primary maceral groups should enable their differentiation in an automated-reflectance frequency histogram (reflectogram). Consequently, reflected light photometry was chosen as the method for automating coal petrographic analysis. Three generations of an automated system (called Rapid Scan Versions I, II and III) were developed and evaluated for petrographic analysis. Their basic design was that of a reflected-light microscope photometer with an automatic stage, interfaced with a minicomputer. The hardware elements used in the Rapid Scan Version I limited the system's flexibility and presented problems with signal digitization and measurement precision. Rapid Scan Version II was designed to incorporate a new microscope photometer and computer system. A digital stepping stage was incorporated into the Rapid Scan Version III system. The precision of reflectance determination of this system was found to be +- 0.02 percent reflectance. The limiting factor in quantitative interpretation of Rapid Scan reflectograms is the resolution of reflectance populations of the individual maceral groups. Statistical testing indicated that reflectograms were highly reproducible, and a new computer program, PETAN, was written to interpret the curves for vitrinite reflectance parameters ad petrographic.

  1. ProDeGe: A Computational Protocol for fully Automated Decontamination of Genomic Data

    Energy Science and Technology Software Center (OSTI)

    2015-12-01

    The Single Cell Data Decontamination Pipeline is a fully-automated software tool which classifies unscreened contigs from single cell datasets through a combination of homology and feature-based methodologies using the organism's nucleotide sequences and known NCBI taxonomony. The software is freely available to download and install, and can be run on any system.

  2. Nondestructive and automated testing for soil and rock properties. ASTM special technical publication 1350

    SciTech Connect (OSTI)

    Marr, W.A.; Fairhurst, C.E.

    1999-07-01

    The purpose of the symposium was to highlight recent developments in nondestructive and automated testing for soil and rock properties. Speakers present results of recent research in these areas that have practical application for the rapid and economical testing of soil and rock. Authors were encouraged to identify which testing equipment and methods have sufficient practical application to warrant standards development.

  3. Opportunities for Energy Efficiency and Automated Demand Response in Industrial Refrigerated Warehouses in California

    SciTech Connect (OSTI)

    Lekov, Alex; Thompson, Lisa; McKane, Aimee; Rockoff, Alexandra; Piette, Mary Ann

    2009-05-11

    This report summarizes the Lawrence Berkeley National Laboratory's research to date in characterizing energy efficiency and open automated demand response opportunities for industrial refrigerated warehouses in California. The report describes refrigerated warehouses characteristics, energy use and demand, and control systems. It also discusses energy efficiency and open automated demand response opportunities and provides analysis results from three demand response studies. In addition, several energy efficiency, load management, and demand response case studies are provided for refrigerated warehouses. This study shows that refrigerated warehouses can be excellent candidates for open automated demand response and that facilities which have implemented energy efficiency measures and have centralized control systems are well-suited to shift or shed electrical loads in response to financial incentives, utility bill savings, and/or opportunities to enhance reliability of service. Control technologies installed for energy efficiency and load management purposes can often be adapted for open automated demand response (OpenADR) at little additional cost. These improved controls may prepare facilities to be more receptive to OpenADR due to both increased confidence in the opportunities for controlling energy cost/use and access to the real-time data.

  4. Function allocation for humans and automation in the context of team dynamics

    SciTech Connect (OSTI)

    Jeffrey C. Joe; John O'Hara; Jacques Hugo; Johanna Oxstrand

    2015-07-01

    Within Human Factors Engineering, a decision-making process called function allocation (FA) is used during the design life cycle of complex systems to distribute the system functions, often identified through a functional requirements analysis, to all human and automated machine agents (or teammates) involved in controlling the system. Most FA methods make allocation decisions primarily by comparing the capabilities of humans and automation, but then also by considering secondary factors such as cost, regulations, and the health and safety of workers. The primary analysis of the strengths and weaknesses of humans and machines, however, is almost always considered in terms of individual human or machine capabilities. Yet, FA is fundamentally about teamwork in that the goal of the FA decision-making process is to determine what are the optimal allocations of functions among agents. Given this framing of FA, and the increasing use of and sophistication of automation, there are two related social psychological issues that current FA methods need to address more thoroughly. First, many principles for effective human teamwork are not considered as central decision points or in the iterative hypothesis and testing phase in most FA methods, when it is clear that social factors have numerous positive and negative effects on individual and team capabilities. Second, social psychological factors affecting team performance and can be difficult to translate to automated agents, and most FA methods currently do not account for this effect. The implications for these issues are discussed.

  5. Automated Energy Distribution and Reliability System: Validation Integration - Results of Future Architecture Implementation

    SciTech Connect (OSTI)

    Buche, D. L.

    2008-06-01

    This report describes Northern Indiana Public Service Co. project efforts to develop an automated energy distribution and reliability system. The purpose of this project was to implement a database-driven GIS solution that would manage all of the company's gas, electric, and landbase objects. This report is second in a series of reports detailing this effort.

  6. A Test Control Languate for a Computer-automated Battery Testing Lab

    Energy Science and Technology Software Center (OSTI)

    2006-02-08

    A test control language was developed for a compute automated battery testing laboratory to permit an operator to construct testing scripts to define an arbitrary battery test regime. The statements defined by the language are tested for syntax and control block structures are produced by a compiler for downloading into data acquisition computers.

  7. Manual of Security Requirements for the Classified Automated Information System Security Program

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    1994-07-15

    This Manual provides specific instructions and delineates the requirements to ensure the graded security of classified information entrusted to the Department of Energy (DOE) that is processed, stored, transferred, or accessed on Automated Information Systems (AISs) and AIS networks. Canceled by DOE M 471.2-2.

  8. Bromocriptine increased operant responding for high fat food but decreased chow intake in both obesity-prone and resistant rats

    SciTech Connect (OSTI)

    Thanos, P.K.; Wang, G.; Thanos, P.K.; Cho, J. Kim, R.; Michaelides, M.; Primeaux, S.; Bray, G.; Wang, G.-J.; Volkow, N.D.

    2010-10-27

    Dopamine (DA) and DAD{sub 2} receptors (D2R) have been implicated in obesity and are thought to be involved in the rewarding properties of food. Osborne-Mendel (OM) rats are susceptible to diet induced obesity (DIO) while S5B/P (S5B) rats are resistant when given a high-fat diet. Here we hypothesized that the two strains would differ in high-fat food self-administration (FSA) and that the D2R agonist bromocriptine (BC) would differently affect their behavior. Ad-libitum fed OM and S5B/P rats were tested in a FSA operant chamber and were trained to lever press for high-fat food pellets under a fixed-ratio (FR1) and a progressive ratio (PR) schedule. After sixteen days of PR sessions, rats were treated with three different doses of BC (1, 10 and 20 mg/kg). No significant differences were found between the two strains in the number of active lever presses. BC treatment (10 mg/kg and 20 mg/kg) increased the number of active lever presses (10 mg/kg having the strongest effect) whereas it decreased rat chow intake in the home cage with equivalent effects in both strains. These effects were not observed on the day of BC administration but on the day following its administration. Our results suggest that these two strains have similar motivation for procuring high fat food using this paradigm. BC increased operant responding for high-fat pellets but decreased chow intake in both strains, suggesting that D2R stimulation may have enhanced the motivational drive to procure the fatty food while correspondingly decreasing the intake of regular food. These findings suggest that susceptibility to dietary obesity (prior to the onset of obesity) may not affect operant motivation for a palatable high fat food and that differential susceptibility to obesity may be related to differential sensitivity to D2R stimulation.

  9. Application of bar codes to the automation of analytical sample data collection

    SciTech Connect (OSTI)

    Jurgensen, H A

    1986-01-01

    The Health Protection Department at the Savannah River Plant collects 500 urine samples per day for tritium analyses. Prior to automation, all sample information was compiled manually. Bar code technology was chosen for automating this program because it provides a more accurate, efficient, and inexpensive method for data entry. The system has three major functions: sample labeling is accomplished at remote bar code label stations composed of an Intermec 8220 (Intermec Corp.) interfaced to an IBM-PC, data collection is done on a central VAX 11/730 (Digital Equipment Corp.). Bar code readers are used to log-in samples to be analyzed on liquid scintillation counters. The VAX 11/730 processes the data and generates reports, data storage is on the VAX 11/730 and backed up on the plant's central computer. A brief description of several other bar code applications at the Savannah River Plant is also presented.

  10. Method and system for assigning a confidence metric for automated determination of optic disc location

    DOE Patents [OSTI]

    Karnowski, Thomas P.; Tobin, Jr., Kenneth W.; Muthusamy Govindasamy, Vijaya Priya; Chaum, Edward

    2012-07-10

    A method for assigning a confidence metric for automated determination of optic disc location that includes analyzing a retinal image and determining at least two sets of coordinates locating an optic disc in the retinal image. The sets of coordinates can be determined using first and second image analysis techniques that are different from one another. An accuracy parameter can be calculated and compared to a primary risk cut-off value. A high confidence level can be assigned to the retinal image if the accuracy parameter is less than the primary risk cut-off value and a low confidence level can be assigned to the retinal image if the accuracy parameter is greater than the primary risk cut-off value. The primary risk cut-off value being selected to represent an acceptable risk of misdiagnosis of a disease having retinal manifestations by the automated technique.

  11. Using after-action review based on automated performance assessment to enhance training effectiveness.

    SciTech Connect (OSTI)

    Stevens-Adams, Susan Marie; Gieseler, Charles J.; Basilico, Justin Derrick; Abbott, Robert G.; Forsythe, James Chris

    2010-09-01

    Training simulators have become increasingly popular tools for instructing humans on performance in complex environments. However, the question of how to provide individualized and scenario-specific assessment and feedback to students remains largely an open question. In this work, we follow-up on previous evaluations of the Automated Expert Modeling and Automated Student Evaluation (AEMASE) system, which automatically assesses student performance based on observed examples of good and bad performance in a given domain. The current study provides a rigorous empirical evaluation of the enhanced training effectiveness achievable with this technology. In particular, we found that students given feedback via the AEMASE-based debrief tool performed significantly better than students given only instructor feedback on two out of three domain-specific performance metrics.

  12. New Prototype Safeguards Technology Offers Improved Confidence and Automation for Uranium Enrichment Facilities

    SciTech Connect (OSTI)

    Brim, Cornelia P.

