Powered by Deep Web Technologies
Note: This page contains sample records for the topic "apel org contact" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Applied Process Engineering Laborotory APEL | Open Energy Information  

Open Energy Info (EERE)

Laborotory APEL Jump to: navigation, search Name: Applied Process Engineering Laborotory (APEL) Place: United States Sector: Services Product: General Financial & Legal Services (...


@HCSE2014 Contact: organizers@hcse-conference.org Web: hcse-conference.org International Conference on  

E-Print Network (OSTI)

@HCSE2014 Contact: organizers@hcse-conference.org Web: hcse-conference.org HCSE 2014 5th International Conference on Human-Centered Software Engineering Paderborn, Germany hcse-conference.org September 16-18, 2014 Call for Participation HCSE is a single-track working conference that brings together

Paderborn, Universität


MEMBERS ONLY | Join | Renew | Shop | About | Contact Us | Home ASME.ORG > News & Public Policy > Press Releases > Research Begun on New Fuel Cell Type  

E-Print Network (OSTI)

SEARCH ASME: MEMBERS ONLY | Join | Renew | Shop | About | Contact Us | Home ASME.ORG > News, the magazine reports on a fuel cell that cleans domestic wastewater while producing electrical energy. This new, takes the high concentration of organic matter found in wastewater and coverts it to energy. "Where



Energy.gov (U.S. Department of Energy (DOE))

For information about Solid-State Lighting, contactJames BrodrickLighting Program ManagerBuilding Technologies OfficeU.S. Department of Energy1000 Independence Avenue, SWWashington, DC 205851-202...



NLE Websites -- All DOE Office Websites (Extended Search)

Contact Information Contact Information > Content on this page requires a newer version of Adobe Flash Player. Get Adobe Flash player July 31, 1942 The Army Corp of Engineers leases 1,025 acres of the Cook County Forest Preserve to build a research facility. November 1942 Under the direction of Enrico Fermi, a group of scientists at the University of Chicago begin building Chicago Pile-1 (CP-1). Security and secracy were essential. December 2, 1942 Enrico Fermi's team creates the world's first self-sustaining nuclear chain reaction using the CP-1 reactor under Stagg Field at the University of Chicago. CP-1 1943 The experiments under Stagg Field shut down, and the scientists move to a 19 acre section of the leased forest preserve, known as Site A. CP-1 is



Gasoline and Diesel Fuel Update (EIA)

Contacts Contacts The International Energy Outlook 2011 was prepared under the general direction of John Conti, Assistant Administrator for Energy Analysis (john.conti@eia.gov, 202-586-2222), and Paul Holtberg, Team Leader, Analysis Integration Team (paul.holtberg@eia. gov, 202-586-1284). General questions concerning the content of this report may be directed to the Office of Communications (202-586-8800). Specific questions about the report should be referred to Linda E. Doman (linda.doman@eia.gov, 202-586-1041) or the following analysts: World energy demand and economic outlook ..................................... Linda E. Doman (linda.doman@eia.gov, 202-586-1041) Macroeconomic assumptions .............. Kay A. Smith (kay.smith@eia.gov, 202-586-1132)


ORISE: Contact Us - Scientific Peer Review  

NLE Websites -- All DOE Office Websites (Extended Search)

Contact Us Tony Lester Senior Associate Director, Scientific Assessment and Workforce Development Work: 865.576.3304 peerreview@orau.org...


2004 Geological Society of America. For permission to copy, contact Copyright Permissions, GSA, or editing@geosociety.org. Geology; January 2004; v. 32; no. 1; p. 58; DOI 10.1130/G19957.1; 2 figures; Data Repository item 2004001. 5  

E-Print Network (OSTI)

2004 Geological Society of America. For permission to copy, contact Copyright Permissions, GSA, or editing@geosociety.org. Geology; January 2004; v. 32; no. 1; p. 5­8; DOI 10.1130/G19957.1; 2 figures; Data a speleothem-based ab- solutely dated record (using uranium-series data) of climate change for the southwestern

Asmerom, Yemane


ORISE: Contacts for Environmental Assessments and Health Physics...  

NLE Websites -- All DOE Office Websites (Extended Search)

Contact us Sarah Roberts, CHP Senior Associate Director; Health, Energy and Environment Work: 865.576.3180 IVsurveys@orau.org Tim Vitkus, CHP IEAV Associate Director Work:...


Media Contacts  

NLE Websites -- All DOE Office Websites (Extended Search)

Media Contacts Media Contacts ORO Public Affairs Office Mike Koentop, Acting Director P.O. Box 2001, M-4 Oak Ridge, TN 37831 (865) 576-0885 or 1-800-382-6938, Option 1 ORNL Communications and External Relations Claire Sinclair Oak Ridge National Laboratory P.O. Box 2008, MS-6269 Oak Ridge, TN 37831 (865) 576-7710 sinclairca@ornl.gov UCOR Public Affairs Fran Smith P.O. Box 4699, MS-7298 Oak Ridge, TN 37831 (865) 241-4690 or 1-800-382-6938, Option 4 B&W Y-12 Public Affairs Alice Brandon P.O. Box 2009 Oak Ridge, TN 37831-8245 (865) 576-2963 brandonam@y12.doe.gov Oak Ridge Institute for Science and Education Pam Bonee, Director of Communications P.O. Box 117 Oak Ridge, TN 37831-0117 (865) 576-3147 Pam.Bonee@orau.org American Museum of Science and Energy Lissa Clarke 300 South Tulane Ave.


LEDSGP/Transportation Toolkit/Contact Us | Open Energy Information  

Open Energy Info (EERE)

Contact Us Contact Us < LEDSGP‎ | Transportation Toolkit Jump to: navigation, search LEDSGP Logo.png Transportation Toolkit Home Tools Training Contacts Contacts for the LEDS GP Transport Working Group If you have questions or comments about the Transportation Toolkit, . Powered by OpenEI ledsgp.org is built on the same platform as the popular Wikipedia site. Like Wikipedia, it is a "wiki" or website developed collaboratively by a community of users. Thanks to our unique relationship with OpenEI.org, you can add or edit most content on ledsgp.org. For more information about this unique collaboration, contact us. View or edit this page on OpenEI.org. Retrieved from "http://en.openei.org/w/index.php?title=LEDSGP/Transportation_Toolkit/Contact_Us&oldid=690462


Clinical/Hospital Volunteer Contacts Local Hospitals  

E-Print Network (OSTI)

Clinical/Hospital Volunteer Contacts Local Hospitals: Crouse Hospital Pennie Stagnitta Reverend Center - http://www.schcny.com/volunteers/ Community General Hospital - http://cgh-home.org/site2/index.php?option=com_content&view=article&id=86&Itemid=57 St. Joseph's Hospital Health Center - http://www.sjhsyr.org/sjhhc/stj_about_8.asp

Kovalev, Leonid


Note: This copy is for your personal, non-commercial use only. To order presentation-ready copies for distribution to your colleagues or clients, contact us at www.rsna.org/rsnarights.  

E-Print Network (OSTI)

.J.H.); Department of Radiology, Harvard Medical School, Boston, Mass (S.J.A.); Division of Pediatric Radiology, DukeSPECIALREPORT Radiology: Volume 258: Number 3--March 2011 n radiology.rsna.org 889 Managing Radiation Use in Medical the Department of Radiology, Memorial Sloan- Kettering Cancer Center, 1275 York Ave, Suite C-278, New York, NY (H

Brenner, David Jonathan


Contact Us  

Energy.gov (U.S. Department of Energy (DOE))

For general questions regarding the Bioenergy Technologies Office, please use the contact information below.



Science Journals Connector (OSTI)

... type contacts mainly find application on instrument-control switches, control-circuit contacts or interlocks on contactor gear. Rarely rated above 5 amp. at 440volts, their contacts are usually of ... action takes place which assists oxide removal. Line butt-type contacts arealso chiefly associated with contactor apparatus. In these, heavy pressures are applied, generally to the main poles of ...




NLE Websites -- All DOE Office Websites (Extended Search)

chemistryworld.org 46 | Chemistry World | April 2010 Catalysts for green energy A catalytic collaboration In a new collaborative effort to develop better catalysts for energy...


PNNL: Contacts  

NLE Websites -- All DOE Office Websites (Extended Search)

Contacts Contacts Have a Question or Comment? Please use our feedback form. We would love to hear from you. Looking for a Staff Member at PNNL? Use our searchable staff directory to find staff contact information. Information returned includes staff name and telephone number. Phone Numbers and Addresses View our phone and address book for mailing addresses and important phone numbers PNNL Contacts Contacts Home Phone and Address Book Staff Directory Richland Building Addresses Visitor Information Encrypted Email Communication Contact us Feedback Form Laboratory Contact Info PNNL Mailing Address Pacific Northwest National Laboratory P.O. Box 999 Richland, WA 99352 PNNL Street Address Pacific Northwest National Laboratory 902 Battelle Boulevard Richland, WA PNNL Toll Free 1-888-375-PNNL (7665)



E-Print Network (OSTI)

CLINICAL/HOSPITAL VOLUNTEER CONTACTS Local Hospitals: Crouse Hospital Pennie Stagnitta (315) 470 Rhonda M. Butler (315) 464-5180 ButlerR@upstate.edu http://www.upstate.edu/hospital/volunteers/ VA University Hospital at Community General http://www.cgh-home.org/ St. Joseph's Hospital Health Center http

McConnell, Terry


WINDExchange: Contacts  

Wind Powering America (EERE)

WINDExchange is a resource of the Department of Energy's Wind Program. Contact Us | Wind Program | Office of Energy Efficiency & Renewable Energy Content Last Updated: 114...


Contact Us  

NLE Websites -- All DOE Office Websites (Extended Search)

Contact Us Contact Us Contact Us Your comments, questions, and feedback about this web site and the Depleted UF6 Conversion EISs are welcomed. Please contact us with any questions or comments you may have about the Depleted UF6 Conversion EIS or the Depleted UF6 Management Program web site. Your questions or comments will be forwarded to the appropriate persons to answer or provide assistance. The purpose of this web site is to inform and involve the public in the Depleted UF6 Management Program, including the Depleted UF6 Conversion EIS process. We want it to meet your needs. Please feel free to make suggestions about additional features or services you would like to see on this web site, or ways you think we could improve the site. For general questions or comments about the Depleted UF6 Management Program web site or the Depleted UF6 Conversion EIS, contact us at: duf6webmaster@anl.gov.

Note: This page contains sample records for the topic "apel org contact" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


ContactInformation Contact Information  

E-Print Network (OSTI)

's only fully accredited institute of higher learning offering graduate education in the field of Steel Institute of Ferrous Technology(GIFT) Admissions Timeline Semester Begins Application Deadline September 1ContactInformation Contact Information For More Information We look forward to receiving your

Sung, Wokyung


Contact Us  

NLE Websites -- All DOE Office Websites (Extended Search)

Contact Us Contact Us Contact Us Focusing on methods and computational tools used to help sequence, assemble, and finish genomes, including new sequencing technologies. If you have any questions, or if you require further information, please contact Chris Detter at (505) 667-1326 or cdetter@lanl.gov. The 2013 "Sequencing, Finishing and Analysis in the Future" Organizing Committee: Chris Detter, Ph.D., JGI-LANL Center Director, Los Alamos National Laboratory (LANL) Johar Ali, Ph.D., Technology Development Team Leader, Ontario Institute for Cancer Research (OICR) Patrick Chain, Metagenomics Team Leader, Los Alamos National Laboratory (LANL) Michael Fitzgerald, Finishing Manager, Broad Institute Bob Fulton, M.S., Sequence Improvement Group Leader, Washington University


TVDG Contacts  

NLE Websites -- All DOE Office Websites (Extended Search)

Contact Information Contact Information To Obtain More Information About The Brookhaven National Laboratory Tandem Van de Graaff, Contact us by any of the means listed below: Phone By Telephone: 1 631 344 4581 Ask for Sandy Fax By Fax: 1 631 344 4583 Attention Chuck Carlson EMail By E-Mail: Send E-Mail to Chuck Carlson SmileMail By Snail Mail: Chuck Carlson Building 901A Upton, N.Y. 11973-5000 USA Phone Preinjecors Group Leader James Alessi Telephone: 1-631-344-7563 E-Mail: Jim Alessi Information can be returned by Fax or Snail Mail. If you do not receive the requested information within 3 to 5 days, please call 1 631 344 4581. An organizational list of staff members and how to contact them. The BNL E-Mail and Telephone Directory for the entire lab. Return to TVDG Home Page. List of Ions, Energies, LETs, Ranges. Facility Useage Calendar


Contact Us  

NLE Websites -- All DOE Office Websites (Extended Search)

Contact Us Contact Us Contact Us ESnet Administration Operations Research Outreach and Communications Greg Bell Division Director Scientific Networking Division grbell@es.net Administrative Contact Shorei Butler smbutler@es.net (510) 486-6304 (510) 486-6712 [fax] Postal Address Lawrence Berkeley National Laboratory Energy Sciences Network 1 Cyclotron Road Mail stop 50A-3111 Berkeley, CA 94720 Visiting ESnet Visitor page for Lawrence Berkeley National Lab ESnet is monitored on a 24-hour-per-day basis by the ESnet networking staff located at Lawrence Berkeley National Laboratory. Our staff is available 8 a.m. to 5 p.m. P.T. Monday through Friday. Call ESnet NOC (Network Operation Center) From inside U.S.: 1 (800) 333-7638 1 (800) 33 ESnet Globally: 1 (510) 486-7600 1 (510) 486-7607


Website Contact  

Energy.gov (U.S. Department of Energy (DOE))

Contact the website administrator with questions, comments, or issues related to the Federal Energy Management Program website. If your inquiry is in regard to a specific Web page, please include...


WINDExchange: Contacts  

Wind Powering America (EERE)

questions, please contact the Webmaster. Photo of Patrick Gilman Patrick Gilman Wind Energy Deployment Manager, U.S. Department of Energy 720-356-1420 Photo of Ian Baring-Gould...


Contacting DSW  

NLE Websites -- All DOE Office Websites (Extended Search)

Environmental Review-NEPA Operations & Maintenance Planning & Projects Power Marketing Rates Environmental Review-NEPA Operations & Maintenance Planning & Projects Power Marketing Rates Contact the Desert Southwest Regional Office Mailing Address: P.O. BOX 6457 Phoenix, Arizona 85005-6457 602-605-2525 Toll Free: 1-800-682-6557 Fax: 602-605-2630 Employee INFO Line: 602-605-INFO (4636) DSW Organizational chart with phone numbers Customer Requests Marketing Services (602) 605-2585 Transmission Services For Transmission Requests, Interconnection Requests, or Large/Small Generation Interconnection Requests please contact a member of our Transmission Business Unit. WALC Transmission Phone - (602) 605-2774 After Hours Support (602) 803-7319 CRSP Transmission Phone - (801) 524-4012 Fax - (801) 524-5017 Other Service Requests Please Choose one of the following:


Contacting Fermilab  

NLE Websites -- All DOE Office Websites (Extended Search)

Contact Information Mailing address: Fermilab P.O. Box 500 Batavia, IL 60510-5011 Phone (630) 840 3000 Fax (630) 840 4343 Shipping address: Fermilab Receiving Wilson and Kirk Roads Batavia, IL 60510-5011 Phone (630) 840 3575 Email Fermilab Useful public email contacts at Fermilab. Web Questions Fermilab Phone Directory and Yellow Pages Office of Communication Phone (630) 840 3351 Fax (630) 840 8780 fermilab@fnal.gov Employment Opportunities Vendor Information Phone: (630) 840 3521 Neutron Therapy Phone: (630) 840 3865 Community Forum A form for Fermilab's neighbors to submit questions and concerns. We respond and post answers weekly. Order Fermilab brochures online Submit the online form, we send the brochures through the mail. Order Fermilab merchandise online Browse Fermilab's online store for t-shirts, jackets, coffee mugs or other


WorldWideScience.org Goes Multilingual | OSTI, US Dept of Energy, Office of  

Office of Scientific and Technical Information (OSTI)

org Goes Multilingual org Goes Multilingual News Media Contact: Cathey Daniels, OSTI, (865) 576-9539 FOR IMMEDIATE RELEASE Friday, June 11, 2010 WorldWideScience.org Goes Multilingual OAK RIDGE, TN - Now you can find non-English scientific literature from databases in China, Russia, France, and several Latin American countries and have your search results translated into one of nine languages. With the beta launch today (view the Office of Science announcement) of Multilingual WorldWideScience.org, real-time searching and translation of globally-dispersed collections of scientific literature is possible. This new capability is the result of an international public-private partnership between the WorldWideScience.org Alliance and Microsoft Research, whose translation technology has been paired with the federated searching


India Added to WorldWideScience.org | OSTI, US Dept of Energy, Office of  

Office of Scientific and Technical Information (OSTI)

India Added to WorldWideScience.org India Added to WorldWideScience.org NEWS MEDIA CONTACT: Cathey Daniels, (865) 576-9539 FOR IMMEDIATE RELEASE January 29, 2008 India Added to WorldWideScience.org Online gateway makes world's science available to citizens everywhere Oak Ridge, TN - WorldWideScience.org, the online gateway that makes the world's science readily available to researchers and citizens alike, recently added four important science sources from India to its global reach. Users can search these and many other science sources from a single entry point and retrieve the most current science findings in fields such as energy, medicine, agriculture and basic sciences. The addition of India effectively doubled the percentage of the world's population represented in the searches of WorldWideScience.org. The newest


Institution Name Institution Name Address Place Zip Notes Website Region  

Open Energy Info (EERE)

Washington Second Washington Second Avenue Suite Seattle Washington http www archventure com Pacific Northwest Area Applied Process Engineering Laboratory Applied Process Engineering Laboratory Hills Street Suite Richland Washington http www apel org contact html Pacific Northwest Area Big Sky Carbon Sequestration Partnership Big Sky Carbon Sequestration Partnership University Way rd Floor Bozeman Montana One of the US DOE s seven regional carbon sequestration partnerships http www bigskyco2 org Pacific Northwest Area Clean Edge Inc Clean Edge Inc Portland Oregon http www cleanedge com Pacific Northwest Area Northwest National Marine Renewable Energy Center Northwest National Marine Renewable Energy Center th Ave Seattle Washington http depts washington edu nnmrec Pacific Northwest Area


Media Contacts  

NLE Websites -- All DOE Office Websites (Extended Search)

Media Contacts Media Contacts Allan Chen A_Chen@lbl.gov (510) 486-4210 Jon Weiner JRWeiner@lbl.gov (510) 486-4014 Gregory Rosenquist GJRosenquist@lbl.gov (510) 486-6851 Richard Brown REBrown@lbl.gov (510) 486-5896 Alan Meier AKMeier@lbl.gov (510) 486-4740 Bruce Nordman BNordman@lbl.gov (510) 486-7089 Nancy Brown NJBrown@lbl.gov (510) 486-4241 Marc Fischer MLFischer@lbl.gov (510) 486-5539 Melissa Lunden MMLunden@lbl.gov (510) 486-4891 Brett Singer BCSinger@lbl.gov (510) 486-4779 Thomas Kirchstetter TWKirchstetter@lbl.gov (510) 486-7071 Melissa Lunden MMLunden@lbl.gov (510) 486-4891 Tihomir Novakov TNovakov@lbl.gov (510) 486-6928 Marc Fischer MLFischer@lbl.gov (510) 486-5539 Vincent Battaglia VSBattaglia@lbl.gov (510) 486-7172 Guoying Chen GChen@lbl.gov (510) 486-5843


NETL: Contact  

NLE Websites -- All DOE Office Websites (Extended Search)

NETL NETL Contact NETL Addresses for the National Energy Technology Laboratories: U.S. Department of Energy National Energy Technology Laboratory 626 Cochrans Mill Road P.O. Box 10940 Pittsburgh, PA 15236-0940 (Street Address: 626 Cochrans Mill Road, Jefferson Hills, PA) GPS Coordinates: Administration Gate: 40.301226,-79.977729 R&D Gate: 40.305089,-79.975006 U.S. Department of Energy National Energy Technology Laboratory 3610 Collins Ferry Road P.O. B ox 880 Morgantown, WV 26507-0880 GPS Coordinates: 39.67234,-79.977347 U.S. Department of Energy National Energy Technology Laboratory 13131 Dairy Ashford Road, Suite 225 Sugar Land, TX 77478-4396 GPS Coordinates: 29.625885,-95.602004 U.S. Department of Energy National Energy Technology Laboratory Arctic Energy Office


David Cappaert, , www.forestryimages.org  

E-Print Network (OSTI)

;EUROPEAN WOOD WASP Kevin Dodds, USDA Forest Service, www.forestryimages.org. #12;K. Loeffler, Cornell Univ.org forestryimages.org European wood wasp #12;European wood wasp Forestryimages.org #12;· · 2004 Oswego, NY European wood wasp #12;European wood wasp #12;15St. Louis 32Total 4Carlton 3Sherburne 7Hennepin 3Anoka Sites

Minnesota, University of


Multilingual WorldWideScience.org Launch Broadens Access to Global Science  

Office of Science (SC) Website

Multilingual Multilingual WorldWideScience.org Launch Broadens Access to Global Science News Featured Articles Science Headlines 2014 2013 2012 2011 2010 2009 2008 2007 2006 2005 Presentations & Testimony News Archives Contact Information Office of Science U.S. Department of Energy 1000 Independence Ave., SW Washington, DC 20585 P: (202) 586-5430 06.11.10 Multilingual WorldWideScience.org Launch Broadens Access to Global Science Print Text Size: A A A Subscribe FeedbackShare Page Washington, D.C. - Scientific language barriers were broken today in Helsinki with the launch of Multilingual WorldWideScience.org External link . While a large share of scientific literature is published in English, vast quantities of high-quality science are not, and the pace of non-English scientific publishing is increasing. WorldWideScience.org External link


Find and share global research with new tools at WorldWideScience.org |  

Office of Scientific and Technical Information (OSTI)

Find and share global research with new tools at WorldWideScience.org Find and share global research with new tools at WorldWideScience.org NEWS MEDIA CONTACT: Cathey Daniels, (865) 576-9539 FOR IMMEDIATE RELEASE Friday, June 26, 2009 Find and share global research with new tools at WorldWideScience.org You can now quickly hone your research results list to the documents you need and then share them via social networking sites using the new features at WorldWideScience.org. This free online science gateway to global databases now offers clustering of results by publication and author, as well as by topic and date. This enhancement allows you to quickly narrow a results list from the databases of approximately 60 countries to the research you are seeking. Using a quick share tool, you can add your results to social networking


WorldWideScience.org: China's Participation Expands Access to Global  

Office of Scientific and Technical Information (OSTI)

org: China's Participation Expands Access to Global org: China's Participation Expands Access to Global Science NEWS MEDIA CONTACT: Cathey Daniels, (865) 576-9539 FOR IMMEDIATE RELEASE Wednesday, June 10, 2009 WorldWideScience.org: China's Participation Expands Access to Global Science Ottawa, Canada Government officials today formalized the addition of the People's Republic of China as the most recent member of the WorldWideScience Alliance. The signing ceremony was held in Ottawa, Canada. The addition of the Chinese database, from the Institute of Scientific and Technical Information of China, means that WorldWideScience.org, the global science gateway, now searches science and technology research and development results from 80 percent of the world's population. The multilateral WorldWideScience Alliance was established in June 2008 to


NETL Contact Information  

NLE Websites -- All DOE Office Websites (Extended Search)

NETL Contact Information Emergency Response Contact U.S. Department of Energy National Energy Technology Laboratory PITTSBURGH, PA 626 Cochrans Mill Road P.O. Box 10940 Pittsburgh,...


Provider Contact Information  

NLE Websites -- All DOE Office Websites (Extended Search)

Provider Contact Information A comprehensive benefits package with plan options for health care and retirement to take care of our employees today and tomorrow. Contacts...


Contact Us | Department of Energy  

NLE Websites -- All DOE Office Websites (Extended Search)

Us Contact Us Contact Us Student and Recent Graduate Contacts List of recruiter liaisons for student and other employment opportunities. Veteran's Contacts Lists veteran...

Note: This page contains sample records for the topic "apel org contact" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Chemical Management Contacts  

Energy.gov (U.S. Department of Energy (DOE))

Contacts for additional information on Chemical Management and brief description on Energy Facility Contractors Group


Contacts | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Contacts Contacts Contacts November 1, 2013 - 11:40am Addthis Contact information for the Industrial Distributed Energy Program is provided below. Industrial Distributed Energy - Research & Development Bob Gemmer Technology Manager Telephone: 202-586-5885 MS EE-2F 1000 Independence Ave., SW Washington, DC 20585 Industrial Distributed Energy - Technical Assistance Katrina Pielli Senior Policy Advisor Telephone: 202-287-5850 MS EE-20 1000 Independence Ave., SW Washington, DC 20585 If you are looking for other DOE contacts, you can look up their contact information by using the DOE Online Telephone Directory. Addthis Related Articles Webcasts Legislative Initiatives Contacts News January 15, 2014 FACTSHEET: Next Generation Power Electronics Manufacturing Innovation Institute


CancerProgressReport.org // AACR.org // #CancerProgress14 AACR CANCER  

E-Print Network (OSTI)

CancerProgressReport.org // AACR.org // #CancerProgress14 AACR CANCER PROGRESS REPORT 2014 TRA NSFO RMING LIVES THRO UG H RE SE ARC H #12;CancerProgressReport.org // AACR.org // #CancerProgress14 AACR CANCER PROGRESS REPORT 2014 TRANSFORMING LIVES THROUGH RESEARCH #12;II AACR Cancer Progress Report 2014

Sherman, S. Murray


Climate VISION: Contact Us  

Office of Scientific and Technical Information (OSTI)

CONTACT US CONTACT US General Contact Information Please contact the individuals below for all general questions about information found on this website. Department of Energy Contact Russell Conklin Policy Analyst U.S. Climate Change Technology Program U.S. Department of Energy Office of Climate Change Policy and Technology (PI-50) 202-586-8339 Web Site Contacts Matt Antes 410-953-6218 Energetics, Incorporated Or Rebecca Gordon 202-406-4138 Energetics, Incorporated Private Sector Initiatives Contact Information Please contact the individuals below for questions about information found on this website regarding the private sector initiatives. Collapse all | Expand all Aluminum - Contacts Association Climate VISION Lead Bob Streiter Aluminum Association 900 19th Street, NW Washington, D.C. 20006


LEDS Collaboration in Action Workshop Contact Us | Open Energy Information  

Open Energy Info (EERE)

source source History View New Pages Recent Changes All Special Pages Semantic Search/Querying Get Involved Help Apps Datasets Community Login | Sign Up Search Page Edit History Facebook icon Twitter icon » LEDS Collaboration in Action Workshop Contact Us Jump to: navigation, search LEDSGP Logo.png Advancing climate-resilient low emission development around the world Home About Tools Expert Assistance Events Publications Join Us ACDS Workshop Participant Pack Agenda Accommodations Participants Location Arrival Form Open Space Sessions Speakers Presentations Links Contact Us Contact Us For any questions please contact: LEDS Global Partnership Secretariat U.S. National Renewable Energy Laboratory Sadie.Cox@nrel.gov +1 303 384 7391 Powered by OpenEI ledsgp.org is built on the same platform as the popular Wikipedia site.


Contacts | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Contacts Contacts Contacts October 9, 2013 - 3:24pm Addthis Website and office contacts are provided below. Website Contact Send us your comments, report problems, and/or ask questions about information on this website. Office Contacts Contact information for the Advanced Manufacturing Office (AMO). Addthis Related Articles Legislative Initiatives Funding Opportunities Contacts News November 22, 2013 In Cleveland, Alcoa and ArcelorMittal Recognized for Leadership in Energy Efficiency As Part of Obama Administration's Better Plants Program, U.S. Manufacturers Cut Energy Waste and Save Money October 21, 2013 FACT SHEET: Energy Department Actions to Deploy Combined Heat and Power, Boost Industrial Efficiency Underscoring President Obama's Climate Action Plan to cut harmful emissions and double energy efficiency, the Energy Department is taking


Contacts | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Contacts Contacts Contacts October 9, 2013 - 3:24pm Addthis Website and office contacts are provided below. Website Contact Send us your comments, report problems, and/or ask questions about information on this website. Office Contacts Contact information for the Advanced Manufacturing Office (AMO). Addthis Related Articles Contacts U.S. Clean Heat and Power Association International District Energy Association News November 22, 2013 In Cleveland, Alcoa and ArcelorMittal Recognized for Leadership in Energy Efficiency As Part of Obama Administration's Better Plants Program, U.S. Manufacturers Cut Energy Waste and Save Money October 21, 2013 FACT SHEET: Energy Department Actions to Deploy Combined Heat and Power, Boost Industrial Efficiency Underscoring President Obama's Climate Action Plan to cut harmful


Thermal contact resistance  

E-Print Network (OSTI)

This work deals with phenomena of thermal resistance for metallic surfaces in contact. The main concern of the work is to develop reliable and practical methods for prediction of the thermal contact resistance for various ...

Mikic, B. B.



Point-contact spectroscopy  

Science Journals Connector (OSTI)

Micro-contacts between metals at low temperatures reveal non-linear structures in the current-voltage characteristics. These deviations from Ohm's law allow an energy-resolved spectroscopy of the interaction of the conduction electrons with elementary excitations (e.g. phonons) in a metal. To explain the method, the important parameters (electron mean free path versus contact dimension) in point-contact spectroscopy will be discussed together with examples of spectroscopic information obtained in various systems. Local temperature gradients in the contact region offer the possibility to study thermo-electric phenomena in small constrictions, such as thermal voltages in non-homogeneous contacts and quenching of the phonon-drag term in the thermo-power in homogeneous contacts. Besides these aspects of the point-contact technique, recent experiments will be shown with applications of point contacts other than just spectroscopy: magneto-resistance of a point contact, high-frequency rectification with a point contact as the non-linear element, electron focusing using a double point-contact set-up, electrical noise in constrictions and generation of phonons by means of point contacts.

A M Duif; A G M Jansen; P Wyder



Microcontrollers Images: http://en.wikipedia.org/wiki/File:Digital_Multimeter_Aka.jpg, http://en.wikipedia.org/wiki/File:Resistors_color_code.jpg, http://en.wikipedia.org/wiki/File:Lm356.jpg , http://en.wikipedia.org/  

E-Print Network (OSTI)

://en.wikipedia.org/wiki/File:Digital_Multimeter_Aka.jpg, http://en.wikipedia.org/wiki/File:Resistors_color_code.jpg, http://en.wikipedia.org/wiki/File:Lm356.jpg://en.wikipedia.org/wiki/File:Digital_Multimeter_Aka.jpg, http://en.wikipedia.org/wiki/File:Resistors_color_code.jpg, http://en.wikipedia.org/wiki/File:Lm356.jpg://en.wikipedia.org/wiki/File:Digital_Multimeter_Aka.jpg, http://en.wikipedia.org/wiki/File:Resistors_color_code.jpg, http://en.wikipedia.org/wiki/File:Lm356.jpg

Smith, James Andrew


Clean Cities: Coalition Contacts  

Alternative Fuels and Advanced Vehicles Data Center (EERE)

Contacts Contacts Clean Cities coordinators are the primary contacts for their coalitions. Coordinators work with local fleets to develop and implement strategic plans to reduce petroleum use in the cities and counties they serve. Clean Cities coordinators lead nearly 100 local coalitions in communities across the country. For national-level and regional-level contacts, see program contacts. Map of Clean Cities collation locations. Sort by State Sort by First Name Sort by Last Name Sort by Coalition Sort by Region Phone Contact Info Alabama Mark Bentley Alabama Clean Fuels Coalition Southeast 205-402-2755 Mark Bentley See Bio 200 Century Park S, Ste 112 Birmingham, AL 35226 Website Arizona Colleen Crowninshield Tucson Clean Cities South Central 520-792-1093 x426


Business Operations Contacts  

Office of Energy Efficiency and Renewable Energy (EERE)

If you have a question for the Office of Business Operations, you can use this contact information to reach the office you're interested in:


Contacts | Argonne National Laboratory  

NLE Websites -- All DOE Office Websites (Extended Search)

Contacts Postdoc Portal The Postdoctoral Office of Argonne provides all Postdocs at Argonne access to our sharepoint postdoc site. This site has information about special...


Golden Field Office Contacts  

Energy.gov (U.S. Department of Energy (DOE))

Field contacts at the U.S. Department of Energy's Golden Field Office who support the Federal Energy Management Program (FEMP)


Federal NEPA Contacts  

Energy.gov (U.S. Department of Energy (DOE))

CEQ and most Federal agencies identify primary points of contact for NEPA compliance. Normally a senior environmental professional, environmental law attorney, or member of agency leadership, these...


ARM - AAF Contacts  

NLE Websites -- All DOE Office Websites (Extended Search)

Atmospheric Research The DOE ARM Aerial Facility Field Campaigns AAF Campaigns 2007 - UAV Campaigns 1993 - 2006, 2015 Other Aircraft Campaigns 1993 - 2010 AAF Contacts Rickey...


Optical contact micrometer  

SciTech Connect

Certain examples provide optical contact micrometers and methods of use. An example optical contact micrometer includes a pair of opposable lenses to receive an object and immobilize the object in a position. The example optical contact micrometer includes a pair of opposable mirrors positioned with respect to the pair of lenses to facilitate viewing of the object through the lenses. The example optical contact micrometer includes a microscope to facilitate viewing of the object through the lenses via the mirrors; and an interferometer to obtain one or more measurements of the object.

Jacobson, Steven D.



Contacts / Hours - Hanford Site  

NLE Websites -- All DOE Office Websites (Extended Search)

Station Real Time Met Data from Around the Site Current HMS Observations Daily HMS Extremes in Met Data Met and Climate Data Summary Products Contacts Hours Current NWS...


IEEE Computer Society: http://computer.org Computer: http://computer.org/computer  

E-Print Network (OSTI)

IEEE Computer Society: http://computer.org Computer: http://computer.org/computer computer@computer.org IEEE Computer Society Publications Office: +1 714 821 8380 COVER FEATURES GUEST EDITOR'S INTRODUCTION 28 Computational Photography--The Next Big Step Oliver Bimber Computational photography extends

Stanford University


Solid-State Lighting: Contacts  

NLE Websites -- All DOE Office Websites (Extended Search)

Contacts Contacts Printable Version Share this resource Send a link to Solid-State Lighting: Contacts to someone by E-mail Share Solid-State Lighting: Contacts on Facebook Tweet about Solid-State Lighting: Contacts on Twitter Bookmark Solid-State Lighting: Contacts on Google Bookmark Solid-State Lighting: Contacts on Delicious Rank Solid-State Lighting: Contacts on Digg Find More places to share Solid-State Lighting: Contacts on AddThis.com... Contacts Web site and program contacts are provided below. Website Contact Send us your comments, report problems, and/or ask questions about information on this site. Program Contacts Contact information for the Solid-State Lighting Program. Contacts | Web Site Policies | U.S. Department of Energy | USA.gov Content Last Updated: 02/14

Note: This page contains sample records for the topic "apel org contact" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


LAC Regional Platform Workshop Contact Us | Open Energy Information  

Open Energy Info (EERE)

source source History View New Pages Recent Changes All Special Pages Semantic Search/Querying Get Involved Help Apps Datasets Community Login | Sign Up Search Page Edit History Facebook icon Twitter icon » LAC Regional Platform Workshop Contact Us Jump to: navigation, search LEDSGP Logo.png Advancing climate-resilient low emission development around the world Home About Tools Expert Assistance Events Publications Join Us LAC Workshop Announcement Agenda Participant Package Accommodations Location & Transportation Insurance & Visas Participants Presentations Outcomes Report Links Contact Us For any questions regarding the LAC Regional Platform Workshop, please contact the LEDS GP Secretariat: Caroline Uriarte caroline.uriarte@nrel.gov Powered by OpenEI ledsgp.org is built on the same platform as the popular Wikipedia site.


www.free4vn.org oldroad www.vsofts.net oldroadwww.free4vn.org oldroad  

E-Print Network (OSTI)

www.free4vn.org oldroad #12;www.vsofts.net oldroadwww.free4vn.org oldroad #12;www.vsofts.net oldroadwww.free4vn.org oldroad #12;www.vsofts.net oldroadwww.free4vn.org oldroad #12;www.vsofts.net oldroadwww.free4vn.org oldroad #12;www.vsofts.net oldroadwww.free4vn.org oldroad #12;www

Giridhar, K.