    2013-04-01

    An important requirement for the international safeguards community is the ability to determine the enrichment level of uranium in gas centrifuge enrichment plants and nuclear fuel fabrication facilities. This is essential to ensure that countries with nuclear nonproliferation commitments, such as States Party to the Nuclear Nonproliferation Treaty, are adhering to their obligations. However, current technologies to verify the uranium enrichment level in gas centrifuge enrichment plants or nuclear fuel fabrication facilities are technically challenging and resource-intensive. NNSA’s Office of Nonproliferation and International Security (NIS) supports the development, testing, and evaluation of future systems that will strengthen and sustain U.S. safeguards and security capabilities—in this case, by automating the monitoring of uranium enrichment in the entire inventory of a fuel fabrication facility. One such system is HEVA—hybrid enrichment verification array. This prototype was developed to provide an automated, nondestructive assay verification technology for uranium hexafluoride (UF6) cylinders at enrichment plants.

  13. Field Demonstration of Automated Demand Response for Both Winter and Summer Events in Large Buildings in the Pacific Northwest

    SciTech Connect (OSTI)

    Piette, Mary Ann; Kiliccote, Sila; Dudley, Junqiao H.

    2011-11-11

    There are growing strains on the electric grid as cooling peaks grow and equipment ages. Increased penetration of renewables on the grid is also straining electricity supply systems and the need for flexible demand is growing. This paper summarizes results of a series of field test of automated demand response systems in large buildings in the Pacific Northwest. The objective of the research was two fold. One objective was to evaluate the use demand response automation technologies. A second objective was to evaluate control strategies that could change the electric load shape in both winter and summer conditions. Winter conditions focused on cold winter mornings, a time when the electric grid is often stressed. The summer test evaluated DR strategies in the afternoon. We found that we could automate both winter and summer control strategies with the open automated demand response communication standard. The buildings were able to provide significant demand response in both winter and summer events.

  14. RapTOR: Automated sequencing library preparation and suppression for rapid pathogen characterization ( 7th Annual SFAF Meeting, 2012)

    ScienceCinema (OSTI)

    Lane, Todd [SNL

    2013-02-11

    Todd Lane on "RapTOR: Automated sequencing library preparation and suppression for rapid pathogen characterization" at the 2012 Sequencing, Finishing, Analysis in the Future Meeting held June 5-7, 2012 in Santa Fe, New Mexico.

  15. Estimate of Fuel Consumption and GHG Emission Impact on an Automated Mobility District: Preprint

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Estimate of Fuel Consumption and GHG Emission Impact on an Automated Mobility District Preprint Yuche Chen, Stanley Young, and Jeff Gonder National Renewable Energy Laboratory Xuewei Qi University of California Riverside Presented at the 4th International Conference on Connected Vehicles & Expo (ICCVE 2015) Shenzhen, China October 19-23, 2015 Conference Paper NREL/CP-5400-65257 December 2015 NOTICE The submitted manuscript has been offered by an employee of the Alliance for Sustainable

  16. Automated fabrication, characterization and transport of ICF pellets. Final report, March 1, 1979-October 31, 1980

    SciTech Connect (OSTI)

    Clifford, D W; Boyd, B A; Lilienkamp, R H

    1980-12-01

    The near-term objectives of the contract were threefold: (1) evaluate techniques for the production of frozen hydrogen microspheres and demonstrate concepts for coating them; (2) develop and demonstrate an optical characterization system which could lead to automated pellet inspection; and (3) develop and demonstrate a preliminary electrostatic pellet transport control system. This report describes the equipment assembled for these experiments and the results obtained.

  17. Conventional Versus Automated Implantation of Loose Seeds in Prostate Brachytherapy: Analysis of Dosimetric and Clinical Results

    SciTech Connect (OSTI)

    Genebes, Caroline; Filleron, Thomas; Graff, Pierre; Jonca, Frdric; Huyghe, Eric; Thoulouzan, Matthieu; Soulie, Michel; Malavaud, Bernard; Aziza, Richard; Brun, Thomas; Delannes, Martine; Bachaud, Jean-Marc

    2013-11-15

    Purpose: To review the clinical outcome of I-125 permanent prostate brachytherapy (PPB) for low-risk and intermediate-risk prostate cancer and to compare 2 techniques of loose-seed implantation. Methods and Materials: 574 consecutive patients underwent I-125 PPB for low-risk and intermediate-risk prostate cancer between 2000 and 2008. Two successive techniques were used: conventional implantation from 2000 to 2004 and automated implantation (Nucletron, FIRST system) from 2004 to 2008. Dosimetric and biochemical recurrence-free (bNED) survival results were reported and compared for the 2 techniques. Univariate and multivariate analysis researched independent predictors for bNED survival. Results: 419 (73%) and 155 (27%) patients with low-risk and intermediate-risk disease, respectively, were treated (median follow-up time, 69.3 months). The 60-month bNED survival rates were 95.2% and 85.7%, respectively, for patients with low-risk and intermediate-risk disease (P=.04). In univariate analysis, patients treated with automated implantation had worse bNED survival rates than did those treated with conventional implantation (P<.0001). By day 30, patients treated with automated implantation showed lower values of dose delivered to 90% of prostate volume (D90) and volume of prostate receiving 100% of prescribed dose (V100). In multivariate analysis, implantation technique, Gleason score, and V100 on day 30 were independent predictors of recurrence-free status. Grade 3 urethritis and urinary incontinence were observed in 2.6% and 1.6% of the cohort, respectively, with no significant differences between the 2 techniques. No grade 3 proctitis was observed. Conclusion: Satisfactory 60-month bNED survival rates (93.1%) and acceptable toxicity (grade 3 urethritis <3%) were achieved by loose-seed implantation. Automated implantation was associated with worse dosimetric and bNED survival outcomes.

  18. Automated position control of a surface array relative to a liquid microjunction surface sampler

    DOE Patents [OSTI]

    Van Berkel, Gary J.; Kertesz, Vilmos; Ford, Michael James

    2007-11-13

    A system and method utilizes an image analysis approach for controlling the probe-to-surface distance of a liquid junction-based surface sampling system for use with mass spectrometric detection. Such an approach enables a hands-free formation of the liquid microjunction used to sample solution composition from the surface and for re-optimization, as necessary, of the microjunction thickness during a surface scan to achieve a fully automated surface sampling system.

  19. Reducing Fuel Consumption through Semi-Automated Platooning with Class 8 Tractor Trailer Combinations (Poster)

    SciTech Connect (OSTI)

    Lammert, M.; Gonder, J.

    2014-07-01

    This poster describes the National Renewable Energy Laboratory's evaluation of the fuel savings potential of semi-automated truck platooning. Platooning involves reducing aerodynamic drag by grouping vehicles together and decreasing the distance between them through the use of electronic coupling, which allows multiple vehicles to accelerate or brake simultaneously. The NREL study addressed the need for data on American style line-haul sleeper cabs with modern aerodynamics and over a range of trucking speeds common in the United States.

  20. Enhancing Seismic Calibration Research Through Software Automation and Scientific Information Management

    SciTech Connect (OSTI)

    Ruppert, S D; Dodge, D A; Ganzberger, M D; Harris, D B; Hauk, T F

    2009-07-07

    The National Nuclear Security Administration (NNSA) Ground-Based Nuclear Explosion Monitoring Research and Development (GNEMRD) Program at LLNL continues to make significant progress enhancing the process of deriving seismic calibrations and performing scientific integration, analysis, and information management with software automation tools. Our tool efforts address the problematic issues of very large datasets and varied formats encountered during seismic calibration research. New information management and analysis tools have resulted in demonstrated gains in efficiency of producing scientific data products and improved accuracy of derived seismic calibrations. In contrast to previous years, software development work this past year has emphasized development of automation at the data ingestion level. This change reflects a gradually-changing emphasis in our program from processing a few large data sets that result in a single integrated delivery, to processing many different data sets from a variety of sources. The increase in the number of sources had resulted in a large increase in the amount of metadata relative to the final volume of research products. Software developed this year addresses the problems of: (1) Efficient metadata ingestion and conflict resolution; (2) Automated ingestion of bulletin information; (3) Automated ingestion of waveform information from global data centers; and (4) Site Metadata and Response transformation required for certain products. This year, we also made a significant step forward in meeting a long-standing goal of developing and using a waveform correlation framework. Our objective for such a framework is to extract additional calibration data (e.g. mining blasts) and to study the extent to which correlated seismicity can be found in global and regional scale environments.

  1. The rotary zone thermal cycler: A low-power system enabling automated rapid PCR

    SciTech Connect (OSTI)

    Bartsch, Michael S.; Edwards, Harrison S.; Lee, Daniel; Moseley, Caroline E.; Tew, Karen E.; Renzi, Ronald F.; Van de Vreugde, James L.; Kim, Hanyoup; Knight, Daniel L.; Sinha, Anupama; Branda, Steven S.; Patel, Kamlesh D.; Wanunu, Meni

    2015-03-31

    In this study, advances in molecular biology, microfluidics, and laboratory automation continue to expand the accessibility and applicability of these methods beyond the confines of conventional, centralized laboratory facilities and into point of use roles in clinical, military, forensic, portable, and field-deployed applications. As a result, there is a growing need to adapt the unit operations of molecular biology such as aliquoting, centrifuging, mixing, and thermal cycling to compact, portable, low-power, and automation-ready formats. Here we present one such adaptation, the rotary zone thermal cycler (RZTC), a novel wheel-based device capable of cycling up to four different fixed-temperature blocks into contact with a stationary 4-microliter capillary-bound sample to realize 1-3 second transitions with steady state heater power of less than 10 W. We further demonstrate the utility of the RZTC for DNA amplification as part of a highly integrated rotary zone PCR (rzPCR) system using low-volume valves and syringe-based fluid handling to automate sample loading and unloading, thermal cycling, and between run cleaning functionalities in a compact, modular form factor. In addition to characterizing the performance of the RZTC and the efficacy of different online cleaning protocols, preliminary results are presented for rapid single-plex PCR, multiplex short tandem repeat (STR) amplification, and second strand cDNA synthesis.

  2. The rotary zone thermal cycler: A low-power system enabling automated rapid PCR

    DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

    Bartsch, Michael S.; Edwards, Harrison S.; Lee, Daniel; Moseley, Caroline E.; Tew, Karen E.; Renzi, Ronald F.; Van de Vreugde, James L.; Kim, Hanyoup; Knight, Daniel L.; Sinha, Anupama; et al

    2015-03-31

    Advances in molecular biology, microfluidics, and laboratory automation continue to expand the accessibility and applicability of these methods beyond the confines of conventional, centralized laboratory facilities and into point of use roles in clinical, military, forensic, and field-deployed applications. As a result, there is a growing need to adapt the unit operations of molecular biology (e.g., aliquoting, centrifuging, mixing, and thermal cycling) to compact, portable, low-power, and automation-ready formats. Here we present one such adaptation, the rotary zone thermal cycler (RZTC), a novel wheel-based device capable of cycling up to four different fixed-temperature blocks into contact with a stationary 4-microlitermorecapillary-bound sample to realize 1-3 second transitions with steady state heater power of less than 10 W. We demonstrate the utility of the RZTC for DNA amplification as part of a highly integrated rotary zone PCR (rzPCR) system that uses low-volume valves and syringe-based fluid handling to automate sample loading and unloading, thermal cycling, and between-run cleaning functionalities in a compact, modular form factor. In addition to characterizing the performance of the RZTC and the efficacy of different online cleaning protocols, we present preliminary results for rapid single-plex PCR, multiplex short tandem repeat (STR) amplification, and second strand cDNA synthesis.less

  3. Opportunities for Automated Demand Response in California’s Dairy Processing Industry

    SciTech Connect (OSTI)

    Homan, Gregory K.; Aghajanzadeh, Arian; McKane, Aimee

    2015-08-30

    During periods of peak electrical demand on the energy grid or when there is a shortage of supply, the stability of the grid may be compromised or the cost of supplying electricity may rise dramatically, respectively. Demand response programs are designed to mitigate the severity of these problems and improve reliability by reducing the demand on the grid during such critical times. In 2010, the Demand Response Research Center convened a group of industry experts to suggest potential industries that would be good demand response program candidates for further review. The dairy industry was suggested due to the perception that the industry had suitable flexibility and automatic controls in place. The purpose of this report is to provide an initial description of the industry with regard to demand response potential, specifically automated demand response. This report qualitatively describes the potential for participation in demand response and automated demand response by dairy processing facilities in California, as well as barriers to widespread participation. The report first describes the magnitude, timing, location, purpose, and manner of energy use. Typical process equipment and controls are discussed, as well as common impediments to participation in demand response and automated demand response programs. Two case studies of demand response at dairy facilities in California and across the country are reviewed. Finally, recommendations are made for future research that can enhance the understanding of demand response potential in this industry.

  4. Automated assessment of bilateral breast volume asymmetry as a breast cancer biomarker during mammographic screening

    SciTech Connect (OSTI)

    Williams, Alex C; Hitt, Austin N; Voisin, Sophie; Tourassi, Georgia

    2013-01-01

    The biological concept of bilateral symmetry as a marker of developmental stability and good health is well established. Although most individuals deviate slightly from perfect symmetry, humans are essentially considered bilaterally symmetrical. Consequently, increased fluctuating asymmetry of paired structures could be an indicator of disease. There are several published studies linking bilateral breast size asymmetry with increased breast cancer risk. These studies were based on radiologists manual measurements of breast size from mammographic images. We aim to develop a computerized technique to assess fluctuating breast volume asymmetry in screening mammograms and investigate whether it correlates with the presence of breast cancer. Using a large database of screening mammograms with known ground truth we applied automated breast region segmentation and automated breast size measurements in CC and MLO views using three well established methods. All three methods confirmed that indeed patients with breast cancer have statistically significantly higher fluctuating asymmetry of their breast volumes. However, statistically significant difference between patients with cancer and benign lesions was observed only for the MLO views. The study suggests that automated assessment of global bilateral asymmetry could serve as a breast cancer risk biomarker for women undergoing mammographic screening. Such biomarker could be used to alert radiologists or computer-assisted detection (CAD) systems to exercise increased vigilance if higher than normal cancer risk is suspected.

  5. Assessment of the Current Level of Automation in the Manufacture of Fuel Cell Systems for Combined Heat and Power Applications

    SciTech Connect (OSTI)

    Ulsh, M.; Wheeler, D.; Protopappas, P.

    2011-08-01

    The U.S. Department of Energy (DOE) is interested in supporting manufacturing research and development (R&D) for fuel cell systems in the 10-1,000 kilowatt (kW) power range relevant to stationary and distributed combined heat and power applications, with the intent to reduce manufacturing costs and increase production throughput. To assist in future decision-making, DOE requested that the National Renewable Energy Laboratory (NREL) provide a baseline understanding of the current levels of adoption of automation in manufacturing processes and flow, as well as of continuous processes. NREL identified and visited or interviewed key manufacturers, universities, and laboratories relevant to the study using a standard questionnaire. The questionnaire covered the current level of vertical integration, the importance of quality control developments for automation, the current level of automation and source of automation design, critical balance of plant issues, potential for continuous cell manufacturing, key manufacturing steps or processes that would benefit from DOE support for manufacturing R&D, the potential for cell or stack design changes to support automation, and the relationship between production volume and decisions on automation.

  6. AutoDrug: fully automated macromolecular crystallography workflows for fragment-based drug discovery

    SciTech Connect (OSTI)

    Tsai, Yingssu; McPhillips, Scott E.; Gonzlez, Ana; McPhillips, Timothy M.; Zinn, Daniel; Cohen, Aina E.; Feese, Michael D.; Bushnell, David; Tiefenbrunn, Theresa; Stout, C. David; Ludaescher, Bertram; Hedman, Britt; Hodgson, Keith O.; Soltis, S. Michael

    2013-05-01

    New software has been developed for automating the experimental and data-processing stages of fragment-based drug discovery at a macromolecular crystallography beamline. A new workflow-automation framework orchestrates beamline-control and data-analysis software while organizing results from multiple samples. AutoDrug is software based upon the scientific workflow paradigm that integrates the Stanford Synchrotron Radiation Lightsource macromolecular crystallography beamlines and third-party processing software to automate the crystallography steps of the fragment-based drug-discovery process. AutoDrug screens a cassette of fragment-soaked crystals, selects crystals for data collection based on screening results and user-specified criteria and determines optimal data-collection strategies. It then collects and processes diffraction data, performs molecular replacement using provided models and detects electron density that is likely to arise from bound fragments. All processes are fully automated, i.e. are performed without user interaction or supervision. Samples can be screened in groups corresponding to particular proteins, crystal forms and/or soaking conditions. A single AutoDrug run is only limited by the capacity of the sample-storage dewar at the beamline: currently 288 samples. AutoDrug was developed in conjunction with RestFlow, a new scientific workflow-automation framework. RestFlow simplifies the design of AutoDrug by managing the flow of data and the organization of results and by orchestrating the execution of computational pipeline steps. It also simplifies the execution and interaction of third-party programs and the beamline-control system. Modeling AutoDrug as a scientific workflow enables multiple variants that meet the requirements of different user groups to be developed and supported. A workflow tailored to mimic the crystallography stages comprising the drug-discovery pipeline of CoCrystal Discovery Inc. has been deployed and successfully demonstrated. This workflow was run once on the same 96 samples that the group had examined manually and the workflow cycled successfully through all of the samples, collected data from the same samples that were selected manually and located the same peaks of unmodeled density in the resulting difference Fourier maps.

  7. Development and evaluation of fully automated demand response in large facilities

    SciTech Connect (OSTI)

    Piette, Mary Ann; Sezgen, Osman; Watson, David S.; Motegi, Naoya; Shockman, Christine; ten Hope, Laurie

    2004-03-30

    This report describes the results of a research project to develop and evaluate the performance of new Automated Demand Response (Auto-DR) hardware and software technology in large facilities. Demand Response (DR) is a set of activities to reduce or shift electricity use to improve electric grid reliability, manage electricity costs, and ensure that customers receive signals that encourage load reduction during times when the electric grid is near its capacity. The two main drivers for widespread demand responsiveness are the prevention of future electricity crises and the reduction of electricity prices. Additional goals for price responsiveness include equity through cost of service pricing, and customer control of electricity usage and bills. The technology developed and evaluated in this report could be used to support numerous forms of DR programs and tariffs. For the purpose of this report, we have defined three levels of Demand Response automation. Manual Demand Response involves manually turning off lights or equipment; this can be a labor-intensive approach. Semi-Automated Response involves the use of building energy management control systems for load shedding, where a preprogrammed load shedding strategy is initiated by facilities staff. Fully-Automated Demand Response is initiated at a building or facility through receipt of an external communications signal--facility staff set up a pre-programmed load shedding strategy which is automatically initiated by the system without the need for human intervention. We have defined this approach to be Auto-DR. An important concept in Auto-DR is that a facility manager is able to ''opt out'' or ''override'' an individual DR event if it occurs at a time when the reduction in end-use services is not desirable. This project sought to improve the feasibility and nature of Auto-DR strategies in large facilities. The research focused on technology development, testing, characterization, and evaluation relating to Auto-DR. This evaluation also included the related decisionmaking perspectives of the facility owners and managers. Another goal of this project was to develop and test a real-time signal for automated demand response that provided a common communication infrastructure for diverse facilities. The six facilities recruited for this project were selected from the facilities that received CEC funds for new DR technology during California's 2000-2001 electricity crises (AB970 and SB-5X).

  8. NAME ORGANIZATION E-MAIL PHONE

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    (865) 574-2105 (Alternate) Miller, Ruth Oak Ridge Nat'l Laboratory ... Ashley, Tom CWI, Idaho Cleanup Project thomas.ashley@icp.doe.gov (208) 360-3552 McGary, ...

  9. Mail Management Memorandum, July 2, 2010

    Energy Savers [EERE]

  10. Printing and Mail Managers Exchange Forum Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    New reporting due date will be October 31 of each year starting in FY-2014. On-line ... Change to Schedule 5-1. Requirement is to now enter numbers rounded to the nearest dollar ...

  11. Widget:MailChimp | Open Energy Information

    Open Energy Info (EERE)

    source History View New Pages Recent Changes All Special Pages Semantic SearchQuerying Get Involved Help Apps Datasets Community Login | Sign Up Search Widget Edit History...