NREL: Technology Transfer - Contacts  

NLE Websites -- All DOE Office Websites (Extended Search)

Contacts Contacts Here you'll find contact information and resources to help answer any questions you may have about NREL's technology transfer and commercialization opportunities. Agreement for Commercializing Technology For more information about NREL's agreements for commercializing technology, contact Anne Miller, 303-384-7353. Financial and Funding Assistance NREL does not provide financial or funding assistance for any research projects. If you're a startup company, small business, or an inventor, visit the following Web sites: Grants.gov Small Business Administration. Industry Growth Forum Visit the NREL Industry Growth Forum website or contact Kate Cheesbrough for more information about this event. Investors and Entrepreneurs For more information about NREL's Innovation and Entrepreneurship Center,


SRS - Media Contacts  

NLE Websites -- All DOE Office Websites (Extended Search)

News Releases News Releases Video Releases Fact Sheets Photo Gallery Speakers Media Contacts SRS Home Media Contacts For information about the Department of Energy-Savannah River Operations contact: Office of External Affairs, 803-952-7697 Savannah River Operations Office, U.S. Dept. of Energy, P.O. Box A, Aiken, SC 29802 Website: http://sro.srs.gov Department of Energy For information about the Savannah River National Laboratory contact: Will Callicott, Manager, SRNL Executive Communications, 803-725-3786 Angeline French, 803-725-2854 Website: http://srnl.doe.gov Savannah River National Laboratory For information about Savannah River Nuclear Solutions, LLC, contact: Robert C. (Clif) Webb, Vice President, Corporate Communications, 803-952-9810 Barbara Smoak, Manager, Public Relations & Media Communications,


Media Contacts | ORNL  

NLE Websites -- All DOE Office Websites (Extended Search)

Media Contacts Media Contacts ORNL's Communications team works with national, regional, and local media outlets on news stories about the laboratory. Media seeking more information on ORNL research and development activities may refer to the resources listed below. General questions not related to media queries may be sent to news@ornl.gov. Media Queries 865.574.4160 Experts List ORNL scientists and engineers are available as information resources for the media. For assistance in scheduling interviews, please contact the Office of Communications and External Relations at 865.574.4160. Photo Gallery Campus shots and research images from ORNL. Staff Contacts Email Phone David Keim Director, Communications keimdm@ornl.gov 865.576.9122 Barbara H. Penland Communications and Media Relations penlandb@ornl.gov 865.574.3664


ARM - Instrument Contacts  

NLE Websites -- All DOE Office Websites (Extended Search)

govInstrumentsContacts govInstrumentsContacts Comments? We would love to hear from you! Send us a note below or call us at 1-888-ARM-DATA. Send Instrument Contacts (Mentors) Instrument Name Abbreviation Contact Phone Absolute Solar Transmittance Interferometer ASTI Douglas Sisterson 630.252.5836 Aerosol Chemical Speciation Monitor ACSM Bill Behrens 631.344.2906 Yin-Nan Lee associate 631.344.3294 Stephen Springston 631.344.4477 Thomas Watson associate 631.344.4517 Aerosol Observing System AOS Bill Behrens 631.344.2906 Manvendra Dubey 505.665.3128 Brian Ermold Developer 509.375.2277 Anne Jefferson 303.497.6493 Chongai Kuang 631.344.7257 Yin-Nan Lee 631.344.3294 Arthur Sedlacek 631.344.2404 Gunnar Senum 631.344.3896 Patrick Sheridan associate 303.497.6672 Stephen Springston 631.344.4477


ARM - TWP Contacts  

NLE Websites -- All DOE Office Websites (Extended Search)

Contacts Contacts TWP Related Links Facilities and Instruments Manus Island Nauru Island Darwin, AUS ES&H Guidance Statement Operations Science Field Campaigns Year of Tropical Convection Visiting the Site TWP Fact Sheet Images Information for Guest Scientists Contacts TWP Contacts Site Oversight - Kim Nitschke, Los Alamos National Laboratory Site Manager - Paul Ortega, Los Alamos National Laboratory Site Operations Manager - Matt Gould, Australian Bureau of Meteorology Site Scientist - Chuck Long, Pacific Northwest National Laboratory Tropical Western Pacific Office Mailing Address: Los Alamos National Laboratory PO Box 1663, MS J577 Los Alamos, NM 87545 U.S.A. Shipping Address: SM-30 Bikini Atoll Road TA-51, Bldg. 82, DP 01U Attn: NAME, MS J577 Los Alamos, NM 87545 U.S.A. Phone: 505.667.1186


How to Contact NERSC  

NLE Websites -- All DOE Office Websites (Extended Search)

Contact us Contact us Contact us Technical Questions, Computer Operations, Passwords, Account Support 1-800-666-3772 (or 1-510-486-8600) Computer Operations Account Support HPC Consulting menu option 1 (24/7) (for passwords and off-hours problem reports/inquiries) menu option 2 or accounts@nersc.gov or http://nim.nersc.gov menu option 3 or consult@nersc.gov or http://help.nersc.gov (On-line Help Desk, "ServiceNow") NERSC Center Contacts Director Services Department Public information Sudip Dosanjh NERSC Director Berkeley Lab, MS 50B4224 1 Cyclotron Road Berkeley, CA 94720-8150 USA email: sudip@lbl.gov phone: (510) 495-2488 fax: (510) 486-4316 Francesca Verdier Services Department Head Berkeley Lab, MS 943-256 1 Cyclotron Road Berkeley, CA 94720-8150 USA email: fverdier@lbl.gov


WNR Instrument Contacts  

NLE Websites -- All DOE Office Websites (Extended Search)

Instrument Contacts Name Flight Path Position Phone Pager Cell Ullmann, John 1FP14(DANCE) Instrument Scientist 667-2517 664-3523 Couture, Aaron 1FP14(DANCE) Instrument Assistant...


Contacts | Department of Energy  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

FORGE FOA For questions about the FORGE FOA, please contact: de-foa-0000890-forge@netl.doe.gov Geothermal Office U.S. Department of Energy Geothermal Technologies Office 1000...


Contact thermal lithography  

E-Print Network (OSTI)

Contact thermal lithography is a method for fabricating microscale patterns using heat transfer. In contrast to photolithography, where the minimum achievable feature size is proportional to the wavelength of light used ...

Schmidt, Aaron Jerome, 1979-



NREL: Library - Contacts  

NLE Websites -- All DOE Office Websites (Extended Search)

of the Information Commons at the National Renewable Energy Laboratory. Contact the library if you need assistance. Phone: 303-275-4215 E-mail: Library@nrel.gov 15013 Denver...


contact | netl.doe.gov  

NLE Websites -- All DOE Office Websites (Extended Search)

Contact NETL Technology Transfer Group Available Technologies Partnerships and Licensing Success Stories Contact Us For any inquiries regarding technology transfer, please email...


Contact urticaria to raw potato  

E-Print Network (OSTI)

allergen in latex-induced potato allergy. Ann Allergy Asthmaof allergy to cooked potatoes in children. Allergy 2007;62(contact dermatitis from potato flesh. Contact Dermatitis

Lagrn, Z Martnez de; Frutos, FJ Ortiz de; Arribas, M Gonzlez de; Vanaclocha-Sebastin, F



Alternative Fuels Data Center: Contacts  

Alternative Fuels and Advanced Vehicles Data Center (EERE)

About About Printable Version Share this resource Send a link to Alternative Fuels Data Center: Contacts to someone by E-mail Share Alternative Fuels Data Center: Contacts on Facebook Tweet about Alternative Fuels Data Center: Contacts on Twitter Bookmark Alternative Fuels Data Center: Contacts on Google Bookmark Alternative Fuels Data Center: Contacts on Delicious Rank Alternative Fuels Data Center: Contacts on Digg Find More places to share Alternative Fuels Data Center: Contacts on AddThis.com... More in this section... Project Assistance News & Features Spanish Resources Contacts Contacts Use these contacts for questions or comments about the Alternative Fuels Data Center. Website Contact Send us your comments, report problems, and/or ask questions about information on this site.


Sustainable Building Contacts | Department of Energy  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

Sustainable Buildings & Campuses Sustainable Building Contacts Sustainable Building Contacts For more information about sustainable buildings and campuses, contact: Sarah Jensen...


CONTACTS FOR INFORMATION MANAGEMENT: Forms, Information Collection...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

CONTACTS FOR INFORMATION MANAGEMENT: Forms, Information Collection (PRA), & Records CONTACTS FOR INFORMATION MANAGEMENT: Forms, Information Collection (PRA), & Records Name Contact...


Institutional Change for Sustainability Contacts | Department...  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

Institutional Change for Sustainability Contacts Institutional Change for Sustainability Contacts For more information about institutional change for sustainability, contact: Jerry...


Contact: Nathan Howard  

NLE Websites -- All DOE Office Websites (Extended Search)

Nathan Howard Nathan Howard nthoward@psfc.mit.edu MIT - Plasma Science and Fusion Center 175 Albany St. Cambridge, MA 02139 NI2.00003 : Measurement and Gyrokinetic Simulation of Impurity Transport in the Core of Alcator C-Mod Session NI2: Transport of Momentum and Particles 9:30 AM-12:30 PM, Wednesday, November 16, 2011 Ballroom BD http://meetings.aps.org/Meeting/DPP11/Event/152523 Keeping Fusion Plasmas Clean by Understanding Impurity Transport Innovative experiments and cutting edge computer simulations provide insight into the movement of impurities in fusion plasmas. Using a novel set of plasma diagnostics and state of the art computer codes, research at MIT is providing insight into the transport of impurities in fusion plasmas. Just as a car runs best


Staff Contacts | Partnerships | ORNL  

NLE Websites -- All DOE Office Websites (Extended Search)

Staff Contacts Staff Contacts SHARE Staff Contacts Executive & Specialty Name Title/Position Email Phone Biography Dr. James Roberto Associate Lab Director robertojb@ornl.gov 865.574.4750 Biography Bert Callahan Information Systems callahanbfjr@ornl.gov 865.241.2355 Teresa Snow Executive Assistant snowt@ornl.gov 865.574.0553 Finance & Administration Name Title/Position Email Phone Biography Bryan Coulter Business Manager coulterbm@ornl.gov 865.574.8897 Matt Rogers Finance Manager rogerswm@ornl.gov 865.576.2178 Industrial and Economic Development Partnerships Name Title/Position Email Phone Biography Tom Rogers Director, Industrial Partnerships and Economic Development rogerstc@ornl.gov 865.241.2149 Biography Cassie Lopez Industrial Partnerships and Economic Development Support lopezcl@ornl.gov 865.576.9294

Note: This page contains sample records for the topic "apel org contact" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


JGI - Contact Us  

NLE Websites -- All DOE Office Websites (Extended Search)

Contact Us Contact Us Search for a Staff Member Enter a name, email address, or phone number for a DOE JGI staff member. (* is a wildcard.) Public and media inquiries Contact David Gilbert, Public Affairs Manager, degilbert@lbl.gov, 925-296-5643. Community Sequencing Program (CSP) questions Send email for support to jgi-jira+pmosupport@lbl.gov, or call Jim Bristow at 925-296-5609. Genome Portal questions For help with the Genome Portal tools/data or the Projects List search page, click the "comments/questions" link at the bottom of the page on those sites. General web site questions For general comments relating to this web site, send email to the webmaster. Other ways to reach us . . . by phone call 925-296-5670. . . . by driving Map with driving directions . . . by public transit


Bilevel contact solar cells  

SciTech Connect

This patent describes a solar cell. It comprises a body of semiconductor material having at least one P/N junction therein, the body including a front face having no electrodes thereon, and a bilevel elevation back face having at least one P-doped region at a first level interdigitated with at least one N-doped region at a second level, wherein the at least one P-doped region and the at least one N-doped region partially overlap to form at least one compensated region; and a positive electrode contacting the at lease one P-doped region and a negative electrode contacting the at least one N-doped region, both electrodes contacting the solar cell on the back face.

Sinton, R.A.



Clean Cities: Clean Cities Contacts  

NLE Websites -- All DOE Office Websites (Extended Search)

About About Printable Version Share this resource Send a link to Clean Cities: Clean Cities Contacts to someone by E-mail Share Clean Cities: Clean Cities Contacts on Facebook Tweet about Clean Cities: Clean Cities Contacts on Twitter Bookmark Clean Cities: Clean Cities Contacts on Google Bookmark Clean Cities: Clean Cities Contacts on Delicious Rank Clean Cities: Clean Cities Contacts on Digg Find More places to share Clean Cities: Clean Cities Contacts on AddThis.com... Goals & Accomplishments Partnerships Hall of Fame Contacts Clean Cities Contacts Clean Cities contact information is provided here. Clean Cities is funded and managed by the U.S. Department of Energy (DOE). The organization includes staff from DOE headquarters, national laboratories, technical contractors, and coalition coordinators.



E-Print Network (OSTI)

CONTACT INFO SIGNALS BUILDING SHELTER THE DISABLED B.E.R.T. TEAM B.E.R.T.* EMERGENCY RESPONSE GUIDE, SIUC*Building Emergency Response Team Siren* Long Blast: Tornado High/Low: Any Other Emergency Radio needed. 2. Find two or three B.E.R.T. "buddies" who are willing to help you in the event of an emergency

King, David G.


UNITED WAY OF ANCHORAGE CODE WEB ADDRESS United Way of Anchorage 71830 www.liveunitedanchorage.org  

E-Print Network (OSTI)

.pathwaycenter.org Renewable Energy Alaska Project 88020 alaskarenewableenergy.org Special Olympics Alaska Inc 55282 www 35694 www.hfhanchorage.org Kids' Corps, Inc. 30881 kcialaska.org Lutheran Social Services of Alaska Inc

Pantaleone, Jim


Institution Name Institution Name Address Place Zip Notes Website Region  

Open Energy Info (EERE)

Laboratory Applied Process Engineering Laboratory Applied Process Engineering Laboratory Hills Street Suite Richland Washington http www apel org contact html Pacific Northwest Area Austin Clean Energy Incubator Austin Clean Energy Incubator West Braker Lane Austin Texas http www ati utexas edu clean energy clean energy html Texas Area Clean Edge Inc Clean Edge Inc Portland Oregon http www cleanedge com Pacific Northwest Area Clean Start McClellan Technology Incubator Clean Start McClellan Technology Incubator Bailey Loop McClellan California http www sarta org go cs Bay Area Corvalence Corvalence Jackson St San Francisco California Bay Area E Co E Co Franklin Street Bloomfield New Jersey http www eandco net EcoElectron Ventures Inc EcoElectron Ventures Inc Second Street PMB Encinitas California http www ecoelectron com Southern CA Area


Photon Sciences | Contacts  

NLE Websites -- All DOE Office Websites (Extended Search)

Contact Us Contact Us User Administration Postal Address User Administration Office Brookhaven National Laboratory 75 Brookhaven Avenue, Bldg. 725B Upton, NY 11973-5000 USA Office Hours Monday through Friday, 8:00 a.m. - 4:30 p.m. Check In All new and returning users must personally check in at Brookhaven National Laboratory's Guests, Users, and Visitors (GUV) Center. The GUV Center is located on the first floor in Bldg. 400, on Brookhaven Avenue diagonally across from Berkner Hall. Phone Number 631.344.8737 Fax Number 631.344.7206 Email Address nslsuser@bnl.gov Email is retrieved daily Monday through Friday. Responses to requests or information are made the same or next day. Communications Office Email a question or comment to the Photon Sciences Directorate. Postal Address Photon Sciences Directorate


Contacts | ORNL Neutron Sciences  

NLE Websites -- All DOE Office Websites (Extended Search)

Science Points of Contact Science Points of Contact Name Research Area Doug Abernathy Wide Angular-Range Chopper Spectrometer (ARCS). Atomic-scale dynamics at thermal and epithermal energies Ke An Engineering Materials Diffractometer (VULCAN). Residual stress, deformation mechanism of materials, phase transitions/transformation, and in situ/operando neutron diffraction in material systems (e.g., working batteries). John Ankner Liquids Reflectometer (LR). Density profiles normal to the surface at liquid surfaces and liquid interfaces Bryan Chakoumakos Nuclear and magnetic crystal structure systematics and structure-property relationships among inorganic materials, powder and single-crystal neutron and x-ray diffraction methods Leighton Coates Macromolecular Neutron Diffractometer (MaNDi). Protein crystallography, biological structure and function


ederal NEPA Contacts  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

STATE NEPA CONTACTS: STATE NEPA CONTACTS: State and Agency: NEPA Regulation: Name: Address: Phone/Email/Website: California Office of Planning and Research/ State Clearinghouse CAL. PUB. RES. CODE §§ 21000 - 21177 Mr. Scott Morgan Director of State Clearinghouse 1400 Tenth Street, Room 212 Sacramento, CA 95814 916-445-0613 state.clearinghouse@opr.ca.gov http://opr.ca.gov/index.php?a=c eqa/index.html Connecticut Office of Policy and Management CONN. GEN. STATE. ANN. §§ 22a-1 to -1i Mr. Dimple Desai Director of CEPA 450 Capitol Avenue Hartford, CT 06106- 1308 860-418-6412 860-418-6200 (fax) Dimple.desai@ct.gov http://www.ct.gov/opm District of Columbia Department of Consumer and Regulatory Affairs D.C. STAT. §§ 8-109.01 to -109.11 Mr. Ibrahim Bullo


Contact stress sensor  

DOE Patents (OSTI)

A method for producing a contact stress sensor that includes one or more MEMS fabricated sensor elements, where each sensor element of includes a thin non-recessed portion, a recessed portion and a pressure sensitive element adjacent to the recessed portion. An electric circuit is connected to the pressure sensitive element. The circuit includes a pressure signal circuit element configured to provide a signal upon movement of the pressure sensitive element.

Kotovsky, Jack



Natural Language Engineering http://journals.cambridge.org/NLE  

E-Print Network (OSTI)

Natural Language Engineering http://journals.cambridge.org/NLE Additional services for Natural1351324912000289 Request Permissions : Click here Downloaded from http://journals.cambridge.org/NLE, IP address information retrieval (search with Google, Bing, etc.), but

Bergler, Sabine


Theranostics 2012, 2(6) http://www.thno.org  

E-Print Network (OSTI)

Theranostics 2012, 2(6) http://www.thno.org 597 TThheerraannoossttiiccss 2012; 2(6):597-606. doi, hepatocellular carcinoma Ivyspring International Publisher #12;Theranostics 2012, 2(6) http://www.thno.org 598


Contact Us | Argonne National Laboratory  

NLE Websites -- All DOE Office Websites (Extended Search)

Contact Us Contact Us Address and phone Argonne National Laboratory 9700 S. Cass Avenue Lemont, IL 60439. Phone: 630/252-2000 For members of the news media News releases online Argonne media contacts For collaboration opportunities For information on joint research or licensing of Argonne technologies and inventions, please contact Technology Development and Commercialization. For student appointments Please see Student and Faculty Opportunities For additional assistance contact DEP_webMaster@anl.gov For job openings or to submit a resume Please see Employment Opportunities For additional assistance contact hrmaster@anl.gov For Argonne retirees and former employees Please keep your contact information current. We may need periodic contact with former Argonne employees (e.g., distributing royalty checks, receiving


Contact Us | Department of Energy  

Energy Savers (EERE)

Contact Us Contact Us Address: 200 Administration Road Oak Ridge, TN 37831 Phone: (865) 576-0742 Operator & Personnel Directory: (865) 574-1000 Email: OakRidgeEM@emor.doe.gov...


Contact Us | Department of Energy  

NLE Websites -- All DOE Office Websites (Extended Search)

Contact Us Contact Us U.S. Department of Energy SunShot Initiative Phone: 202-287-1862 Email: sunshotsummit@ee.doe.gov Mailing Address: 1000 Independence Avenue, SW Washington, DC...


Contact Us | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

About Contact Us Contact Us U.S. Department of Energy SunShot Initiative Phone: 202-287-1862 Email: solar@ee.doe.gov Mailing Address: 1000 Independence Avenue, SW Washington,...


SRI2007 Conference - Contact Information  

NLE Websites -- All DOE Office Websites (Extended Search)

Contact Information For further information about the conference, please click on the following link. E-mail Ms. Lee Ann Murphey or contact Ms. Lee Ann Murphey CAMDLSU 6980...


DOE Radiation Records Contacts List  

Energy.gov (U.S. Department of Energy (DOE))

DOE radiation records contact list for individuals to obtain records of occupational exposure directly from a DOE site.


Oakwood Healthcare, 2014. All rights reserved. oakwood.org/foundation For more information, visit oakwood.org/foundation  

E-Print Network (OSTI)

©Oakwood Healthcare, 2014. All rights reserved. oakwood.org/foundation For more information, visit oakwood.org/foundation Oakwood Healthcare Foundation cordially invites you to Clays For Kids Sporting

Finley Jr., Russell L.


Contact Issue 1  

E-Print Network (OSTI)

, '\\ ..... ,. '" ' ; ') I f. I , j ------------------~ The tall lean Earthman stepped up to the8!nterprise trio who had just beamed down onto his porch. "Welcome to the Kes sler Colonr.' gentlemen, " he greeted them. "I'm Leon Kessler at your service l' The man... DEDICATION This zi_e is dedicated to all STAR TREK raas who saw aad uaderstood that special quality ia the "Kirk/Spock Relatioash!p", aad to WILLIAM SHATNER .ad LEONARD NIMOY, who made it happe_. ? Copyright December, 1915, CONTACT. No reprlats...

Multiple Contributors


Note: This page contains sample records for the topic "apel org contact" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Bourses thses Org Domaine Dure Dead line Particularit Lien  

E-Print Network (OSTI)

neurodénératives FONDATION MOTRICE avril http://www.lafondationmotrice.org/in dex://www.fdv-paris.org/fr/ecole- doctorale-fdv/ FONDATION MOTRICE avril may France ou étranger http://www.lafondationmotrice.org/in dex

Arleo, Angelo


Contact | National Nuclear Security Administration  

National Nuclear Security Administration (NNSA)

Contact | National Nuclear Security Administration Contact | National Nuclear Security Administration Our Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy Emergency Response Recapitalizing Our Infrastructure Continuing Management Reform Countering Nuclear Terrorism About Us Our Programs Our History Who We Are Our Leadership Our Locations Budget Our Operations Media Room Congressional Testimony Fact Sheets Newsletters Press Releases Speeches Events Social Media Video Gallery Photo Gallery NNSA Archive Federal Employment Apply for Our Jobs Our Jobs Working at NNSA Blog Contact Home > About Us > Our Locations > Albuquerque Complex > Federal Asian Pacific American Council - New Mexico Chapter Albuquerque, NM > Contact Contact "Promoting Equal Opportunity and Cultural Diversity for APAs in Government"


EERE: Weatherization and Intergovernmental Program - Contacts  

NLE Websites -- All DOE Office Websites (Extended Search)

Contacts Contacts Site Map Printable Version Share this resource Send a link to EERE: Weatherization and Intergovernmental Program - Contacts to someone by E-mail Share EERE: Weatherization and Intergovernmental Program - Contacts on Facebook Tweet about EERE: Weatherization and Intergovernmental Program - Contacts on Twitter Bookmark EERE: Weatherization and Intergovernmental Program - Contacts on Google Bookmark EERE: Weatherization and Intergovernmental Program - Contacts on Delicious Rank EERE: Weatherization and Intergovernmental Program - Contacts on Digg Find More places to share EERE: Weatherization and Intergovernmental Program - Contacts on AddThis.com... Contacts Web site and program contacts are provided below. Web Site Contact Send us your comments, report problems, and/or ask questions about


Uniform Methods Project Contacts | Department of Energy  

NLE Websites -- All DOE Office Websites (Extended Search)

Contacts Uniform Methods Project Contacts The primary contacts for the Uniform Methods Project are: U.S. Department of Energy Michael Li Carla Frisch National Renewable Energy...


Supplement Tables - Contacts  

Gasoline and Diesel Fuel Update (EIA)

Homepage Homepage For Further Information... The Annual Energy Outlook 2001 (AEO2001) was prepared by the Energy Information Administration (EIA), Office of Integrated Analysis and Forecasting, under the direction of Mary J. Hutzler (mhutzler@eia.doe.gov, 202/586-2222), Director, Office of Integrated Analysis and Forecasting; Susan H. Holte (sholte@eia.doe.gov, 202/586-4838), Director of the Demand and Integration Division; James M. Kendell (jkendell@eia.doe.gov, 202/586-9646), Director of the Oil and Gas Division; Scott Sitzer (ssitzer@eia.doe.gov, 202/586-2308), Director of the Coal and Electric Power Division; and Andy S. Kydes (akydes@eia.doe.gov, 202/586-2222), Senior Modeling Analyst. For ordering information and questions on other energy statistics available from EIA, please contact EIA’s National Energy Information Center. Addresses, telephone numbers, and hours are as follows:


Contact List, Human Resources  

NLE Websites -- All DOE Office Websites (Extended Search)

Human Resources & Occupational Medicine Division Human Resources & Occupational Medicine Division Contact List Human Resources Guest, User, Visitor (GUV) Center Occupational Medicine Training and Qualifications Office Note: All listed phone extensions are in the format of (631) 344-xxxx. Human Resources Robert Lincoln, Chief Human Resources Officer x7435 rlincoln@bnl.gov Margaret Hughes x2108 hughes@bnl.gov Elizabeth Gilbert x2315 gilbert@bnl.gov Human Resources Generalists Christel Colon, HR Manager - BES, GARS & ELS x8469 ccolon@bnl.gov Joann Williams, HR Manager - Support Operations x8356 williamsj@bnl.gov Joanna Hall, HR Manager - Photon Sciences x4410 jhall@bnl.gov Donna Dowling, HR Manager - Nuclear & Particle Physics x2754 dowling@bnl.gov Terrence Buck x8715 tbuck@bnl.gov


Contacts | Building Energy Codes Program  

NLE Websites -- All DOE Office Websites (Extended Search)

Contacts Contacts Provide feedback, ask questions, or formally request assistance: Website Contact Report broken links and suggest content and/or updates to information on this website. Please use the Online Help Desk for questions or issues with the compliance software tools. Online Help Desk Submit questions regarding energy codes, compliance, REScheck(tm), COMcheck(tm), or other BECP tools to a building energy codes expert. Technical Assistance Request Submit a formal, state or local jurisdiction-level request for technical assistance. Program Contacts U.S. Department of Energy (DOE) contacts for the Building Energy Codes Program (BECP). Federal (DOE) Contact Program Area Jeremy Williams, Project Manager Adoption Compliance Compliance Tools- REScheck& COMcheck Technical Assistance


Media Contacts | Argonne National Laboratory  

NLE Websites -- All DOE Office Websites (Extended Search)

Media Contacts Media Contacts Steve McGregor Argonne National Laboratory Stephen McGregor is manager of media relations for Argonne. Contact him at (630) 252-5580 or media@anl.gov. Joseph Bernstein Argonne National Laboratory Joseph Bernstein is the communications lead for Physical Sciences and Engineering. Contact him at (630) 252-7268 or media@anl.gov. Angela Hardin Argonne National Laboratory Angela Hardin is a media relations specialist who covers transportation, energy research and tech transfer at the lab. Contact her at (630) 252-5501 or media@anl.gov. Jared Sagoff Argonne National Laboratory Jared Sagoff is a media relations specialist who covers national security, environment and life sciences, computing and fundamental sciences research. Contact him at (630) 252-5549 or media@anl.gov.


Sandia National Laboratories: Contact Us  

NLE Websites -- All DOE Office Websites (Extended Search)

Contact Us Contact Us Contact Us By email: For questions or comments about the Sandia website please contact the Sandia webmaster. By mail: New Mexico California Sandia National Laboratories, New Mexico P.O. Box 5800 Albuquerque, NM 87185-(mail stop)* non-mail deliveries: 1515 Eubank SE Albuquerque, NM 87123 Sandia National Laboratories, California P.O. Box 969 Livermore, CA 94551-0969 non-mail deliveries: 7011 East Avenue Livermore, CA 94550 * All mail must contain an appropriate mail stop to ensure delivery. For employee mail stops, reference our Employee Locator. Other Contacts Employee locator Online employee locator Telephone employee locator service: (505) 845-0011 Press Queries New Mexico News media help line: (505) 844-4902 (for members of the news media) Additional Media Relations contacts


www.electricitypolicy.org.uk EPRGWORKINGPAPER  

E-Print Network (OSTI)

www.electricitypolicy.org.uk EPRGWORKINGPAPER Abstract Nuclear Power and Deregulated Electricity of running a nuclear generator in a deregulated electricity market. This paper explains the causes of the company's financial difficulties and argues that they do not amount to evidence that nuclear power cannot

Aickelin, Uwe


www.electricitypolicy.org.uk EPRGWORKINGPAPER  

E-Print Network (OSTI)

www.electricitypolicy.org.uk EPRGWORKINGPAPER Abstract Financing the Nuclear Renaissance EPRG the key economic risks associated with nuclear power. The authors observe that the bulk of the risks of a nuclear power station project fall during the roughly five year period of plant construction. This window

Aickelin, Uwe



E-Print Network (OSTI)

NAZ EDUCATION PIPELINE the-naz.org 1200 W. Broadway #250 | Minneapolis, MN 55411 | Family Academy is a foundational component of the NAZ "cradle to career" pipeline. NAZ families can enroll in the Family Academy college ready. Families and children move through a "cradle to career" pipeline that provides

Amin, S. Massoud


Communication www.rsc.org/chemcomm  

E-Print Network (OSTI)

Communication www.rsc.org/chemcomm CHEMCOMM Two different one-dimensional structural motifs,4-bis[(4A- pyridylethynyl)benzene] (14.4 mg, 0.05 mmol). Light green precipitates formed immediately. After two weeks, green crystals of 2 and 3 grew at the interface of the two layers and also at the top

zur Loye, Hans-Conrad


Communication www.rsc.org/chemcomm  

E-Print Network (OSTI)

Communication www.rsc.org/chemcomm CHEMCOMM Electron beam induced in situ clusterisation of 1D Zr-Borkowskib and Malcolm L. H. Green*a a Wolfson Catalysis Centre (Carbon Nanotechnology Group), Inorganic Chemistry Laboratory, University of Oxford, South Parks Road, Oxford, UK OX1 3QR. E-mail: malcolm.green@chem.ox.ac.uk b

Dunin-Borkowski, Rafal E.


www.electricitypolicy.org.uk EPRGWORKINGPAPER  

E-Print Network (OSTI)

www.electricitypolicy.org.uk EPRGWORKINGPAPER Abstract Do homes that are more energy efficient consume less energy?: A structural equation model for England's residential sector EPRG Working Paper 1117 Cambridge Working Paper in Economics 1139 Scott Kelly Energy consumption from the residential sector

Aickelin, Uwe


Oak Ridge Site Specific Advisory Board Contacts  

Energy.gov (U.S. Department of Energy (DOE))

Lists Oak Ridge Site Specific Advisory Board contact information including mailing address, phone numbers, and contact email addresses.


LTS Contact Us - Hanford Site  

NLE Websites -- All DOE Office Websites (Extended Search)

Contact Us About Us LTS Home Page LTS Project Management LTS Transition and Timeline LTS Execution LTS Background LTS Information Management LTS Fact Sheets Briefings LTS In The...


Supplement Tables - Contacts  

Gasoline and Diesel Fuel Update (EIA)

Annual Energy Outlook 2000 (AEO2000) was prepared by the Energy Information Administration (EIA), Office of Integrated Analysis and Forecasting, under the direction of Mary J. Hutzler (mhutzler@ eia.doe.gov, 202/586-2222), Director, Office of Integrated Analysis and Forecasting; Susan H. Holte (sholte@eia.doe.gov, 202/586-4838), Director, Demand and Integration Division; James M. Kendell (jkendell@eia.doe.gov, 202/586-9646), Director, Oil and Gas Division; Scott Sitzer (ssitzer@eia.doe.gov, 202/586-2308), Director, Coal and Electric Power Division; and Andy S. Kydes (akydes@eia.doe.gov, 202/586-2222), Senior Modeling Analyst: Annual Energy Outlook 2000 (AEO2000) was prepared by the Energy Information Administration (EIA), Office of Integrated Analysis and Forecasting, under the direction of Mary J. Hutzler (mhutzler@ eia.doe.gov, 202/586-2222), Director, Office of Integrated Analysis and Forecasting; Susan H. Holte (sholte@eia.doe.gov, 202/586-4838), Director, Demand and Integration Division; James M. Kendell (jkendell@eia.doe.gov, 202/586-9646), Director, Oil and Gas Division; Scott Sitzer (ssitzer@eia.doe.gov, 202/586-2308), Director, Coal and Electric Power Division; and Andy S. Kydes (akydes@eia.doe.gov, 202/586-2222), Senior Modeling Analyst: For ordering information and questions on other energy statistics available from EIA, please contact EIA’s National Energy Information Center. Addresses, telephone numbers, and hours are as follows:


For permission to copy, contact editing@geosociety.org 2007 Geological Society of America  

E-Print Network (OSTI)

and stable isotopes of hydrogen and oxygen. Solute chemistry and isotopic signatures of seeps are distinct Antarctic Ice Sheet. Moreover, glaciers do not form in the valley bottoms because the sublimation and melt evaporation and sublimation (Fountain et al., 1999). Ice-cemented permafrost occurs in the upper 1 m

Fountain, Andrew G.


For permission to copy, contact editing@geosociety.org 2007 Geological Society of America  

E-Print Network (OSTI)

The significance of the stratigraphic record in Kents Cavern, Devon, United Kingdom, to the interpretation passages. The Kents Cavern record of continuous, repeated sedimentation events followed by frost shat and establishes Kents Cavern as a site of international scientific interest. Keywords: Kents Cavern, middle

McFarlane, Donald A.

Note: This page contains sample records for the topic "apel org contact" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


For permission to copy, contact editing@geosociety.org 2004 Geological Society of America368  

E-Print Network (OSTI)

Production Re- search Company (EPR), northwest Euro- E-mail: kgm@rci.rutgers.edu. pean sections, and Russian- duction Research Company (EPR) defined a depositional sequence as a ``stratigraphic unit composed


For permission to copy, contact editing@geosociety.org 2011 Geological Society of America  

E-Print Network (OSTI)

, and substantial economic resources (most notably evaporite minerals, coal, oil, and oil shale). The Eocene Green, 1996) and oil shale (Dyni, 2006). Studies of ancient lake systems often fail to adequately consider

Janecke, Susanne


For permission to copy, contact editing@geosociety.org 2005 Geological Society of America  

E-Print Network (OSTI)

, or (3) loess derived from central Asian deserts. A mass balance calculation indicates that plutonic

Garzione, Carmala N.


For permission to copy, contact editing@geosociety.org 2005 Geological Society of America  

E-Print Network (OSTI)

enrichment of light rare earth elements (LREEs) versus heavy rare earth elements (REEs) or in melt in SiO2 and not sufficiently light rare earth element (LREE) enriched to form continental crust was rare but occurred over short intervals in the middle of the section. The TalkeetnaVolcanic Formation


For permission to copy, contact editing@geosociety.org 2007 Geological Society of America  

E-Print Network (OSTI)

, biostratigraphic, stable isotopic, benthic foraminiferal faunal, downhole log, and sequence stratigraphic studies from the Alabama St. Stephens Quarry (SSQ) core hole, linking global ice volume, sea level- aries are well dated here: North Twistwood Creek­Cocoa (35.4­35.9 Ma), Mint Spring­ Red Bluff (33.0 Ma


C3Bio.org - Wiki: hough replays demonstrated there was no contact...  

NLE Websites -- All DOE Office Websites (Extended Search)

Mickey Mouse is a... - Select an answer - Penguin Chicken Suitcase Teapot Mouse Please leave this field blank. required Problem: required Attach a screenshot: optional (.jpg,...


For permission to copy, contact editing@geosociety.org 2005 Geological Society of America  

E-Print Network (OSTI)

rupture include subcritical crack growth, which takes place when the host rock is subjected to slow, long the path taken by the crack tip line during rupture growth. Rupture shapes in layered, clastic sediments that stable or quasistatic crack growth is the most common type of joint propagation within the Earth (e

Engelder, Terry


ESAIM: M2AN 45 (2011) 11631192 ESAIM: Mathematical Modelling and Numerical Analysis DOI: 10.1051/m2an/2011008 www.esaim-m2an.org  

E-Print Network (OSTI)

2an/2011008 www.esaim-m2an.org SOME ENERGY CONSERVATIVE SCHEMES FOR VIBRO-IMPACTS OF A BEAM ON RIGID OBSTACLES C. Pozzolini1, 2 and M. Salaun3 Abstract. Caused by the problem of unilateral contact during vibrations of satellite solar arrays, the aim of this paper is to better understand such a phenomenon

Paris-Sud XI, Université de


XI. Index of Primary Contacts  

NLE Websites -- All DOE Office Websites (Extended Search)

XI Index of Primary Contacts XI Index of Primary Contacts A Aaron, Tim . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .23 Aceves, Salvador M. . . . . . . . . . . . . . . . . . . . . . .186 Adams, Stephen. . . . . . . . . . . . . . . . . . . . . . . . . .713 Adzic, Radoslav. . . . . . . . . . . . . . . . . . . . . . . . . .384 Ahluwalia, Rajesh K.. . . . . . . . . . . . . . . . . . . . . .511 Ahmed, S. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .451 Ahn, Channing. . . . . . . . . . . . . . . . . . . . . . .262, 267 Alam, Mohammad S.. . . . . . . . . . . . . . . . . . . . . .509 Andersen, Cindi. . . . . . . . . . . . . . . . . . . . . . . . . .811 Anton, Donald L.. . . . . . . . . . . . . . . . . . . . .230, 243 Arduengo III, Anthony J. . . . . . . . . . . . . . . . . . .274


Microsoft PowerPoint - Nov 2009 PI Org Chart (web) | Department...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Microsoft PowerPoint - Nov 2009 PI Org Chart (web) Microsoft PowerPoint - Nov 2009 PI Org Chart (web) PI Organization chart Microsoft PowerPoint - Nov 2009 PI Org Chart (web) More...