  12. Heavy Oil Process Monitor: Automated On-Column Asphaltene Precipitation and Re-Dissolution

    SciTech Connect (OSTI)

    John F. Schabron; Joseph F. Rovani; Mark Sanderson

    2007-03-31

    An automated separation technique was developed that provides a new approach to measuring the distribution profiles of the most polar, or asphaltenic components of an oil, using a continuous flow system to precipitate and re-dissolve asphaltenes from the oil. Methods of analysis based on this new technique were explored. One method based on the new technique involves precipitation of a portion of residua sample in heptane on a polytetrafluoroethylene-packed (PTFE) column. The precipitated material is re-dissolved in three steps using solvents of increasing polarity: cyclohexane, toluene, and methylene chloride. The amount of asphaltenes that dissolve in cyclohexane is a useful diagnostic of the thermal history of oil, and its proximity to coke formation. For example, about 40 % (w/w) of the heptane asphaltenes from unpyrolyzed residua dissolves in cyclohexane. As pyrolysis progresses, this number decrease to below 15% as coke and toluene insoluble pre-coke materials appear. Currently, the procedure for the isolation of heptane asphaltenes and the determination of the amount of asphaltenes soluble in cyclohexane spans three days. The automated procedure takes one hour. Another method uses a single solvent, methylene chloride, to re-dissolve the material that precipitates on heptane on the PTFE-packed column. The area of this second peak can be used to calculate a value which correlates with gravimetric asphaltene content. Currently the gravimetric procedure to determine asphaltenes takes about 24 hours. The automated procedure takes 30 minutes. Results for four series of original and pyrolyzed residua were compared with data from the gravimetric methods. Methods based on the new on-column precipitation and re-dissolution technique provide significantly more detail about the polar constituent's oils than the gravimetric determination of asphaltenes.

  13. Collaboration, Automation, and Information Management at Hanford High Level Radioactive Waste (HLW) Tank Farms

    SciTech Connect (OSTI)

    Aurah, Mirwaise Y.; Roberts, Mark A.

    2013-12-12

    Washington River Protection Solutions (WRPS), operator of High Level Radioactive Waste (HLW) Tank Farms at the Hanford Site, is taking an over 20-year leap in technology, replacing systems that were monitored with clipboards and obsolete computer systems, as well as solving major operations and maintenance hurdles in the area of process automation and information management. While WRPS is fully compliant with procedures and regulations, the current systems are not integrated and do not share data efficiently, hampering how information is obtained and managed.

  14. Automated apparatus for solvent separation of a coal liquefaction product stream

    DOE Patents [OSTI]

    Schweighardt, Frank K. (Upper Macungie, PA)

    1985-01-01

    An automated apparatus for the solvent separation of a coal liquefaction product stream that operates continuously and unattended and eliminates potential errors resulting from subjectivity and the aging of the sample during analysis. In use of the apparatus, metered amounts of one or more solvents are passed sequentially through a filter containing the sample under the direction of a microprocessor control means. The mixture in the filter is agitated by means of ultrasonic cavitation for a timed period and the filtrate is collected. The filtrate of each solvent extraction is collected individually and the residue on the filter element is collected to complete the extraction process.

  15. Automated Testing of Supercomputers ANL/ALCF/TM-13/3 Argonne Leadership Computing Facility

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Automated Testing of Supercomputers ANL/ALCF/TM-13/3 Argonne Leadership Computing Facility Availability of This Report This report is available, at no cost, at http://www.osti.gov/bridge. It is also available on paper to the U.S. Department of Energy and its contractors, for a processing fee, from: U.S. Department of Energy Offce of Scientifc and Technical Information P.O. Box 62 Oak Ridge, TN 37831-0062 phone (865) 576-8401 fax (865) 576-5728 reports@adonis.osti.gov Disclaimer This report was

  16. SU-E-CAMPUS-T-01: Automation of the Winston-Lutz Test for Stereotactic Radiosurgery

    SciTech Connect (OSTI)

    Litzenberg, D; Irrer, J; Kessler, M; Lam, K; Keranen, W

    2014-06-15

    Purpose: To optimize clinical efficiency and shorten patient wait time by minimizing the time and effort required to perform the Winston-Lutz test before stereotactic radiosurgery (SRS) through automation of the delivery, analysis, and documentation of results. Methods: The radiation fields of the Winston-Lutz (WL) test were created in a machine-QA patient saved in ARIA for use before SRS cases. Images of the BRW target ball placed at mechanical isocenter are captured with the portal imager for each of four, 2cm2cm, MLC-shaped beams. When the WL plan is delivered and closed, this event is detected by in-house software called EventNet which automates subsequent processes with the aid of the ARIA web services. Images are automatically retrieved from the ARIA database and analyzed to determine the offset of the target ball from radiation isocenter. The results are posted to a website and a composite summary image of the results is pushed back into ImageBrowser for review and authenticated documentation. Results: The total time to perform the test was reduced from 20-25 minutes to less than 4 minutes. The results were found to be more accurate and consistent than the previous method which used radiochromic film. The images were also analyzed with DoseLab for comparison. The difference between the film and automated WL results in the X and Y direction and the radius were (?0.17 +/? 0.28) mm, (0.21 +/? 0.20) mm and (?0.14 +/? 0.27) mm, respectively. The difference between the DoseLab and automated WL results were (?0.05 +/? 0.06) mm, (?0.01 +/? 0.02) mm and (0.01 +/? 0.07) mm, respectively. Conclusions: This process reduced patient wait times by 1520 minutes making the treatment machine available to treat another patient. Accuracy and consistency of results were improved over the previous method and were comparable to other commercial solutions. Access to the ARIA web services is made possible through an Eclipse co-development agreement with Varian Medical Systems.

  17. Functional requirements for the Automated Transportation Management System: TTP number: RL 439002

    SciTech Connect (OSTI)

    Portsmouth, J.H.

    1992-12-31

    This requirements analysis, documents Department of Energy (DOE) transportation management procedures for the purpose of providing a clear and mutual understanding between users and designers of the proposed Automated Transportation Management System (ATMS). It is imperative that one understand precisely how DOE currently performs traffic management tasks; only then can an integrated system be proposed that successfully satisfies the major requirements of transportation managers and other system users. Accordingly, this report describes the current workings of DOE transportation organizations and then proposes a new system which represents a synthesis of procedures (both current and desired) which forms the basis for further systems development activities.

  18. Automated Feature Generation in Large-Scale Geospatial Libraries for Content-Based Indexing.

    SciTech Connect (OSTI)

    Tobin Jr, Kenneth William; Bhaduri, Budhendra L; Bright, Eddie A; Cheriydat, Anil; Karnowski, Thomas Paul; Palathingal, Paul J; Potok, Thomas E; Price, Jeffery R

    2006-05-01

    We describe a method for indexing and retrieving high-resolution image regions in large geospatial data libraries. An automated feature extraction method is used that generates a unique and specific structural description of each segment of a tessellated input image file. These tessellated regions are then merged into similar groups, or sub-regions, and indexed to provide flexible and varied retrieval in a query-by-example environment. The methods of tessellation, feature extraction, sub-region clustering, indexing, and retrieval are described and demonstrated using a geospatial library representing a 153 km2 region of land in East Tennessee at 0.5 m per pixel resolution.

  19. Opportunities for Energy Efficiency and Open Automated Demand Response in Wastewater Treatment Facilities in California -- Phase I Report

    SciTech Connect (OSTI)

    Lekov, Alex; Thompson, Lisa; McKane, Aimee; Song, Katherine; Piette, Mary Ann

    2009-04-01

    This report summarizes the Lawrence Berkeley National Laboratory?s research to date in characterizing energy efficiency and automated demand response opportunities for wastewater treatment facilities in California. The report describes the characteristics of wastewater treatment facilities, the nature of the wastewater stream, energy use and demand, as well as details of the wastewater treatment process. It also discusses control systems and energy efficiency and automated demand response opportunities. In addition, several energy efficiency and load management case studies are provided for wastewater treatment facilities.This study shows that wastewater treatment facilities can be excellent candidates for open automated demand response and that facilities which have implemented energy efficiency measures and have centralized control systems are well-suited to shift or shed electrical loads in response to financial incentives, utility bill savings, and/or opportunities to enhance reliability of service. Control technologies installed for energy efficiency and load management purposes can often be adapted for automated demand response at little additional cost. These improved controls may prepare facilities to be more receptive to open automated demand response due to both increased confidence in the opportunities for controlling energy cost/use and access to the real-time data.

  20. Shrirang Abhyankar | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Photo of Shrirang Abhyankar Shrirang Abhyankar Computational Engineer Telephone (630) 252-0219 E-mail abhyshr@anl.gov Projects Distribution Automation

  1. Beamline 9.3.1

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    environment 10-7 Torr Experimental techniques XAS, XAFS, NEXAFS Sample handling automation Yes, rotation and Z Spokesperson This e-mail address is being protected from...

  2. Automated solar cell assembly team process research. Annual subcontract report, 1 January 1993--31 December 1993

    SciTech Connect (OSTI)

    Nowlan, M.J.; Hogan, S.J.; Darkazalli, G.; Breen, W.F.; Murach, J.M.; Sutherland, S.F.; Patterson, J.S.

    1994-06-01

    This report describes work done under the Photovoltaic Manufacturing Technology (PVMaT) project, Phase 3A, which addresses problems that are generic to the photovoltaic (PV) industry. Spire`s objective during Phase 3A was to use its light soldering technology and experience to design and fabricate solar cell tabbing and interconnecting equipment to develop new, high-yield, high-throughput, fully automated processes for tabbing and interconnecting thin cells. Areas that were addressed include processing rates, process control, yield, throughput, material utilization efficiency, and increased use of automation. Spire teamed with Solec International, a PV module manufacturer, and the University of Massachusetts at Lowell`s Center for Productivity Enhancement (CPE), automation specialists, who are lower-tier subcontractors. A number of other PV manufacturers, including Siemens Solar, Mobil Solar, Solar Web, and Texas instruments, agreed to evaluate the processes developed under this program.

  3. Estimate of Fuel Consumption and GHG Emission Impact from an Automated Mobility District

    SciTech Connect (OSTI)

    Chen, Yuche; Young, Stanley; Qi, Xuewei; Gonder, Jeffrey

    2015-10-19

    This study estimates the range of fuel and emissions impact of an automated-vehicle (AV) based transit system that services campus-based developments, termed an automated mobility district (AMD). The study develops a framework to quantify the fuel consumption and greenhouse gas (GHG) emission impacts of a transit system comprised of AVs, taking into consideration average vehicle fleet composition, fuel consumption/GHG emission of vehicles within specific speed bins, and the average occupancy of passenger vehicles and transit vehicles. The framework is exercised using a previous mobility analysis of a personal rapid transit (PRT) system, a system which shares many attributes with envisioned AV-based transit systems. Total fuel consumption and GHG emissions with and without an AMD are estimated, providing a range of potential system impacts on sustainability. The results of a previous case study based of a proposed implementation of PRT on the Kansas State University (KSU) campus in Manhattan, Kansas, serves as the basis to estimate personal miles traveled supplanted by an AMD at varying levels of service. The results show that an AMD has the potential to reduce total system fuel consumption and GHG emissions, but the amount is largely dependent on operating and ridership assumptions. The study points to the need to better understand ride-sharing scenarios and calls for future research on sustainability benefits of an AMD system at both vehicle and system levels.

  4. Estimate of Fuel Consumption and GHG Emission Impact on an Automated Mobility District: Preprint

    SciTech Connect (OSTI)

    Chen, Yuche; Young, Stanley; Gonder, Jeff; Qi, Xuewei

    2015-12-11

    This study estimates the range of fuel and emissions impact of an automated-vehicle (AV) based transit system that services campus-based developments, termed an automated mobility district (AMD). The study develops a framework to quantify the fuel consumption and greenhouse gas (GHG) emission impacts of a transit system comprised of AVs, taking into consideration average vehicle fleet composition, fuel consumption/GHG emission of vehicles within specific speed bins, and the average occupancy of passenger vehicles and transit vehicles. The framework is exercised using a previous mobility analysis of a personal rapid transit (PRT) system, a system which shares many attributes with envisioned AV-based transit systems. Total fuel consumption and GHG emissions with and without an AMD are estimated, providing a range of potential system impacts on sustainability. The results of a previous case study based of a proposed implementation of PRT on the Kansas State University (KSU) campus in Manhattan, Kansas, serves as the basis to estimate personal miles traveled supplanted by an AMD at varying levels of service. The results show that an AMD has the potential to reduce total system fuel consumption and GHG emissions, but the amount is largely dependent on operating and ridership assumptions. The study points to the need to better understand ride-sharing scenarios and calls for future research on sustainability benefits of an AMD system at both vehicle and system levels.

  5. Effects of an Advanced Reactor’s Design, Use of Automation, and Mission on Human Operators

    SciTech Connect (OSTI)

    Jeffrey C. Joe; Johanna H. Oxstrand

    2014-06-01

    The roles, functions, and tasks of the human operator in existing light water nuclear power plants (NPPs) are based on sound nuclear and human factors engineering (HFE) principles, are well defined by the plant’s conduct of operations, and have been validated by years of operating experience. However, advanced NPPs whose engineering designs differ from existing light-water reactors (LWRs) will impose changes on the roles, functions, and tasks of the human operators. The plans to increase the use of automation, reduce staffing levels, and add to the mission of these advanced NPPs will also affect the operator’s roles, functions, and tasks. We assert that these factors, which do not appear to have received a lot of attention by the design engineers of advanced NPPs relative to the attention given to conceptual design of these reactors, can have significant risk implications for the operators and overall plant safety if not mitigated appropriately. This paper presents a high-level analysis of a specific advanced NPP and how its engineered design, its plan to use greater levels of automation, and its expanded mission have risk significant implications on operator performance and overall plant safety.

  6. Automated Work Packages Prototype: Initial Design, Development, and Evaluation. Light Water Reactor Sustainability Program

    SciTech Connect (OSTI)

    Oxstrand, Johanna Helene; Ahmad Al Rashdan; Le Blanc, Katya Lee; Bly, Aaron Douglas; Agarwal, Vivek

    2015-07-01

    The goal of the Automated Work Packages (AWP) project is to demonstrate how to enhance work quality, cost management, and nuclear safety through the use of advanced technology. The work described in this report is part of the digital architecture for a highly automated plant project of the technical program plan for advanced instrumentation, information, and control (II&C) systems technologies. This report addresses the DOE Milestone M2LW-15IN0603112: Describe the outcomes of field evaluations/demonstrations of the AWP prototype system and plant surveillance and communication framework requirements at host utilities. A brief background to the need for AWP research is provided, then two human factors field evaluation studies are described. These studies focus on the user experience of conducting a task (in this case a preventive maintenance and a surveillance test) while using an AWP system. The remaining part of the report describes an II&C effort to provide real time status updates to the technician by wireless transfer of equipment indications and a dynamic user interface.

  7. Design and performance of an automated video-based laser beam alignment system

    SciTech Connect (OSTI)

    Rundle, W.J. ); Kartz, M.W. ); Bliss, E.S.; English, R.E. Jr.; Peterson, R.L.; Thompson, G.R.; Uhlich, D.M. )

    1992-07-14

    This paper describes the design and performance of an automated, closed-loop, laser beam alignment system. Its function is to sense a beam alignment error in a laser beam transport system and automatically steer mirrors preceding the sensor location as required to maintain beam alignment. The laser beam is sampled by an optomechanical package which uses video cameras to sense pointing and centering errors. The camera outputs are fed to an image processing module, which includes video digitizers and uses image storage and software to sense the centroid of the image. Signals are sent through a VMEbus to an optical device controller'' (ODC), which drives stepper-motor actuators on mirror mounts preceding the beam-sampling location to return the beam alignment to the prescribed condition. Photodiodes are also used to extend the control bandwidth beyond that which is achievable with video cameras. This system has been operated at LLNL in the Atomic Vapor Laser Isotope Separation (AVLIS) program to maintain the alignment of copper and dye laser beams, the latter to within [plus minus]2 [mu]r in pointing and less than 1 mm in centering. The optomechanical design of the instrumented package, which includes lens, mirror, and video mounts in a rigid housing, the automated control system architecture, and the performance of this equipment is described.

  8. Design and performance of an automated video-based laser beam alignment system

    SciTech Connect (OSTI)

    Rundle, W.J.; Kartz, M.W.; Bliss, E.S.; English, R.E. Jr.; Peterson, R.L.; Thompson, G.R.; Uhlich, D.M.

    1992-07-14

    This paper describes the design and performance of an automated, closed-loop, laser beam alignment system. Its function is to sense a beam alignment error in a laser beam transport system and automatically steer mirrors preceding the sensor location as required to maintain beam alignment. The laser beam is sampled by an optomechanical package which uses video cameras to sense pointing and centering errors. The camera outputs are fed to an image processing module, which includes video digitizers and uses image storage and software to sense the centroid of the image. Signals are sent through a VMEbus to an ``optical device controller`` (ODC), which drives stepper-motor actuators on mirror mounts preceding the beam-sampling location to return the beam alignment to the prescribed condition. Photodiodes are also used to extend the control bandwidth beyond that which is achievable with video cameras. This system has been operated at LLNL in the Atomic Vapor Laser Isotope Separation (AVLIS) program to maintain the alignment of copper and dye laser beams, the latter to within {plus_minus}2 {mu}r in pointing and less than 1 mm in centering. The optomechanical design of the instrumented package, which includes lens, mirror, and video mounts in a rigid housing, the automated control system architecture, and the performance of this equipment is described.

  9. Knowledge Support and Automation for Performance Analysis with PerfExplorer 2.0

    DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

    Huck, Kevin A.; Malony, Allen D.; Shende, Sameer; Morris, Alan

    2008-01-01

    The integration of scalable performance analysis in parallel development tools is difficult. The potential size of data sets and the need to compare results from multiple experiments presents a challenge to manage and process the information. Simply to characterize the performance of parallel applications running on potentially hundreds of thousands of processor cores requires new scalable analysis techniques. Furthermore, many exploratory analysis processes are repeatable and could be automated, but are now implemented as manual procedures. In this paper, we will discuss the current version of PerfExplorer, a performance analysis framework which provides dimension reduction, clustering and correlation analysis ofmore » individual trails of large dimensions, and can perform relative performance analysis between multiple application executions. PerfExplorer analysis processes can be captured in the form of Python scripts, automating what would otherwise be time-consuming tasks. We will give examples of large-scale analysis results, and discuss the future development of the framework, including the encoding and processing of expert performance rules, and the increasing use of performance metadata.« less

  10. Automation and optimization of the design parameters in tactical military pipeline systems. Master's thesis

    SciTech Connect (OSTI)

    Frick, R.M.

    1988-12-01

    Tactical military petroleum pipeline systems will play a vital role in any future conflict due to an increased consumption of petroleum products by our combined Armed Forces. The tactical pipeline must be rapidly constructed and highly mobile to keep pace with the constantly changing battle zone. Currently, the design of these pipeline system is time consuming and inefficient, which may cause shortages of fuel and pipeline components at the front lines. Therefore, a need for a computer program that will both automate and optimize the pipeline design process is quite apparent. These design needs are satisfied by developing a software package using Advance Basic (IBM DOS) programming language and made to run on an IBM-compatible personal computer. The program affords the user the options of either finding the optimum pump station locations for a proposed pipeline or calculating the maximum operating pressures for an existing pipeline. By automating the design procedure, a field engineer can vary the pipeline length, diameter, roughness, viscosity, gravity, flow rate, pump station pressure, or terrain profile and see how it affects the other parameters in just a few seconds. The design process was optimized by implementing a weighting scheme based on the volume percent of each fuel in the pipeline at any given time.