Clean Cities: Clean Cities Contacts for Coordinators  

NLE Websites -- All DOE Office Websites (Extended Search)

Contacts for Coordinators Contacts for Coordinators to someone by E-mail Share Clean Cities: Clean Cities Contacts for Coordinators on Facebook Tweet about Clean Cities: Clean Cities Contacts for Coordinators on Twitter Bookmark Clean Cities: Clean Cities Contacts for Coordinators on Google Bookmark Clean Cities: Clean Cities Contacts for Coordinators on Delicious Rank Clean Cities: Clean Cities Contacts for Coordinators on Digg Find More places to share Clean Cities: Clean Cities Contacts for Coordinators on AddThis.com... Coordinator Basics Outreach Education & Webinars Meetings Reporting Contacts Clean Cities Contacts for Coordinators The Clean Cities contact resources help coordinators communicate with the Clean Cities program staff and other coordinators. Program Contacts Use the program contacts to communicate individually with U.S. Department


Solar cell with back side contacts  

DOE Patents (OSTI)

A III-V solar cell is described herein that includes all back side contacts. Additionally, the positive and negative electrical contacts contact compoud semiconductor layers of the solar cell other than the absorbing layer of the solar cell. That is, the positive and negative electrical contacts contact passivating layers of the solar cell.

Nielson, Gregory N; Okandan, Murat; Cruz-Campa, Jose Luis; Resnick, Paul J; Wanlass, Mark Woodbury; Clews, Peggy J



Safety Organization and Contact Information  

NLE Websites -- All DOE Office Websites (Extended Search)

Organization and Contact Information Print Organization and Contact Information Print Safety Staff Contact Information Contact Extension Location CONTROL ROOM (24/7) 4969 80-140 Floor Operations Floor Operators 7464 (RING) 80-159 Building Manager This e-mail address is being protected from spambots. You need JavaScript enabled to view it 7358 80-151 Work Planning/Permit/span> This e-mail address is being protected from spambots. You need JavaScript enabled to view it This e-mail address is being protected from spambots. You need JavaScript enabled to view it 7358 6793 80-151 80-233 ALS-EHS Program This e-mail address is being protected from spambots. You need JavaScript enabled to view it (Interim Manager, EHS Program Management) This e-mail address is being protected from spambots. You need JavaScript enabled to view it (Interim Manager, Accelerator Facility Safety)


Safety Organization and Contact Information  

NLE Websites -- All DOE Office Websites (Extended Search)

Organization and Contact Information Print Organization and Contact Information Print Safety Staff Contact Information Contact Extension Location CONTROL ROOM (24/7) 4969 80-140 Floor Operations Floor Operators 7464 (RING) 80-159 Building Manager This e-mail address is being protected from spambots. You need JavaScript enabled to view it 7358 80-151 Work Planning/Permit/span> This e-mail address is being protected from spambots. You need JavaScript enabled to view it This e-mail address is being protected from spambots. You need JavaScript enabled to view it 7358 6793 80-151 80-233 ALS-EHS Program This e-mail address is being protected from spambots. You need JavaScript enabled to view it (Interim Manager, EHS Program Management) This e-mail address is being protected from spambots. You need JavaScript enabled to view it (Interim Manager, Accelerator Facility Safety)


FOIA Contacts | Department of Energy  

NLE Websites -- All DOE Office Websites (Extended Search)

Contacts Contacts FOIA Contacts FOIA REQUESTER SERVICE CENTERS, FOIA PUBLIC LIASONS, AND FOIA OFFICERS DOE Headquarters (HQ) FOIA Requester Service Center 1000 Independence Avenue, SW Washington, DC 20585 Phone: 202-586-5955 Fax: 202-586-0575 FOIA Web Page: http://energy.gov/management/office-management/operational-management/freedom-information-act Ingrid A. Kolb Chief FOIA Officer Kevin T. Hagerty FOIA Public Liaison Phone: 202-586-5955 Alexander C. Morris FOIA Officer Phone: 202-586-3159 Poli A. Marmolejos FOIA Appeals Officer Phone: 202-287-1400 Appeals Contact Web Page: http://energy.gov/oha/office-hearings-and-appeals ====================================================================== Chicago Office (CH) 9800 South Cass Avenue Argonne, IL 60439 FOIA Requester Service Center: 630-252-2041


Contact Us | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Contact Us Contact Us Contact Us By E-mail: You can send an email to the Secretary of Energy at The.Secretary@hq.doe.gov By Phone: 202-586-5000 (Main Switchboard) or use the National Phone Directory For Hearing and/or Speech Impaired: 1-800-877-8339 By Fax: 202-586-4403 *By Mail: U.S. Department of Energy 1000 Independence Ave., SW Washington, DC 20585 *Please note: mail may take up to 3 weeks to arrive. As such, we strongly encourage you to use the email address provided above or the form provided below. Media Inquiries: Contact the Office of Public Affairs at (202) 586-4940. Recovery Act Inquiries: Please direct your questions to the Oak Ridge Clearinghouse at 1-877-496-2310, and select Option 4. If you wish to correspond by email, please use the address clearinghouse@oro.doe.gov.



NLE Websites -- All DOE Office Websites (Extended Search)

Contact OAK RIDGE NATIONAL LABORATORY ORNL is managed by UT-Battelle for the US Department of Energy Solving the big problems Oak Ridge National Laboratory is the largest US...


Contact Us | Department of Energy  

Office of Environmental Management (EM)

SW Mail Stop 5D-031 Washington, DC 20585 BY PHONE D.C. Metro Area: (202) 586-4073 Toll free: (800) 541-1625 FAX: (202) 586-4902 Contact Us Office of Inspector General 1000...


Congressional Affairs Points of Contact  

Energy.gov (U.S. Department of Energy (DOE))

Lists the Office of Congressional Affairs points of contacts. The Office of Congressional Affairs is available to assist congressional offices and committees regarding Department of Energy programs and activities.


Protein folding using contact maps  

E-Print Network (OSTI)

We present the development of the idea to use dynamics in the space of contact maps as a computational approach to the protein folding problem. We first introduce two important technical ingredients, the reconstruction of a three dimensional conformation from a contact map and the Monte Carlo dynamics in contact map space. We then discuss two approximations to the free energy of the contact maps and a method to derive energy parameters based on perceptron learning. Finally we present results, first for predictions based on threading and then for energy minimization of crambin and of a set of 6 immunoglobulins. The main result is that we proved that the two simple approximations we studied for the free energy are not suitable for protein folding. Perspectives are discussed in the last section.

Michele Vendruscolo; Eytan Domany


Note: This page contains sample records for the topic "apel org contact" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Sandia National Laboratories: Contact Z-Machine  

NLE Websites -- All DOE Office Websites (Extended Search)

About Z Z Research Z News Contact Us Facebook Twitter YouTube Flickr RSS Z-Machine Contact Z For more information, please contact us. * Items are Required First Name * Last Name *...


Contact Us | Y-12 National Security Complex  

NLE Websites -- All DOE Office Websites (Extended Search)

Contact Us Contact Us Ray Smith Y-12 Historian The primary contact for more information about Y-12's history and the History Center in New Hope Center is our Y-12 historian and B&W...


Natural Language Engineering http://journals.cambridge.org/NLE  

E-Print Network (OSTI)

Natural Language Engineering http://journals.cambridge.org/NLE Additional services for Natural1351324912000101 Request Permissions : Click here Downloaded from http://journals.cambridge.org/NLE, IP address: 79 as anchors that delimit the search space. We use a large monolingual corpus to rank and filter

Wintner, Shuly


Natural Language Engineering http://journals.cambridge.org/NLE  

E-Print Network (OSTI)

Natural Language Engineering http://journals.cambridge.org/NLE Additional services for Natural Permissions : Click here Downloaded from http://journals.cambridge.org/NLE, IP address: on 29-processing steps for a variety of natural language processing applications, from search and information extraction

Wintner, Shuly


www.heatpumpcentre.org IEA HEAT PUMP PROGRAMME  

E-Print Network (OSTI)

www.heatpumpcentre.org IEA HEAT PUMP PROGRAMME Research, Development, Demonstration and Promotion of Heat Pumping Technology #12;www.heatpumpcentre.org Includes ­ Heating ­ Air conditioning ­ Refrigeration Covers applications in ­ Residential and commercial buildings ­ Industry HEAT PUMPING TECHNOLOGY

Oak Ridge National Laboratory


www.vics.org1 Joseph C. Andraski  

E-Print Network (OSTI)

's wrong with Peak Oil 3) Warning: now entering the Oil Danger Zone #12;www.vics.org10 Continued 4) Ability Stare #12;www.vics.org9 Oil - The Real Story? 1) Facing up to End of Easy Oil, (WSJ 5- 24) 2) What Beyond Oil and Fuel Costs 1. Driver shortages 2. Hours of Service (HOS) rule changes 3. CSA - Compliance

Lin, Xiaodong


Theranostics 2012, 2(12) http://www.thno.org  

E-Print Network (OSTI)

Theranostics 2012, 2(12) http://www.thno.org 1117 TThheerraannoossttiiccss 2012; 2(12):1117-1126. doi: 10.7150/thno.4381 Review Lipid- and Polymer-Based Nanostructures for Cancer Theranostics Brian T and polymeric NPs at the Ivyspring International Publisher #12;Theranostics 2012, 2(12) http://www.thno.org 1118

Zhang, Liangfang


Federal Energy Management Program: Renewable Energy Contacts  

NLE Websites -- All DOE Office Websites (Extended Search)

Contacts to someone by E-mail Contacts to someone by E-mail Share Federal Energy Management Program: Renewable Energy Contacts on Facebook Tweet about Federal Energy Management Program: Renewable Energy Contacts on Twitter Bookmark Federal Energy Management Program: Renewable Energy Contacts on Google Bookmark Federal Energy Management Program: Renewable Energy Contacts on Delicious Rank Federal Energy Management Program: Renewable Energy Contacts on Digg Find More places to share Federal Energy Management Program: Renewable Energy Contacts on AddThis.com... Energy-Efficient Products Technology Deployment Renewable Energy Federal Requirements Renewable Resources & Technologies Project Planning & Implementation Project Assistance Resource Maps & Screening Tools Purchasing Renewable Power


EPAct Transportation Regulatory Activities: Contacts for EPAct  

NLE Websites -- All DOE Office Websites (Extended Search)

Contacts Contacts for EPAct Transportation Regulatory Activities to someone by E-mail Share EPAct Transportation Regulatory Activities: Contacts for EPAct Transportation Regulatory Activities on Facebook Tweet about EPAct Transportation Regulatory Activities: Contacts for EPAct Transportation Regulatory Activities on Twitter Bookmark EPAct Transportation Regulatory Activities: Contacts for EPAct Transportation Regulatory Activities on Google Bookmark EPAct Transportation Regulatory Activities: Contacts for EPAct Transportation Regulatory Activities on Delicious Rank EPAct Transportation Regulatory Activities: Contacts for EPAct Transportation Regulatory Activities on Digg Find More places to share EPAct Transportation Regulatory Activities: Contacts for EPAct Transportation Regulatory Activities on


Working with SRNL - Technology Transfer - Contacts  

NLE Websites -- All DOE Office Websites (Extended Search)

SRNL GO Tech Briefs Contacts Ombudsman Tech Home SRNL Home Working with SRNL - Technology Transfer Contacts Dale Haas, Manager (Acting) Strategic Development and Technical...


National Laboratory Contacts | Department of Energy  

Office of Environmental Management (EM)

National Laboratory Contacts National Laboratory Contacts The Geothermal Technologies Office works closely with several DOE national laboratories in managing and contributing to...


Contact the Sustainability Performance Office | Department of...  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

You are here Home About Contact the Sustainability Performance Office Contact the Sustainability Performance Office The U.S. Department of Energy (DOE) Sustainability...


High Performance Windows Volume Purchase: Contacts  

NLE Websites -- All DOE Office Websites (Extended Search)

Contacts to Contacts to someone by E-mail Share High Performance Windows Volume Purchase: Contacts on Facebook Tweet about High Performance Windows Volume Purchase: Contacts on Twitter Bookmark High Performance Windows Volume Purchase: Contacts on Google Bookmark High Performance Windows Volume Purchase: Contacts on Delicious Rank High Performance Windows Volume Purchase: Contacts on Digg Find More places to share High Performance Windows Volume Purchase: Contacts on AddThis.com... Home About For Builders For Residential Buyers For Light Commercial Buyers For Manufacturers For Utilities Information Resources Contacts Web site and High Performance Windows Volume Purchase Program contacts are provided below. Website Contact Send us your comments, report problems, and/or ask questions about


Veteran's Contacts | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Veteran's Contacts Veteran's Contacts Veteran's Contacts Veteran Employment Program Manager Donna Friend; 202-586-5880; VetProgram@hq.doe.gov Headquarters DOE Jobs in: Washington, DC Kenneth Fields; 202-586-0283; Kenneth.Fields@hq.doe.gov NNSA Jobs in: Washington, DC; Las Vegas, NV; Albuquerque, NM; Carlsbad, NM Norm Schwantes; 505-845-5676; norman.schwantes@nnsa.doe.gov Office of the Inspector General Jobs in: Washington, DC; Germantown, MD; Albuquerque, NM; Chicago, IL; Idaho Falls, ID; Las Vegas, NV; Livermore, CA; Los Alamos, NM; Oak Ridge, TN; Pittsburgh, PA; Richland, WA; Savannah River, SC Edith Ramos; 202-586-2470; Edith.Ramos@hq.doe.gov Office of Science - Headquarters Jobs in: Washington, DC and Germantown, MD Terri Sosa; 202-586-8460; terri.sosa@science.doe.gov


Stakeholder Engagement and Outreach: Contacts  

Wind Powering America (EERE)

Stakeholder Engagement and Outreach Staff Contacts Stakeholder Engagement and Outreach Staff Contacts This page introduces the Stakeholder Engagement and Outreach team. If you have questions, please contact the Webmaster. Photo of Patrick Gilman Patrick Gilman Wind Energy Deployment Manager, U.S. Department of Energy 720-356-1420 Photo of Ben Chicoski Ben Chicoski Senior Analyst, Energetics Incorporated 202-406-4149 Photo of Debbie Schultheis Debbie Schultheis Technical Project Officer, U.S. Department of Energy 720-356-1811 Photo of Mark Bolinger Mark Bolinger Research Scientist, Electricity Markets and Policy Group, Lawrence Berkeley National Laboratory 603-795-4937 Photo of Tessa Dardani Tessa Dardani Administrative Analyst, National Renewable Energy Laboratory 303-384-6962 Photo of Ben Hoen Ben Hoen Principal Research Associate, Electricity Markets and Policy Group,


Contact Us | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Contact Us Contact Us Contact Us EEOICPA Program The U.S. Department of Labor (DOL) administers the EEOICPA Program. For information on how to submit an EEOICPA claim, please go to: U.S. Department of Labor, Division of Energy Employees Occupational Illness Compensation DOE's role is to provide requested record information to DOL. Individuals may request their own EEOICPA record information by submitting a Privacy Act request through the DOE Freedom of Information and Privacy Act Office. Requests are to be submitted in writing to: Chief Freedom of Information Act Officer U.S. Department of Energy 1000 Independence Avenue, SW Washington, DC 20585 Records requests for other individuals can be submitted through a FOIA request through the DOE Freedom of Information and Privacy Act Office in


C-AD Contact List  

NLE Websites -- All DOE Office Websites (Extended Search)

C-AD Organization Chart C-AD Organization Chart IFM North Organization Chart Information Contact Personnel C-AD Committees Meeting Room Reservation Technical Notes Status Information Operating Schedules Scheduling Physicist RHIC-AGS Machine Status RHIC Broadcast Accelerator Performances Department Contact Personnel Chair: Thomas Roser Associate Chair for Accelerators: Wolfram Fischer Associate Chair for Experiment Support & Facilities: Philip Pile Associate Chair for Accelerator R&D: Ilan Ben-Zvi Associate Chair for ESSHQ: Edward Lessard Assistant Chair for Administration: Stephanie LaMontagne Associate Chair for Accelerator Applications & Education: Derek I. Lowenstein Chief Electrical Engineer: Jon Sandberg Chief Mechanical Engineer: Joseph Tuozzolo Administrative Assistant: Lynanne DiFilippo


DPP Paper YI2.00003 http://meeting.aps.org/Meeting/DPP11/Event/153466  

NLE Websites -- All DOE Office Websites (Extended Search)

energy confinement regime expanded to high power on the Alcator energy confinement regime expanded to high power on the Alcator C-Mod tokamak DPP Paper YI2.00003 http://meeting.aps.org/Meeting/DPP11/Event/153466 (To be presented 10:30 AM, Friday, November 18, 2011 Ballroom BD) For more information contact: Earl S. Marmar, marmar@psfc.mit.edu MIT Plasma Science and Fusion Center, Cambridge MA 02139 USA Tuning the plasma geometry has opened a significant operational window for a new high performance plasma regime with excellent thermal insulation and good impurity control. A key challenge in fusion energy is to confine the plasma energy long enough for the ionized hydrogen plasma to fuse and produce net power. Suppression of plasma turbulence has long been a key to achieving this, but the resulting increase in energy confinement is usually accompanied


Improved Electrical Contact For Dowhhole Drilling Networks  

DOE Patents (OSTI)

An electrical contact system for transmitting information across tool joints while minimizing signal reflections that occur at the tool joints includes a first electrical contact comprising an annular resilient material. An annular conductor is embedded within the annular resilient material and has a surface exposed from the annular resilient material. A second electrical contact is provided that is substantially equal to the first electrical contact. Likewise, the second electrical contact has an annular resilient material and an annular conductor. The two electrical contacts configured to contact one another such that the annular conductors of each come into physical contact. The annular resilient materials of each electrical contact each have dielectric characteristics and dimensions that are adjusted to provide desired impedance to the electrical contacts.

Hall, David R. (Provo, UT); Hall, Jr., H. Tracy (Provo, UT); Pixton, David S. (Lehi, UT); Dahlgren, Scott (Provo, UT); Fox, Joe (Spanish Fork, UT); Sneddon, Cameron (Provo, UT)



Safety Organization and Contact Information  

NLE Websites -- All DOE Office Websites (Extended Search)

Safety Organization and Contact Information Print Safety Organization and Contact Information Print Safety Staff Contact Information Contact Extension Location CONTROL ROOM (24/7) 4969 80-140 Floor Operations Floor Operators 7464 (RING) 80-159 Building Manager This e-mail address is being protected from spambots. You need JavaScript enabled to view it 7358 80-151 Work Planning/Permit/span> This e-mail address is being protected from spambots. You need JavaScript enabled to view it This e-mail address is being protected from spambots. You need JavaScript enabled to view it 7358 6793 80-151 80-233 ALS-EHS Program This e-mail address is being protected from spambots. You need JavaScript enabled to view it (Interim Manager, EHS Program Management) This e-mail address is being protected from spambots. You need JavaScript enabled to view it (Interim Manager, Accelerator Facility Safety)

Note: This page contains sample records for the topic "apel org contact" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


M Magazine Advertising Contact Information  

E-Print Network (OSTI)

Overview #12;M Magazine Advertising Contact Information Call (03)8667 2000 or visit Adcentre, and entertainment. For advertisers the diversity of M is appealing, as is the 7 day TV guide which ensures retention over the week and greater exposure for advertisers. Profile 52% 48% 87% 35% ix:170 PI (Full Time) $83k

Peters, Richard


Contacts with semi-insulators  

Science Journals Connector (OSTI)

... properties themselves can be very useful, for example in the contexts of rectification and photovoltaic energy conversion1. In such cases one aims to separate the contact properties from bulk (volume ... law associated with them (Fig. 2). These departures result from the presence of carrier concentration gradients which, in turn, imply diffusion currents, to which Ohm's law ...

H. K. Henisch; C. Popescu



Contact Symmetries and Hamiltonian Thermodynamics  

E-Print Network (OSTI)

In this work we analyze several aspects of the application of contact geometry to thermodynamics. We first investigate the role of gauge transformations and Legendre symmetries in thermodynamics, with respect to both the contact and the metric structures. Then we present a novel mathematical characterization of first order phase transitions as equilibrium processes on the thermodynamic phase space for which the Legendre symmetry is broken. Moreover, using contact Hamiltonian dynamics, we propose a formalism for thermodynamics that resembles the classical Hamiltonian formulation of conservative mechanics. We find out the general functional form for the relevant contact Hamiltonian in thermodynamics and show that it is a measure of the entropy production along thermodynamic processes. Therefore, we use such property to give a precise definition of thermodynamically admissible processes according to the Second Law of thermodynamics. Finally, we also show that we can give an equivalent formulation in terms of the Fisher-Rao metric, in analogy with the Theory of Relativity, where the metric structure defines admissible paths.

A. Bravetti; C. S. Lopez-Monsalvo; F. Nettel




NLE Websites -- All DOE Office Websites (Extended Search)

Email Executive Advisor Mark Anderson (505) 667-4772 Email Program Specialist Jean Harris (505) 667-5778 Email Executive Administrator Roberta Viarreal (505) 667-9128 Email...



Gasoline and Diesel Fuel Update (EIA)

4/04Q) 4/04Q) Quarterly Coal Report October - December 2004 March 2005 Energy Information Administration Office of Coal, Nuclear, Electric, and Alternate Fuels U.S. Department of Energy Washington, DC 20585 _____________________________________________________________________________ This report is available on the Web at: http://www.eia.doe.gov/cneaf/coal/quarterly/qcr.pdf _____________________________________________ This report was prepared by the Energy Information Administration, the independent statistical and analytical agency within the U.S. Department of Energy. The information contained herein should be not be construed as advocating or reflecting any policy position of the U.S. Department of Energy or any other organization.


Pg. 1 -http://www.eduteka.org/EstandaresDocentesUnesco.php Pg. 2 -http://www.eduteka.org/EstandaresDocentesUnesco.php  

E-Print Network (OSTI)

Pág. 1 - http://www.eduteka.org/EstandaresDocentesUnesco.php #12;Pág. 2 - http://www.eduteka.org/EstandaresDocentesUnesco.php UNESCO ESTÁNDARES DE COMPETENCIAS EN TIC PARA DOCENTES http://portal.unesco.org/es/ev.php-URL_ID=41553 UNESCO cumple con: #12;Pág. 3 - http://www.eduteka.org/EstandaresDocentesUnesco.php a) su función como

Vásquez, Carlos


NETL: Gasification Systems Program Contacts  

NLE Websites -- All DOE Office Websites (Extended Search)

Gasification Systems Program Contacts Gasification Systems Program Contacts Jenny Tennant Gasification Technology Manager U.S. Department of Energy National Energy Technology Laboratory 3610 Collins Ferry Road P.O. Box 880 Morgantown, WV 26507-0880 Phone: (304) 285-4830 Email: Jenny.Tennant@netl.doe.gov Pete Rozelle Division of Advanced Energy System - Program Manager, Office of Fossil Energy U.S. Department of Energy FE-221/Germantown Building 1000 Independence Avenue, S.W. Washington, DC 20585-1209 Phone: (301) 903-2338 Email: Peter.Rozelle@hq.doe.gov Heather Quedenfeld Gasification Division Director U.S. Department of Energy National Energy Technology Laboratory 626 Cochrans Mill Road P.O. Box 10940 Pittsburgh, PA 15236-0940 Phone: (412) 386-5781 Email: Heather.Quedenfeld@netl.doe.gov Kristin Gerdes Performance Division


Annual Energy Outlook 2000 - Contact  

Gasoline and Diesel Fuel Update (EIA)

bullet1.gif (843 bytes) Major Assumptions for the Forecasts (PDF) Summary of the AEO2000 Cases/Scenarios - Appendix Table G1 (HTML) bullet1.gif (843 bytes) Model Results (PDF, ZIP) - Appendix Tables - Reference Case - 1997 to 2020 bullet1.gif (843 bytes) Download Report - Entire AEO2000 (PDF) - AEO2000 by Chapters (PDF) bullet1.gif (843 bytes) Acronyms bullet1.gif (843 bytes) Contacts link.gif (1946 bytes) bullet1.gif (843 bytes) Assumptions to the AEO2000 bullet1.gif (843 bytes) Supplemental Data to the AEO2000 - Regional and more detailed AEO 2000 Reference Case Results - 1998, 2000 to 2020 - Only available on Web bullet1.gif (843 bytes) NEMS Conference bullet1.gif (843 bytes) To Forecasting Home Page bullet1.gif (843 bytes) EIA Homepage contact.gif (4492 bytes)


Annual Energy Outlook 1999 - Contact  

Gasoline and Diesel Fuel Update (EIA)

contact.gif (4492 bytes) contact.gif (4492 bytes) The Annual Energy Outlook 1999 (AEO99) was prepared by the Energy Information Administration (EIA), Office of Integrated Analysis and Forecasting, under the direction of Mary J. Hutzler (mhutzler@eia.doe.gov, 202/586-2222). General questions may be addressed to Arthur T. Andersen (aanderse@eia.doe.gov, 202/586-1441), Director of the International, Economic, and Greenhouse Gas Division; Susan H. Holte (sholte@eia.doe.gov, 202/586-4838), Director of the Demand and Integration Division; James M. Kendell (jkendell@eia.doe.gov, 202/586-9646), Director of the Oil and Gas Division; Scott Sitzer (ssitzer@eia.doe.gov, 202/586-2308), Director of the Coal and Electric Power Division; or Andy S. Kydes (akydes@eia.doe.gov, 202/586-2222), Senior Modeling Analyst. Detailed questions about the forecasts and related model components may be addressed to the following analysts:


International Energy Outlook 2001 - Contact  

Gasoline and Diesel Fuel Update (EIA)

Contacts Contacts Printer Friendly Version (PDF) The International Energy Outlook is prepared by the Energy Information Administration (EIA). General questions concerning the contents of the report should be referred to Mary J. Hutzler (202/586-2222), Director, Office of Integrated Analysis and Forecasting. Specific questions about the report should be referred to Linda E. Doman (202/586-1041) or the following analysts: World Energy Consumption Linda Doman (linda.doman@eia.doe.gov, 202/586-1041) World Oil Markets G. Daniel Butler (george.butler@eia.doe.gov, 202/586-9503) Bruce Bawks (bruce.bawks@eia.doe.gov, 202/586-6579) Natural Gas Sara Banaszak Phyllis Martin (phyllis.martin@eia.doe.gov, 202/586-9592) Coal Sara Banaszak


International Energy Outlook 2002 - Contacts  

Gasoline and Diesel Fuel Update (EIA)

Contacts Contacts The International Energy Outlook is prepared by the Energy Information Administration (EIA). General questions concerning the contents of the report should be referred to Mary J. Hutzler (202/586-2222), Director, Office of Integrated Analysis and Forecasting. Specific questions about the report should be referred to Linda E. Doman (202/586-1041) or the following analysts: World Energy Consumption Linda Doman linda.doman@eia.doe.gov, 202/586-1041 World Oil Markets G. Daniel Butler Aloulou Fawzi george.butler@eia.doe.gov aloulou.fawzi@eia.doe.gov 202/586-9503 202/586-7818 Natural Gas Phyllis Martin Bruce Bawks phyllis.martin@eia.doe.gov bruce.bawks@eia.doe.gov 202/586-9592 202/586-6579 China’s West-to-East Pipeline Aloulou Fawzi aloulou.fawzi@eia.doe.gov 202/586-7818


Contact Info | Occupational Medicine Clinic  

NLE Websites -- All DOE Office Websites (Extended Search)

Occupational Medicine Clinic Occupational Medicine Clinic Promoting optimal physical and emotional health through quality care that is convenient, confidential & individualized. Home Health Promotion Program Employee Assistance Program Contact Contact Info Occupational Medicine Joseph Falco, M.D. 344-3666 OMC Manager/Supervising Physician Staff Physicians Carol Davis, D.O. 344-3667 Board Certified - Occupational Medicine Eva Erens, M.D. 344-3668 Board Certified - Internal Medicine Jaishree Subramani, M.D. MPH 344-3669 Board Certified - Internal Medicine Health Promotion Program Michael Thorn, RN, MBA 344-8612 Health Promotion/Disease Prevention Program Employee Assistance Program (EAP) Nancy Losinno, LCSW, CEAP 344-4567 EAP Manager Linda DiPierro 344-2733 Senior Occupational Medicine Assistant


Contact angles and surface forces  

Science Journals Connector (OSTI)

The modern state of the theory of wetting phenomena is considered with special attention to the approach based on the theory of surface forces. Contribution of the effects of molecular, electrostatic and short-range structural forces to wetting films stability and forming contact angles is discussed. The magnitudes of contact angles may be predicted on the basis of isotherms of disjoining pressure of wetting films that include Hamaker constants, electrical potentials of solid-liquid and liquid-gas interfaces, and experimental constants that characterize the structural forces of hydrophilic repulsion and hydrophobic attraction. The constants seem to be the same as in the case of interaction of colloidal particles. In the framework of the suggested approach, the influence of surfactants on wetting phenomena was considered.

N.V. Churaev



Relaxation damping in oscillating contacts  

E-Print Network (OSTI)

If a contact of two purely elastic bodies with no sliding (infinite coefficient of friction) is subjected to superimposed oscillations in the normal and tangential directions, then a specific damping appears, that is not dependent on friction or dissipation in the material. We call this effect "relaxation damping". The rate of energy dissipation due to relaxation damping is calculated in a closed analytic form for arbitrary axially-symmetric contacts. In the case of equal frequency of normal and tangential oscillations, the dissipated energy per cycle is proportional to the square of the amplitude of tangential oscillation and to the absolute value of the amplitude of normal oscillation, and is dependent on the phase shift between both oscillations. In the case of low frequency tangential motion with superimposed high frequency normal oscillations, the system acts as a tunable linear damper. Generalization of the results for macroscopically planar, randomly rough surfaces is discussed.

M. Popov; V. L. Popov; R. Pohrt



Theranostics 2011, 1 http://www.thno.org  

E-Print Network (OSTI)

Theranostics 2011, 1 http://www.thno.org 263 TThheerraannoossttiiccss 2011; 1:263-275 Research of diseases [1-4]. Among many clinical imaging modalities (e.g. PET, #12;Theranostics 2011, 1 http

Gao, Jinming


Google.org Invests $10 Million in Enhanced Geothermal Systems...  

Energy Savers (EERE)

of hot water or steam where none existed before or to extend and enhance an existing geothermal reservoir. Google.org will invest 4 million in Potter Drilling, Inc., which is...


Solar cell contact formation using laser ablation  

DOE Patents (OSTI)

The formation of solar cell contacts using a laser is described. A method of fabricating a back-contact solar cell includes forming a poly-crystalline material layer above a single-crystalline substrate. The method also includes forming a dielectric material stack above the poly-crystalline material layer. The method also includes forming, by laser ablation, a plurality of contacts holes in the dielectric material stack, each of the contact holes exposing a portion of the poly-crystalline material layer; and forming conductive contacts in the plurality of contact holes.

Harley, Gabriel; Smith, David; Cousins, Peter



Solar cell contact formation using laser ablation  

DOE Patents (OSTI)

The formation of solar cell contacts using a laser is described. A method of fabricating a back-contact solar cell includes forming a poly-crystalline material layer above a single-crystalline substrate. The method also includes forming a dielectric material stack above the poly-crystalline material layer. The method also includes forming, by laser ablation, a plurality of contacts holes in the dielectric material stack, each of the contact holes exposing a portion of the poly-crystalline materiat layer; and forming conductive contacts in the plurality of contact holes.

Harley, Gabriel; Smith, David D.; Cousins, Peter John



Contact processes in crowded environments  

Science Journals Connector (OSTI)

Periodically sheared colloids at low densities demonstrate a dynamical phase transition from an inactive to active phase as the strain amplitude is increased. The inactive phase consists of no collisions (contacts) between particles in the steady state limit, while in the active phase collisions persist. To investigate this system at higher densities, we construct and study a conserved-particle-number contact process with three-body interactions, which are potentially more likely than two-body interactions at higher densities. For example, consider one active (diffusing) particle colliding with two inactive (nondiffusing) particles such that they become active and consider spontaneous inactivation. In mean field, this system exhibits a continuous dynamical phase transition. Simulations on square lattices also indicate a continuous transition with exponents similar to those measured for the conserved lattice gas (CLG) model. In contrast, the three-body interaction requiring two active particles to activate one inactive particle exhibits a discontinuous transition. Finally, inspired by kinetically constrained models of the glass transition, we investigate the caging effect at even higher particle densities to look for a second dynamical phase transition back to an inactive phase. Square lattice simulations suggest a continuous transition with a new set of exponents differing from both the CLG model and what is known as directed percolation, indicating a potentially new universality class for a contact process with a conserved particle number.

S.-L.-Y. Xu and J. M. Schwarz



Details of Forestry Commission and DARDNI Plant Health Contacts for UK Points of Entry UK Principle Ports Contacts Contact Details  

E-Print Network (OSTI)

Ports Contacts Contact Details Felixstowe Richard Fergusson Pat Mitchell Philip Evans Roland Fry Fax Other GB Ports John Hunter Joanne McAuley Fax 0131-314-6148 Tel : 0131-314-6182 or Tel : 0131

Note: This page contains sample records for the topic "apel org contact" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Template:ContactInfo | Open Energy Information  

Open Energy Info (EERE)

ContactInfo ContactInfo Jump to: navigation, search This is the ContactInfo template. It is designed for use by Companies, Organizations and Government Agencies. To specify the contact info for an arganization, go to that organization's page and click Edit with Form. Parameters For - The branch of the organizations or specialty with which this contact is associated. (i.e. "Biomass", "New Applications", etc. Default is "GeneralInfo".) This will be used to differentiate this contact from others associated with the same organization. Name - The name Topics this page discusses. (optional) When a person's name is unknown, a position name will often suffice. Phone - The contact's phone number. Website - A web page URL with additional contact info.


Contact Us | National Nuclear Security Administration  

National Nuclear Security Administration (NNSA)

Contact Us Contact Us NPO Public Affairs Manager Steven Wyatt (865) 576-9918 NPO Mailing Address NNSA Production Office PO Box 2050 Oak Ridge, TN 37831 Fax Number (865) 576-1237...


Clean Cities Program Contacts (Fact Sheet)  

SciTech Connect

This fact sheet provides contact information for program staff of the U.S. Department of Energy's Clean Cities program, as well as contact information for the nearly 100 local Clean Cities coalitions across the country.

Not Available



3 - Fundamentals of contact mechanics and friction  

Science Journals Connector (OSTI)

Abstract: The subjects of contact and friction are introduced here in the context of frictionvibration interactions. The chapter begins with a brief presentation of the fundamentals of contact mechanics and friction phenomena, and continues with an examination of classic formulations and laws of contact and friction. The various steps involved in contact and friction analysis of an engineering system are outlined, and essential definitions and concepts of contact and friction are introduced. There follows a presentation of the detailed contact and friction analysis, which can be used for the analysis of general contact and friction phenomena encountered in dealing with frictionvibration interaction problems. The comprehensive treatment of interface contact and friction from macro-to micro-level are presented.



Contact Information | Princeton Plasma Physics Lab  

NLE Websites -- All DOE Office Websites (Extended Search)

Careers Human Resources Environment, Safety & Health Procurement Division Technology Transfer Current Projects Patents Disclosures Contact Information Forms Furth Plasma...


Contacts for Information Collection Management | Department of...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Information Collection Management Contacts for Information Collection Management Information Collection Program, and Information Quality Guidelines Christina Rouleau, IM-23 Records...