  11. Automated Demand Response Technology Demonstration Project for Small and Medium Commercial Buildings

    SciTech Connect (OSTI)

    Page, Janie; Kiliccote, Sila; Dudley, Junqiao Han; Piette, Mary Ann; Chiu, Albert K.; Kellow, Bashar; Koch, Ed; Lipkin, Paul

    2011-07-01

    Small and medium commercial customers in California make up about 20-25% of electric peak load in California. With the roll out of smart meters to this customer group, which enable granular measurement of electricity consumption, the investor-owned utilities will offer dynamic prices as default tariffs by the end of 2011. Pacific Gas and Electric Company, which successfully deployed Automated Demand Response (AutoDR) Programs to its large commercial and industrial customers, started investigating the same infrastructures application to the small and medium commercial customers. This project aims to identify available technologies suitable for automating demand response for small-medium commercial buildings; to validate the extent to which that technology does what it claims to be able to do; and determine the extent to which customers find the technology useful for DR purpose. Ten sites, enabled by eight vendors, participated in at least four test AutoDR events per site in the summer of 2010. The results showed that while existing technology can reliably receive OpenADR signals and translate them into pre-programmed response strategies, it is likely that better levels of load sheds could be obtained than what is reported here if better understanding of the building systems were developed and the DR response strategies had been carefully designed and optimized for each site.

  12. Demand Response and Open Automated Demand Response Opportunities for Data Centers

    SciTech Connect (OSTI)

    Ghatikar, Girish; Piette, Mary Ann; Fujita, Sydny; McKane, Aimee; Dudley, Junqiao Han; Radspieler, Anthony; Mares, K.C.; Shroyer, Dave

    2009-12-30

    This study examines data center characteristics, loads, control systems, and technologies to identify demand response (DR) and automated DR (Open Auto-DR) opportunities and challenges. The study was performed in collaboration with technology experts, industrial partners, and data center facility managers and existing research on commercial and industrial DR was collected and analyzed. The results suggest that data centers, with significant and rapidly growing energy use, have significant DR potential. Because data centers are highly automated, they are excellent candidates for Open Auto-DR. 'Non-mission-critical' data centers are the most likely candidates for early adoption of DR. Data center site infrastructure DR strategies have been well studied for other commercial buildings; however, DR strategies for information technology (IT) infrastructure have not been studied extensively. The largest opportunity for DR or load reduction in data centers is in the use of virtualization to reduce IT equipment energy use, which correspondingly reduces facility cooling loads. DR strategies could also be deployed for data center lighting, and heating, ventilation, and air conditioning. Additional studies and demonstrations are needed to quantify benefits to data centers of participating in DR and to address concerns about DR's possible impact on data center performance or quality of service and equipment life span.

  13. Analysis of Open Automated Demand Response Deployments in California and Guidelines to Transition to Industry Standards

    SciTech Connect (OSTI)

    Ghatikar, Girish; Riess, David; Piette, Mary Ann

    2014-01-02

    This report reviews the Open Automated Demand Response (OpenADR) deployments within the territories serviced by California?s investor-owned utilities (IOUs) and the transition from the OpenADR 1.0 specification to the formal standard?OpenADR 2.0. As demand response service providers and customers start adopting OpenADR 2.0, it is necessary to ensure that the existing Automated Demand Response (AutoDR) infrastructure investment continues to be useful and takes advantage of the formal standard and its many benefits. This study focused on OpenADR deployments and systems used by the California IOUs and included a summary of the OpenADR deployment from the U.S. Department of Energy-funded demonstration conducted by the Sacramento Municipal Utility District (SMUD). Lawrence Berkeley National Laboratory collected and analyzed data about OpenADR 1.0 deployments, categorized architectures, developed a data model mapping to understand the technical compatibility of each version, and compared the capabilities and features of the two specifications. The findings, for the first time, provided evidence of the total enabled load shed and average first cost for system enablement in the IOU and SMUD service territories. The OpenADR 2.0a profile specification semantically supports AutoDR system architectures and data propagation with a testing and certification program that promotes interoperability, scaled deployments by multiple vendors, and provides additional features that support future services.

  14. Development of an Automated Decision-Making Tool for Supervisory Control System

    SciTech Connect (OSTI)

    Cetiner, Sacit M.; Muhlheim, Michael David; Flanagan, George F.; Fugate, David L.; Kisner, Roger A.

    2014-09-01

    This technical report was generated as a product of the Supervisory Control for Multi-Modular Small Modular Reactor (SMR) Plants project within the Instrumentation, Control and Human-Machine Interface technology area under the Advanced Small Modular Reactor (AdvSMR) Research and Development Program of the US Department of Energy. The report documents the definition of strategies, functional elements, and the structural architecture of a supervisory control system for multi-modular AdvSMR plants. This research activity advances the state of the art by incorporating real-time, probabilistic-based decision-making into the supervisory control system architectural layers through the introduction of a tiered-plant system approach. The report provides background information on the state of the art of automated decision-making, including the description of existing methodologies. It then presents a description of a generalized decision-making framework, upon which the supervisory control decision-making algorithm is based. The probabilistic portion of automated decision-making is demonstrated through a simple hydraulic loop example.

  15. Automated design synthesis of robotic/human workcells for improved manufacturing system design in hazardous environments

    SciTech Connect (OSTI)

    Williams, Joshua M.

    2012-06-12

    Manufacturing tasks that are deemed too hazardous for workers require the use of automation, robotics, and/or other remote handling tools. The associated hazards may be radiological or nonradiological, and based on the characteristics of the environment and processing, a design may necessitate robotic labor, human labor, or both. There are also other factors such as cost, ergonomics, maintenance, and efficiency that also effect task allocation and other design choices. Handling the tradeoffs of these factors can be complex, and lack of experience can be an issue when trying to determine if and what feasible automation/robotics options exist. To address this problem, we utilize common engineering design approaches adapted more for manufacturing system design in hazardous environments. We limit our scope to the conceptual and embodiment design stages, specifically a computational algorithm for concept generation and early design evaluation. In regard to concept generation, we first develop the functional model or function structure for the process, using the common 'verb-noun' format for describing function. A common language or functional basis for manufacturing was developed and utilized to formalize function descriptions and guide rules for function decomposition. Potential components for embodiment are also grouped in terms of this functional language and are stored in a database. The properties of each component are given as quantitative and qualitative criteria. Operators are also rated for task-relevant criteria which are used to address task compatibility. Through the gathering of process requirements/constraints, construction of the component database, and development of the manufacturing basis and rule set, design knowledge is stored and available for computer use. Thus, once the higher level process functions are defined, the computer can automate the synthesis of new design concepts through alternating steps of embodiment and function structure updates/decomposition. In the process, criteria guide function allocation of components/operators and help ensure compatibility and feasibility. Through multiple function assignment options and varied function structures, multiple design concepts are created. All of the generated designs are then evaluated based on a number of relevant evaluation criteria: cost, dose, ergonomics, hazards, efficiency, etc. These criteria are computed using physical properties/parameters of each system based on the qualities an engineer would use to make evaluations. Nuclear processes such as oxide conversion and electrorefining are utilized to aid algorithm development and provide test cases for the completed program. Through our approach, we capture design knowledge related to manufacturing and other operations in hazardous environments to enable a computational program to automatically generate and evaluate system design concepts.

  16. ENHANCING SEISMIC CALIBRATION RESEARCH THROUGH SOFTWARE AUTOMATION AND SCIENTIFIC INFORMATION MANAGEMENT

    SciTech Connect (OSTI)

    Ruppert, S D; Dodge, D A; Ganzberger, M D; Hauk, T F; Matzel, E M

    2007-07-06

    The National Nuclear Security Administration (NNSA) Ground-Based Nuclear Explosion Monitoring Research and Engineering (GNEM R&E) Program at LLNL has made significant progress enhancing the process of deriving seismic calibrations and performing scientific integration, analysis, and information management with software automation tools. Several achievements in schema design, data visualization, synthesis, and analysis were completed this year. Our tool efforts address the problematic issues of very large datasets and varied formats encountered during seismic calibration research. As data volumes have increased, scientific information management issues such as data quality assessment, ontology mapping, and metadata collection that are essential for production and validation of derived calibrations have negatively impacted researchers abilities to produce products. New information management and analysis tools have resulted in demonstrated gains in efficiency of producing scientific data products and improved accuracy of derived seismic calibrations. Significant software engineering and development efforts have produced an object-oriented framework that provides database centric coordination between scientific tools, users, and data. Nearly a half billion parameters, signals, measurements, and metadata entries are all stored in a relational database accessed by an extensive object-oriented multi-technology software framework that includes elements of stored procedures, real-time transactional database triggers and constraints, as well as coupled Java and C++ software libraries to handle the information interchange and validation requirements. Significant resources were applied to schema design to enable recording of processing flow and metadata. A core capability is the ability to rapidly select and present subsets of related signals and measurements to the researchers for analysis and distillation both visually (JAVA GUI client applications) and in batch mode (instantiation of multi-threaded applications on clusters of processors). Development of efficient data exploitation methods has become increasingly important throughout academic and government seismic research communities to address multi-disciplinary large scale initiatives. Effective frameworks must also simultaneously provide the researcher with robust measurement and analysis tools that can handle and extract groups of events effectively and isolate the researcher from the now onerous task of database management and metadata collection necessary for validation and error analysis. Sufficient information management robustness is required to avoid loss of metadata that would lead to incorrect calibration results in addition to increasing the data management burden. Our specific automation methodology and tools improve the researchers ability to assemble quality-controlled research products for delivery into the NNSA Knowledge Base (KB). The software and scientific automation tasks also provide the robust foundation upon which synergistic and efficient development of, GNEM R&E Program, seismic calibration research may be built.