Electrical Contacts to Individual Colloidal Semiconductor Nanorods  

E-Print Network (OSTI)

stable nanostructured electrical devices with interestingElectrical Contacts to Individual Colloidal Semiconductorand its effect on electrical properties has important

Trudeau, Paul-Emile



Contact Us | National Nuclear Security Administration  

National Nuclear Security Administration (NNSA)

The National Nuclear Security Administration The National Nuclear Security Administration Contact Us Home > Field Offices > Welcome to the Sandia Field Office > Contact Us Contact Us If you have questions about activities at the Sandia Field Office, please contact the SFO Public Affairs Director at (505) 845-5264. Our mailing address is: U. S. Department of Energy, National Nuclear Security Administration, Sandia Field Office, P.O. Box 5400, Albuquerque, NM 87185. Printer-friendly version Printer-friendly version Facebook Twitter Youtube Flickr General Information About SFO Contact Us Contract Administration & Business Management Emergency Information Facilities & Projects Nuclear Operations Environment, Safety & Health Public Affairs Safeguards & Security Performance and Quality Assurance


Protein Folding in Contact Map Space  

Science Journals Connector (OSTI)

Changing a few contacts in a contact map corresponds to a large scale move in confrontation space; hence, one gains a lot by using the contact map representation for protein folding. We developed an efficient search procedure in the space of physical contact maps, which could identify the native fold as of the lowest free energy, provided on had a free energy function whose ground state is the native map. We prove rigorously that the widely used pairwise contact approximation to the free energy cannot stabilize even a single protein's native map. Testing the native map against a set of decoys obtained by gapless threading, one may be misled to the opposite conclusion.

M. Vendruscolo; R. Najmanovich; E. Domany



Accommodation Program Contacts | Department of Energy  

NLE Websites -- All DOE Office Websites (Extended Search)

Accommodation Program Contacts Accommodation Program Contacts Accommodation Program Contacts Section 508 Coordinators: For information with regard to DOE Section 508 Policy and Guidance, contact DOE Section 508 Coordinators: Jeffrey Williams DOE Section 508 Coordinator (Primary) Chief Information Office, Customer Relationship Management Office (202) 586-1305 jeffrey.williams@hq.doe.gov Deborah Urban DOE Section 508 Coordinator (Alternate) Chief Information Office, Customer Relationship Management Office (702) 295-1333 deborah.urban@hq.doe.gov Assistive Technologies Coordinator (ATC) For information and recommendations with regard to assistive devices and or applications, employees should contact the Office of Chief Information Officer (OCIO) Assistive Technologies Coordinator (ATC): Jeffrey Williams


Rolling Contact Fatigue of Ceramics  

SciTech Connect

High hardness, low coefficient of thermal expansion and high temperature capability are properties also suited to rolling element materials. Silicon nitride (Si{sub 3}N{sub 4}) has been found to have a good combination of properties suitable for these applications. However, much is still not known about rolling contact fatigue (RCF) behavior, which is fundamental information to assess the lifetime of the material. Additionally, there are several test techniques that are employed internationally whose measured RCF performances are often irreconcilable. Due to the lack of such information, some concern for the reliability of ceramic bearings still remains. This report surveys a variety of topics pertaining to RCF. Surface defects (cracks) in Si{sub 3}N{sub 4} and their propagation during RCF are discussed. Five methods to measure RCF are then briefly overviewed. Spalling, delamination, and rolling contact wear are discussed. Lastly, methods to destructively (e.g., C-sphere flexure strength testing) and non-destructively identify potential RCF-limiting flaws in Si{sub 3}N{sub 4} balls are described.

Wereszczak, Andrew A [ORNL; Wang, W. [Bournemouth University, Bournemouth, United Kingdom; Wang, Y. [Bournemouth University, Bournemouth, United Kingdom; Hadfield, M. [Bournemouth University, Bournemouth, United Kingdom; Kanematsu, W. [National Institute of Advanced Industrial Science and Technology, Japan; Kirkland, Timothy Philip [ORNL; Jadaan, Osama M. [University of Wisconsin, Platteville




Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

77991 Federal Register 77991 Federal Register / Vol. 76, No. 241 / Thursday, December 15, 2011 / Notices would like to make oral statements regarding any of the items on the agenda, you should contact Elena Melchert at the telephone number listed above. You must make your request for an oral statement at least three business days prior to the meeting, and reasonable provisions will be made to include all who wish to speak. Public comment will follow the three minute rule. Minutes: The minutes of this meeting will be available for public review and copying within 60 days at: http:// www.fossil.energy.gov/programs/oilgas/ advisorycommittees/ UltraDeepwater.html. Issued at Washington, DC, on December 7, 2011. LaTanya Butler, Acting Deputy Committee Management Officer. [FR Doc. 2011-32160 Filed 12-14-11; 8:45 am]


Export.gov - Contact Us Index  

NLE Websites -- All DOE Office Websites (Extended Search)

Contact Us Contact Us Print | E-mail Page Contact Us Contact Us Home Export Counseling Help with Trade Problems Non-US Companies Employment Website Feedback Related Topics International Finance International Law Contact Us - Trade Information Center Important Contacts: Questions on tariffs/taxes/duties for shipments going overseas: Please contact your freight forwarder/service provider/courier service Questions on imports into the United States: U.S. Customs at 1 877 227 5511 Questions on export license requirements: Bureau of Industry and Security at 202 482 4811 Questions on HS/Schedule B numbers: Census Bureau, Foreign Trade Division at 1 800 549 0595, option #2 Export Counseling To receive answers to your exporting questions on: Country-specific Export Information Region-specific Export Information (Middle East, China, Latin


Theranostics 2014, Vol. 4, Issue 3 http://www.thno.org  

E-Print Network (OSTI)

Theranostics 2014, Vol. 4, Issue 3 http://www.thno.org 267 TThheerraannoossttiiccss 2014; 4 with select Ivyspring International Publisher #12;Theranostics 2014, Vol. 4, Issue 3 http://www.thno.org 268

Craik, Charles S.


Procuring Solar Energy Guide Contacts | Department of Energy  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

Procuring Solar Energy Guide Contacts Procuring Solar Energy Guide Contacts Contact information for the Procuring Solar Energy: A Guide for Federal Facility Decision Makers is...


Next of Kin and Emergency Contact Procedures | Department of...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Next of Kin and Emergency Contact Procedures Next of Kin and Emergency Contact Procedures DOE procedures for the maintenance of an employees emergency contact information and for...


How to Contact Power Services (pbl/main)  

NLE Websites -- All DOE Office Websites (Extended Search)

Contact Power Services Power Services Account Executives Customer Service Centers Comment Form Firstgov How to Contact Power Services General Power Services Contact Information: If...


Advanced Source/Drain and Contact Design for Nanoscale CMOS  

E-Print Network (OSTI)

Barrier Modeling of Metal and Silicide Contacts, IEEE Elec.Redistributions in Metal and Silicide Contacts, IEEE Trans.Redistributions in Metal and Silicide Contacts, IEEE Trans.

Vega, Reinaldo



International Energy Outlook 2000 - Contacts  

Gasoline and Diesel Fuel Update (EIA)

The International Energy Outlook is prepared by the Energy Information Administration (EIA). General questions concerning the contents of the report should be referred to Mary J. Hutzler (202/586-2222), Director, Office of Integrated Analysis and Forecasting. Specific questions about the report should be referred to Linda E. Doman (202/586-1041) or the following analysts: Report Contact World Energy Consumption Linda E. Doman - 202/586-1041 linda.doman@eia.doe.gov World Oil Markets G. Daniel Butler - 202/586-9503 gbutler@eia.doe.gov Bruce Bawks - 202/586-6579 bruce.bawks@eia.doe.gov Natural Gas Phyllis Martin - 202/586-9592 phyllis.martin@eia.doe.gov Gas-to-Liquids Technology William Trapmann - 202/586-6408 william.trapmann@eia.doe.gov Coal Michael Mellish - 202/586-2136


Annual Energy Outlook 2000 - Contact  

Gasoline and Diesel Fuel Update (EIA)

Homepage Homepage For Further Information... The Annual Energy Outlook 2001 (AEO2001) was prepared by the Energy Information Administration (EIA), Office of Integrated Analysis and Forecasting, under the direction of Mary J. Hutzler (mhutzler@eia.doe.gov, 202/586-2222), Director, Office of Integrated Analysis and Forecasting; Susan H. Holte (sholte@eia.doe.gov, 202/586-4838), Director of the Demand and Integration Division; James M. Kendell (jkendell@eia.doe.gov, 202/586-9646), Director of the Oil and Gas Division; Scott Sitzer (ssitzer@eia.doe.gov, 202/586-2308), Director of the Coal and Electric Power Division; and Andy S. Kydes (akydes@eia.doe.gov, 202/586-2222), Senior Modeling Analyst. For ordering information and questions on other energy statistics available from EIA, please contact EIA’s National Energy Information Center. Addresses, telephone numbers, and hours are as follows:

Note: This page contains sample records for the topic "apel org contact" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.



Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

454 Federal Register 454 Federal Register / Vol. 76, No. 170 / Thursday, September 1, 2011 / Notices FOR FURTHER INFORMATION CONTACT: General questions concerning the proposed action and the DEIS can be directed to: Hannah Hadley, Study Environmental Coordinator (see ADDRESSES) or Daniel Johnson, Project Manager, Seattle District, U.S. Army Corps of Engineers, P.O. 3755, Seattle, WA 98124-3755, ATTN: CENWS-EN- CM-CJ; telephone (206) 764-3423; fax (206) 764-4470; or e-mail Daniel.E.Johnson@usace.army.mil. SUPPLEMENTARY INFORMATION: The NOI to prepare a Draft Environmental Impact Statement for the Skagit River General Investigation Study (previously advertised as the Skagit River Flood Damage Reduction Study), Skagit County, Washington was published in the July 29, 2011 Federal Register (76


Doping Graphene with Metal Contacts  

Science Journals Connector (OSTI)

Making devices with graphene necessarily involves making contacts with metals. We use density functional theory to study how graphene is doped by adsorption on metal substrates and find that weak bonding on Al, Ag, Cu, Au, and Pt, while preserving its unique electronic structure, can still shift the Fermi level with respect to the conical point by ?0.5??eV. At equilibrium separations, the crossover from p-type to n-type doping occurs for a metal work function of ?5.4??eV, a value much larger than the graphene work function of 4.5eV. The numerical results for the Fermi level shift in graphene are described very well by a simple analytical model which characterizes the metal solely in terms of its work function, greatly extending their applicability.

G. Giovannetti; P. A. Khomyakov; G. Brocks; V. M. Karpan; J. van den Brink; P. J. Kelly



Archived BPRC Web Links: http://www.arcus.org/trec/vbc/index.php?act=home  

E-Print Network (OSTI)

Archived BPRC Web Links: http://www.arcus.org/trec/vbc/index.php?act=home "Explore Antarctica guide. http://www.marinetech.org/rov_competition/2007/international_comp_2007.php International Student or call 614-292-3416. http://www.nsta.org/main/news/stories/nsta_story.php?news_story_ID=53499

Howat, Ian M.


StepGreen.org: Increasing energy saving behaviors via social networks Jennifer Mankoff1  

E-Print Network (OSTI)

StepGreen.org: Increasing energy saving behaviors via social networks Jennifer Mankoff1 , Susan R and evaluation of StepGreen.org, a site intended to promote energy-saving behaviors. We present the results of StepGreen.org (Figure 1), a site intended to motivate people to make energy-reducing changes

Mankoff, Jennifer


media-contacts | ornl.gov  

NLE Websites -- All DOE Office Websites (Extended Search)

Find People Find People General Contacts Leadership Team Media Contacts User Facility Contacts Internal Users Home | Our People | Media Contacts SHARE Media Contacts ORNL's Communications team works with national, regional, and local media outlets on news stories about the laboratory. Media seeking more information on ORNL research and development activities may refer to the resources listed below. General questions not related to media queries may be sent to news@ornl.gov. Media Queries 865.574.4160 Experts List ORNL scientists and engineers are available as information resources for the media. For assistance in scheduling interviews, please contact the Office of Communications and External Relations at 865.574.4160. Photo Gallery Campus shots and research images from ORNL.


Contact Us | National Nuclear Security Administration  

NLE Websites -- All DOE Office Websites (Extended Search)

Contact Us Contact Us Home > Field Offices > Welcome to the Los Alamos Field Office > Contact Us Contact Us Contact the NNSA Los Alamos Field Office NNSA Los Alamos Field Office (NA-00-LA) 3747 West Jemez Road Los Alamos, NM 87544 (505) 667-6691 Please send any comments, questions, or feedback to Toni Chiri Featured Links LANL Phonebook National Nuclear Security Administration Los Alamos National Laboratory Los Alamos County USA Gov Department of Energy (DOE) New Mexico Environmental Department - LANL U.S. Department of Homeland Security Printer-friendly version Printer-friendly version Facebook Twitter Youtube Flickr General Information About Los Alamos Field Office Contact Us Employee Concerns Program LANS Contract Los Alamos Field Office Emergency Public Information Related Links


Roughening Transition in a Moving Contact Line  

E-Print Network (OSTI)

The dynamics of the deformations of a moving contact line on a disordered substrate is formulated, taking into account both local and hydrodynamic dissipation mechanisms. It is shown that both the coating transition in contact lines receding at relatively high velocities, and the pinning transition for slowly moving contact lines, can be understood in a unified framework as roughening transitions in the contact line. We propose a phase diagram for the system in which the phase boundaries corresponding to the coating transition and the pinning transition meet at a junction point, and suggest that for sufficiently strong disorder a receding contact line will leave a Landau--Levich film immediately after depinning. This effect may be relevant to a recent experimental observation in a liquid Helium contact line on a Cesium substrate [C. Guthmann, R. Gombrowicz, V. Repain, and E. Rolley, Phys. Rev. Lett. {\\bf 80}, 2865 (1998)].

Ramin Golestanian; Elie Raphael



Initiatives and Projects Contacts | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Initiatives and Projects Contacts Initiatives and Projects Contacts Initiatives and Projects Contacts If you have a question about any of the initiatives and projects listed on this site, you can use this contact information to reach the office you're interested in: State and Local Energy Efficiency Action Network (SEE Action) See the State and Local Energy Efficiency Action Network Contacts page for individuals you can contact. Hawaii Clean Energy Initiative See the Hawaii Clean Energy Initiative page for more information. International Partnerships and Projects International Program EE-13 / Forrestal Building U.S. Department of Energy 1000 Independence Avenue, SW Washington, D.C. 20585-0121 Small Business Innovation Research Case Studies See Small Business Innovation and Research on the U.S. Department of Energy


Zero-bias anomaly in asymmetric contacts  

Science Journals Connector (OSTI)

The Coulomb electron-electron interaction effect on the tunneling conductance of an asymmetric contact consisting of two nonequivalent two-dimensional electron systems, one clean and the other disordered, is considered. It is shown that the zero-bias anomalies typical for symmetric disordered and clean contacts are strongly modified in the asymmetric clean-disordered contact due to more complicated screening effects and appearance of a new collective mode.

Michael Reizer



Contact | U.S. DOE Office of Science (SC)  

Office of Science (SC) Website

Budget Field Offices Federal Advisory Committees History Scientific and Technical Information Honors & Awards Jobs Brochures, Logos, & Information Resources Contact Contact...


Title of Document | 1 LOCAL UNION CONTACT LIST  

E-Print Network (OSTI)

on the following web site: http://atyourservice.ucop.edu/employees/policies/labor_relations/index.html Code., Suite C San Diego CA 92110 (619) 296-4937 Web site: www.cueunion.org SX Service American Federation) 296-0342 Web site: www.afscme3299.org EX Patient Care Technical American Federation of State, County

Gleeson, Joseph G.


MSTC - Microsystems Science, Technology, and Components - Contacts  

NLE Websites -- All DOE Office Websites (Extended Search)

Contacts Contacts Microsystems Home Custom Microsystems Solutions Microsystems R&D Services Capabilities and Technologies Facilities Trusted Microsystems General Info About Us Awards Contacts Doing Business with Us Fact Sheets MESA News CONTACT US card file image ASIC Custom Solutions email: ASIC Custom Solutions Biological Microsensor Technologies Biosensors and Nanomaterials email: Biosensors and Nanomaterials Chemical Microsensors and Sensor Microsystems Chemical sensors and integrated sensor-based microsystems email: Chemical Microsensors and Sensor Microsystems Custom Components COTS, Capacitors, Magnetics, Cables and Interconnects email: Custom Components Failure Analysis Root Cause and Failure Analysis email: Failure Analysis Integrated Photonics Photonic Crystals, Nano Photonics, Micro Optics


Improved Contact Design Methodology for Solar Cells  

Science Journals Connector (OSTI)

A rigorous approach to optimize the layout of the front contact under the real working condition of the solar cell is proposed.

Li, Jing-Jing; Ding, Ding; Lim, Swee Hoe; Zhang, Yong-Hang


Contacts for Cybersecurity | Department of Energy  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

Cybersecurity Contacts for Cybersecurity Office of the Associate CIO for Cybersecurity Office of the Chief Information Officer US Department of Energy 202-586-0166...


Contact Us | National Nuclear Security Administration  

National Nuclear Security Administration (NNSA)

please use the form below. For general information about NNSA, please feel free to contact us: Mailing Address National Nuclear Security Administration U.S....


Clean Cities Program Contacts (Fact Sheet)  

SciTech Connect

This fact sheet contains contact information for program staff and coalition coordinators for the U.S. Department of Energy's Clean Cities program.

Not Available



Clean Cities Program Contacts (Fact Sheet)  

SciTech Connect

This fact sheet contains contact information for program staff and coalition coordinators for the U.S. Department of Energy's Clean Cities program.

Not Available



Clean Cities Program Contacts (Fact Sheet)  

SciTech Connect

This fact sheet contains contact information for program staff and coalition coordinators for the U.S. Department of Energy's Clean Cities program.

Not Available



Contact Form - DOE Directives, Delegations, and Requirements  

NLE Websites -- All DOE Office Websites (Extended Search)

Contact Form by Diane Johnson Directives are the Department of Energy's Primary means of establishing policies, requirements, responsibilities, and procedures for Departmental...


Organization Chart and Contacts | Department of Energy  

Office of Environmental Management (EM)

Manager Karen Dandridge 202-586-6108 Karen.Dandridge@ee.doe.gov Contacts by Area Fuel Cells Hydrogen Production and Delivery Hydrogen Storage Manufacturing Technology Validation...

Note: This page contains sample records for the topic "apel org contact" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Data Qualification Report: Borehole Straigraphic Contacts  

SciTech Connect

The data set considered here is the borehole stratigraphic contacts data (DTN: M09811MWDGFM03.000) used as input to the Geologic Framework Model. A Technical Assessment method used to evaluate these data with a two-fold approach: (1) comparison to the geophysical logs on which the contacts were, in part, based; and (2) evaluation of the data by mapping individual units using the entire data set. Qualification of the geophysical logs is being performed in a separate activity. A representative subset of the contacts data was chosen based on importance of the contact and representativeness of that contact in the total data set. An acceptance window was established for each contact based on the needs of the data users. Data determined to be within the acceptance window were determined to be adequate for their intended use in three-dimensional spatial modeling and were recommended to be Qualified. These methods were chosen to provide a two-pronged evaluation that examines both the origin and results of the data. The result of this evaluation is a recommendation to qualify all contacts. No data were found to lie outside the pre-determined acceptance window. Where no geophysical logs are available, data were evaluated in relation to surrounding data and by impact assessment. These data are also recommended to be qualified. The stratigraphic contact data contained in this report (Attachment VII; DTN: M00004QGFMPICK.000) are intended to replace the source data, which will remain unqualified.

R.W. Clayton; C. Lum



Laser and Particle Beams http://journals.cambridge.org/LPB  

E-Print Network (OSTI)

Laser and Particle Beams http://journals.cambridge.org/LPB Additional services for Laser, J. Limpouch, R. Liska and P. Váchal Laser and Particle Beams / Volume 30 / Issue 03 / September 2012 of annularlaserbeamdriven plasma jets from massive planar targets. Laser and Particle Beams,30, pp 445457 doi:10.1017/S

Liska, Richard


https://doyouliveunited.org 1. Enter you user ID  

E-Print Network (OSTI)

Search' button. 7. Enter you search terms for the agency of your choice and click on `Search'. #12;httpshttps://doyouliveunited.org 1. Enter you user ID: your email address Enter your password: welcome be different then the options listed here. 5. For a payroll pledge, enter the amount per pay or the total


Goldschmidt Conference Abstracts Mineralogical Magazine www.minersoc.org  

E-Print Network (OSTI)

patterns. In addition to removal of silicic acid, simultaneous removal of boron coprecipitatedGoldschmidt Conference Abstracts Mineralogical Magazine www.minersoc.org 2224 Silicic acid removal to short lifetime of reinjection well caused by siliceous deposit from geothermal water. Removal of silicic

Sparks, Donald L.


www.egec.org Nuremberg, 15 October 2013  

E-Print Network (OSTI)

and Technology ­ a report from EGC 2013 Dr. Burkhard Sanner European Geothermal Energy Council, Brussels #12;www.egec.org Content European Geothermal Energy Council · Market and application · Technological development The European Geothermal Energy Congress in June 2013 in Pisa (EGC 2013) brought together ca 500 experts from

Oak Ridge National Laboratory



E-Print Network (OSTI)

www.electricitypolicy.org.uk EPRGWORKINGPAPERNON-TECHNICALSUMMARY Financing the Nuclear Renaissance with nuclear power. The cost structure of nuclear power differs significantly from that of fossil-fuelled electricity. In the case of nuclear the majority of costs are associated with the construiction phase whereas

Aickelin, Uwe



E-Print Network (OSTI)

www.electricitypolicy.org.uk EPRGWORKINGPAPERNON-TECHNICALSUMMARY Nuclear Power and Deregulated nuclear power company British Energy ran into financial crisis in 2002 and had to be rescued by the government, it appeared to show that nuclear power could not survive in a deregulated electricity market like

Aickelin, Uwe


The Neutron Scattering Society www.neutronscattering.org  

E-Print Network (OSTI)

The Neutron Scattering Society of America www.neutronscattering.org Press Release, February 4, 2008 The Neutron Scattering Society of America is pleased to announce the 2008 recipients of its 3 major prizes. The Neutron Scattering Society of America (NSSA) established the Clifford G. Shull Prize in Neutron Science

Chen, Sow-Hsin


The Neutron Scattering Society www.neutronscattering.org  

E-Print Network (OSTI)

The Neutron Scattering Society of America www.neutronscattering.org Press Release February 11, 2008 The Neutron Scattering Society of America is pleased to announce the election as Fellows of the Society of in application of neutron scattering to studies of surfaces and crystal field excitations as well as his

Homes, Christopher C.


MALLINCKRODT GRANT PROGRAM (http://emallinckrodtfoundation.org/Guidelines.html)  

E-Print Network (OSTI)

MALLINCKRODT GRANT PROGRAM (http://emallinckrodtfoundation.org/Guidelines.html) The University of Pittsburgh may submit two grant applications to the Mallinckrodt Grant Program of the Edward Mallinckrodt, Jr. Foundation. A grant from this program provides $60,000 per year in direct costs for three years. No indirect

Jiang, Huiqiang


www.cambridge.org/us/9780521194280 Molecular Machines in  

E-Print Network (OSTI)

www.cambridge.org/us/9780521194280 Molecular Machines in Biology Workshop of the Cell Joachim Frank Columbia University, New York About the Book The concept of molecular machines in biology has transformed, translation, protein folding, and protein degradation, are all carried out by molecular machines. This volume

Grishok, Alla


www.ResponsiblePurchasing.org Sustainable Purchasing 101  

E-Print Network (OSTI)

· Recyclable or compostable · Made from renewable resources · Less toxic than conventional goods · Manufactured purchasing resources are available for universities? 2 OSU Sustainability Conference #12;www.ResponsiblePurchasing.org EPPs are... · Made with recycled content · Highly energy efficient · Designed to be long lasting

Escher, Christine


The Texas Common Application www.applytexas.org  

E-Print Network (OSTI)

at Galveston Texas Southern University University of Houston Main Campus University of Houston Downtown #12The Texas Common Application www.applytexas.org #12;About the Texas Common Application The goal of ApplyTexas is to offer a centralized means for both Texas and non-Texas students to apply to the many


www.rsc.org Registered Charity Number 207890  

E-Print Network (OSTI)

www.rsc.org Registered Charity Number 207890 As featured in: SeeWeitz et al., Lab Chip, 2008, 8 silanes. These silanes allow us to tailor the surface chemistry of the interface and to use lithographic tech- niques to spatially pattern the wettability. To demonstrate the utility of this approach, we



E-Print Network (OSTI)

MATHEMATICAL BIOSCIENCES http://www.mbejournal.org/ AND ENGINEERING Volume 1, Number 1, September Departments of Mathematical Sciences and of Biomedical Engineering New Jersey Institute of Technology, Newark such a numerical method to the study of ion movements in cellular environments, as well as its potential for future

Huang, Huaxiong


http://journals.cambridge.org/ROB Additional services for Robotica  

E-Print Network (OSTI)

Robotica http://journals.cambridge.org/ROB Additional services for Robotica: Email alerts: Click predictive controller for robots to follow a virtual leader Dongbing Gu and Huosheng Hu Robotica / Volume 27. Robotica, 27, pp 905-913 doi:10.1017/S0263574708005316 Request Permissions : Click here Downloaded from

Hu, Huosheng


http://journals.cambridge.org/ROB Additional services for Robotica  

E-Print Network (OSTI)

Robotica http://journals.cambridge.org/ROB Additional services for Robotica: Email alerts: Click and Vicente Matellán Robotica / Volume 26 / Issue 06 / November 2008, pp 817 - 830 DOI: 10.1017/S (2008). A hybrid approach to fast and accurate localization for legged robots. Robotica, 26, pp 817

Hu, Huosheng


http://journals.cambridge.org/ROB Additional services for Robotica  

E-Print Network (OSTI)

Robotica http://journals.cambridge.org/ROB Additional services for Robotica: Email alerts: Click and Y. Ahmet ekerciolu Robotica / FirstView Article / October 2014, pp 1 - 13 DOI: 10.1017/S formation control of networked mobile robots in environments with obstacles. Robotica, Available on CJO 2014

Sekercioglu, Y. Ahmet


http://journals.cambridge.org/ROB Additional services for Robotica  

E-Print Network (OSTI)

Robotica http://journals.cambridge.org/ROB Additional services for Robotica: Email alerts: Click. Goldberg Robotica / Volume 13 / Issue 06 / November 1995, pp 565 573 DOI: 10.1017/S0263574700018646 algorithms for automatic planning by robots in stochastic environments. Robotica,13, pp 565573 doi:10.1017/S

Goldberg, Ken


http://journals.cambridge.org/ROB Additional services for Robotica  

E-Print Network (OSTI)

Robotica http://journals.cambridge.org/ROB Additional services for Robotica: Email alerts: Click Robotica / FirstView Article / September 2012, pp 1 8 DOI: 10.1017/S0263574711000774, Published online: 25 on taskoriented workspace. Robotica, Available on CJO 2011 doi:10.1017/S0263574711000774 Request Permissions

Kim, Jongwon

Note: This page contains sample records for the topic "apel org contact" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


http://journals.cambridge.org/ROB Additional services for Robotica  

E-Print Network (OSTI)

Robotica http://journals.cambridge.org/ROB Additional services for Robotica: Email alerts: Click Robotica / Volume 24 / Issue 04 / July 2006, pp 429 - 431 DOI: 10.1017/S0263574705002420, Published online positioning method for a humanoid robot. Robotica, 24, pp 429-431 doi:10.1017/S0263574705002420 Request

Hu, Huosheng


ISSN 1464-0325 www.rsc.org/jem  

E-Print Network (OSTI)

ISSN 1464-0325 www.rsc.org/jem Cutting-Edge Research on Environmental Processes & Impacts Volume 10 | Number 11 | November 2008 | Pages 1241­1372 Journal of Environmental Monitoring Cover Benitez et al. Microbial activity in contaminated soils 10th Anniversary Focus Leal Filho Rainforest depletion and climate

Granada, Universidad de



E-Print Network (OSTI)

www.electricitypolicy.org.uk EPRGWORKINGPAPERNON-TECHNICALSUMMARY Do homes that are more energy efficient consume less energy?: A structural equation model of the English residential sector EPRG Working Paper 1117 Cambridge Working Paper in Economics 1139 Scott Kelly Energy consumption from the residential

Aickelin, Uwe


www.VadoseZoneJournal.org Soil Architecture and  

E-Print Network (OSTI)

www.VadoseZoneJournal.org Soil Architecture and Physicochemical Func ons: An Introduc on Soils func engineers with the best educa on possible. The 16 papers in this special sec on on soil architecture measurement, visualiza on, and modeling of soil structure (architecture) and physical, chemical

Wildenschild, Dorthe


Optimization of Modelica Models with JModelica.org and Optimica  

E-Print Network (OSTI)

-based modeling ­ Text book style equations · Multi-domain modeling ­ Heterogeneous modeling · Object orientedOptimization of Modelica Models with JModelica.org and Optimica #12;Outline · Modelica · Dynamic's next? #12;What is Modelica? · A language for modeling of complex heterogeneous physical systems · Open


www.vics.org1 September 27, 2011  

E-Print Network (OSTI)

replenishments and promotional needs Bulk: Liquid chemical, fuel and energy industry transportation specialists America and China Port Logistics: Transloading, distribution, warehousing and port dray services-modal and brokerage services to meet demand #12;www.vics.org6 Fuel cost volatility Alternative, data-based, lane

Lin, Xiaodong


EPJ Photovoltaics 2, 20301 (2011) www.epj-pv.org  

E-Print Network (OSTI)

EPJ Photovoltaics 2, 20301 (2011) www.epj-pv.org DOI: 10.1051/epjpv/2011001 c Owned by the authors, published by EDP Sciences, 2011 EPJ PhotovoltaicsEPJ Photovoltaics Geometrical optimization and electrical online: 1 April 2011 Abstract This article investigates the optimal efficiency of a photovoltaic system

Paris-Sud XI, Université de


PFP: Protein Function Prediction server For any questions regarding PFP contact the administration at info@kiharalab.org  

E-Print Network (OSTI)

also click on "Load Sample" link to load this sequence in the text box and follow the next steps "Enter Query Sequence(s)". Consider the following sequence that you can enter. >sp|P56851|EP3B. Clicking on "Clear" link will clear the text box for sequence and load default ESG parameters in the boxes

Kihara, Daisuke


Effect of contact statistics on electrical contact resistance Yong Hoon Janga)  

E-Print Network (OSTI)

Effect of contact statistics on electrical contact resistance Yong Hoon Janga) School of Mechanical, there will be a constriction resistance to electrical flow between them of /2a, where is the electrical resistivity; accepted 10 September 2003 The flow of electrical current through a microscopic actual contact spot between

Barber, James R.


ARM - AMF2 Organization and Contact Information  

NLE Websites -- All DOE Office Websites (Extended Search)

Organization and Contact Information Organization and Contact Information AMF Information Science Architecture Baseline Instruments AMF1 AMF2 AMF3 Data Operations AMF Fact Sheet Images Contacts AMF Deployments Hyytiälä, Finland, 2014 Manacapuru, Brazil, 2014 Oliktok Point, Alaska, 2013 Los Angeles, California, to Honolulu, Hawaii, 2012 Cape Cod, Massachusetts, 2012 Gan Island, Maldives, 2011 Ganges Valley, India, 2011 Steamboat Springs, Colorado, 2010 Graciosa Island, Azores, 2009-2010 Shouxian, China, 2008 Black Forest, Germany, 2007 Niamey, Niger, 2006 Point Reyes, California, 2005 AMF2 Organization and Contact Information The Argonne AMF2 Operations Office manages the operation of the second ARM mobile facility. Basic contact information, phone numbers, email, and shipping information to personnel in this office is available on this page.


Field Facilities Contacts for Printing and Mail  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Facilities Contacts for Printing and Mail Facilities Contacts for Printing and Mail Print and Mail Contacts Site Printing Contact Mail Contact NNSA, Albuquerque Deborah Miller (505) 845-6049 Thomas H. Clinkenbeard NNSA Service Center PO Box 5400 Albuquerque, NM 87185-5400 (505) 845-4602 tclinkenbeard@doeal.gov (mailto:tclinkenbeard@doeal.gov) Argonne National Laboratory Doreen Schoening Argonne National Laboratory U.S. Department of Energy 9700 South Cass Avenue Blvd 340 Lemonmt, IL 60439 (630) 840-6399 dschoening@anl.gov (mailto:dschoening@anl.gov) Bechtel Jacobs James Hughes Bechtel Jacobs - Mail Stop 7294 U.S. Department of Energy PO Box 4699 Oak Ridge, TN 37831 (865) 576-8423 Berkeley Site Office Mercedes Downing Berkeley Site Office U.S. Department of Energy 1 Cyclotron Road Bldg 90


Golden Field Office Contacts | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Golden Field Office Contacts Golden Field Office Contacts Golden Field Office Contacts On this page you will find address and contact information for the Golden Field Office. Mailing Address: U.S. Department of Energy Golden Field Office 15013 Denver West Parkway Golden, Colorado 80401 Main Number: 720-356-1800 Main Fax: 720-356-1750 Golden Field Office Key Contacts: Business Operations Director (Acting) Doug Kaempf 720-356-1753 Business Services Deputy Director Timothy Meeks 720-356-1403 Chief Counsel Derek Passarelli 720-356-1742 Freedom of Information Act Michele Altieri 720-356-1427 Environmental Oversight Robin Sweeney 720-356-1562 National Laboratory Oversight Doug Hooker 720-356-1578 Financial Oversight Marlys Kinsey 720-356-1427 Procurement Services Director John Meeker 720-356-1399


DOE Community Transition Contacts | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

About Us » Contact Us » DOE Community Transition Contacts About Us » Contact Us » DOE Community Transition Contacts DOE Community Transition Contacts Headquarters David Geiser, Director Office of Legacy Management, LM-1 U.S. Department of Energy 1000 Independence Ave., SW Washington, DC 20585 (202) 586-8324 (202) 586-8403 (FAX) david.geiser@hq.doe.gov Field HANFORD Colleen French U.S. Department of Energy Richland Operations Office P.O. Box 550 A7-75 Richland, WA 99352 (509) 373-5985 (509) 373-1563 (FAX) colleen_c_french@rl.gov IDAHO NATIONAL LABORATORY Jacqie Gernant, Program Manager National Security/Technology Partnership Division 2525 Fremont Avenue Idaho Falls, ID 83415 (208) 526-1742 (208) 526-0727 (FAX) gernanja@id.doe.gov MOUND Jane Powell Office of Legacy Management, LM-20 U.S. Department of Energy 10995 Hamilton-Cleves Highway


An extraordinary film sponsored by the Earth Engineering Center (EEC) www.eecny.org, www.wtert.org  

E-Print Network (OSTI)

An extraordinary film sponsored by the Earth Engineering Center (EEC) www.eecny.org, www University Rapid economic development in the last few decades has been accompanied by the generation Engineering Center - The Wang Jiuliang film (1 hour) -Concluding remarks by Mr. Ling Qiu (M.S. candidate, SEAS


LEDSGP/about/contacts | Open Energy Information  

Open Energy Info (EERE)

source source History View New Pages Recent Changes All Special Pages Semantic Search/Querying Get Involved Help Apps Datasets Community Login | Sign Up Search Page Edit History Facebook icon Twitter icon » LEDSGP/about/contacts < LEDSGP‎ | about Jump to: navigation, search LEDSGP Logo.png Advancing climate-resilient low emission development around the world Home About Tools Expert Assistance Events Publications Join Us About How We Work > Regional Platforms > Working Groups LEDS GP Members Steering Committee Guiding Structure Contacts Contact Us Sadie Cox LEDS Global Partnership Secretariat US National Renewable Energy Laboratory Caroline Uriarte LEDS Global Partnership Secretariat US National Renewable Energy Laboratory Caroline Spencer Climate and Development Knowledge Network


Contact Information | National Nuclear Security Administration  

National Nuclear Security Administration (NNSA)

Information | National Nuclear Security Administration Information | National Nuclear Security Administration Our Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy Emergency Response Recapitalizing Our Infrastructure Continuing Management Reform Countering Nuclear Terrorism About Us Our Programs Our History Who We Are Our Leadership Our Locations Budget Our Operations Media Room Congressional Testimony Fact Sheets Newsletters Press Releases Speeches Events Social Media Video Gallery Photo Gallery NNSA Archive Federal Employment Apply for Our Jobs Our Jobs Working at NNSA Blog Contact Information Home > About Us > Our Programs > Defense Programs > Military Academic Collaborations > Contact Information Contact Information At each of NNSA's eight sites, leading-edge research and development is


r XXXX American Chemical Society A dx.doi.org/10.1021/ac201626b |Anal. Chem. XXXX, XXX, 000000 pubs.acs.org/ac  

E-Print Network (OSTI)

proposed as a platform for miniaturized chemical sen- sor systems. However, only a few systems achieve massr XXXX American Chemical Society A dx.doi.org/10.1021/ac201626b |Anal. Chem. XXXX, XXX, 000­000 ARTICLE pubs.acs.org/ac Chemical Vapor Detection Using a Capacitive Micromachined Ultrasonic Transducer

Khuri-Yakub, Butrus T. "Pierre"


Contact Us | Y-12 National Security Complex  

NLE Websites -- All DOE Office Websites (Extended Search)

Contact Us Contact Us Contact Us Mail and delivery address information: Y-12 National Security Complex P.O. Box 2009 Oak Ridge, TN 37831-8245* Non-mail deliveries: Bear Creek Road P.O. Box 2009 Oak Ridge, TN 37830 *This mailstop is for general inquiries. For other mail, please contact the intended recipient for the appropriate mailstop. If you don't find what you're looking for on our Home Page or through our Search page, try one of the resources listed below. Media Inquiries Ellen Boatner, 865.241.4937 Public and Governmental Affairs Alice Brandon, 865.576.2963 Benefits One Call, 865.574.1500 New Hope Center Public Use Areas Ray Smith, 865.576.7781 Procurement procurement@y12.doe.gov, 865.576-8500 Socioeconomic Programs Lisa Copeland, 865.576.2090 Employment Staffing, staff@y12.doe.gov, 865.576.1377


Tribal Points of Contacts | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Points of Contacts Points of Contacts Tribal Points of Contacts US DOE-Office of Environmental Management 1000 Independence Avenue, SW Washington, DC 20585 ph: (202) 586-5944 fax: (202) 586-5000 Richland Operations Office- Hanford Indian Nations Program P.O. Box 550- MSIN A7-75 Richland, WA 99352 ph: (509) 376-6332 fax: (509) 376-1563 West Valley Demonstration Project Tribal Government Liaison P.O. Box 191- 10282 Rock Springs Road West Valley, NY 14171 ph: (716) 942-4629 fax: (716) 942-2068 Albuquerque Operations Office Tribal Government Liaison P.O. Box 5400 Albuquerque, NM 87185 ph: (505) 845-5977 fax: (505) 845-4154 Tribal Points of Contact Richland Operations Office: Hanford Albuquerque Operations Office: Yakama Indian Nation Environmental Restoration/ Waste Management Program


TEPP Points of Contact | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Services » Waste Management » Packaging and Transportation » Services » Waste Management » Packaging and Transportation » Transportation Emergency Preparedness Program » TEPP Points of Contact TEPP Points of Contact TEPP is a national program managed at a headquarters level and implemented through the TEPP Central Operations Center managed by Technical Resources Group, Inc. For additional information on the TEPP, or to find out how you can obtain TEPP materials or schedule a class, contact either the HQ Program Manager or TEPP Central Operations. EM Contact EM Headquarters Program Manager Ella McNeil, Office of Transportation Ella.McNeil@em.doe.gov U.S. Department of Energy Washington, DC 20585 TEPP Central Operations admin@merrtt.com 208-528-8895 Waste Management Nuclear Materials & Waste Tank Waste and Waste Processing

Note: This page contains sample records for the topic "apel org contact" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


contact-us | ornl.gov  

NLE Websites -- All DOE Office Websites (Extended Search)

News Careers Work with ORNL About ORNL Visiting ORNL Events and Conferences Highlights Success Stories Contact Us Index Home | ORNL | Contact Us Contact Us | contact-us SHARE If you don't find what you're looking for on the Home Page, the Site Index or by using the search box at the top of the page, you may want to refer to one of the resources listed below. Comments and Questions We're always happy to get feedback from our users. Please use the Comments form to send us your comments, questions, and observations. Mailing Address Our mailing address for U.S. Postal Service deliveries is: Oak Ridge National Laboratory P.O. Box 2008 Oak Ridge, TN 37831 For carriers other than U.S. Postal Service, replace "P.O. Box 2008" with "1 Bethel Valley Road."