  17. Automated High Throughput Protein Crystallization Screening at Nanoliter Scale and Protein Structural Study on Lactate Dehydrogenase

    SciTech Connect (OSTI)

    Fenglei Li

    2006-08-09

    The purposes of our research were: (1) To develop an economical, easy to use, automated, high throughput system for large scale protein crystallization screening. (2) To develop a new protein crystallization method with high screening efficiency, low protein consumption and complete compatibility with high throughput screening system. (3) To determine the structure of lactate dehydrogenase complexed with NADH by x-ray protein crystallography to study its inherent structural properties. Firstly, we demonstrated large scale protein crystallization screening can be performed in a high throughput manner with low cost, easy operation. The overall system integrates liquid dispensing, crystallization and detection and serves as a whole solution to protein crystallization screening. The system can dispense protein and multiple different precipitants in nanoliter scale and in parallel. A new detection scheme, native fluorescence, has been developed in this system to form a two-detector system with a visible light detector for detecting protein crystallization screening results. This detection scheme has capability of eliminating common false positives by distinguishing protein crystals from inorganic crystals in a high throughput and non-destructive manner. The entire system from liquid dispensing, crystallization to crystal detection is essentially parallel, high throughput and compatible with automation. The system was successfully demonstrated by lysozyme crystallization screening. Secondly, we developed a new crystallization method with high screening efficiency, low protein consumption and compatibility with automation and high throughput. In this crystallization method, a gas permeable membrane is employed to achieve the gentle evaporation required by protein crystallization. Protein consumption is significantly reduced to nanoliter scale for each condition and thus permits exploring more conditions in a phase diagram for given amount of protein. In addition, evaporation rate can be controlled or adjusted in this method during the crystallization process to favor either nucleation or growing processes for optimizing crystallization process. The protein crystals gotten by this method were experimentally proven to possess high x-ray diffraction qualities. Finally, we crystallized human lactate dehydrogenase 1 (H4) complexed with NADH and determined its structure by x-ray crystallography. The structure of LDH/NADH displays a significantly different structural feature, compared with LDH/NADH/inhibitor ternary complex structure, that subunits in LDH/NADH complex show open conformation or two conformations on the active site while the subunits in LDH/NADH/inhibitor are all in close conformation. Multiple LDH/NADH crystals were obtained and used for x-ray diffraction experiments. Difference in subunit conformation was observed among the structures independently solved from multiple individual LDH/NADH crystals. Structural differences observed among crystals suggest the existence of multiple conformers in solution.

  18. Effects of Levels of Automation for Advanced Small Modular Reactors: Impacts on Performance, Workload, and Situation Awareness

    SciTech Connect (OSTI)

    Johanna Oxstrand; Katya Le Blanc

    2014-07-01

    The Human-Automation Collaboration (HAC) research effort is a part of the Department of Energy (DOE) sponsored Advanced Small Modular Reactor (AdvSMR) program conducted at Idaho National Laboratory (INL). The DOE AdvSMR program focuses on plant design and management, reduction of capital costs as well as plant operations and maintenance costs (O&M), and factory production costs benefits.

  19. Vision 20/20: Automation and advanced computing in clinical radiation oncology

    SciTech Connect (OSTI)

    Moore, Kevin L. Moiseenko, Vitali; Kagadis, George C.; McNutt, Todd R.; Mutic, Sasa

    2014-01-15

    This Vision 20/20 paper considers what computational advances are likely to be implemented in clinical radiation oncology in the coming years and how the adoption of these changes might alter the practice of radiotherapy. Four main areas of likely advancement are explored: cloud computing, aggregate data analyses, parallel computation, and automation. As these developments promise both new opportunities and new risks to clinicians and patients alike, the potential benefits are weighed against the hazards associated with each advance, with special considerations regarding patient safety under new computational platforms and methodologies. While the concerns of patient safety are legitimate, the authors contend that progress toward next-generation clinical informatics systems will bring about extremely valuable developments in quality improvement initiatives, clinical efficiency, outcomes analyses, data sharing, and adaptive radiotherapy.

  20. Automated method and system for the alignment and correlation of images from two different modalities

    DOE Patents [OSTI]

    Giger, Maryellen L.; Chen, Chin-Tu; Armato, Samuel; Doi, Kunio

    1999-10-26

    A method and system for the computerized registration of radionuclide images with radiographic images, including generating image data from radiographic and radionuclide images of the thorax. Techniques include contouring the lung regions in each type of chest image, scaling and registration of the contours based on location of lung apices, and superimposition after appropriate shifting of the images. Specific applications are given for the automated registration of radionuclide lungs scans with chest radiographs. The method in the example given yields a system that spatially registers and correlates digitized chest radiographs with V/Q scans in order to correlate V/Q functional information with the greater structural detail of chest radiographs. Final output could be the computer-determined contours from each type of image superimposed on any of the original images, or superimposition of the radionuclide image data, which contains high activity, onto the radiographic chest image.

  1. Automated feature detection and identification in digital point-ordered signals

    DOE Patents [OSTI]

    Oppenlander, Jane E.; Loomis, Kent C.; Brudnoy, David M.; Levy, Arthur J.

    1998-01-01

    A computer-based automated method to detect and identify features in digital point-ordered signals. The method is used for processing of non-destructive test signals, such as eddy current signals obtained from calibration standards. The signals are first automatically processed to remove noise and to determine a baseline. Next, features are detected in the signals using mathematical morphology filters. Finally, verification of the features is made using an expert system of pattern recognition methods and geometric criteria. The method has the advantage that standard features can be, located without prior knowledge of the number or sequence of the features. Further advantages are that standard features can be differentiated from irrelevant signal features such as noise, and detected features are automatically verified by parameters extracted from the signals. The method proceeds fully automatically without initial operator set-up and without subjective operator feature judgement.

  2. CHANNEL MORPHOLOGY TOOL (CMT): A GIS-BASED AUTOMATED EXTRACTION MODEL FOR CHANNEL GEOMETRY

    SciTech Connect (OSTI)

    JUDI, DAVID; KALYANAPU, ALFRED; MCPHERSON, TIMOTHY; BERSCHEID, ALAN

    2007-01-17

    This paper describes an automated Channel Morphology Tool (CMT) developed in ArcGIS 9.1 environment. The CMT creates cross-sections along a stream centerline and uses a digital elevation model (DEM) to create station points with elevations along each of the cross-sections. The generated cross-sections may then be exported into a hydraulic model. Along with the rapid cross-section generation the CMT also eliminates any cross-section overlaps that might occur due to the sinuosity of the channels using the Cross-section Overlap Correction Algorithm (COCoA). The CMT was tested by extracting cross-sections from a 5-m DEM for a 50-km channel length in Houston, Texas. The extracted cross-sections were compared directly with surveyed cross-sections in terms of the cross-section area. Results indicated that the CMT-generated cross-sections satisfactorily matched the surveyed data.

  3. Automation, Control and Modeling of Compound Semiconductor Thin-Film Growth

    SciTech Connect (OSTI)

    Breiland, W.G.; Coltrin, M.E.; Drummond, T.J.; Horn, K.M.; Hou, H.Q.; Klem, J.F.; Tsao, J.Y.

    1999-02-01

    This report documents the results of a laboratory-directed research and development (LDRD) project on control and agile manufacturing in the critical metalorganic chemical vapor deposition (MOCVD) and molecular beam epitaxy (MBE) materials growth processes essential to high-speed microelectronics and optoelectronic components. This effort is founded on a modular and configurable process automation system that serves as a backbone allowing integration of process-specific models and sensors. We have developed and integrated MOCVD- and MBE-specific models in this system, and demonstrated the effectiveness of sensor-based feedback control in improving the accuracy and reproducibility of semiconductor heterostructures. In addition, within this framework we have constructed ''virtual reactor'' models for growth processes, with the goal of greatly shortening the epitaxial growth process development cycle.

  4. Process automation using combinations of process and machine control technologies with application to a continuous dissolver

    SciTech Connect (OSTI)

    Spencer, B.B.: Yarbro, O.O.

    1991-01-01

    Operation of a continuous rotary dissolver, designed to leach uranium-plutonium fuel from chopped sections of reactor fuel cladding using nitric acid, has been automated. The dissolver is a partly continuous, partly batch process that interfaces at both ends with batchwise processes, thereby requiring synchronization of certain operations. Liquid acid is fed and flows through the dissolver continuously, whereas chopped fuel elements are fed to the dissolver in small batches and move through the compartments of the dissolver stagewise. Sequential logic (or machine control) techniques are used to control discrete activities such as the sequencing of isolation valves. Feedback control is used to control acid flowrates and temperatures. Expert systems technology is used for on-line material balances and diagnostics of process operation. 1 ref., 3 figs.

  5. Automated high pressure cell for pressure jump x-ray diffraction

    SciTech Connect (OSTI)

    Brooks, Nicholas J.; Gauthe, Beatrice L. L. E.; Templer, Richard H.; Ces, Oscar; Seddon, John M.; Terrill, Nick J.; Rogers, Sarah E.

    2010-06-15

    A high pressure cell for small and wide-angle x-ray diffraction measurements of soft condensed matter samples has been developed, incorporating a fully automated pressure generating network. The system allows both static and pressure jump measurements in the range of 0.1-500 MPa. Pressure jumps can be performed as quickly as 5 ms, both with increasing and decreasing pressures. Pressure is generated by a motorized high pressure pump, and the system is controlled remotely via a graphical user interface to allow operation by a broad user base, many of whom may have little previous experience of high pressure technology. Samples are loaded through a dedicated port allowing the x-ray windows to remain in place throughout an experiment; this facilitates accurate subtraction of background scattering. The system has been designed specifically for use at beamline I22 at the Diamond Light Source, United Kingdom, and has been fully integrated with the I22 beamline control systems.

  6. Automated high-throughput flow-through real-time diagnostic system

    DOE Patents [OSTI]

    Regan, John Frederick

    2012-10-30

    An automated real-time flow-through system capable of processing multiple samples in an asynchronous, simultaneous, and parallel fashion for nucleic acid extraction and purification, followed by assay assembly, genetic amplification, multiplex detection, analysis, and decontamination. The system is able to hold and access an unlimited number of fluorescent reagents that may be used to screen samples for the presence of specific sequences. The apparatus works by associating extracted and purified sample with a series of reagent plugs that have been formed in a flow channel and delivered to a flow-through real-time amplification detector that has a multiplicity of optical windows, to which the sample-reagent plugs are placed in an operative position. The diagnostic apparatus includes sample multi-position valves, a master sample multi-position valve, a master reagent multi-position valve, reagent multi-position valves, and an optical amplification/detection system.

  7. Optimal Control and Coordination of Connected and Automated Vehicles at Urban Traffic Intersections

    SciTech Connect (OSTI)

    Zhang, Yue J.; Malikopoulos, Andreas; Cassandras, Christos G.

    2016-01-01

    We address the problem of coordinating online a continuous flow of connected and automated vehicles (CAVs) crossing two adjacent intersections in an urban area. We present a decentralized optimal control framework whose solution yields for each vehicle the optimal acceleration/deceleration at any time in the sense of minimizing fuel consumption. The solu- tion, when it exists, allows the vehicles to cross the intersections without the use of traffic lights, without creating congestion on the connecting road, and under the hard safety constraint of collision avoidance. The effectiveness of the proposed solution is validated through simulation considering two intersections located in downtown Boston, and it is shown that coordination of CAVs can reduce significantly both fuel consumption and travel time.