Failure Modes of Ceramics in Rolling Contact  

Science Journals Connector (OSTI)

...engineering applications such as rolling contact bearing for gas turbines. The results of extensive testing carried out on perfect...subsequent crack propagation. By using X-ray diffraction, residual stresses on delaminated surfaces were measured and results...



Colorado State University Extension Contact: Joanne Littlefield  

E-Print Network (OSTI)

Colorado State University Extension Contact: Joanne Littlefield Director, Outreach and Engagement weather situation in Colorado is requiring often quick property and safety decisions; recovery efforts and rapidly shifting conditions along Colorado's Front Range. From food safety issues related to crops

Stephens, Graeme L.


Contact Us - HPMC Occupational Health Services  

NLE Websites -- All DOE Office Websites (Extended Search)

Contact us image MEDICAL EMERGENCIES - Call 911 from a land line or 373-0911 from a cell phone. Department and Program Information Principal Manager 376-4414 Site...


Front contact solar cell with formed emitter  

SciTech Connect

A bipolar solar cell includes a backside junction formed by an N-type silicon substrate and a P-type polysilicon emitter formed on the backside of the solar cell. An antireflection layer may be formed on a textured front surface of the silicon substrate. A negative polarity metal contact on the front side of the solar cell makes an electrical connection to the substrate, while a positive polarity metal contact on the backside of the solar cell makes an electrical connection to the polysilicon emitter. An external electrical circuit may be connected to the negative and positive metal contacts to be powered by the solar cell. The positive polarity metal contact may form an infrared reflecting layer with an underlying dielectric layer for increased solar radiation collection.

Cousins, Peter John



Front contact solar cell with formed emitter  

DOE Patents (OSTI)

A bipolar solar cell includes a backside junction formed by an N-type silicon substrate and a P-type polysilicon emitter formed on the backside of the solar cell. An antireflection layer may be formed on a textured front surface of the silicon substrate. A negative polarity metal contact on the front side of the solar cell makes an electrical connection to the substrate, while a positive polarity metal contact on the backside of the solar cell makes an electrical connection to the polysilicon emitter. An external electrical circuit may be connected to the negative and positive metal contacts to be powered by the solar cell. The positive polarity metal contact may form an infrared reflecting layer with an underlying dielectric layer for increased solar radiation collection.

Cousins, Peter John (Menlo Park, CA)



Contact fatigue : life prediction and palliatives  

E-Print Network (OSTI)

Fretting fatigue is defined as damage resulting from small magnitude (0.5-50 microns) displacement between contacting bodies where at least one of the bodies has an applied bulk stress. The applicability and limits of a ...

Conner, Brett P. (Brett Page), 1975-



Cooperativity and Contact Order in Protein Folding  

E-Print Network (OSTI)

The effects of cooperativity are studied within Go-Lennard-Jones models of proteins by making the contact interactions dependent on the proximity to the native conformation. The kinetic universality classes are found to remain the same as in the absence of cooperativity. For a fixed native geometry, small changes in the effective contact map may affect the folding times in a chance way and to the extent that is comparable to the shift in the folding times due to cooperativity. The contact order controlls folding scenarios: the average times necessary to bring pairs of amino acids into their near native separations depend on the sequential distances within the pairs. This dependence is largely monotonic, regardless of the cooperativity, and the dominant trend could be described by a single parameter like the average contact order. However, it is the deviations from the trend which are usually found to set the net folding times.

Marek Cieplak




SciTech Connect

Numerical modeling was used to simulate the constrained sintering process of the cathode contact layer during assembly of solid oxide fuel cells (SOFCs). A finite element model based on the continuum theory for sintering of porous bodies was developed and used to investigate candidate low-temperature cathode contact materials. Constitutive parameters for various contact materials under investigation were estimated from dilatometry screening tests, and the influence of processing time, processing temperature, initial grain size, and applied compressive stress on the free sintering response was predicted for selected candidate materials. The densification behavior and generated stresses within a 5-cell planar SOFC stack during sintering, high temperature operation, and room temperature shutdown were predicted. Insufficient constrained densification was observed in the stack at the proposed heat treatment, but beneficial effects of reduced grain size, compressive stack preload, and reduced thermal expansion coefficient on the contact layer densification and stresses were observed.

Koeppel, Brian J.; Liu, Wenning N.; Stephens, Elizabeth V.; Khaleel, Mohammad A.



Cooperativity and contact order in protein folding  

Science Journals Connector (OSTI)

The effects of cooperativity are studied within Go-Lennard-Jones models of proteins by making the contact interactions dependent on the proximity to the native conformation. The kinetic universality classes are found to remain the same as in the absence of cooperativity. For a fixed native geometry, small changes in the effective contact map may affect the folding times in a chance way, and, to an extent that is comparable to the shift in the folding times due to cooperativity. The contact order controls folding scenarios: the average times necessary to bring pairs of amino acids into their near native separations depend on the sequential distances within the pairs. This dependence is largely monotonic, regardless of the cooperativity, and the dominant trend could be described by a single parameter like the average contact order. However, it is the deviations from the trend which are usually found to set the net folding times.

Marek Cieplak



Clean Cities Program Contacts (Fact Sheet)  

SciTech Connect

Contact information for the U.S. Department of Energy's Clean Cities program staff and for the coordinators of the nearly 100 local Clean Cities coalitions across the country.

Not Available



Contact the GTT | Department of Energy  

Office of Environmental Management (EM)

and documents are posted to this website, we welcome your comments and interest in the GTT's efforts. Please feel free to contact the GTT via email: gridtechteam@hq.doe.gov....


Contact Information | Princeton Plasma Physics Lab  

NLE Websites -- All DOE Office Websites (Extended Search)

Contact Information Princeton Plasma Physics Laboratory P.O. Box 451 Princeton, NJ 08543-0451 GPS: 100 Stellarator Road Princeton, NJ 08540 U.S.A. Main Telephone: (609) 243-2000...


U-172: OpenOffice.org Two Vulnerabilities | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

72: OpenOffice.org Two Vulnerabilities 72: OpenOffice.org Two Vulnerabilities U-172: OpenOffice.org Two Vulnerabilities May 18, 2012 - 7:00am Addthis PROBLEM: OpenOffice.org Two Vulnerabilities PLATFORM: OpenOffice.org 3.3, Other versions may also be affected. ABSTRACT: Two vulnerabilities have been reported in OpenOffice.org, which can be exploited by malicious people to compromise a user's system. Reference LINKS: Secunia Advisory SA46992 CVE-2012-1149 CVE-2012-2149 IMPACT ASSESSMENT: High Discussion: 1) An integer overflow error in the vclmi.dll module when allocating memory for an embedded image object can be exploited to cause a heap-based buffer overflow e.g. via a specially crafted JPEG object within a DOC file. 2) An error within libwpd when parsing Wordperfect documents can be exploited to overwrite arbitrary memory via a specially crafted Wordperfect


ElasticPlastic Spherical Contact Modeling Including Roughness Effects  

E-Print Network (OSTI)

A multilevel model for elasticplastic contact between ajunction growth of an elasticplastic spherical contact. J.nite element based elasticplastic model for the contact of

Li, L.; Etsion, I.; Talke, F. E.



Department Name: Center for International Education Org. #: 2062 Position Title: Technology Coordinator  

E-Print Network (OSTI)

Department Name: Center for International Education Org. #: 2062 Position Title: Technology Content Manager) 2. Use appropriate software for creation of posters, flyers, and other promotiona

Baltisberger, Jay H.


Nuclear Mass Visualization and Analysis at nuclearmasses.org  

Science Journals Connector (OSTI)

Nuclear masses play an important role in a wide variety of studies motivating a tremendous surge in new precision mass measurements and global mass models. To handle this information and to address inadequacies of existing text?based disseminations of nuclear masses we have built a suite of codesonline at nuclearmasses.orgto manage visualize access manipulate share compare and analyze nuclear mass datasets. The services at this site are described along with plans for future development.

Michael S. Smith; Eric J. Lingerfelt; Caroline D. Nesaraja; Hiroyuki Koura; Filip G. Kondev



Exploring Korean Americans Interracial Contact Experiences During Recreational Sport Activities  

E-Print Network (OSTI)

This thesis follows the style of Journal of Leisure Research. 2 of friendship, as an essential condition for successful intergroup contact (Pettigrew, 1997; Pettigrew & Tropp, 2006). Since the contact hypothesis was first introduced, intergroup contact... conditions for successful intergroup contact. Their meta-analysis of 713 independent samples from 515 intergroup contact studies revealed four important findings First, 17 intergroup contact typically reduces intergroup prejudice. Second, the positive...

Lee, Kang Jae



Federal Energy Management Program: Operations and Maintenance Contacts  

NLE Websites -- All DOE Office Websites (Extended Search)

Contacts to someone by E-mail Contacts to someone by E-mail Share Federal Energy Management Program: Operations and Maintenance Contacts on Facebook Tweet about Federal Energy Management Program: Operations and Maintenance Contacts on Twitter Bookmark Federal Energy Management Program: Operations and Maintenance Contacts on Google Bookmark Federal Energy Management Program: Operations and Maintenance Contacts on Delicious Rank Federal Energy Management Program: Operations and Maintenance Contacts on Digg Find More places to share Federal Energy Management Program: Operations and Maintenance Contacts on AddThis.com... Sustainable Buildings & Campuses Operations & Maintenance Federal Requirements Program Management Commissioning Metering Computerized Maintenance Management Systems Maintenance Types


Water Power Program Contacts and Organization | Department of...  

Energy Savers (EERE)

Water Power Program Contacts and Organization Water Power Program Contacts and Organization The Wind and Water Power Technologies Office within the U.S. Department of Energy's...

Note: This page contains sample records for the topic "apel org contact" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Wind Program Contacts and Organization | Department of Energy  

Energy Savers (EERE)

Program Contacts and Organization Wind Program Contacts and Organization The Wind and Water Power Technologies Office within the U.S. Department of Energy's (DOE's) Office of...


Recommendation 217: Stewardship Point of Contact for the Oak...  

Office of Environmental Management (EM)

Recommendation 217: Stewardship Point of Contact for the Oak Ridge Reservation Recommendation 217: Stewardship Point of Contact for the Oak Ridge Reservation The Oak Ridge Site...


Cell Phone Allergic Contact Dermatitis: Case Report and Review  

E-Print Network (OSTI)

testing in a sample of cell phones in Denmark. ContactCell phone allergic contact dermatitis: Case report andcombination of increased cell phone ownership and unlimited

Rajpara, Anand; Feldman, Steven R



EERE Information Center Contact, PIA, The Office of Energy Efficiency...  

NLE Websites -- All DOE Office Websites (Extended Search)

Information Center Contact, PIA, The Office of Energy Efficiency and Renewable Energy (EERE) EERE Information Center Contact, PIA, The Office of Energy Efficiency and Renewable...


Bureau of Land Management - WO-210 - Contact Information | Open...  

Open Energy Info (EERE)

- Contact Information Jump to: navigation, search OpenEI Reference LibraryAdd to library Web Site: Bureau of Land Management - WO-210 - Contact Information Abstract This page...


2/21/2014 terragreen.teriin.org/popup.php?section_id=1905&category_id=10 http://terragreen.teriin.org/popup.php?section_id=1905&category_id=10 1/2  

E-Print Network (OSTI)

2/21/2014 terragreen.teriin.org/popup.php?section_id=1905&category_id=10 http://terragreen.teriin.org/popup.php in the material because of the durable nickel alloy and smart aerodynamic design. #12;2/21/2014 terragreen.teriin.org/popup.php?section_id=1905&category_id=10 http://terragreen.teriin.org/popup.php?section_id=1905&category_id=10 2/2 "The

Chiao, Jung-Chih


Assumptions to the Annual Energy Outlook - Contacts  

Gasoline and Diesel Fuel Update (EIA)

Contacts Contacts Assumption to the Annual Energy Outlook Contacts Specific questions about the information in this report may be directed to: Introduction Paul D. Holtberg 202/586-1284 Macroeconomic Activity Module Ronald F. Earley Yvonne Taylor 202/586-1398 202/586-1398 International Energy Module G. Daniel Butler 202/586-9503 Household Expenditures Module/ Residential Demand Module John H. Cymbalsky 202/586-4815 Commercial Demand Module Erin E. Boedecker 202/586-4791 Industrial Demand Module T. Crawford Honeycutt 202/586-1420 Transportation Demand Module John D. Maples 202/586-1757 Electricity Market Module Laura Martin 202/586-1494 Oil and Gas Supply Module/Natural Gas Transmission and Distribution Module Joseph Benneche 202/586-6132 Petroleum Market Module Bill Brown 202/586-8181


Legacy Management Contacts | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Legacy Management Contacts Legacy Management Contacts Legacy Management Contacts Title Name Phone Fax LM Director David Geiser (202) 586-7550 (202) 586-8403 Office of Business Operations Director Barbara McNeal Lloyd (202) 586-7550 (202) 586-8403 Benefits Continuity Team Patrick Ring Team Leader (202) 586-1835 (202) 586-1540 Planning, Budget, and Acquisition Team Jane Powell, Team Leader (202) 586-3924 (202) 586-1540 Archives and Information Management Team John Montgomery Team Leader (304) 413-0816 (304) 413-0540 Human Resource Management Patricia Poole-Shirriel Team Leader (202) 586-0402 (202) 586-1540 Administrative Team Teresa Collins Team Leader (202) 586-8259 (202) 586-1540 Office of Site Operations Director Tom Pauling (202) 586-1782 (202) 586-1540 Environmental Team 1


A Germanium Back Contact Type Thermophotovoltaic Cell  

SciTech Connect

A Ge back contact type photovoltaic cell has been proposed to reduce resistance loss for high current densities in thermophotovoltaic systems. The back contact structure requires less surface recombination velocities than conventional structures with front grid contacts. A SiO2/SiNx double anti-reflection coating including a high refractive index SiNx layer was studied. The SiNx layer has an enough passivation effect to obtain high efficiency. The quantum efficiency of the Ge cell was around 0.8 in the 800-1600 nm wavelength range. The conversion efficiency for infrared lights was estimated at 18% for a blackbody surface and 25% for a selective emitter by using the quantum efficiency and a simulation analysis.

Nagashima, Tomonori; Okumura, Kenichi [Future Project Div., Toyota Motor Corporation, 1200 Mishuku, Susono, Shizuoka 410-1193 (Japan); Yamaguchi, Masafumi [Toyota Technological Institute, 2-12-1 Hisakata, Tempaku, Nagoya 468-8511 (Japan)



Electric Field and Humidity Trigger Contact Electrification  

E-Print Network (OSTI)

Here, we study the old problem of why identical insulators can charge one another on contact. We perform several experiments showing that, if driven by a preexisting electric field, charge is transferred between contacting insulators. This happens because the insulator surfaces adsorb small amounts of water from a humid atmosphere. We believe the electric field then separates positively from negatively charged ions prevailing within the water, which we believe to be hydronium and hydroxide ions, such that at the point of contact, positive ions of one insulator neutralize negative ions of the other one, charging both of them. This mechanism can explain for the first time the observation made four decades ago that wind-blown sand discharges in sparks if and only if a thunderstorm is nearby.

Zhang, Yanzhen; Liu, Yonghong; Wang, Xiaolong; Zhang, Rui; Shen, Yang; Ji, Renjie; Cai, Baoping



Electric Field and Humidity Trigger Contact Electrification  

E-Print Network (OSTI)

Here, we study the old problem of why identical insulators can charge one another on contact. We perform several experiments showing that, if driven by a preexisting electric field, charge is transferred between contacting insulators. This happens because the insulator surfaces adsorb small amounts of water from a humid atmosphere. We believe the electric field then separates positively from negatively charged ions prevailing within the water, which we believe to be hydronium and hydroxide ions, such that at the point of contact, positive ions of one insulator neutralize negative ions of the other one, charging both of them. This mechanism can explain for the first time the observation made four decades ago that wind-blown sand discharges in sparks if and only if a thunderstorm is nearby.

Yanzhen Zhang; Thomas Phtz; Yonghong Liu; Xiaolong Wang; Rui Zhang; Yang Shen; Renjie Ji; Baoping Cai



Contact Us | National Nuclear Security Administration  

National Nuclear Security Administration (NNSA)

The National Nuclear Security Administration The National Nuclear Security Administration Contact Us Home > About Us > Our Programs > Defense Programs > Future Science & Technology Programs > Office of Advanced Simulation and Computing and Institutional R&D Programs > Institutional Research & Development > Contact Us Contact Us Above Image: Fission neutrons can be distinguished from background radiation using a novel variation of a metal-organic framework (MOF) scintillator that was a new class of scintillator previously patented by Sandia: Crystals of a metal organic framework (left) emit light in the blue (middle) when exposed to ionizing radiation. Infiltrating them with an organometallic compound causes the crystals to emit red light as well (right), creating a new way to differentiate fission neutrons from


SolutionsForYourLife.org What's Inside  

E-Print Network (OSTI)

Office, Live Oak, 1pm contact Carolyn Saft at csaft@ufl.edu or 386-362-2771 8 Florida Carolyn Saft at csaft@ufl.edu or 386-362-2771, FREE 9 Springs' Friendly Gardening Series , Native and Drought Tolerant Plants, Lafayette County Public Library (Mayo), 10am contact Carolyn Saft at csaft

Jawitz, James W.


Ohmic contacts to n-GaSb  

E-Print Network (OSTI)

in the semiconductor is measured during the deposition of the metal contact. In using method 1, the I-V characteristics is plotted. The thermionic emission theory predicts the current-voltage characteristics of Schottky diodes as [13]: J(rhcrmionic) = A" T' exp... of different work functions. This situation is also true for metal contacts to n-GaSb. Polyakov et al. [14] examined the Schottky diodes of Al, Au, In, Pd, Ga, and Sb on Te doped n-GaSb. They used the C-V measurements methods. They reported that barrier...

Yang, Zhengchong



awma.org october 2009 em 13Copyright 2009 Air & Waste Management Association em feature  

E-Print Network (OSTI)

awma.org october 2009 em 13Copyright 2009 Air & Waste Management Association em · feature by Doreen.orgCopyright 2009 Air & Waste Management Association The satellite observations provide constraints on detailed. In this article, we highlight the use of satellite data to constrain biomass burning emissions, to assess oxides


10 IAEI NEWS September.October 2009 www.iaei.org connecting the inverter  

E-Print Network (OSTI)

10 IAEI NEWS September.October 2009 www.iaei.org connecting the inverter by John Wiles CONNECTING THE INVERTER CONNECTING THE INVERTER 10 IAEI NEWS September.October 2009 #12;www.iaei.org September.October 2009 IAEI NEWS 11 connecting the inverter C onnecting the utility-interactive inverter prop- erly

Johnson, Eric E.


A RESTful API for exchanging Materials Data in the AFLOWLIB.org consortium  

E-Print Network (OSTI)

A RESTful API for exchanging Materials Data in the AFLOWLIB.org consortium Richard H. Taylor1, an Application Program Interface (API) follow- ing REST principles is introduced for the AFLOWLIB.org materials through a RESTful API and a python library enabling ad-hoc ap- plications [17]. Other examples of online

Curtarolo, Stefano


Contacts for Integrating Renewable Energy into Federal Construction Projects  

Energy.gov (U.S. Department of Energy (DOE))

Contacts to learn more about integrating renewable energy technologies into Federal construction projects.


Measurement of Contact Angles in the Presence of Mass Transfer  

Science Journals Connector (OSTI)

... has shown that, for contact angles measured without mass transfer under isothermal conditions on differing roughened surfaces, cos 6x = r cos 0, where 61 is the contact angle on ... , cos 6x = r cos 0, where 61 is the contact angle on a roughened surface and 0 is the true contact angle on a perfectly smooth surface.




Federal Energy Management Program: Assistance and Contacts for Energy  

NLE Websites -- All DOE Office Websites (Extended Search)

Assistance and Assistance and Contacts for Energy Savings Performance Contracts to someone by E-mail Share Federal Energy Management Program: Assistance and Contacts for Energy Savings Performance Contracts on Facebook Tweet about Federal Energy Management Program: Assistance and Contacts for Energy Savings Performance Contracts on Twitter Bookmark Federal Energy Management Program: Assistance and Contacts for Energy Savings Performance Contracts on Google Bookmark Federal Energy Management Program: Assistance and Contacts for Energy Savings Performance Contracts on Delicious Rank Federal Energy Management Program: Assistance and Contacts for Energy Savings Performance Contracts on Digg Find More places to share Federal Energy Management Program: Assistance and Contacts for Energy Savings Performance Contracts on

Note: This page contains sample records for the topic "apel org contact" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Solid-State Lighting: Solid-State Lighting Contacts  

NLE Websites -- All DOE Office Websites (Extended Search)

About the About the Program Printable Version Share this resource Send a link to Solid-State Lighting: Solid-State Lighting Contacts to someone by E-mail Share Solid-State Lighting: Solid-State Lighting Contacts on Facebook Tweet about Solid-State Lighting: Solid-State Lighting Contacts on Twitter Bookmark Solid-State Lighting: Solid-State Lighting Contacts on Google Bookmark Solid-State Lighting: Solid-State Lighting Contacts on Delicious Rank Solid-State Lighting: Solid-State Lighting Contacts on Digg Find More places to share Solid-State Lighting: Solid-State Lighting Contacts on AddThis.com... Contacts Partnerships Solid-State Lighting Contacts For information about Solid-State Lighting, contact James Brodrick Lighting Program Manager Building Technologies Office U.S. Department of Energy



U.S. Energy Information Administration (EIA) Indexed Site

FOR IMMEDIATE RELEASE CONTACT: MATT LETOURNEAU APRIL 8, 2008 (202) 224-6977 mrep~red qext of rKpK pen~tor mete sK aomenici's oem~rks ~t bf^'s ^nnu~l bnergy `onference OMMU Thank you, Administrator Caruso, for that introduction, and for the invitation to speak here this morning.


For additional information, contact: Department of Psychology  

E-Print Network (OSTI)

For additional information, contact: Department of Psychology Montana State University 325.montana.edu/wwwpy psydept@montana.edu PSYCHOLOGY: SCIENCE FOR FUTURE CAREERS Our department offers a Bachelor of Science (B.S.) degree in psychology. This degree prepares undergraduate students for employment in applied settings

Maxwell, Bruce D.


Contact Details Journeying Beyond Breast Cancer  

E-Print Network (OSTI)

Home About Contact Details Facebook Search Journeying Beyond Breast Cancer making sense of the cancer experience Feeds: Posts Comments Cancer-fighting fountain pen May 20, 2009 by JBBC A research team be used both as a research tool in the development of next-generation cancer treatments

Espinosa, Horacio D.


For more information, contact University Parking  

E-Print Network (OSTI)

.275.4524 Have a Flat Tire? Car Won't Start? Need Directions? V.A.P. VEHICLE ASSISTANCE PROGRAM University Tire? Car Won't Start? Contact University Parking and Transportation's Vehicle Assistance Program (V-icer assistance during winter months ·Tire inflations Inclement Travel Information When inclement weather

Mahon, Bradford Z.


Robotic Assembly and Contact Force Control  

E-Print Network (OSTI)

indis- pensable in many applications, such as spot welding and painting in the automotive industryRobotic Assembly and Contact Force Control Andreas Stolt Department of Automatic Control Lund in Sweden, Lund University, Lund 2012 #12;Abstract Modern industrial robots are traditionally programmed


Media KitAdvertisers Advertising Contact  

E-Print Network (OSTI)

Media KitAdvertisers 2012­2013 #12;Advertising Contact Samella Wright Office of Public Affairs (MC.com/uicmedia twitter.com/uicnews Contents About UIC News How to Advertise Advertising Policies Publication Schedule during the fall and spring semesters and monthly during the summer. The display advertising dead- line

Illinois at Chicago, University of


Media KitAdvertisers Advertising Contact  

E-Print Network (OSTI)

Media KitAdvertisers 2014­2015 #12;Advertising Contact Samella Wright Office of Public Affairs (MC.com/uicmedia twitter.com/uicnews Contents About UIC News How to Advertise Advertising Policies Publication Schedule during the fall and spring semesters and monthly during the summer. The display advertising dead- line

Illinois at Chicago, University of


Curriculum Vitae J. Ross Beveridge Name & Contact  

E-Print Network (OSTI)

Recognition 2011. 2 J.Ross Beveridge, Geof H. Givens, P.Jonathon Phillips, Bruce A. Draper, David S. BolmeCurriculum Vitae J. Ross Beveridge Name & Contact J. Ross Beveridge Computer Science Department Computation Conference. May 7, 2013 1 #12;Curriculum Vitae J. Ross Beveridge Publications Books 1 Mark R

Beveridge, Ross


Curriculum Vitae J. Ross Beveridge Name & Contact  

E-Print Network (OSTI)

Recognition 2011. 2 J.Ross Beveridge, Geof H. Givens, P.Jonathon Phillips, Bruce A. Draper, David S. BolmeCurriculum Vitae J. Ross Beveridge Name & Contact J. Ross Beveridge Computer Science Department Computation Conference. February 12, 2013 1 #12;Curriculum Vitae J. Ross Beveridge Publications Books 1 Mark R

Beveridge, Ross


Thermodynamics of nuclei in thermal contact  

E-Print Network (OSTI)

The behaviour of a di-nuclear system in the regime of strong pairing correlations is studied with the methods of statistical mechanics. It is shown that the thermal averaging is strong enough to assure the application of thermodynamical methods to the energy exchange between the two nuclei in contact. In particular, thermal averaging justifies the definition of a nuclear temperature.

Karl-Heinz Schmidt; Beatriz Jurado



For additional information, contact: Department of Ecology  

E-Print Network (OSTI)

For additional information, contact: Department of Ecology Montana State University 310 Lewis Hall P.O. Box 173460 Bozeman, MT 59717-3460 Tel: 406-994-4548 Fax: 406-994-3190 www.montana.edu/ecology/ ecology@montana.edu The Department of Ecology at Montana State University offers undergraduate majors

Maxwell, Bruce D.


Alternative Fuels Data Center: Iowa Points of Contact  

Alternative Fuels and Advanced Vehicles Data Center (EERE)

Iowa Points of Contact Iowa Points of Contact to someone by E-mail Share Alternative Fuels Data Center: Iowa Points of Contact on Facebook Tweet about Alternative Fuels Data Center: Iowa Points of Contact on Twitter Bookmark Alternative Fuels Data Center: Iowa Points of Contact on Google Bookmark Alternative Fuels Data Center: Iowa Points of Contact on Delicious Rank Alternative Fuels Data Center: Iowa Points of Contact on Digg Find More places to share Alternative Fuels Data Center: Iowa Points of Contact on AddThis.com... More in this section... Federal State Advanced Search All Laws & Incentives Sorted by Type Iowa Points of Contact The following people or agencies can help you find more information about Iowa's clean transportation laws, incentives, and funding opportunities.


Photovoltaic Electrical Contact and Cell Coating Basics | Department of  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Photovoltaic Electrical Contact and Cell Coating Basics Photovoltaic Electrical Contact and Cell Coating Basics Photovoltaic Electrical Contact and Cell Coating Basics August 19, 2013 - 4:12pm Addthis The outermost layers of photovoltaic (PV) cell, or solar cell, are the electrical contacts and anti-reflective coating. These layers provide essential functions to the cell's operation. Electrical Contacts Electrical contacts are essential to PV cells because they bridge the connection between the semiconductor material and the external electrical load, such as a light bulb. The back contact of a cell-the side away from the incoming sunlight-is relatively simple. It usually consists of a layer of aluminum or molybdenum metal. Illustration of a cutaway of a typical solar cell. The layers, from top to bottom, include a cover glass, transparent adhesive, antireflection coating, front contact, n-type semiconductor, p-type seminconductor, and back contact.


Photovoltaic Electrical Contact and Cell Coating Basics | Department of  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Photovoltaic Electrical Contact and Cell Coating Basics Photovoltaic Electrical Contact and Cell Coating Basics Photovoltaic Electrical Contact and Cell Coating Basics August 19, 2013 - 4:12pm Addthis The outermost layers of photovoltaic (PV) cell, or solar cell, are the electrical contacts and anti-reflective coating. These layers provide essential functions to the cell's operation. Electrical Contacts Electrical contacts are essential to PV cells because they bridge the connection between the semiconductor material and the external electrical load, such as a light bulb. The back contact of a cell-the side away from the incoming sunlight-is relatively simple. It usually consists of a layer of aluminum or molybdenum metal. Illustration of a cutaway of a typical solar cell. The layers, from top to bottom, include a cover glass, transparent adhesive, antireflection coating, front contact, n-type semiconductor, p-type seminconductor, and back contact.


Alternative Fuels Data Center: Utah Points of Contact  

Alternative Fuels and Advanced Vehicles Data Center (EERE)

Utah Points of Contact Utah Points of Contact to someone by E-mail Share Alternative Fuels Data Center: Utah Points of Contact on Facebook Tweet about Alternative Fuels Data Center: Utah Points of Contact on Twitter Bookmark Alternative Fuels Data Center: Utah Points of Contact on Google Bookmark Alternative Fuels Data Center: Utah Points of Contact on Delicious Rank Alternative Fuels Data Center: Utah Points of Contact on Digg Find More places to share Alternative Fuels Data Center: Utah Points of Contact on AddThis.com... More in this section... Federal State Advanced Search All Laws & Incentives Sorted by Type Utah Points of Contact The following people or agencies can help you find more information about Utah's clean transportation laws, incentives, and funding opportunities.


Alternative Fuels Data Center: Ohio Points of Contact  

Alternative Fuels and Advanced Vehicles Data Center (EERE)

Ohio Points of Contact Ohio Points of Contact to someone by E-mail Share Alternative Fuels Data Center: Ohio Points of Contact on Facebook Tweet about Alternative Fuels Data Center: Ohio Points of Contact on Twitter Bookmark Alternative Fuels Data Center: Ohio Points of Contact on Google Bookmark Alternative Fuels Data Center: Ohio Points of Contact on Delicious Rank Alternative Fuels Data Center: Ohio Points of Contact on Digg Find More places to share Alternative Fuels Data Center: Ohio Points of Contact on AddThis.com... More in this section... Federal State Advanced Search All Laws & Incentives Sorted by Type Ohio Points of Contact The following people or agencies can help you find more information about Ohio's clean transportation laws, incentives, and funding opportunities.


EIA - Annual Energy Outlook 2009 - Contacts  

Gasoline and Diesel Fuel Update (EIA)

Contacts Contacts Annual Energy Outlook 2009 with Projections to 2030 For Further Information . . . The Annual Energy Outlook 2009 was prepared by the Energy Information Administration, under the direction of John J. Conti (john.conti@eia.doe.gov, 202-586-2222), Director, Integrated Analysis and Forecasting; Paul D. Holtberg (paul.holtberg@eia.doe.gov, 202/586-1284), Director, Demand and Integration Division; Joseph A. Beamon (jbeamon@eia.doe.gov, 202/586-2025), Director, Coal and Electric Power Division; A. Michael Schaal (michael.schaal@eia.doe.gov, 202/586-5590), Director, Oil and Gas Division; Glen E. Sweetnam (glen.sweetnam@eia.doe.gov, 202/586-2188), Director, International, Economic, and Greenhouse Gases Division; and Andy S. Kydes (akydes@eia.doe.gov, 202/586-2222), Senior Technical Advisor.


NREL: Email Contact for NREL Newsroom  

NLE Websites -- All DOE Office Websites (Extended Search)

Printable Version Printable Version Email Contact for NREL Newsroom Use this form to contact Public Affairs for information about NREL or renewable energy and energy efficiency technologies, including interviews, photographs, graphics and other help. Please enter your email address in the box provided, then type your message below. When you are finished, click "Send Message." If you enter your e-mail address incorrectly, we will be unable to reply. Your name: Your email address: Your message: Send Message Printable Version NREL Newsroom Home Feature News News Releases Events Awards Research Support Facility Energy Systems Integration Facility Related Links Did you find what you needed? Yes 1 No 0 Thank you for your feedback. Would you like to take a moment to tell us how we can improve this page?


Contact List, Security Operations, Laboratory Protection Division,  

NLE Websites -- All DOE Office Websites (Extended Search)

Homepage Homepage Points of Contact Organization Chart (pdf) Groups Emergency Services Emergency Management Security Operations BNL Site Access Main Gate Access Forms Contact List When Outside the Laboratory: Precede Phone numbers with 631 344-xxxx Description Name Email Ext Division Manager M. Pena mpena@bnl.gov 7759 Security Operations Manager L. Butera lbutera@bnl.gov 4691 Police Chief S. Mc Cune mccune@bnl.gov 5656 Police Group Police Supervisors Police Supervisors@bnl.gov 2235 Senior Administrative Assistant M. Markstaller markstaller@bnl.gov 2280 Personnel and Information Security Group C. Mauro V. Feldman S. Krsnak K. Lucadamo A. Wund cmauro@bnl.gov vfeldman@bnl.gov krsnak@bnl.gov lucadamo@bnl.gov awund@bnl.gov 5524 4271 5690 2596 4656 Visitor Notifications V. Feldman

Note: This page contains sample records for the topic "apel org contact" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Property:Geothermal/Contact | Open Energy Information  

Open Energy Info (EERE)

Property Property Edit with form History Facebook icon Twitter icon » Property:Geothermal/Contact Jump to: navigation, search This is a property of type String. Pages using the property "Geothermal/Contact" Showing 25 pages using this property. (previous 25) (next 25) 4 4 UR Guest Ranch Pool & Spa Low Temperature Geothermal Facility + 719-658-2202 + A Ace Development Aquaculture Low Temperature Geothermal Facility + Bob Williams; 208-854-2487 + Agua Calientes Trailer Park Space Heating Low Temperature Geothermal Facility + Glen Vanrockel; 775-726-3114 + Alive Polarity's Murrietta Hot Spring Pool & Spa Low Temperature Geothermal Facility + 909-677-7451 + Americulture Aquaculture Low Temperature Geothermal Facility + 575-548-2328 + Aqua Caliente County Park Pool & Spa Low Temperature Geothermal Facility + 858-565-3600 +


NETL: Contact Info and Privacy Act Advisory  

NLE Websites -- All DOE Office Websites (Extended Search)

Contact Info and Privacy Act Advisory To contact us: National Energy Technology Laboratory 626 Cochrans Mill Road P.O. Box 10940 Pittsburgh, PA 15236-0940 Phone: 412-386-6167 PRIVACY ACT ADVISORY: Authority: 5 U.S.C. 301, 5 U.S.C. 552, Freedom of Information Act (FOIA); and Title 10, Code of Federal Regulations, Part 1004. Purpose: To allow individuals to file electronic FOIA requests; to track all FOIA requests from receipt to response to compile statistics for the Annual FOIA Report; to research and respond to FOIA requests; to maintain case files to comply with records disposal requirements; and to maintain an administrative record to support any litigation. Routine Use: Records related to the FOIA request will be maintained in DOE-55 "Freedom of Information and Privacy Act (FOIA/PA) Requests for Records." A record


Electrical contact arrangement for a coating process  

DOE Patents (OSTI)

A protective coating is applied to the electrically conductive surface of a reflective coating of a solar mirror by biasing a conductive member having a layer of a malleable electrically conductive material, e.g. a paste, against a portion of the conductive surface while moving an electrodepositable coating composition over the conductive surface. The moving of the electrodepositable coating composition over the conductive surface includes moving the solar mirror through a flow curtain of the electrodepositable coating composition and submerging the solar mirror in a pool of the electrodepositable coating composition. The use of the layer of a malleable electrically conductive material between the conductive member and the conductive surface compensates for irregularities in the conductive surface being contacted during the coating process thereby reducing the current density at the electrical contact area.

Kabagambe, Benjamin; McCamy, James W; Boyd, Donald W



Direct contact, binary fluid geothermal boiler  

DOE Patents (OSTI)

Energy is extracted from geothermal brines by direct contact with a working fluid such as isobutane which is immiscible with the brine in a geothermal boiler. The geothermal boiler provides a distributor arrangement which efficiently contacts geothermal brine with the isobutane in order to prevent the entrainment of geothermal brine in the isobutane vapor which is directed to a turbine. Accordingly the problem of brine carry-over through the turbine causes corrosion and scaling thereof is eliminated. Additionally the heat exchanger includes straightening vanes for preventing startup and other temporary fluctuations in the transitional zone of the boiler from causing brine carryover into the turbine. Also a screen is provided in the heat exchanger to coalesce the working fluid and to assist in defining the location of the transitional zone where the geothermal brine and the isobutane are initially mixed.

Rapier, Pascal M. (Richmond, CA)



Modelling receding contact lines on superhydrophobic surfaces  

E-Print Network (OSTI)

We use mesoscale simulations to study the depinning of a receding contact line on a superhydrophobic surface patterned by a regular array of posts. In order that the simulations are feasible, we introduce a novel geometry where a column of liquid dewets a capillary bounded by a superhydrophobic plane which faces a smooth hydrophilic wall of variable contact angle. We present results for the dependence of the depinning angle on the shape and spacing of the posts, and discuss the form of the meniscus at depinning. We find, in agreement with [17], that the local post concentration is a primary factor in controlling the depinning angle, and show that the numerical results agree well with recent experiments. We also present two examples of metastable pinned configurations where the posts are partially wet.

B. M. Mognetti; J. M. Yeomans



Quark contact interactions at the LHC  

Science Journals Connector (OSTI)

Quark contact interactions are an important signal of new physics. We introduce a model in which the presence of a symmetry protects these new interactions from giving large corrections in flavor changing processes at low energies. This minimal model provides the basic set of operators which must be considered to contribute to the high-energy processes. To discuss their experimental signature in jet pairs produced in proton-proton collisions, we simplify the number of possible operators down to two. We show (for a representative integrated luminosity of 200??pb-1 at s=7??TeV) how the presence of two operators significantly modifies the bound on the characteristic energy scale of the contact interactions, which is obtained by keeping a single operator.

F. Bazzocchi; U. De Sanctis; M. Fabbrichesi; A. Tonero



Photoinduced electron transfer in contact ion pairs  

SciTech Connect

Contact ion pair (CIP) formation is especially relevant to the reactivity of organic and organometallic nucleophiles and electrophiles in solution. The authors felt that the intermolecular charge-transfer (CT) absorptions which commonly accompany the interaction of uncharged nucleophiles (donors) with electrophiles (acceptors) could also provide the experimental means to assess CIP behavior. Accordingly they examined the CT excitations from CIPs of carbonylmetallate anions in this study, since they are known to be effective nucleophiles with relatively low ionization potentials.

Bockman, T.M.; Kochi, J.K.



Contacts Dynamics Reveals Widom Lines for Jamming  

E-Print Network (OSTI)

We experimentally study the vicinity of the Jamming transition by investigating the statics and the dynamics of the contact network of an horizontally shaken bi-disperse packing of photo-elastic discs. Compressing the packing very slowly, while maintaining a mechanical excitation, yields a granular glass, namely a frozen structure of vibrating grains. In this glass phase, we observe a remarkable dynamics of the contact network, which exhibits strong dynamical heterogeneities. Such heterogeneities are maximum at a packing fraction $\\phi^*$, \\emph{distinct} and smaller than the jamming packing fraction $\\phi_J$, which is indicated by the abrupt variation of the average number of contact per particle. We demonstrate that the two cross-overs, one for the maximum dynamical heterogeneity, and the other for static jamming, converge at point J in the zero mechanical excitation limit, a behavior reminiscent of the Widom lines in the supercritical phase of a second order critical point. Our findings are discussed in the light of recent numerical and theoretical studies of thermal soft spheres.

C. Coulais; R. P. Behringer; O. Dauchot



The Contact Electricity of Solid Dielectrics  

Science Journals Connector (OSTI)

The electric charges produced by wringing optically flat surfaces together were measured in order to determine whether or not there is a possibility of formulating a single contact theory which will include both the metals and the dielectrics. Experiments with flint glass and steel proved that the frictional charge is independent of the amount of friction, provided only that intimate contact be established, and is proportional to the area of contact. The voltaic nature of the frictional charge. The charge was in no wise affected by the ionization of the residual air molecules between the surfaces by means of an intense beam of x-rays, and was also found to be independent of the duration of contact for periods varying up to 17 hours. The failure of the double-layer to recombine under these conditions proves that it was sustained by a voltaic field. The dependence of the effect on the dielectric constant. The charge per cm2 Q12 of material 1 in contact with material 2, was found for 8 different pairs of the materials, quartz, fluorite, crown glass, flint glass and steel, to satisfy, within 14 per cent, the equation Q12=C(K1-K2), where K1 and K2 are the dielectric constants and C is a positive constant, whose mean value is 4.43 e.s.u., provided the value K=3.1 be assigned to steel. This equation is consistent with the results of Coehn's measurements of electric osmosis.The electric effect of compressing amorphous dielectrics was determined by pressing two kinds of sheet rubber, of dielectric constants 2.94 and 3.96, against seven hard materials, whose dielectric constants ranged from 2.8 to 7.8. The charge on the compressible dielectric was found to be independent of the nature of the material against which it was pressed, proving that this is not a voltaic effect and that amorphous as well as crystalline substances can be electrified by pressure.The electric effect of collision of a solid insulator and a metal was found, with four pairs of materials, to be consistently opposite in sign to the frictional effect. This result shows that collision must be considered to produce two different effects, one of which is the voltaic charge, while the other is a transfer of electrons from the metal to the dielectric, due in all probability to the inertia of the mobile electrons.Dielectric constant of steel, as suggested by these results, is not infinity but 3.1.

Harold F. Richards




Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

EGISTERED DRBYIST CONTACT DISC1 ,QSURE F EGISTERED DRBYIST CONTACT DISC1 ,QSURE F O W This form is to be completed by Executive Branch employees who are contacted by registered lobbyists regarding the Recovery Act. This report includes a written description of each contact, the date and time of the contact, and the names of the registered lobbyist(s) and the employee(s) with whom the contact took place. The information on this form will be available to the public on the Executive Branch agency's recovery website. Written materials prepared by registered lobbyists should be attached to this form for posting on the website. To be completed by the employee contacted. Name of the Date and time of mntact: Employee(s) Contacted (Name and Title) Brief description of the contad: (attach separate sheet if necessary)


Alternative Fuels Data Center: New Mexico Points of Contact  

Alternative Fuels and Advanced Vehicles Data Center (EERE)

Mexico Points of Mexico Points of Contact to someone by E-mail Share Alternative Fuels Data Center: New Mexico Points of Contact on Facebook Tweet about Alternative Fuels Data Center: New Mexico Points of Contact on Twitter Bookmark Alternative Fuels Data Center: New Mexico Points of Contact on Google Bookmark Alternative Fuels Data Center: New Mexico Points of Contact on Delicious Rank Alternative Fuels Data Center: New Mexico Points of Contact on Digg Find More places to share Alternative Fuels Data Center: New Mexico Points of Contact on AddThis.com... More in this section... Federal State Advanced Search All Laws & Incentives Sorted by Type New Mexico Points of Contact The following people or agencies can help you find more information about New Mexico's clean transportation laws, incentives, and funding


Alternative Fuels Data Center: Oregon Points of Contact  

Alternative Fuels and Advanced Vehicles Data Center (EERE)

Oregon Points of Oregon Points of Contact to someone by E-mail Share Alternative Fuels Data Center: Oregon Points of Contact on Facebook Tweet about Alternative Fuels Data Center: Oregon Points of Contact on Twitter Bookmark Alternative Fuels Data Center: Oregon Points of Contact on Google Bookmark Alternative Fuels Data Center: Oregon Points of Contact on Delicious Rank Alternative Fuels Data Center: Oregon Points of Contact on Digg Find More places to share Alternative Fuels Data Center: Oregon Points of Contact on AddThis.com... More in this section... Federal State Advanced Search All Laws & Incentives Sorted by Type Oregon Points of Contact The following people or agencies can help you find more information about Oregon's clean transportation laws, incentives, and funding opportunities.


Alternative Fuels Data Center: Minnesota Points of Contact  

Alternative Fuels and Advanced Vehicles Data Center (EERE)

Minnesota Points of Minnesota Points of Contact to someone by E-mail Share Alternative Fuels Data Center: Minnesota Points of Contact on Facebook Tweet about Alternative Fuels Data Center: Minnesota Points of Contact on Twitter Bookmark Alternative Fuels Data Center: Minnesota Points of Contact on Google Bookmark Alternative Fuels Data Center: Minnesota Points of Contact on Delicious Rank Alternative Fuels Data Center: Minnesota Points of Contact on Digg Find More places to share Alternative Fuels Data Center: Minnesota Points of Contact on AddThis.com... More in this section... Federal State Advanced Search All Laws & Incentives Sorted by Type Minnesota Points of Contact The following people or agencies can help you find more information about Minnesota's clean transportation laws, incentives, and funding


Alternative Fuels Data Center: Florida Points of Contact  

Alternative Fuels and Advanced Vehicles Data Center (EERE)

Florida Points of Florida Points of Contact to someone by E-mail Share Alternative Fuels Data Center: Florida Points of Contact on Facebook Tweet about Alternative Fuels Data Center: Florida Points of Contact on Twitter Bookmark Alternative Fuels Data Center: Florida Points of Contact on Google Bookmark Alternative Fuels Data Center: Florida Points of Contact on Delicious Rank Alternative Fuels Data Center: Florida Points of Contact on Digg Find More places to share Alternative Fuels Data Center: Florida Points of Contact on AddThis.com... More in this section... Federal State Advanced Search All Laws & Incentives Sorted by Type Florida Points of Contact The following people or agencies can help you find more information about Florida's clean transportation laws, incentives, and funding opportunities.


Alternative Fuels Data Center: North Carolina Points of Contact  

Alternative Fuels and Advanced Vehicles Data Center (EERE)

Carolina Points Carolina Points of Contact to someone by E-mail Share Alternative Fuels Data Center: North Carolina Points of Contact on Facebook Tweet about Alternative Fuels Data Center: North Carolina Points of Contact on Twitter Bookmark Alternative Fuels Data Center: North Carolina Points of Contact on Google Bookmark Alternative Fuels Data Center: North Carolina Points of Contact on Delicious Rank Alternative Fuels Data Center: North Carolina Points of Contact on Digg Find More places to share Alternative Fuels Data Center: North Carolina Points of Contact on AddThis.com... More in this section... Federal State Advanced Search All Laws & Incentives Sorted by Type North Carolina Points of Contact The following people or agencies can help you find more information about


Alternative Fuels Data Center: Tennessee Points of Contact  

Alternative Fuels and Advanced Vehicles Data Center (EERE)

Tennessee Points of Tennessee Points of Contact to someone by E-mail Share Alternative Fuels Data Center: Tennessee Points of Contact on Facebook Tweet about Alternative Fuels Data Center: Tennessee Points of Contact on Twitter Bookmark Alternative Fuels Data Center: Tennessee Points of Contact on Google Bookmark Alternative Fuels Data Center: Tennessee Points of Contact on Delicious Rank Alternative Fuels Data Center: Tennessee Points of Contact on Digg Find More places to share Alternative Fuels Data Center: Tennessee Points of Contact on AddThis.com... More in this section... Federal State Advanced Search All Laws & Incentives Sorted by Type Tennessee Points of Contact The following people or agencies can help you find more information about Tennessee's clean transportation laws, incentives, and funding


Alternative Fuels Data Center: Montana Points of Contact  

Alternative Fuels and Advanced Vehicles Data Center (EERE)

Montana Points of Montana Points of Contact to someone by E-mail Share Alternative Fuels Data Center: Montana Points of Contact on Facebook Tweet about Alternative Fuels Data Center: Montana Points of Contact on Twitter Bookmark Alternative Fuels Data Center: Montana Points of Contact on Google Bookmark Alternative Fuels Data Center: Montana Points of Contact on Delicious Rank Alternative Fuels Data Center: Montana Points of Contact on Digg Find More places to share Alternative Fuels Data Center: Montana Points of Contact on AddThis.com... More in this section... Federal State Advanced Search All Laws & Incentives Sorted by Type Montana Points of Contact The following people or agencies can help you find more information about Montana's clean transportation laws, incentives, and funding opportunities.


Alternative Fuels Data Center: Colorado Points of Contact  

Alternative Fuels and Advanced Vehicles Data Center (EERE)

Colorado Points of Colorado Points of Contact to someone by E-mail Share Alternative Fuels Data Center: Colorado Points of Contact on Facebook Tweet about Alternative Fuels Data Center: Colorado Points of Contact on Twitter Bookmark Alternative Fuels Data Center: Colorado Points of Contact on Google Bookmark Alternative Fuels Data Center: Colorado Points of Contact on Delicious Rank Alternative Fuels Data Center: Colorado Points of Contact on Digg Find More places to share Alternative Fuels Data Center: Colorado Points of Contact on AddThis.com... More in this section... Federal State Advanced Search All Laws & Incentives Sorted by Type Colorado Points of Contact The following people or agencies can help you find more information about Colorado's clean transportation laws, incentives, and funding


Alternative Fuels Data Center: Dist. of Columbia Points of Contact  

Alternative Fuels and Advanced Vehicles Data Center (EERE)

Dist. of Columbia Dist. of Columbia Points of Contact to someone by E-mail Share Alternative Fuels Data Center: Dist. of Columbia Points of Contact on Facebook Tweet about Alternative Fuels Data Center: Dist. of Columbia Points of Contact on Twitter Bookmark Alternative Fuels Data Center: Dist. of Columbia Points of Contact on Google Bookmark Alternative Fuels Data Center: Dist. of Columbia Points of Contact on Delicious Rank Alternative Fuels Data Center: Dist. of Columbia Points of Contact on Digg Find More places to share Alternative Fuels Data Center: Dist. of Columbia Points of Contact on AddThis.com... More in this section... Federal State Advanced Search All Laws & Incentives Sorted by Type Dist. of Columbia Points of Contact The following people or agencies can help you find more information about


Alternative Fuels Data Center: Kentucky Points of Contact  

Alternative Fuels and Advanced Vehicles Data Center (EERE)

Kentucky Points of Kentucky Points of Contact to someone by E-mail Share Alternative Fuels Data Center: Kentucky Points of Contact on Facebook Tweet about Alternative Fuels Data Center: Kentucky Points of Contact on Twitter Bookmark Alternative Fuels Data Center: Kentucky Points of Contact on Google Bookmark Alternative Fuels Data Center: Kentucky Points of Contact on Delicious Rank Alternative Fuels Data Center: Kentucky Points of Contact on Digg Find More places to share Alternative Fuels Data Center: Kentucky Points of Contact on AddThis.com... More in this section... Federal State Advanced Search All Laws & Incentives Sorted by Type Kentucky Points of Contact The following people or agencies can help you find more information about Kentucky's clean transportation laws, incentives, and funding

Note: This page contains sample records for the topic "apel org contact" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Alternative Fuels Data Center: Louisiana Points of Contact  

Alternative Fuels and Advanced Vehicles Data Center (EERE)

Louisiana Points of Louisiana Points of Contact to someone by E-mail Share Alternative Fuels Data Center: Louisiana Points of Contact on Facebook Tweet about Alternative Fuels Data Center: Louisiana Points of Contact on Twitter Bookmark Alternative Fuels Data Center: Louisiana Points of Contact on Google Bookmark Alternative Fuels Data Center: Louisiana Points of Contact on Delicious Rank Alternative Fuels Data Center: Louisiana Points of Contact on Digg Find More places to share Alternative Fuels Data Center: Louisiana Points of Contact on AddThis.com... More in this section... Federal State Advanced Search All Laws & Incentives Sorted by Type Louisiana Points of Contact The following people or agencies can help you find more information about Louisiana's clean transportation laws, incentives, and funding


Alternative Fuels Data Center: New Hampshire Points of Contact  

Alternative Fuels and Advanced Vehicles Data Center (EERE)

Hampshire Points Hampshire Points of Contact to someone by E-mail Share Alternative Fuels Data Center: New Hampshire Points of Contact on Facebook Tweet about Alternative Fuels Data Center: New Hampshire Points of Contact on Twitter Bookmark Alternative Fuels Data Center: New Hampshire Points of Contact on Google Bookmark Alternative Fuels Data Center: New Hampshire Points of Contact on Delicious Rank Alternative Fuels Data Center: New Hampshire Points of Contact on Digg Find More places to share Alternative Fuels Data Center: New Hampshire Points of Contact on AddThis.com... More in this section... Federal State Advanced Search All Laws & Incentives Sorted by Type New Hampshire Points of Contact The following people or agencies can help you find more information about New Hampshire's clean transportation laws, incentives, and funding


Alternative Fuels Data Center: Connecticut Points of Contact  

Alternative Fuels and Advanced Vehicles Data Center (EERE)

Connecticut Points of Connecticut Points of Contact to someone by E-mail Share Alternative Fuels Data Center: Connecticut Points of Contact on Facebook Tweet about Alternative Fuels Data Center: Connecticut Points of Contact on Twitter Bookmark Alternative Fuels Data Center: Connecticut Points of Contact on Google Bookmark Alternative Fuels Data Center: Connecticut Points of Contact on Delicious Rank Alternative Fuels Data Center: Connecticut Points of Contact on Digg Find More places to share Alternative Fuels Data Center: Connecticut Points of Contact on AddThis.com... More in this section... Federal State Advanced Search All Laws & Incentives Sorted by Type Connecticut Points of Contact The following people or agencies can help you find more information about Connecticut's clean transportation laws, incentives, and funding


Alternative Fuels Data Center: Alaska Points of Contact  

Alternative Fuels and Advanced Vehicles Data Center (EERE)

Alaska Points of Alaska Points of Contact to someone by E-mail Share Alternative Fuels Data Center: Alaska Points of Contact on Facebook Tweet about Alternative Fuels Data Center: Alaska Points of Contact on Twitter Bookmark Alternative Fuels Data Center: Alaska Points of Contact on Google Bookmark Alternative Fuels Data Center: Alaska Points of Contact on Delicious Rank Alternative Fuels Data Center: Alaska Points of Contact on Digg Find More places to share Alternative Fuels Data Center: Alaska Points of Contact on AddThis.com... More in this section... Federal State Advanced Search All Laws & Incentives Sorted by Type Alaska Points of Contact The following people or agencies can help you find more information about Alaska's clean transportation laws, incentives, and funding opportunities.


Alternative Fuels Data Center: Maryland Points of Contact  

Alternative Fuels and Advanced Vehicles Data Center (EERE)

Maryland Points of Maryland Points of Contact to someone by E-mail Share Alternative Fuels Data Center: Maryland Points of Contact on Facebook Tweet about Alternative Fuels Data Center: Maryland Points of Contact on Twitter Bookmark Alternative Fuels Data Center: Maryland Points of Contact on Google Bookmark Alternative Fuels Data Center: Maryland Points of Contact on Delicious Rank Alternative Fuels Data Center: Maryland Points of Contact on Digg Find More places to share Alternative Fuels Data Center: Maryland Points of Contact on AddThis.com... More in this section... Federal State Advanced Search All Laws & Incentives Sorted by Type Maryland Points of Contact The following people or agencies can help you find more information about Maryland's clean transportation laws, incentives, and funding


Alternative Fuels Data Center: Kansas Points of Contact  

Alternative Fuels and Advanced Vehicles Data Center (EERE)

Kansas Points of Kansas Points of Contact to someone by E-mail Share Alternative Fuels Data Center: Kansas Points of Contact on Facebook Tweet about Alternative Fuels Data Center: Kansas Points of Contact on Twitter Bookmark Alternative Fuels Data Center: Kansas Points of Contact on Google Bookmark Alternative Fuels Data Center: Kansas Points of Contact on Delicious Rank Alternative Fuels Data Center: Kansas Points of Contact on Digg Find More places to share Alternative Fuels Data Center: Kansas Points of Contact on AddThis.com... More in this section... Federal State Advanced Search All Laws & Incentives Sorted by Type Kansas Points of Contact The following people or agencies can help you find more information about Kansas's clean transportation laws, incentives, and funding opportunities.


Alternative Fuels Data Center: Wisconsin Points of Contact  

Alternative Fuels and Advanced Vehicles Data Center (EERE)

Wisconsin Points of Wisconsin Points of Contact to someone by E-mail Share Alternative Fuels Data Center: Wisconsin Points of Contact on Facebook Tweet about Alternative Fuels Data Center: Wisconsin Points of Contact on Twitter Bookmark Alternative Fuels Data Center: Wisconsin Points of Contact on Google Bookmark Alternative Fuels Data Center: Wisconsin Points of Contact on Delicious Rank Alternative Fuels Data Center: Wisconsin Points of Contact on Digg Find More places to share Alternative Fuels Data Center: Wisconsin Points of Contact on AddThis.com... More in this section... Federal State Advanced Search All Laws & Incentives Sorted by Type Wisconsin Points of Contact The following people or agencies can help you find more information about Wisconsin's clean transportation laws, incentives, and funding


Alternative Fuels Data Center: South Carolina Points of Contact  

Alternative Fuels and Advanced Vehicles Data Center (EERE)

Carolina Points Carolina Points of Contact to someone by E-mail Share Alternative Fuels Data Center: South Carolina Points of Contact on Facebook Tweet about Alternative Fuels Data Center: South Carolina Points of Contact on Twitter Bookmark Alternative Fuels Data Center: South Carolina Points of Contact on Google Bookmark Alternative Fuels Data Center: South Carolina Points of Contact on Delicious Rank Alternative Fuels Data Center: South Carolina Points of Contact on Digg Find More places to share Alternative Fuels Data Center: South Carolina Points of Contact on AddThis.com... More in this section... Federal State Advanced Search All Laws & Incentives Sorted by Type South Carolina Points of Contact The following people or agencies can help you find more information about


Alternative Fuels Data Center: Illinois Points of Contact  

Alternative Fuels and Advanced Vehicles Data Center (EERE)

Illinois Points of Illinois Points of Contact to someone by E-mail Share Alternative Fuels Data Center: Illinois Points of Contact on Facebook Tweet about Alternative Fuels Data Center: Illinois Points of Contact on Twitter Bookmark Alternative Fuels Data Center: Illinois Points of Contact on Google Bookmark Alternative Fuels Data Center: Illinois Points of Contact on Delicious Rank Alternative Fuels Data Center: Illinois Points of Contact on Digg Find More places to share Alternative Fuels Data Center: Illinois Points of Contact on AddThis.com... More in this section... Federal State Advanced Search All Laws & Incentives Sorted by Type Illinois Points of Contact The following people or agencies can help you find more information about Illinois's clean transportation laws, incentives, and funding


Alternative Fuels Data Center: Virginia Points of Contact  

Alternative Fuels and Advanced Vehicles Data Center (EERE)

Virginia Points of Virginia Points of Contact to someone by E-mail Share Alternative Fuels Data Center: Virginia Points of Contact on Facebook Tweet about Alternative Fuels Data Center: Virginia Points of Contact on Twitter Bookmark Alternative Fuels Data Center: Virginia Points of Contact on Google Bookmark Alternative Fuels Data Center: Virginia Points of Contact on Delicious Rank Alternative Fuels Data Center: Virginia Points of Contact on Digg Find More places to share Alternative Fuels Data Center: Virginia Points of Contact on AddThis.com... More in this section... Federal State Advanced Search All Laws & Incentives Sorted by Type Virginia Points of Contact The following people or agencies can help you find more information about Virginia's clean transportation laws, incentives, and funding


Alternative Fuels Data Center: Georgia Points of Contact  

Alternative Fuels and Advanced Vehicles Data Center (EERE)

Georgia Points of Georgia Points of Contact to someone by E-mail Share Alternative Fuels Data Center: Georgia Points of Contact on Facebook Tweet about Alternative Fuels Data Center: Georgia Points of Contact on Twitter Bookmark Alternative Fuels Data Center: Georgia Points of Contact on Google Bookmark Alternative Fuels Data Center: Georgia Points of Contact on Delicious Rank Alternative Fuels Data Center: Georgia Points of Contact on Digg Find More places to share Alternative Fuels Data Center: Georgia Points of Contact on AddThis.com... More in this section... Federal State Advanced Search All Laws & Incentives Sorted by Type Georgia Points of Contact The following people or agencies can help you find more information about Georgia's clean transportation laws, incentives, and funding opportunities.


Alternative Fuels Data Center: Washington Points of Contact  

Alternative Fuels and Advanced Vehicles Data Center (EERE)

Washington Points of Washington Points of Contact to someone by E-mail Share Alternative Fuels Data Center: Washington Points of Contact on Facebook Tweet about Alternative Fuels Data Center: Washington Points of Contact on Twitter Bookmark Alternative Fuels Data Center: Washington Points of Contact on Google Bookmark Alternative Fuels Data Center: Washington Points of Contact on Delicious Rank Alternative Fuels Data Center: Washington Points of Contact on Digg Find More places to share Alternative Fuels Data Center: Washington Points of Contact on AddThis.com... More in this section... Federal State Advanced Search All Laws & Incentives Sorted by Type Washington Points of Contact The following people or agencies can help you find more information about Washington's clean transportation laws, incentives, and funding


Alternative Fuels Data Center: Mississippi Points of Contact  

Alternative Fuels and Advanced Vehicles Data Center (EERE)

Mississippi Points of Mississippi Points of Contact to someone by E-mail Share Alternative Fuels Data Center: Mississippi Points of Contact on Facebook Tweet about Alternative Fuels Data Center: Mississippi Points of Contact on Twitter Bookmark Alternative Fuels Data Center: Mississippi Points of Contact on Google Bookmark Alternative Fuels Data Center: Mississippi Points of Contact on Delicious Rank Alternative Fuels Data Center: Mississippi Points of Contact on Digg Find More places to share Alternative Fuels Data Center: Mississippi Points of Contact on AddThis.com... More in this section... Federal State Advanced Search All Laws & Incentives Sorted by Type Mississippi Points of Contact The following people or agencies can help you find more information about Mississippi's clean transportation laws, incentives, and funding


Alternative Fuels Data Center: Pennsylvania Points of Contact  

Alternative Fuels and Advanced Vehicles Data Center (EERE)

Pennsylvania Points of Pennsylvania Points of Contact to someone by E-mail Share Alternative Fuels Data Center: Pennsylvania Points of Contact on Facebook Tweet about Alternative Fuels Data Center: Pennsylvania Points of Contact on Twitter Bookmark Alternative Fuels Data Center: Pennsylvania Points of Contact on Google Bookmark Alternative Fuels Data Center: Pennsylvania Points of Contact on Delicious Rank Alternative Fuels Data Center: Pennsylvania Points of Contact on Digg Find More places to share Alternative Fuels Data Center: Pennsylvania Points of Contact on AddThis.com... More in this section... Federal State Advanced Search All Laws & Incentives Sorted by Type Pennsylvania Points of Contact The following people or agencies can help you find more information about Pennsylvania's clean transportation laws, incentives, and funding


Graphene quantum point contact transistor for DNA sensing  

Science Journals Connector (OSTI)

Graphene quantum point contact transistor for DNA...the position and size of a nanopore in graphene nanoribbons can strongly affect its electronic...nanopore. In particular, we show that a graphene membrane with quantum point contact geometry...

Anuj Girdhar; Chaitanya Sathe; Klaus Schulten; Jean-Pierre Leburton



Oak Ridge Site Specific Advisory Board Contacts | Department...  

Office of Environmental Management (EM)

Contacts Oak Ridge Site Specific Advisory Board Contacts Mailing Address Oak Ridge Site Specific Advisory Board P.O. Box 2001, EM-91 Oak Ridge, TN 37831 Phone Numbers (865)...


Au-free Ohmic Contacts to Gallium Nitride and Graphene  

E-Print Network (OSTI)

. ................................................................................................. 43 Figure 28 Specific contact resistivity of co-sputtered Ti-Ta contact calculated after RTA at different temperatures ......................................................... 43 Figure 29 PMMA transfer method for transferring CVD grown...

Ravikirthi, Pradhyumna



Protein folding using contact maps Michele Vendruscolo and Eytan Domany  

E-Print Network (OSTI)

Protein folding using contact maps Michele Vendruscolo and Eytan Domany Department of Physics 26 I. INTRODUCTION Computational approaches to protein folding are divided into two main categories protein fold prediction. Contact maps are a particularly manageable representation of protein structure

Domany, Eytan


Line tension vector thermodynamics of anisotropic contact lines  

Science Journals Connector (OSTI)

Multiphase materials with intersecting diving surfaces give rise to contact lines. A line tension vector thermodynamics formalism is developed and used to analyze contact line problems in the presence of anisotropy, taking into account two elastic modes: change in contact line length and change in contact line orientation. Using this formalism, the contact line-shape equation is derived, and the renormalization of the line tension due to anisotropy is characterized. The correspondence and analogies between the shape equation for anisotropic surfaces (Herring equation) and the shape equation for contact lines is established. Line energies for nematic liquid crystals, representative of generic anisotropic contact lines, are used to derive a shape equation that takes into account ambient orientation effects. It is found that anisotropic line tension may promote bending and chiral modes to avoid unfavorable orientations of the contact line with respect to the ambient nematic ordering.

Alejandro D. Rey



Size and load dependence of nanoscale electric contact resistance  

Science Journals Connector (OSTI)

Abstract Nanoscale electrical resistance between a platinum-coated atomic force microscope tip and highly oriented pyrolytic graphite surface is measured as a function of normal load and tip radius. These measurements are complemented by molecular dynamics simulations that relate load and radius to contact area. Simulation-predicted contact area and experimentally-measured resistance are used to calculate contact resistivity. The results show that the effect of load on resistance can be captured by the real contact area, while tip size, although in part captured by area, affects contact resistivity itself, potentially through interface distance. Our study provides new insight into the effect of load and geometry on nanoscale electric contact and, more significantly, highlights the role of atomic-scale contact features in determining contact resistance.

Zhijiang Ye; Hyeongjoo Moon; Min Hwan Lee; Ashlie Martini


Note: This page contains sample records for the topic "apel org contact" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Alternative Fuels Data Center: North Dakota Points of Contact  

Alternative Fuels and Advanced Vehicles Data Center (EERE)

Dakota Points of Dakota Points of Contact to someone by E-mail Share Alternative Fuels Data Center: North Dakota Points of Contact on Facebook Tweet about Alternative Fuels Data Center: North Dakota Points of Contact on Twitter Bookmark Alternative Fuels Data Center: North Dakota Points of Contact on Google Bookmark Alternative Fuels Data Center: North Dakota Points of Contact on Delicious Rank Alternative Fuels Data Center: North Dakota Points of Contact on Digg Find More places to share Alternative Fuels Data Center: North Dakota Points of Contact on AddThis.com... More in this section... Federal State Advanced Search All Laws & Incentives Sorted by Type North Dakota Points of Contact The following people or agencies can help you find more information about North Dakota's clean transportation laws, incentives, and funding


Alternative Fuels Data Center: Vermont Points of Contact  

Alternative Fuels and Advanced Vehicles Data Center (EERE)

Vermont Points of Vermont Points of Contact to someone by E-mail Share Alternative Fuels Data Center: Vermont Points of Contact on Facebook Tweet about Alternative Fuels Data Center: Vermont Points of Contact on Twitter Bookmark Alternative Fuels Data Center: Vermont Points of Contact on Google Bookmark Alternative Fuels Data Center: Vermont Points of Contact on Delicious Rank Alternative Fuels Data Center: Vermont Points of Contact on Digg Find More places to share Alternative Fuels Data Center: Vermont Points of Contact on AddThis.com... More in this section... Federal State Advanced Search All Laws & Incentives Sorted by Type Vermont Points of Contact The following people or agencies can help you find more information about Vermont's clean transportation laws, incentives, and funding opportunities.


Alternative Fuels Data Center: Wyoming Points of Contact  

Alternative Fuels and Advanced Vehicles Data Center (EERE)

Wyoming Points of Wyoming Points of Contact to someone by E-mail Share Alternative Fuels Data Center: Wyoming Points of Contact on Facebook Tweet about Alternative Fuels Data Center: Wyoming Points of Contact on Twitter Bookmark Alternative Fuels Data Center: Wyoming Points of Contact on Google Bookmark Alternative Fuels Data Center: Wyoming Points of Contact on Delicious Rank Alternative Fuels Data Center: Wyoming Points of Contact on Digg Find More places to share Alternative Fuels Data Center: Wyoming Points of Contact on AddThis.com... More in this section... Federal State Advanced Search All Laws & Incentives Sorted by Type Wyoming Points of Contact The following people or agencies can help you find more information about Wyoming's clean transportation laws, incentives, and funding opportunities.


Alternative Fuels Data Center: Michigan Points of Contact  

Alternative Fuels and Advanced Vehicles Data Center (EERE)

Michigan Points of Michigan Points of Contact to someone by E-mail Share Alternative Fuels Data Center: Michigan Points of Contact on Facebook Tweet about Alternative Fuels Data Center: Michigan Points of Contact on Twitter Bookmark Alternative Fuels Data Center: Michigan Points of Contact on Google Bookmark Alternative Fuels Data Center: Michigan Points of Contact on Delicious Rank Alternative Fuels Data Center: Michigan Points of Contact on Digg Find More places to share Alternative Fuels Data Center: Michigan Points of Contact on AddThis.com... More in this section... Federal State Advanced Search All Laws & Incentives Sorted by Type Michigan Points of Contact The following people or agencies can help you find more information about Michigan's clean transportation laws, incentives, and funding


Alternative Fuels Data Center: Federal Points of Contact  

Alternative Fuels and Advanced Vehicles Data Center (EERE)

Federal Points of Federal Points of Contact to someone by E-mail Share Alternative Fuels Data Center: Federal Points of Contact on Facebook Tweet about Alternative Fuels Data Center: Federal Points of Contact on Twitter Bookmark Alternative Fuels Data Center: Federal Points of Contact on Google Bookmark Alternative Fuels Data Center: Federal Points of Contact on Delicious Rank Alternative Fuels Data Center: Federal Points of Contact on Digg Find More places to share Alternative Fuels Data Center: Federal Points of Contact on AddThis.com... More in this section... Federal State Advanced Search All Laws & Incentives Sorted by Type Federal Points of Contact The following people or agencies can help you find more information about clean transportation laws, incentives, and funding opportunities available


Alternative Fuels Data Center: Hawaii Points of Contact  

Alternative Fuels and Advanced Vehicles Data Center (EERE)

Hawaii Points of Hawaii Points of Contact to someone by E-mail Share Alternative Fuels Data Center: Hawaii Points of Contact on Facebook Tweet about Alternative Fuels Data Center: Hawaii Points of Contact on Twitter Bookmark Alternative Fuels Data Center: Hawaii Points of Contact on Google Bookmark Alternative Fuels Data Center: Hawaii Points of Contact on Delicious Rank Alternative Fuels Data Center: Hawaii Points of Contact on Digg Find More places to share Alternative Fuels Data Center: Hawaii Points of Contact on AddThis.com... More in this section... Federal State Advanced Search All Laws & Incentives Sorted by Type Hawaii Points of Contact The following people or agencies can help you find more information about Hawaii's clean transportation laws, incentives, and funding opportunities.