  8. Device and method for automated separation of a sample of whole blood into aliquots

    DOE Patents [OSTI]

    Burtis, Carl A.; Johnson, Wayne F.

    1989-01-01

    A device and a method for automated processing and separation of an unmeasured sample of whole blood into multiple aliquots of plasma. Capillaries are radially oriented on a rotor, with the rotor defining a sample chamber, transfer channels, overflow chamber, overflow channel, vent channel, cell chambers, and processing chambers. A sample of whole blood is placed in the sample chamber, and when the rotor is rotated, the blood moves outward through the transfer channels to the processing chambers where the blood is centrifugally separated into a solid cellular component and a liquid plasma component. When the rotor speed is decreased, the plasma component backfills the capillaries resulting in uniform aliquots of plasma which may be used for subsequent analytical procedures.

  9. Extending and automating a Systems-Theoretic hazard analysis for requirements generation and analysis.

    SciTech Connect (OSTI)

    Thomas, John

    2012-05-01

    Systems Theoretic Process Analysis (STPA) is a powerful new hazard analysis method designed to go beyond traditional safety techniques - such as Fault Tree Analysis (FTA) - that overlook important causes of accidents like flawed requirements, dysfunctional component interactions, and software errors. While proving to be very effective on real systems, no formal structure has been defined for STPA and its application has been ad-hoc with no rigorous procedures or model-based design tools. This report defines a formal mathematical structure underlying STPA and describes a procedure for systematically performing an STPA analysis based on that structure. A method for using the results of the hazard analysis to generate formal safety-critical, model-based system and software requirements is also presented. Techniques to automate both the analysis and the requirements generation are introduced, as well as a method to detect conflicts between the safety and other functional model-based requirements during early development of the system.

  10. Computerized detection of breast cancer on automated breast ultrasound imaging of women with dense breasts

    SciTech Connect (OSTI)

    Drukker, Karen Sennett, Charlene A.; Giger, Maryellen L.

    2014-01-15

    Purpose: Develop a computer-aided detection method and investigate its feasibility for detection of breast cancer in automated 3D ultrasound images of women with dense breasts. Methods: The HIPAA compliant study involved a dataset of volumetric ultrasound image data, views, acquired with an automated U-Systems SomoV{sup } ABUS system for 185 asymptomatic women with dense breasts (BI-RADS Composition/Density 3 or 4). For each patient, three whole-breast views (3D image volumes) per breast were acquired. A total of 52 patients had breast cancer (61 cancers), diagnosed through any follow-up at most 365 days after the original screening mammogram. Thirty-one of these patients (32 cancers) had a screening-mammogram with a clinically assigned BI-RADS Assessment Category 1 or 2, i.e., were mammographically negative. All software used for analysis was developed in-house and involved 3 steps: (1) detection of initial tumor candidates, (2) characterization of candidates, and (3) elimination of false-positive candidates. Performance was assessed by calculating the cancer detection sensitivity as a function of the number of marks (detections) per view. Results: At a single mark per view, i.e., six marks per patient, the median detection sensitivity by cancer was 50.0% (16/32) 6% for patients with a screening mammogram-assigned BI-RADS category 1 or 2similar to radiologists performance sensitivity (49.9%) for this dataset from a prior reader studyand 45.9% (28/61) 4% for all patients. Conclusions: Promising detection sensitivity was obtained for the computer on a 3D ultrasound dataset of women with dense breasts at a rate of false-positive detections that may be acceptable for clinical implementation.

  11. Signatures and Methods for the Automated Nondestructive Assay of UF6 Cylinders at Uranium Enrichment Plants

    SciTech Connect (OSTI)

    Smith, Leon E.; Mace, Emily K.; Misner, Alex C.; Shaver, Mark W.

    2010-08-08

    International Atomic Energy Agency (IAEA) inspectors currently perform periodic inspections at uranium enrichment plants to verify UF6 cylinder enrichment declarations. Measurements are typically performed with handheld high-resolution sensors on a sampling of cylinders taken to be representative of the facility’s entire cylinder inventory. These measurements are time-consuming, expensive, and assay only a small fraction of the total cylinder volume. An automated nondestructive assay system capable of providing enrichment measurements over the full volume of the cylinder could improve upon current verification practices in terms of manpower and assay accuracy. Such a station would use sensors that can be operated in an unattended mode at an industrial facility: medium-resolution scintillators for gamma-ray spectroscopy (e.g., NaI(Tl)) and moderated He-3 neutron detectors. This sensor combination allows the exploitation of additional, more-penetrating signatures beyond the traditional 185-keV emission from U-235: neutrons produced from F-19(α,n) reactions (spawned primarily from U 234 alpha emission) and high-energy gamma rays (extending up to 8 MeV) induced by neutrons interacting in the steel cylinder. This paper describes a study of these non-traditional signatures for the purposes of cylinder enrichment verification. The signatures and the radiation sensors designed to collect them are described, as are proof-of-principle cylinder measurements and analyses. Key sources of systematic uncertainty in the non-traditional signatures are discussed, and the potential benefits of utilizing these non-traditional signatures, in concert with an automated form of the traditional 185-keV-based assay, are discussed.

  12. SU-E-J-191: Automated Detection of Anatomic Changes in H'N Patients

    SciTech Connect (OSTI)

    Usynin, A; Ramsey, C [Thompson Cancer Survival Center Knoxville, TN (United States)

    2014-06-01

    Purpose: To develop a novel statistics-based method for automated detection of anatomical changes using cone-beam CT data. A method was developed that can provide a reliable and automated early warning system that enables a just-in-time adaptation of the treatment plan. Methods: Anatomical changes were evaluated by comparing the original treatment planning CT with daily CBCT images taken prior treatment delivery. The external body contour was computed on a given CT slice and compared against the corresponding contour on the daily CBCT. In contrast to threshold-based techniques, a statistical approach was employed to evaluate the difference between the contours using a given confidence level. The detection tool used the two-sample Kolmogorov-Smirnov test, which is a non-parametric technique that compares two samples drawn from arbitrary probability distributions. 11 H'N patients were retrospectively selected from a clinical imaging database with a total of 186 CBCT images. Six patients in the database were confirmed to have anatomic changes during the course of radiotherapy. Five of the H'N patients did not have significant changes. The KS test was applied to the contour data using a sliding window analysis. The confidence level of 0.99 was used to moderate false detection. Results: The algorithm was able to correctly detect anatomical changes in 6 out of 6 patients with an excellent spatial accuracy as early as at the 14th elapsed day. The algorithm provided a consistent and accurate delineation of the detected changes. The output of the anatomical change tool is easy interpretable, and can be shown overlaid on a 3D rendering of the patient's anatomy. Conclusion: The detection method provides the basis for one of the key components of Adaptive Radiation Therapy. The method uses tools that are readily available in the clinic, including daily CBCT imaging, and image co-registration facilities.

  13. Effects of Granular Control on Customers’ Perspective and Behavior with Automated Demand Response Systems

    SciTech Connect (OSTI)

    Schetrit, Oren; Kim, Joyce; Yin, Rongxin; Kiliccote, Sila

    2014-08-01

    Automated demand response (Auto-DR) is expected to close the loop between buildings and the grid by providing machine-to-machine communications to curtail loads without the need for human intervention. Hence, it can offer more reliable and repeatable demand response results to the grid than the manual approach and make demand response participation a hassle-free experience for customers. However, many building operators misunderstand Auto-DR and are afraid of losing control over their building operation. To ease the transition from manual to Auto-DR, we designed and implemented granular control of Auto-DR systems so that building operators could modify or opt out of individual load-shed strategies whenever they wanted. This paper reports the research findings from this effort demonstrated through a field study in large commercial buildings located in New York City. We focused on (1) understanding how providing granular control affects building operators’ perspective on Auto-DR, and (2) evaluating the usefulness of granular control by examining their interaction with the Auto-DR user interface during test events. Through trend log analysis, interviews, and surveys, we found that: (1) the opt-out capability during Auto-DR events can remove the feeling of being forced into load curtailments and increase their willingness to adopt Auto-DR; (2) being able to modify individual load-shed strategies allows flexible Auto-DR participation that meets the building’s changing operational requirements; (3) a clear display of automation strategies helps building operators easily identify how Auto-DR is functioning and can build trust in Auto-DR systems.

  14. Hydrogen Safety: First Responder Education

    Broader source: Energy.gov [DOE]

    2009 DOE Hydrogen Program and Vehicle Technologies Program Annual Merit Review and Peer Evaluation Meeting, May 18-22, 2009 -- Washington D.C.

  15. LANL responds to radiological incident

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Center(LANSCE). Aerial view of the Los Alamos Neutron Science Center (LANSCE). The contamination poses no danger to the public. The Laboratory is investigating the inadvertent...

  16. This form may be submitted to the EIA by mail, fax, e-mail, or...

    U.S. Energy Information Administration (EIA) Indexed Site

    business on the web.) To use this service, we recommend the use of Microsoft Internet Explorer 5.5 or later or Netscape 4.77 or later. Send your surveys using this secure...

  17. This form may be submitted to the EIA by mail, fax, e-mail, or...

    U.S. Energy Information Administration (EIA) Indexed Site

    over the web using secure, encrypted processes. (It is the same method that commercial companies communicate with customers when transacting business on the web.) To use this ...

  18. This form may be submitted to the EIA by mail, fax, e-mail, or...

    U.S. Energy Information Administration (EIA) Indexed Site

    over the web using secure, encrypted processes. (It is the same method that commercial companies use to communicate with customers when transacting business on the web.) To use ...

  19. This form may be submitted to the EIA by mail, fax, e-mail, or...

    U.S. Energy Information Administration (EIA) Indexed Site

    month." " since the last report, enter an ""X"" in the block:" " ",,,..."Mo",,,"Yea... "If this is a resubmission, enter an ""X"" in the block:",,,...

  20. This form may be submitted to the EIA by mail, fax, e-mail, or...

    U.S. Energy Information Administration (EIA) Indexed Site

    ,,," Version No: 2014.001" "ANNUAL REPORT OF THE ORIGIN OF NATURAL GAS LIQUIDS PRODUCTION" "FORM EIA-64A" "REPORT YEAR 2014" "This report is...