Alternative Fuels Data Center: South Dakota Points of Contact  

Alternative Fuels and Advanced Vehicles Data Center (EERE)

Dakota Points of Dakota Points of Contact to someone by E-mail Share Alternative Fuels Data Center: South Dakota Points of Contact on Facebook Tweet about Alternative Fuels Data Center: South Dakota Points of Contact on Twitter Bookmark Alternative Fuels Data Center: South Dakota Points of Contact on Google Bookmark Alternative Fuels Data Center: South Dakota Points of Contact on Delicious Rank Alternative Fuels Data Center: South Dakota Points of Contact on Digg Find More places to share Alternative Fuels Data Center: South Dakota Points of Contact on AddThis.com... More in this section... Federal State Advanced Search All Laws & Incentives Sorted by Type South Dakota Points of Contact The following people or agencies can help you find more information about South Dakota's clean transportation laws, incentives, and funding


Alternative Fuels Data Center: Idaho Points of Contact  

Alternative Fuels and Advanced Vehicles Data Center (EERE)

Idaho Points of Idaho Points of Contact to someone by E-mail Share Alternative Fuels Data Center: Idaho Points of Contact on Facebook Tweet about Alternative Fuels Data Center: Idaho Points of Contact on Twitter Bookmark Alternative Fuels Data Center: Idaho Points of Contact on Google Bookmark Alternative Fuels Data Center: Idaho Points of Contact on Delicious Rank Alternative Fuels Data Center: Idaho Points of Contact on Digg Find More places to share Alternative Fuels Data Center: Idaho Points of Contact on AddThis.com... More in this section... Federal State Advanced Search All Laws & Incentives Sorted by Type Idaho Points of Contact The following people or agencies can help you find more information about Idaho's clean transportation laws, incentives, and funding opportunities.


Alternative Fuels Data Center: Rhode Island Points of Contact  

Alternative Fuels and Advanced Vehicles Data Center (EERE)

Rhode Island Points of Rhode Island Points of Contact to someone by E-mail Share Alternative Fuels Data Center: Rhode Island Points of Contact on Facebook Tweet about Alternative Fuels Data Center: Rhode Island Points of Contact on Twitter Bookmark Alternative Fuels Data Center: Rhode Island Points of Contact on Google Bookmark Alternative Fuels Data Center: Rhode Island Points of Contact on Delicious Rank Alternative Fuels Data Center: Rhode Island Points of Contact on Digg Find More places to share Alternative Fuels Data Center: Rhode Island Points of Contact on AddThis.com... More in this section... Federal State Advanced Search All Laws & Incentives Sorted by Type Rhode Island Points of Contact The following people or agencies can help you find more information about Rhode Island's clean transportation laws, incentives, and funding


Alternative Fuels Data Center: Arkansas Points of Contact  

Alternative Fuels and Advanced Vehicles Data Center (EERE)

Arkansas Points of Arkansas Points of Contact to someone by E-mail Share Alternative Fuels Data Center: Arkansas Points of Contact on Facebook Tweet about Alternative Fuels Data Center: Arkansas Points of Contact on Twitter Bookmark Alternative Fuels Data Center: Arkansas Points of Contact on Google Bookmark Alternative Fuels Data Center: Arkansas Points of Contact on Delicious Rank Alternative Fuels Data Center: Arkansas Points of Contact on Digg Find More places to share Alternative Fuels Data Center: Arkansas Points of Contact on AddThis.com... More in this section... Federal State Advanced Search All Laws & Incentives Sorted by Type Arkansas Points of Contact The following people or agencies can help you find more information about Arkansas's clean transportation laws, incentives, and funding


Alternative Fuels Data Center: Delaware Points of Contact  

Alternative Fuels and Advanced Vehicles Data Center (EERE)

Delaware Points of Delaware Points of Contact to someone by E-mail Share Alternative Fuels Data Center: Delaware Points of Contact on Facebook Tweet about Alternative Fuels Data Center: Delaware Points of Contact on Twitter Bookmark Alternative Fuels Data Center: Delaware Points of Contact on Google Bookmark Alternative Fuels Data Center: Delaware Points of Contact on Delicious Rank Alternative Fuels Data Center: Delaware Points of Contact on Digg Find More places to share Alternative Fuels Data Center: Delaware Points of Contact on AddThis.com... More in this section... Federal State Advanced Search All Laws & Incentives Sorted by Type Delaware Points of Contact The following people or agencies can help you find more information about Delaware's clean transportation laws, incentives, and funding


Alternative Fuels Data Center: Oklahoma Points of Contact  

Alternative Fuels and Advanced Vehicles Data Center (EERE)

Oklahoma Points of Oklahoma Points of Contact to someone by E-mail Share Alternative Fuels Data Center: Oklahoma Points of Contact on Facebook Tweet about Alternative Fuels Data Center: Oklahoma Points of Contact on Twitter Bookmark Alternative Fuels Data Center: Oklahoma Points of Contact on Google Bookmark Alternative Fuels Data Center: Oklahoma Points of Contact on Delicious Rank Alternative Fuels Data Center: Oklahoma Points of Contact on Digg Find More places to share Alternative Fuels Data Center: Oklahoma Points of Contact on AddThis.com... More in this section... Federal State Advanced Search All Laws & Incentives Sorted by Type Oklahoma Points of Contact The following people or agencies can help you find more information about Oklahoma's clean transportation laws, incentives, and funding


Alternative Fuels Data Center: Maine Points of Contact  

Alternative Fuels and Advanced Vehicles Data Center (EERE)

Maine Points of Maine Points of Contact to someone by E-mail Share Alternative Fuels Data Center: Maine Points of Contact on Facebook Tweet about Alternative Fuels Data Center: Maine Points of Contact on Twitter Bookmark Alternative Fuels Data Center: Maine Points of Contact on Google Bookmark Alternative Fuels Data Center: Maine Points of Contact on Delicious Rank Alternative Fuels Data Center: Maine Points of Contact on Digg Find More places to share Alternative Fuels Data Center: Maine Points of Contact on AddThis.com... More in this section... Federal State Advanced Search All Laws & Incentives Sorted by Type Maine Points of Contact The following people or agencies can help you find more information about Maine's clean transportation laws, incentives, and funding opportunities.


Alternative Fuels Data Center: Arizona Points of Contact  

Alternative Fuels and Advanced Vehicles Data Center (EERE)

Arizona Points of Arizona Points of Contact to someone by E-mail Share Alternative Fuels Data Center: Arizona Points of Contact on Facebook Tweet about Alternative Fuels Data Center: Arizona Points of Contact on Twitter Bookmark Alternative Fuels Data Center: Arizona Points of Contact on Google Bookmark Alternative Fuels Data Center: Arizona Points of Contact on Delicious Rank Alternative Fuels Data Center: Arizona Points of Contact on Digg Find More places to share Alternative Fuels Data Center: Arizona Points of Contact on AddThis.com... More in this section... Federal State Advanced Search All Laws & Incentives Sorted by Type Arizona Points of Contact The following people or agencies can help you find more information about Arizona's clean transportation laws, incentives, and funding opportunities.


Alternative Fuels Data Center: New Jersey Points of Contact  

Alternative Fuels and Advanced Vehicles Data Center (EERE)

Jersey Points of Jersey Points of Contact to someone by E-mail Share Alternative Fuels Data Center: New Jersey Points of Contact on Facebook Tweet about Alternative Fuels Data Center: New Jersey Points of Contact on Twitter Bookmark Alternative Fuels Data Center: New Jersey Points of Contact on Google Bookmark Alternative Fuels Data Center: New Jersey Points of Contact on Delicious Rank Alternative Fuels Data Center: New Jersey Points of Contact on Digg Find More places to share Alternative Fuels Data Center: New Jersey Points of Contact on AddThis.com... More in this section... Federal State Advanced Search All Laws & Incentives Sorted by Type New Jersey Points of Contact The following people or agencies can help you find more information about New Jersey's clean transportation laws, incentives, and funding


Alternative Fuels Data Center: Alabama Points of Contact  

Alternative Fuels and Advanced Vehicles Data Center (EERE)

Alabama Points of Alabama Points of Contact to someone by E-mail Share Alternative Fuels Data Center: Alabama Points of Contact on Facebook Tweet about Alternative Fuels Data Center: Alabama Points of Contact on Twitter Bookmark Alternative Fuels Data Center: Alabama Points of Contact on Google Bookmark Alternative Fuels Data Center: Alabama Points of Contact on Delicious Rank Alternative Fuels Data Center: Alabama Points of Contact on Digg Find More places to share Alternative Fuels Data Center: Alabama Points of Contact on AddThis.com... More in this section... Federal State Advanced Search All Laws & Incentives Sorted by Type Alabama Points of Contact The following people or agencies can help you find more information about Alabama's clean transportation laws, incentives, and funding opportunities.


Alternative Fuels Data Center: Nebraska Points of Contact  

Alternative Fuels and Advanced Vehicles Data Center (EERE)

Nebraska Points of Nebraska Points of Contact to someone by E-mail Share Alternative Fuels Data Center: Nebraska Points of Contact on Facebook Tweet about Alternative Fuels Data Center: Nebraska Points of Contact on Twitter Bookmark Alternative Fuels Data Center: Nebraska Points of Contact on Google Bookmark Alternative Fuels Data Center: Nebraska Points of Contact on Delicious Rank Alternative Fuels Data Center: Nebraska Points of Contact on Digg Find More places to share Alternative Fuels Data Center: Nebraska Points of Contact on AddThis.com... More in this section... Federal State Advanced Search All Laws & Incentives Sorted by Type Nebraska Points of Contact The following people or agencies can help you find more information about Nebraska's clean transportation laws, incentives, and funding


Alternative Fuels Data Center: New York Points of Contact  

Alternative Fuels and Advanced Vehicles Data Center (EERE)

New York Points of New York Points of Contact to someone by E-mail Share Alternative Fuels Data Center: New York Points of Contact on Facebook Tweet about Alternative Fuels Data Center: New York Points of Contact on Twitter Bookmark Alternative Fuels Data Center: New York Points of Contact on Google Bookmark Alternative Fuels Data Center: New York Points of Contact on Delicious Rank Alternative Fuels Data Center: New York Points of Contact on Digg Find More places to share Alternative Fuels Data Center: New York Points of Contact on AddThis.com... More in this section... Federal State Advanced Search All Laws & Incentives Sorted by Type New York Points of Contact The following people or agencies can help you find more information about New York's clean transportation laws, incentives, and funding


Alternative Fuels Data Center: California Points of Contact  

Alternative Fuels and Advanced Vehicles Data Center (EERE)

California Points of California Points of Contact to someone by E-mail Share Alternative Fuels Data Center: California Points of Contact on Facebook Tweet about Alternative Fuels Data Center: California Points of Contact on Twitter Bookmark Alternative Fuels Data Center: California Points of Contact on Google Bookmark Alternative Fuels Data Center: California Points of Contact on Delicious Rank Alternative Fuels Data Center: California Points of Contact on Digg Find More places to share Alternative Fuels Data Center: California Points of Contact on AddThis.com... More in this section... Federal State Advanced Search All Laws & Incentives Sorted by Type California Points of Contact The following people or agencies can help you find more information about California's clean transportation laws, incentives, and funding


Alternative Fuels Data Center: Texas Points of Contact  

Alternative Fuels and Advanced Vehicles Data Center (EERE)

Texas Points of Texas Points of Contact to someone by E-mail Share Alternative Fuels Data Center: Texas Points of Contact on Facebook Tweet about Alternative Fuels Data Center: Texas Points of Contact on Twitter Bookmark Alternative Fuels Data Center: Texas Points of Contact on Google Bookmark Alternative Fuels Data Center: Texas Points of Contact on Delicious Rank Alternative Fuels Data Center: Texas Points of Contact on Digg Find More places to share Alternative Fuels Data Center: Texas Points of Contact on AddThis.com... More in this section... Federal State Advanced Search All Laws & Incentives Sorted by Type Texas Points of Contact The following people or agencies can help you find more information about Texas's clean transportation laws, incentives, and funding opportunities.

Note: This page contains sample records for the topic "apel org contact" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Alternative Fuels Data Center: Indiana Points of Contact  

Alternative Fuels and Advanced Vehicles Data Center (EERE)

Indiana Points of Indiana Points of Contact to someone by E-mail Share Alternative Fuels Data Center: Indiana Points of Contact on Facebook Tweet about Alternative Fuels Data Center: Indiana Points of Contact on Twitter Bookmark Alternative Fuels Data Center: Indiana Points of Contact on Google Bookmark Alternative Fuels Data Center: Indiana Points of Contact on Delicious Rank Alternative Fuels Data Center: Indiana Points of Contact on Digg Find More places to share Alternative Fuels Data Center: Indiana Points of Contact on AddThis.com... More in this section... Federal State Advanced Search All Laws & Incentives Sorted by Type Indiana Points of Contact The following people or agencies can help you find more information about Indiana's clean transportation laws, incentives, and funding opportunities.


Alternative Fuels Data Center: Missouri Points of Contact  

Alternative Fuels and Advanced Vehicles Data Center (EERE)

Missouri Points of Missouri Points of Contact to someone by E-mail Share Alternative Fuels Data Center: Missouri Points of Contact on Facebook Tweet about Alternative Fuels Data Center: Missouri Points of Contact on Twitter Bookmark Alternative Fuels Data Center: Missouri Points of Contact on Google Bookmark Alternative Fuels Data Center: Missouri Points of Contact on Delicious Rank Alternative Fuels Data Center: Missouri Points of Contact on Digg Find More places to share Alternative Fuels Data Center: Missouri Points of Contact on AddThis.com... More in this section... Federal State Advanced Search All Laws & Incentives Sorted by Type Missouri Points of Contact The following people or agencies can help you find more information about Missouri's clean transportation laws, incentives, and funding


Alternative Fuels Data Center: Massachusetts Points of Contact  

Alternative Fuels and Advanced Vehicles Data Center (EERE)

Massachusetts Points Massachusetts Points of Contact to someone by E-mail Share Alternative Fuels Data Center: Massachusetts Points of Contact on Facebook Tweet about Alternative Fuels Data Center: Massachusetts Points of Contact on Twitter Bookmark Alternative Fuels Data Center: Massachusetts Points of Contact on Google Bookmark Alternative Fuels Data Center: Massachusetts Points of Contact on Delicious Rank Alternative Fuels Data Center: Massachusetts Points of Contact on Digg Find More places to share Alternative Fuels Data Center: Massachusetts Points of Contact on AddThis.com... More in this section... Federal State Advanced Search All Laws & Incentives Sorted by Type Massachusetts Points of Contact The following people or agencies can help you find more information about Massachusetts's clean transportation laws, incentives, and funding


Alternative Fuels Data Center: West Virginia Points of Contact  

Alternative Fuels and Advanced Vehicles Data Center (EERE)

West Virginia Points West Virginia Points of Contact to someone by E-mail Share Alternative Fuels Data Center: West Virginia Points of Contact on Facebook Tweet about Alternative Fuels Data Center: West Virginia Points of Contact on Twitter Bookmark Alternative Fuels Data Center: West Virginia Points of Contact on Google Bookmark Alternative Fuels Data Center: West Virginia Points of Contact on Delicious Rank Alternative Fuels Data Center: West Virginia Points of Contact on Digg Find More places to share Alternative Fuels Data Center: West Virginia Points of Contact on AddThis.com... More in this section... Federal State Advanced Search All Laws & Incentives Sorted by Type West Virginia Points of Contact The following people or agencies can help you find more information about West Virginia's clean transportation laws, incentives, and funding


Alternative Fuels Data Center: Nevada Points of Contact  

Alternative Fuels and Advanced Vehicles Data Center (EERE)

Nevada Points of Nevada Points of Contact to someone by E-mail Share Alternative Fuels Data Center: Nevada Points of Contact on Facebook Tweet about Alternative Fuels Data Center: Nevada Points of Contact on Twitter Bookmark Alternative Fuels Data Center: Nevada Points of Contact on Google Bookmark Alternative Fuels Data Center: Nevada Points of Contact on Delicious Rank Alternative Fuels Data Center: Nevada Points of Contact on Digg Find More places to share Alternative Fuels Data Center: Nevada Points of Contact on AddThis.com... More in this section... Federal State Advanced Search All Laws & Incentives Sorted by Type Nevada Points of Contact The following people or agencies can help you find more information about Nevada's clean transportation laws, incentives, and funding opportunities.


MIT Plasma Science & Fusion Center: research>alcator>contact  

NLE Websites -- All DOE Office Websites (Extended Search)

Introduction Facility Information Tokamak Data & Real-Time Information Computer & Data Systems Research Program Information Publications & News Meetings & Seminars Contact...


Optimizing Carbon Nanotube Contacts for Use in Organic Photovoltaics: Preprint  

SciTech Connect

This report describes research on optimizing carbon nanotube networks for use as transparent electrical contacts (TCs) in organic photovoltaics (OPV).

Barnes, T. M.; Blackburn, J. L.; Tenent, R. C.; Morfa, A.; Heben, M.; Coutts, T. J.



Office of Energy Efficiency and Renewable Energy Contacts  

Office of Energy Efficiency and Renewable Energy (EERE)

Contact information for the Office of Energy Efficiency and Renewable Energy (EERE) and the EERE technology areas and offices


Sampling effect on contact and transport properties between fractal surfaces  

E-Print Network (OSTI)

or long-term nuclear waste storage. In mechanical design, fluid flow through the contact between machined

Paris-Sud XI, Université de


Property:RAPID/Contact/ID6/Position | Open Energy Information  

Open Energy Info (EERE)

Information Services Branch Supervisor + T Texas Commission on Environmental Quality + Drinking Water Permitting Contact + U Utah Department of Environmental Quality +...


For Immediate release: 08/09/2011 Contact: Ingrid Wright  

E-Print Network (OSTI)

to Obtain ISO 9001 Certification Congressman Silvestre Reyes will recognize Xceed Resources (http://www.xceedresources.org) as the First Non-Profit to obtain ISO 9001 certification. Xceed Resources was able to achieve ISO 9001 Texas. ISO 9001 certification assures customers and clients that Xceed's quality management systems

Ward, Karen


DOI: 10.1126/science.1142204 , 1412 (2007);318Science  

E-Print Network (OSTI)

. Mislow, M. S. Kim, D. B. Davis, E. M. McNally, J. Cell Sci. 115, 61 (2002). 93. J. M. Mislow et al., FEBS.sciencemag.orgDownloadedfrom #12;91. E. D. Apel, R. M. Lewis, R. M. Grady, J. R. Sanes, J. Biol. Chem. 275, 31986 (2000). 92. J. M. Cell Biol. 178, 785 (2007). 102. R. Goldman et al., Ann. N. Y. Acad. Sci. 455, 1 (1985). 103. A. J

Bedwell, David M.


Ohmic contact metallization on p-type indium phosphide  

E-Print Network (OSTI)

contact resistivities comparable to those of Au-based contacts, determined by the Cox and Strack structure, can be obtained for a pure Pd contact on p-InP (hole concentration -3xlOl' cm-'). The defects can be identified to be related with phosphorus...

Park, Moonho



RisR1307(EN) Contact Resistance of Ceramic  

E-Print Network (OSTI)

Risø­R­1307(EN) Contact Resistance of Ceramic Interfaces Between Materi- als Used for Solid Oxide Contact resistance of ceramic interfaces between materials used for solid oxide fuel cell applications the constriction resistance. The contact resistance between pairs of three different materials were analysed (stron


Electrical Contacts to Molecular Layers by Nanotransfer Printing  

E-Print Network (OSTI)

Electrical Contacts to Molecular Layers by Nanotransfer Printing Yueh-Lin Loo, David V. Lang, John of electrical contact. Results show that the nTP method produces superior devices in which the electrical for making electrical contacts in molecular electronics. Organic molecules whose electronic properties can

Rogers, John A.


Agency Points of Contact for Tribal Consultation Agency Point of Contact Email and Phone  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Points of Contact for Tribal Consultation Points of Contact for Tribal Consultation Agency Point of Contact Email and Phone Department of the Interior Sarah Harris Chief of Staff to the Assist Secretary - Indian Affairs Tribalconsultation@bia.gov (202) 208-7163 Department of Justice Tracy Toulou Director, Office of Tribal Justice OTJ@usdoj.gov (202) 514-8812 Department of State Reta Lewis Special Representative for Global Intergovernmental Affairs tribalconsultation@state.gov (202) 647-7710 Department of the Treasury Alexander Gelber Deputy Assistant Secretary alexander.gelber@treasury.gov (202) 622-1513 Department of Defense Serena Bellew Acting Senior Advisor and Liaison for Native American Affairs Serena.bellew@osd.mil


Silicon point contact concentrator solar cells  

SciTech Connect

Experimental results are presented for thin high resistivity concentrator silicon solar cells which use a back-side point-contact geometry. Cells of 130 and 233 micron thickness were fabricated and characterized. The thin cells were found to have efficiencies greater than 22 percent for incident solar intensities of 3 to 30 W/sq cm. Efficiency peaked at 23 percent at 11 W/sq cm measured at 22-25 C. Strategies for obtaining higher efficiencies with this solar cell design are discussed. 8 references.

Sinton, R.A.; Kwark, Y.; Swirhun, S.; Swanson, R.M.



Thermodynamics of nuclei in thermal contact  

Science Journals Connector (OSTI)

The thermodynamic properties of a dinuclear system are studied with the methods of statistical mechanics. A schematic model calculation shows that the excitation-energy transfer proceeds in energy steps of considerable amount which are subject to large fluctuations. As a consequence, thermal averaging is strong enough to assure the application of thermodynamical methods for describing the energy exchange between the two nuclei in contact. In particular, thermal averaging justifies the definition of a nuclear temperature. The division of excitation energy in thermal equilibrium is derived for several analytical descriptions of the level density.

Karl-Heinz Schmidt and Beatriz Jurado



http://occr.christiantimes.org.hk/art_0123.htm 1 Christianity and Culture  

E-Print Network (OSTI)

http://occr.christiantimes.org.hk/art_0123.htm 1 Christianity and Culture Jerry Solomon Jerry Solomon field ministries Probe Ministries "Mind Games" College Prep Criswell College University measurement, statistics and methodological studies Cisco Systems PDF PDF html

Yu, Alex



E-Print Network (OSTI)


California at Santa Barbara, University of

Note: This page contains sample records for the topic "apel org contact" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Meteoritics & Planetary Science 38, Nr 6, 871885 (2003) Abstract available online at http://meteoritics.org  

E-Print Network (OSTI)

Meteoritics & Planetary Science 38, Nr 6, 871­885 (2003) Abstract available online at http://meteoritics.org 871 © Meteoritical Society, 2003. Printed in USA. Searching for the source regions of martian

Hamilton, Victoria E.


www.frontiersinecology.org The Ecological Society of America Leaving scientific footprints  

E-Print Network (OSTI)

502 www.frontiersinecology.org � The Ecological Society of America Leaving scientific footprints scientists used. I noticed some minor disturbances, such as vehicle tracks from the 1970s; trash buried

Wall, Diana


-The Bubble Chamber -http://thebubblechamber.org -Review: Cold War Social Science  

E-Print Network (OSTI)

[1] - The Bubble Chamber - http://thebubblechamber.org - Review: Cold War Social Science Posted assume that all developments in the social sciences during the Cold War period can be The Bubble Chamber

Solovey, Mark


rspb.royalsocietypublishing.org Cite this article: Trumble BC, Smith EA,  

E-Print Network (OSTI)

rspb.royalsocietypublishing.org Research Cite this article: Trumble BC, Smith EA, O'Connor KA A. Smith3,4, Kathleen A. O'Connor3,4, Hillard S. Kaplan5 and Michael D. Gurven2 1 Institute

Smith, Eric Alden


From: Ed Roman <EROMAN@smud.org>  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Ed Roman Ed Roman <EROMAN@smud.org> To: CC: , "Howard Hirahara" Date: 4/3/2009 10:30 AM Subject: SMUD'S COMMENTS AND QUESTIONS ON THE PROPOSED TIP Attachments: AGM ES 09-006 Commnet Letter on TIP.pdf Attached are comments of the Sacramento Municipal Utility District (SMUD) on the proposed principles, policies and practices that the Western Area Power Administration (Western) plans to use to implement the authority provided to it in section 402 of the American Recovery and Reinvestment Act of 2009 (Recovery Act). These comments are provided in response to the Notice of Proposed Program and Request for Public Comments as posted by the Western Area Power Administration (Western) in


Method of forming contacts for a back-contact solar cell  

DOE Patents (OSTI)

Methods of forming contacts for back-contact solar cells are described. In one embodiment, a method includes forming a thin dielectric layer on a substrate, forming a polysilicon layer on the thin dielectric layer, forming and patterning a solid-state p-type dopant source on the polysilicon layer, forming an n-type dopant source layer over exposed regions of the polysilicon layer and over a plurality of regions of the solid-state p-type dopant source, and heating the substrate to provide a plurality of n-type doped polysilicon regions among a plurality of p-type doped polysilicon regions.

Manning, Jane



http://www.schizophreniabulletin.oupjournals.org Schizophrenia Bulletin. For Peer Review Only  

E-Print Network (OSTI)

. For Peer Review Only #12; Page 1 of 22 http://www.schizophreniabulletin.oupjournals.org Schizophrenia Bulletin. For Peer Review Only 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25://www.schizophreniabulletin.oupjournals.org Schizophrenia Bulletin. For Peer Review Only 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25

Ochsner, Kevin


Effect of contact conditions during thermo-mechanical contact between a thermal flying height control slider and a disk asperity  

E-Print Network (OSTI)

is developed for the transient contact between a thermal flying height control (TFC) slider and a disk asperityEffect of contact conditions during thermo-mechanical contact between a thermal flying height control slider and a disk asperity Wenping Song a,c,n , Andrey Ovcharenko b , Bernhard Knigge b , Min Yang

Wang, Deli


Role of chemical termination in edge contact to graphene  

SciTech Connect

Edge contacts to graphene can offer excellent contact properties. Role of different chemical terminations is examined by using ab initio density functional theory and quantum transport simulations. It is found that edge termination by group VI elements O and S offers considerably lower contact resistance compared to H and group VII element F. The results can be understood by significantly larger binding energy and shorter binding distance between the metal contact and these group VI elements, which results in considerably lower interface potential barrier and larger transmission. The qualitative conclusion applies to a variety of contact metal materials.

Gao, Qun; Guo, Jing, E-mail: guoj@ufl.edu [Department of Electrical and Computer Engineering, University of Florida, Gainesville, Florida 32611 (United States)



Phorgotten phenomena: Verifying electrical CP contacts on gas distribution pipelines  

SciTech Connect

Federal and state regulations mandate that gas companies must maintain cathodic protection (CP) throughout distribution systems to protect against corrosion. From time to time, underground contacts occur. Any contact of metal lines depletes CP potentials. Finding and clearing these contacts is time-consuming and costly. Some gas companies report that only one in 10 of these underground contacts are found. The paper describes a method that has maintained a 98% efficiency in clearing underground contacts for the past 10 years for Cascade Natural Gas.

Maxwell, J.L. [Cascade Natural Gas Corp., Seattle, WA (United States)



E-Print Network 3.0 - airborne allergic contact Sample Search...  

NLE Websites -- All DOE Office Websites (Extended Search)

contact surfaces... . Be aware of how "cross-contact" can happen. Cross-contact is when a food ... Source: Liskiewicz, Maciej - Institut fr Theoretische Informatik, Universitt...


SolutionsForYourLife.org What's Inside  

E-Print Network (OSTI)

Office, 6:30pm-7:45pm, FREE, Contact Carolyn Saft at 386-362-2771 for more information. 12 4-H Sewing Carolyn Saft at 386-362-2771 for more information. 22-24 South Eastern Builders Conference, Orlando 23

Jawitz, James W.


Thin Silicon MEMS Contact-Stress Sensor  

SciTech Connect

This thin, MEMS contact-stress (CS) sensor continuously and accurately measures time-varying, solid interface loads in embedded systems over tens of thousands of load cycles. Unlike all other interface load sensors, the CS sensor is extremely thin (< 150 {micro}m), provides accurate, high-speed measurements, and exhibits good stability over time with no loss of calibration with load cycling. The silicon CS sensor, 5 mm{sup 2} and 65 {micro}m thick, has piezoresistive traces doped within a load-sensitive diaphragm. The novel package utilizes several layers of flexible polyimide to mechanically and electrically isolate the sensor from the environment, transmit normal applied loads to the diaphragm, and maintain uniform thickness. The CS sensors have a highly linear output in the load range tested (0-2.4 MPa) with an average accuracy of {+-} 1.5%.

Kotovsky, J; Tooker, A; Horsley, D



Contact structure for use in catalytic distillation  

DOE Patents (OSTI)

A method is described for conducting catalytic chemical reactions and fractionation of the reaction mixture comprising feeding reactants into a distillation column reactor, contracting said reactant in liquid phase with a fixed bed catalyst in the form of a contact catalyst structure consisting of closed porous containers containing the catalyst for the reaction and a clip means to hold and support said containers, which are disposed above, i.e., on the distillation trays in the tower. The trays have weir means to provide a liquid level on the trays to substantially cover the containers. In other words, the trays function in their ordinary manner with the addition thereto of the catalyst. The reaction mixture is concurrently fractionated in the column. 7 figs.

Jones, E.M. Jr.



Contact structure for use in catalytic distillation  

DOE Patents (OSTI)

A method and apparatus are disclosed for conducting catalytic chemical reactions and fractionation of the reaction mixture, comprising and feeding reactants into a distillation column reactor contracting said reactant in a liquid phase with a fixed bed catalyst in the form of a contact catalyst structure, consisting of closed porous containers containing the catalyst for the reaction and a clip means to hold and support said containers, which are disposed above, i.e., on the distillation trays in the tower. The trays have weir means to provide a liquid level on the trays to substantially cover the containers. In other words, the trays function in their ordinary manner with the addition thereto of the catalyst. The reaction mixture is concurrently fractionated in the column. 7 figs.

Jones, E.M. Jr.



Contact structure for use in catalytic distillation  

DOE Patents (OSTI)

A method for conducting catalytic chemical reactions and fractionation of the reaction mixture comprising feeding reactants into a distillation column reactor contracting said reactant in liquid phase with a fixed bed catalyst in the form of a contact catalyst structure consisting of closed porous containers containing the catatlyst for the reaction and a clip means to hold and support said containers, which are disposed above, i.e., on the distillation trays in the tower. The trays have weir means to provide a liquid level on the trays to substantially cover the containers. In other words, the trays function in their ordinary manner with the addition thereto of the catalyst. The reaction mixture is concurrently fractionated in the column.

Jones, Jr., Edward M. (Friendswood, TX)



Contact structure for use in catalytic distillation  

DOE Patents (OSTI)

A method and apparatus for conducting catalytic chemical reactions and fractionation of the reaction mixture, comprising and feeding reactants into a distillation column reactor contracting said reactant in a liquid phase with a fixed bed catalyst in the form of a contact catalyst structure, consisting of closed porous containers containing the catalyst for the reaction and a clip means to hold and support said containers, which are disposed above, i.e., on the distillation trays in the tower. The trays have weir means to provide a liquid level on the trays to substantially cover the containers. In other words, the trays function in their ordinary manner with the addition thereto of the catalyst. The reaction mixture is concurrently fractionated in the column.

Jones, Jr., Edward M. (Friendswood, TX)



Energy Information Administration (EIA) - Supplement Tables - Contact  

Gasoline and Diesel Fuel Update (EIA)

6 6 For Further Information . . . The Annual Energy Outlook 2006 (AEO2006) was prepared by the Energy Information Administration (EIA), under the direction of John J. Conti (john.conti@eia.does.gov, 202/586-2222), Director, Integrated Analysis and Forecasting; Paul D. Holtberg (paul.holtberg@eia.doe.gov, 202/586-1284), Director, Demand and Integration Division; Joseph A. Beamon (jbeamon@eia.doe.gov, 202/586-2025), Director, Coal and Electric Power Division; Andy S. Kydes (akydes@eia.doe.gov, 202/586-2222), Acting Director, Oil and Gas Division and Senior Technical Advisor; and Glen E. Sweetnam (glen.sweetnam@eia.doe.gov, 202/586-2188), Director, International, Economic, and Greenhouse Gases Division. For ordering information and questions on other energy statistics available from EIA, please contact EIA's National Energy Information Center. Addresses, telephone numbers, and hours are as follows:


r XXXX American Chemical Society A dx.doi.org/10.1021/ja107719u |J. Am. Chem. Soc. XXXX, XXX, 000000 pubs.acs.org/JACS  

E-Print Network (OSTI)

these problems, including using carbide, nitride, or metal oxides as catalyst supports.3,8 Meta­000 ARTICLE pubs.acs.org/JACS Stabilization of Electrocatalytic Metal Nanoparticles at Metal-Metal Oxide, Washington 99164, United States bS Supporting Information ABSTRACT: Carbon-supported precious metal catalysts

Aksay, Ilhan A.


r XXXX American Chemical Society A dx.doi.org/10.1021/nl201070c |Nano Lett. XXXX, XXX, 000000 pubs.acs.org/NanoLett  

E-Print Network (OSTI)

-based ultracapacitors,24 electrodes for batteries,25?27 electrochemical sensors,28?30 and graphene-based composites as functionalized graphene sheets (FGSs). FGSs have been used in various applications: In lithium ion batteries­000 LETTER pubs.acs.org/NanoLett Local Voltage Drop in a Single Functionalized Graphene Sheet Characterized

Aksay, Ilhan A.

Note: This page contains sample records for the topic "apel org contact" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Federal Energy Management Program Contacts | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

About the Program » Federal Energy Management Program Contacts About the Program » Federal Energy Management Program Contacts Federal Energy Management Program Contacts October 8, 2013 - 1:32pm Addthis Contact information for the U.S. Department of Energy's (DOE) Federal Energy Management Program (FEMP) is available for: Leadership Staff Information is also available for: FEMP Field Contacts Federal Financing Specialists National Laboratory Liaisons DOE Sustainability Performance Office. Leadership The FEMP leadership team is composed of the following contacts. Dr. Timothy Unruh Director 202-586-5772 Jerry Dion Strategic Program Development 202-586-9470 Daniel Gore Supervisor, Technology Services 202-586-6477 Brad Gustafson Supervisor, Customer Services 202-586-5865 Hayes Jones Supervisor, Operations 202-586-8873 Schuyler (Skye) Schell


Contact | U.S. DOE Office of Science (SC)  

NLE Websites -- All DOE Office Websites (Extended Search)

Contact Contact Energy Frontier Research Centers (EFRCs) EFRCs Home Centers Research Science Highlights News & Events Publications Contact BES Home Contact Print Text Size: A A A RSS Feeds FeedbackShare Page The scientific directions of the EFRCs are overseen by program staff in the Basic Energy Sciences program within the Office of Science to ensure a unified management strategy and structure. This BES EFRC management team includes program managers from each of the BES Divisions and acts in partnership with many other BES staff who have core research program responsibilities in related areas. Each EFRC has a principal point of contact on the BES EFRC management team, as indicated below. The EFRCs are, however, managed collectively by this team. Contact information for general


Microsoft Word - FINAL Contact Record 2012-01 Roads Maintenance  

Office of Legacy Management (LM)

RFLMA Contact Record 2012-01 page 1 of 6 RFLMA Contact Record 2012-01 page 1 of 6 ROCKY FLATS SITE REGULATORY CONTACT RECORD Purpose: Soil Disturbance Review Plan-Roads maintenance, including grading the road to the former A-3 Pond to convert the road to two-track vehicle use. Contact Record Approval Date: May 31, 2012 Site Contact(s)/Affiliation(s): Scott Surovchak, U.S. Department of Energy (DOE); Gwen Hooton, DOE; Rick DiSalvo, S.M. Stoller Corporation (Stoller); Kurt Franzen, Stoller; Linda Kaiser, Stoller Regulatory Contact(s)/Affiliation(s): Carl Spreng, Colorado Department of Public Health and Environment (CDPHE); Vera Moritz, U.S. Environmental Protection Agency (EPA) Date of Consultation Meeting: May 24, 2012 Consultation Meeting Participants: Carl Spreng, CDPHE; Scott Surovchak, DOE;


Published: March 16, 2011 r 2011 American Chemical Society 1603 dx.doi.org/10.1021/nl104514m |Nano Lett. 2011, 11, 16031608  

E-Print Network (OSTI)

Published: March 16, 2011 r 2011 American Chemical Society 1603 dx.doi.org/10.1021/nl104514m |Nano Lett. 2011, 11, 1603­1608 LETTER pubs.acs.org/NanoLett Light Propagation in Curved Silver Nanowire

Wang, Zhong L.


Contacts Between Metals and Between a Metal and a Semiconductor  

Science Journals Connector (OSTI)

The problem of contacts between metals and between a metal and a semiconductor is treated classically with the help of the results of wave mechanical theory of electron energy states in solids. The potential and electron density distributions in the two bodies near the contact are discussed. The bodies are assumed to be in immediate contact. The problem of a body in vacuum and the problem of two bodies separated by a gap are discussed qualitatively.

H. Y. Fan



MIT Plasma Science & Fusion Center: research>alcator>contact  

NLE Websites -- All DOE Office Websites (Extended Search)

Facility Information Tokamak Data & Real-Time Information Computer & Data Systems Research Program Information Publications & News Meetings & Seminars Contact Information Physics...


Contacts for the Assistant General Counsel for Technology Transfer...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Technology Transfer and Procurement Contacts for the Assistant General Counsel for Technology Transfer and Procurement Subject MatterFunctional Area Lead Backup Technology...


LSU EFRC - Center for Atomic Level Catalyst Design - Contact...  

NLE Websites -- All DOE Office Websites (Extended Search)

Contact Us >> space control Center for Atomic-Level Catalyst Design (CALCD) 110 Chemical Engineering South Stadium Road Baton Rouge, LA 70803 Telephone: 225.578.1426 Fax:...


Development of an energy efficient direct contact membrane distillation system.  

E-Print Network (OSTI)

??Direct contact membrane distillation (DCMD) was investigated for its performance abilities and capability to concentrate aqueous solutions with high solid contents at low temperatures. The (more)

Bui, Anh



Nanoscale contact engineering for Si/Silicide nanowire devices.  

E-Print Network (OSTI)

??Metal silicides have been used in silicon technology as contacts to achieve high device performance and desired device functions. The growth and applications of silicide (more)

Lin, Yung-Chen



Contacts for Geospatial Science Program | Department of Energy  

Energy Savers (EERE)

Geospatial Science Program Contacts for Geospatial Science Program LeAnn Oliver Associate Chief Information Officer for IT Policy and Governance US Department of Energy...


Bureau of Indian Affairs Contact Information Website | Open Energy...  

Open Energy Info (EERE)

Information Website Jump to: navigation, search OpenEI Reference LibraryAdd to library Web Site: Bureau of Indian Affairs Contact Information Website Abstract This website...


Contact glow discharge electrolysis for liquid waste processing  

E-Print Network (OSTI)

for an alka- line water electrolysis at a small pin verticaldischarge electrolysis applied to waste water treatment.water treatment induced by plasma with contact glow discharge electrolysis.

Sharma, Neeraj



Commercialization of Anaerobic Contact Process for Anaerobic Digestion of Algae.  

E-Print Network (OSTI)

??The commercialization of anaerobic contact process for the digestion of algal biomass has been shown to be feasible on a technical and economic basis. The (more)

Andlay, Gunjan



Contact - Center for Solar and Thermal Energy Conversion  

NLE Websites -- All DOE Office Websites (Extended Search)

Contact Prof. Peter Green, CSTEC Director Research Group Leader for Thrust 3 - Energy transport in organic and hybrid systems Materials Science & Engineering Dept. H H Dow...


Registered_Lobbyist_Contact_Disclosure_Form.pdf | Department...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

egisteredLobbyistContactDisclosureForm.pdf More Documents & Publications Lobbyist Disclosure Form - AltEn Interested Parties - Shipp Interested Parties - Smith Dawson & Andrews...


Property:RAPID/Contact/ID3/Position | Open Energy Information  

Open Energy Info (EERE)

of Texas + Drilling and Well Development + T Texas Commission on Environmental Quality + Air Quality Permitting Contact - Construction Permitting + U Utah Department of...


Thermal resistance of contact with oxidized metal surfaces  

Science Journals Connector (OSTI)

A model of an elementary heat channel is analyzed which simulates the ... is derived which describes the increment of contact resistance due to the presence of an oxide...

V. M. Popov; A. I. Krasnoborod'ko



Ohmic contacts for high-temperature GaP devices  

E-Print Network (OSTI)

REMOVAL 10 13 24 24 26 50 50 52 78 80 83 98 98 99 100 TABLE OF CONTENTS (Continued) APPENDIX D ? 6 LIFT-OFF PREMETAL PREPARATION APPENDIX D ? 7 METAL LIFTOFF Page 100 100 vi LIST OP TABLES Table I Relative High Temperature... with a variety of III-V compound semi- conductors and contact metals. By using a ruby or a COe laser with Au-Sn or Ag-Sn contact metals, specific contact resistances as low as 8. 6 x 19 " 0-cm were reported. (The specific contact resistance...

Van der Hoeven, Willem Bernard



The Exoplanet Orbit Database II: Updates to exoplanets.org  

E-Print Network (OSTI)

The Exoplanet Orbit Database (EOD) compiles orbital, transit, host star, and other parameters of robustly detected exoplanets reported in the peer-reviewed literature. The EOD can be navigated through the Exoplanet Data Explorer (EDE) Plotter and Table, available on the World Wide Web at exoplanets.org. The EOD contains data for 1492 confirmed exoplanets as of July 2014. The EOD descends from a table in Butler et al. (2002) and the Catalog of Nearby Exoplanets (Butler et al. 2006), and the first complete documentation for the EOD and the EDE was presented in Wright et al. (2011). In this work, we describe our work since then. We have expanded the scope of the EOD to include secondary eclipse parameters, asymmetric uncertainties, and expanded the EDE to include the sample of over 3000 Kepler Objects of Interest (KOIs), and other real planets without good orbital parameters (such as many of those detected by microlensing and imaging). Users can download the latest version of the entire EOD as a single comma sep...

Han, Eunkyu; Wright, Jason T; Feng, Y Katherina; Zhao, Ming; Brown, Jacob I; Hancock, Colin


Note: This page contains sample records for the topic "apel org contact" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Contact lines for fluid surface adhesion  

E-Print Network (OSTI)

When a fluid surface adheres to a substrate, the location of the contact line adjusts in order to minimize the overall energy. This adhesion balance implies boundary conditions which depend on the characteristic surface deformation energies. We develop a general geometrical framework within which these conditions can be systematically derived. We treat both adhesion to a rigid substrate as well as adhesion between two fluid surfaces, and illustrate our general results for several important Hamiltonians involving both curvature and curvature gradients. Some of these have previously been studied using very different techniques, others are to our knowledge new. What becomes clear in our approach is that, except for capillary phenomena, these boundary conditions are not the manifestation of a local force balance, even if the concept of surface stress is properly generalized. Hamiltonians containing higher order surface derivatives are not just sensitive to boundary translations but also notice changes in slope or even curvature. Both the necessity and the functional form of the corresponding additional contributions follow readily from our treatment.

Markus Deserno; Martin M. Mueller; Jemal Guven



Things to Do in Santa Cruz and the Area Wine tasting: http://www.santacruzca.org/things/wine-tasting.php?page=1#tpsearch  

E-Print Network (OSTI)

Things to Do in Santa Cruz and the Area Wine tasting: http://www.santacruzca.org/things/wine-tasting.php: http://www.santacruzca.org/things/parks.php Stand Up Paddling at the Harbor: www Giants, San Francisco Giants, Oakland A's Beaches in and around Santa Cruz: http://www.santacruzca.org/things/best-beaches.php

California at Santa Cruz, University of


COST ACTON A22: Exploring New Ways to Explore the Future www.costa22.org COST Action A22  

E-Print Network (OSTI)

COST ACTON A22: Exploring New Ways to Explore the Future www.costa22.org COST Action A22 Exploring Development, Brussels, 19 September, 2005 Kristian Borch (Coordinator) & Ted Fuller (Chair) #12;COST ACTON A22;COST ACTON A22: Exploring New Ways to Explore the Future www.costa22.org United Kingdom 06/08/2003Malta


http://www.jstor.org Male and Female Pollination Success in a Deceptive Orchid, a Selection Study  

E-Print Network (OSTI)

http://www.jstor.org Male and Female Pollination Success in a Deceptive Orchid, a Selection Study/08/2008 12:49 Your use of the JSTOR archive indicates your acceptance of JSTOR's Terms and Conditions of Use, available at http://www.jstor.org/page/info/about/policies/terms.jsp. JSTOR's Terms and Conditions of Use

Johnston, Mark


A RESTful API for exchanging materials data in the AFLOWLIB.org Richard H. Taylor a,b  

E-Print Network (OSTI)

A RESTful API for exchanging materials data in the AFLOWLIB.org consortium Richard H. Taylor a (API) following REST principles is introduced for the AFLOWLIB.org materials data repositories through a RESTful API and a python library enabling ad hoc applications [17]. Other examples of online

Curtarolo, Stefano


www.biosciencemag.org January 2011 / Vol. 61 No. 1 BioScience 19 Energetic Limits to Economic Growth  

E-Print Network (OSTI)

. We demonstrate a positive scaling relationship between per capita energy use and per capita gross status and ecological impact are correlated with energy use and GDP. We estimate global energy.iea.org/stats/index.asp) and World Resources Institute (WRI; http://earthtrends.wri.org/index.php).Per capita energy consumption

Brown, James H.


A Drucker-Prager model for elastic contact with friction; A Drucker-Prager model for elastic contact with friction.  

E-Print Network (OSTI)

?? In mumerical contact simulations with friction, the simple Coloumb law is usually employed. Standard plasticity models are difficult to use since the balance enforced (more)

wu, yunxian



Language barrier broken with Multilingual WorldWideScience.org BETA | OSTI,  

Office of Scientific and Technical Information (OSTI)

Language barrier broken with Multilingual WorldWideScience.org BETA Language barrier broken with Multilingual WorldWideScience.org BETA Multilingual WordWideScience Officials at the June 11 launch of Multilingual WorldWideScience.org BETA at the International Council for Scientific and Technical Information (ICSTI) annual conference held in Helsinki, Finland. Pictured, from left, Dr. Walter Warnick, U.S. Department of Energy Office of Scientific and Technical Information (OSTI) Director; Yuri Arskiy, All-Russian Institute of Scientific and Technical Information (VINITI) Director; Tony Hey, Microsoft Research Corporate Vice-President; Richard Boulderstone of the British Library and the WorldWideScience Alliance Chairman; and Wu Yishan, Institute of Scientific and Technical Information of China (ISTIC) Chief Engineer OSTI Homepage


OpenEI.org: A wealth of renewable energy info at your fingertips | OpenEI  

Open Energy Info (EERE)

OpenEI.org: A wealth of renewable energy info at your fingertips OpenEI.org: A wealth of renewable energy info at your fingertips Home > Groups > OpenEI Community Central Graham7781's picture Submitted by Graham7781(1992) Super contributor 15 November, 2010 - 08:46 imported OpenEI Are you looking for information on how to make your home more energy efficient? Want to know what types of government incentives are available in your state if you utilize wind energy to power your business? Or maybe you're an analyst looking for up-to-date data on ARRA-funded geothermal projects in your technology sector. Whether you're a consumer, business owner, analyst or researcher, OpenEI.org puts a wealth of information on renewable energy at your fingertips. And it's all free. OpenEI was created in response to the White House's Open Government


Simulations with Sliding and Intermittent Contact Matthew P. Kelly  

E-Print Network (OSTI)

touching 1four contact points causes difficulties even for a single die in isolation... 2Some algorithms with discrete transitions (collision, lift-off...). Simulation of hybrid systems can be tricky, and this report to simulate a system of 10 dice being thrown. Each die can contact the ground at either one, two, or four

Ruina, Andy L.


Hole Selective MoOx Contact for Silicon Solar Cells  

Science Journals Connector (OSTI)

Hole Selective MoOx Contact for Silicon Solar Cells ... This work has important implications toward enabling a novel class of junctionless devices with applications for solar cells, light-emitting diodes, photodetectors, and transistors. ... Junctionless solar cells; silicon photovoltaics; heterojunctions; dopant-free contact; molybdenum trioxide ...

Corsin Battaglia; Xingtian Yin; Maxwell Zheng; Ian D. Sharp; Teresa Chen; Stephen McDonnell; Angelica Azcatl; Carlo Carraro; Biwu Ma; Roya Maboudian; Robert. M. Wallace; Ali Javey



Energy-efficient Contact Probing in Opportunistic Mobile Networks  

E-Print Network (OSTI)

a trade-off between energy efficiency and the contact opportunities in OppNets. In this paper, in order proposed model. Finally, based on the proposed model, we analyze the trade- off between energy efficiency to a trade-off between energy efficiency and contact opportunities. For strategies which use a constant

Wu, Jie


Lattice Boltzmann simulations of contact line motion on uniform surfaces  

Science Journals Connector (OSTI)

Lattice Boltzmann simulations of three-dimensional drops spreading on a uniform solid surface will be discussed. It will be shown that, if the liquid-liquid interface is sufficiently thick, the contact line velocities obtained from the simulations agree ... Keywords: contact line motion, lattice Boltzmann method, wedge solution

Xinli Jia; J. B. McLaughlin; K. Kontomaris



Contact Information: Jeff Williams, MLIS phone (858) 822-2218  

E-Print Network (OSTI)

Contact Information: Jeff Williams, MLIS phone (858) 822-2218 Biology Librarian fax (858) 822-2219 UCSD Biomedical Library j12williams@ucsd.edu Life Sciences Newsletter UCSD Biomedical Library Fall 2004 contact me at (858) 822-2218 or j12williams@ucsd.edu Top Biology Resources ­ http

California at San Diego, University of



E-Print Network (OSTI)

RELATIVISTIC HEAVY-ION PHYSICS WITHOUT NUCLEAR CONTACT The large electromagnetic field generated physics research--for example, for investigating nuclear structure, hadronic structure, atomic physics Berkeley Laboratory--it became clear that heavy-ion physics without nuclear contact could be very useful

Bertulani, Carlos A. - Department of Physics and Astronomy, Texas A&M University


Bounds on the electrical resistance between contacting elastic rough bodies  

Science Journals Connector (OSTI)

...conductance for the rough contact problem...be restricted to a set of microscopic `actual...comprises an in nite set of highly clustered...of indentation of a rough surface. These bounds...Consequences for fractal rough surfaces The bounds...comprises an in nite set of point contacts...



The Role of Contacts in Molecular Electronics Gianaurelio Cuniberti1  

E-Print Network (OSTI)

will integrate the elementary functions and interconnections required for computation [2]. Indeed, the primary of the wire can be correctly attributed and studied. They must also be low in resistance This chapter is based of the support with the electrical contacts is often much greater than that between the electrical contacts

Cuniberti, Gianaurelio


Data System Sciences & Engineering Group - Contact Us  

NLE Websites -- All DOE Office Websites (Extended Search)

Contact Us Contact Us If you have any questions or comments regarding any of our research and development activities, how to work with the Data Systems Sciences & Engineering Group, or the content of this website, please contact: Robert R. Burleson Richard M. Lusk Group Leader, Data Systems Sciences & Engineering Group Computational Sciences and Engineering Division Oak Ridge National Laboratory P.O. Box 2008, MS-6085 Oak Ridge, Tennessee 37831-6085 Office: (865) 574-8864 E-mail: luskrm@ornl.gov If you need to contact individuals in the Group or need general information, contact: Rochelle Coats Data Systems Sciences & Engineering Group Secretary, Computational Sciences and Engineering Division Oak Ridge National Laboratory P.O. Box 2008, MS-6085 Oak Ridge, Tennessee 37831-6085


Project Management Coordination Office Contacts | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Coordination Office Contacts Coordination Office Contacts Project Management Coordination Office Contacts A complete list of Project Management Coordination Office points of contact can be found below. The best way to contact PMCO is by sending an email to PMCO@ee.doe.gov. PMCO is a small but nimble group that interacts with a variety of internal and external organizations. Their work includes analyzing current program efforts and the performance of PMCO's management support. Project Performance and Evaluation Methodology and Competency Management Audit Resolution Organization Chart See the Program Management Coordination Office organization chart. Name Phone Email Aguilar, Phaedra (on Detail) 202-287-5924 phaedra.aguilar@ee.doe.gov Baker, Jeff Deputy Director Desk: 720-356-1434


Contacts for NEPA Policy and Compliance | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Us » Contact Us » Contacts for NEPA Policy and Compliance Us » Contact Us » Contacts for NEPA Policy and Compliance Contacts for NEPA Policy and Compliance Carol Borgstrom, Director 202-586-4600 carol.borgstrom@hq.doe.gov Lettie Wormley, Secretary 202-586-4610 lettie.wormley@hq.doe.gov Eric Cohen, Supervisory Environmental Protection Specialist 202-586-7684 eric.cohen@hq.doe.gov Brian Costner, Supervisory Environmental Protection Specialist 202-586-9924 brian.costner@hq.doe.gov James (Jim) Daniel, Supervisory Environmental Protection Specialist 202-586-9760 daniel.james@hq.doe.gov Ralph Barr, Environmental Protection Specialist 202-586-3448 ralph.barr@hq.doe.gov Vivian Bowie, Environmental Protection Specialist 202-586-1771 vivian.bowie@hq.doe.gov Connie Chen, Environmental Protection Specialist 202-586-0733 connie.chen@hq.doe.gov

Note: This page contains sample records for the topic "apel org contact" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


LEDSGP/Transportation Toolkit/Contact Us | Open Energy Information  

Open Energy Info (EERE)

LEDSGP/Transportation Toolkit/Contact Us LEDSGP/Transportation Toolkit/Contact Us < LEDSGP‎ | Transportation Toolkit(Redirected from Transportation Toolkit/Contact Us) Jump to: navigation, search LEDSGP Logo.png Transportation Toolkit Home Tools Training Contacts Contacts for the LEDS GP Transport Working Group The Transportation Toolkit is provided by the Transport Working Group as part of the Low Emission Development Strategies (LEDS) Global Partnership. If you have questions or comments about this toolkit, . Remote Expert Assistance on LEDS The LEDS Global Partnership provides timely, high-quality, no-fee technical assistance on transportation issues as part of the Remote Expert Assistance on LEDS (REAL) service. Experts from institutions around the world are available to provide objective advice, conduct reviews and brief


Contacting nanowires and nanotubes with atomic precision for electronic transport  

SciTech Connect

Making contacts to nanostructures with atomic precision is an important process in the bottom-up fabrication and characterization of electronic nanodevices. Existing contacting techniques use top-down lithography and chemical etching, but lack atomic precision and introduce the possibility of contamination. Here, we report that a field-induced emission process can be used to make local contacts onto individual nanowires and nanotubes with atomic spatial precision. The gold nano-islands are deposited onto nanostructures precisely by using a scanning tunneling microscope tip, which provides a clean and controllable method to ensure both electrically conductive and mechanically reliable contacts. To demonstrate the wide applicability of the technique, nano-contacts are fabricated on silicide atomic wires, carbon nanotubes, and copper nanowires. The electrical transport measurements are performed in situ by utilizing the nanocontacts to bridge the nanostructures to the transport probes.

Qin, Shengyong [ORNL; Hellstrom, Sondra L [ORNL; Bao, Zhenan [ORNL; Boyanov, Boyan [Intel Corporation; Li, An-Ping [ORNL



Contact angles in the pseudopotential lattice Boltzmann modeling of wetting  

E-Print Network (OSTI)

In this paper, we aim to investigate the implementation of contact angles in the pseudopotential lattice Boltzmann modeling of wetting at a large density ratio. The pseudopotential lattice Boltzmann model [X. Shan and H. Chen, Phys. Rev. E 49, 2941 (1994)] is a popular mesoscopic model for simulating multiphase flows and interfacial dynamics. In this model, the contact angle is usually realized by a fluid-solid interaction. Two widely used fluid-solid interactions: the density-based interaction and the pseudopotential-based interaction, as well as a modified pseudopotential-based interaction formulated in the present paper, are numerically investigated and compared in terms of the achievable contact angles, the maximum and the minimum densities, and the spurious currents. It is found that the pseudopotential-based interaction works well for simulating small static (liquid) contact angles, however, is unable to reproduce static contact angles close to 180 degrees. Meanwhile, it is found that the proposed modif...

Li, Q; Kang, Q J; Chen, Q



Method of forming contacts for a back-contact solar cell  

DOE Patents (OSTI)

Methods of forming contacts for solar cells are described. In one embodiment, a method includes forming a silicon layer above a substrate, forming and patterning a solid-state p-type dopant source on the silicon layer, forming an n-type dopant source layer over exposed regions of the silicon layer and over a plurality of regions of the solid-state p-type dopant source, and heating the substrate to provide a plurality of n-type doped silicon regions among a plurality of p-type doped silicon regions.

Manning, Jane



Method and apparatus for high-efficiency direct contact condensation  

DOE Patents (OSTI)

A direct contact condenser having a downward vapor flow chamber and an upward vapor flow chamber, wherein each of the vapor flow chambers includes a plurality of cooling liquid supplying pipes and a vapor-liquid contact medium disposed thereunder to facilitate contact and direct heat exchange between the vapor and cooling liquid. The contact medium includes a plurality of sheets arranged to form vertical interleaved channels or passageways for the vapor and cooling liquid streams. The upward vapor flow chamber also includes a second set of cooling liquid supplying pipes disposed beneath the vapor-liquid contact medium which operate intermittently in response to a pressure differential within the upward vapor flow chamber. The condenser further includes separate wells for collecting condensate and cooling liquid from each of the vapor flow chambers. In alternate embodiments, the condenser includes a cross-current flow chamber and an upward flow chamber, a plurality of upward flow chambers, or a single upward flow chamber. The method of use of the direct contact condenser of this invention includes passing a vapor stream sequentially through the downward and upward vapor flow chambers, where the vapor is condensed as a result of heat exchange with the cooling liquid in the contact medium. The concentration of noncondensable gases in the resulting condensate-liquid mixtures can be minimized by controlling the partial pressure of the vapor, which depends in part upon the geometry of the vapor-liquid contact medium. In another aspect of this invention, the physical and chemical performance of a direct contact condenser can be predicted based on the vapor and coolant compositions, the condensation conditions. and the geometric properties of the contact medium.

Bharathan, Desikan (Lakewood, CO); Parent, Yves (Golden, CO); Hassani, A. Vahab (Golden, CO)



Method and apparatus for high-efficiency direct contact condensation  

DOE Patents (OSTI)

A direct contact condenser having a downward vapor flow chamber and an upward vapor flow chamber, wherein each of the vapor flow chambers includes a plurality of cooling liquid supplying pipes and a vapor-liquid contact medium disposed thereunder to facilitate contact and direct heat exchange between the vapor and cooling liquid. The contact medium includes a plurality of sheets arranged to form vertical interleaved channels or passageways for the vapor and cooling liquid streams. The upward vapor flow chamber also includes a second set of cooling liquid supplying pipes disposed beneath the vapor-liquid contact medium which operate intermittently in response to a pressure differential within the upward vapor flow chamber. The condenser further includes separate wells for collecting condensate and cooling liquid from each of the vapor flow chambers. In alternate embodiments, the condenser includes a cross-current flow chamber and an upward flow chamber, a plurality of upward flow chambers, or a single upward flow chamber. The method of use of the direct contact condenser of this invention includes passing a vapor stream sequentially through the downward and upward vapor flow chambers, where the vapor is condensed as a result of heat exchange with the cooling liquid in the contact medium. The concentration of noncondensable gases in the resulting condensate-liquid mixtures can be minimized by controlling the partial pressure of the vapor, which depends in part upon the geometry of the vapor-liquid contact medium. In another aspect of this invention, the physical and chemical performance of a direct contact condenser can be predicted based on the vapor and coolant compositions, the condensation conditions, and the geometric properties of the contact medium. 39 figs.

Bharathan, D.; Parent, Y.; Hassani, A.V.



Contact Resistance for "End-Contacted" Metal-Graphene and Metal-Nanotube Interfaces from Quantum Mechanics  

E-Print Network (OSTI)

ballistic conductance,12-14 and high thermal conductivity.15 Indeed, significant progress has been made layer graphene has been demonstrated to exhibit high electron mobility (15 000 cm2 /(V s)) and thermalContact Resistance for "End-Contacted" Metal-Graphene and Metal-Nanotube Interfaces from Quantum

Goddard III, William A.


Analysis of a-Si:H/TCO contact resistance for the Si heterojunction back-contact solar cell  

E-Print Network (OSTI)

Analysis of a-Si:H/TCO contact resistance for the Si heterojunction back-contact solar cell Seung- circuit voltage (Voc) and the conversion efficiency of the Si solar cell. Recently, a-Si:H heterojunction (heterojunction with intrinsic thin layer) cell [1] even with practical-sized Czochralski-grown (CZ) wafer. The a-Si:H

Park, Byungwoo


ESG: Extended Similarity Group method for protein function prediction For any questions regarding ESG contact the administration at info@kiharalab.org  

E-Print Network (OSTI)

box titled "Enter Query Sequence(s)". Consider the following sequence that you can enter. >sp|P56851 KDKSSHMFIYISWYKIEHICTSDNWMDRFRNAYVWVQNPLKVLKCHQENSKNSYTESRSF NYIEFHCSMDGYVDSIEDLKMVEPIGN You can also click on "Load Sample" link to load this sequence in the text box and follow the next steps. Clicking on "Clear" link will clear the text box for sequence

Kihara, Daisuke


AAAS/Science | 1200 New York Avenue, NW | Washington, DC 20005 | USA | +1-202-326-6730 | scienceonline@aaas.org FOR IMMEDIATE RELEASE CONTACT: Natasha Pinol  

E-Print Network (OSTI)

AAAS/Science | 1200 New York Avenue, NW | Washington, DC 20005 | USA | +1 Care Professionals in the UK Receive One-Year Trial Access to Science Translational Medicine and Science Signaling Washington, D.C., 1 May 2014--The American Association for the Advancement of Science

Napp, Nils


NNSA Points of Contact | National Nuclear Security Administration  

National Nuclear Security Administration (NNSA)

Points of Contact | National Nuclear Security Administration Points of Contact | National Nuclear Security Administration Our Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy Emergency Response Recapitalizing Our Infrastructure Continuing Management Reform Countering Nuclear Terrorism About Us Our Programs Our History Who We Are Our Leadership Our Locations Budget Our Operations Media Room Congressional Testimony Fact Sheets Newsletters Press Releases Speeches Events Social Media Video Gallery Photo Gallery NNSA Archive Federal Employment Apply for Our Jobs Our Jobs Working at NNSA Blog The National Nuclear Security Administration NNSA Points of Contact Home > About Us > Our Operations > Acquisition and Project Management > Major Contract Solicitations > Environmental Program Services Contract >


The hierarchical properties of contact networks in granular packings  

E-Print Network (OSTI)

The topological structure resulting from the network of contacts between grains (contact network) is studied for very large samples of disorderly-packed monosized spheres with densities ranging from 0.58 to 0.64. The hierarchical organization of such a structure is studied by means of a topological map which starts from a given sphere and moves outwards in concentric shells through the contact network. We find that the topological density of disordered sphere packing is larger than the topological density of equivalent lattice sphere packings.

T. Aste; T. J. Senden



www.cost.esf.org European Cooperation in Science and Technology  

E-Print Network (OSTI)

www.cost.esf.org European Cooperation in Science and Technology COST is supported by the EU RTD Framework Programme ESF provides the COST Office through an EC contract COSTCOST ­­ a flexible researchDr Martin Grabert COST Office, BrusselsCOST Office, Brussels #12;COST is supported by the EU RTD Framework

De Cindio, Fiorella


NETWORKS AND HETEROGENEOUS MEDIA Website: http://aimSciences.org c American Institute of Mathematical Sciences  

E-Print Network (OSTI)

NETWORKS AND HETEROGENEOUS MEDIA Website: http://aimSciences.org c American Institute. Only a local micro-phase separation occurs: micro-domains rich in A and B emerge. These micro-monomers appear. This phenomenon is known as micro-phase separation. For a further analysis of the scaling

Niethammer, Barbara


correspondence n engl j med 363;16 nejm.org october 14, 2010 1583  

E-Print Network (OSTI)

correspondence n engl j med 363;16 nejm.org october 14, 2010 1583 blood pressureTrials.gov number, NCT00608049). Frank M. Sacks, M.D. Hannia Campos, Ph.D. Harvard School of Public Health Boston potential conflict of interest. 1. Reducing salt intake in populations: report of a WHO forum and technical

Paris-Sud XI, Université de


LASER & PHOTONICS www.lpr-journal.org Vol. 7 No. 5 September 2013  

E-Print Network (OSTI)

LASER & PHOTONICS REVIEWS www.lpr-journal.org Vol. 7 No. 5 September 2013 4H-SiC: a new nonlinear material for midinfrared lasers Nonlinear optical (NLO) frequency conversion is commonly used for generating midinfrared (MIR) lasers that offer light sources for a variety of applications. However, the low

Wang, Wei Hua


nwcouncil.org > SPRING 2011 > PAGE 16 Wind power continues to make strides as  

E-Print Network (OSTI)

nwcouncil.org > SPRING 2011 > PAGE 16 Wind power continues to make strides as part of the Pacific Northwest's power supply. Just how fast has wind power grown in the last five years? Here are the numbers 10 percent of total supply That's a lot of new wind power developed in a short timeframe, which has


14 January 2011 / Vol. 61 No. 1 www.biosciencemag.org Easing the Transition  

E-Print Network (OSTI)

14 January 2011 / Vol. 61 No. 1 www.biosciencemag.org Feature Easing the Transition AMY of a major professional transition, each an example of how fundamental the post- doc period has become.1525/bio.2011.61.1.5 A lab leadership and management conference helped Brent Stockwell, pictured in his lab


www.bluesci.orgIssue 14 Lent 2009 Randomness . Electronic Paper . Huntington's Disease  

E-Print Network (OSTI)

.bluesci.org · Artificial Intelligence · Obesity · · Women In Science · Genetic Counselling · New Parts For Old The future · · Time Truck · Gaia · Pharmacogenomics · The Energy Crisis What are our options? in association with

Cambridge, University of


http://www.jstor.org Chemical Ions Affect Survival of Avian Cholera Organisms in Pondwater  

E-Print Network (OSTI)

http://www.jstor.org Chemical Ions Affect Survival of Avian Cholera Organisms in Pondwater Author their work and the materials they rely upon, and to build a common research platform that promotes whether chemical ions affected survival of avian choleraorganismsin water collected from the Nebraska

Yandell, Brian S.

Note: This page contains sample records for the topic "apel org contact" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Wi$eUp Money Basicswww.wiseupwomen.org 3-1 Chapter 3. Money Basics  

E-Print Network (OSTI)

Wi$eUp ­ Money Basicswww.wiseupwomen.org 3-1 Chapter 3. Money Basics Tools and Habits for Achieving Your Goals In the previous chapter, Money Math, you learned how to prepare a Statement of Financial and financial security, financial author Jean Chatzsky1 found that good money control is a matter of cultivating


Wi$eUp Money Mathwww.wiseupwomen.org 2-1 Chapter 2. Money Math  

E-Print Network (OSTI)

Wi$eUp ­ Money Mathwww.wiseupwomen.org 2-1 Chapter 2. Money Math Good, solid financial planning is based on facts ­ money facts. If financial planning is the roadmap, then money facts are its building a clear path to your future. That will involve fact gathering and some money math. This chapter will help


Copyright 2013, National Environmental Health Association (www.neha.org) Environmental Health  

E-Print Network (OSTI)

nearby residents about the health and nuisance implications of these facilities. See page 8. CoverCopyright 2013, National Environmental Health Association (www.neha.org) JOURNAL OF Environmental Health Dedicated to the advancement of the environmental health professional Volume 75, No. 9 May 2013


Copyright 2012, National Environmental Health Association (www.neha.org) Environmental Health  

E-Print Network (OSTI)

Copyright 2012, National Environmental Health Association (www.neha.org) JOURNAL OF Environmental Health Dedicated to the advancement of the environmental health professional Volume 74, No. 9 May 2012 cover feature this month, "Bacterial Amplification and In-Place Carpet Drying: Implications for Category


28 NOVEMBER 2008 VOL 322 SCIENCE www.sciencemag.org1324 CREDIT:NASA/JPL  

E-Print Network (OSTI)

28 NOVEMBER 2008 VOL 322 SCIENCE www.sciencemag.org1324 CREDIT:NASA/JPL LETTERS I BOOKS I POLICY The Price of Exploration NASA IS IN THE FINAL THROES OF IMPLEMENTING THE MOST POWERFUL SURFACE RECON- naissance mission ever undertaken to Mars. Dubbed the Mars Science Laboratory (MSL), it represents NASA

Li, Xin


238 Org. Synth. 2008, 85, 238-247 Published on the Web 6/11/08  

E-Print Network (OSTI)

238 Org. Synth. 2008, 85, 238-247 Published on the Web 6/11/08 (R)-2,2'-BINAPHTHOYL-(S,S)-DI(1 results in the solution becoming dark pink. A solution of (R)-(-)-1,1'-binaphthyl-2

RajanBabu, T. V. "Babu"


288 Org. Synth. 2010, 87, 288-298 Published on the Web 5/13/2010  

E-Print Network (OSTI)

288 Org. Synth. 2010, 87, 288-298 Published on the Web 5/13/2010 SAFE AND SCALABLE PREPARATION 8) under suction (15 mmHg), and the dark red filtrate is collected directly in a 1-L, 1- necked

Davis, Ben G.


HARVARD UNIVERSITY VENDOR JUSTIFICATION/PRICE VERIFICATION FORM TUB AND ORG NAME: ___________________________ACCT.CODE:________________________________________________________DATE:_______  

E-Print Network (OSTI)

HARVARD UNIVERSITY VENDOR JUSTIFICATION/PRICE VERIFICATION FORM TUB AND ORG NAME (please check one) The Federal Government requires vendor selection justification and price verification, blanket orders) complete Section B and Section C. GGRRAANNTTSS $2,500-$9,999 OMB A-110 requires price

Heller, Eric


29 JANUARY 2010 VOL 327 SCIENCE www.sciencemag.org514 NEWS OF THE WEEK  

E-Print Network (OSTI)

for nuclear fusion experi- ments at Lawrence Livermore National Laboratory in Califor- nia, have been gingerly with CERN's setbacks in mind, those in charge of the National Ignition Facility (NIF), a huge laser published online this week by Science (www. sciencemag.org/cgi/content/ abstract/1185634), NIF researchers


THEORY OF COMPUTING, Volume 2 (2006), pp. 207224 http://theoryofcomputing.org  

E-Print Network (OSTI)

metric into 1 Moses Charikar Robert Krauthgamer Received: December 8, 2005; revised: September 18, 2006 copyright statement, see http://theoryofcomputing.org/copyright.html. c 2006 Moses Charikar and Robert offers a much better model (up to minor variations such as weighting). Let ED(x,y) denote the edit

Håstad, Johan


THEORY OF COMPUTING, Volume 2 (2006), pp. 207--224 http://theoryofcomputing.org  

E-Print Network (OSTI)

metric into # 1 Moses Charikar # Robert Krauthgamer Received: December 8, 2005; revised: September 18://theoryofcomputing.org/copyright.html. c # 2006 Moses Charikar and Robert Krauthgamer DOI: 10.4086/toc.2006.v002a011 #12; M. CHARIKAR AND R such as weighting). Let ED(x,y) denote the edit distance between strings x and y. Fixing an alphabet S, the edit

Håstad, Johan


The Workshop on Active Internet Measurements (AIMS) kc@caida.org  

E-Print Network (OSTI)

The Workshop on Active Internet Measurements (AIMS) Report kc claffy CAIDA kc@caida.org Marina Internet is a perpetually challenging task for technical, economic and policy reasons, which leaves empirical grounding. On February 12-13, 2009, CAIDA hosted the Workshop on Ac- tive Internet Measurements

California at San Diego, University of


http://royalsociety.org/news.asp?id=8827 Latest press releases  

E-Print Network (OSTI)

to science that improves crops and sustainable crop management must be a Government priority. This would see in the report include: - Short-term (less than 8 years): New approaches to crop management including modifiedhttp://royalsociety.org/news.asp?id=8827 Latest press releases £2 billion needed for science 'Grand

Utrecht, Universiteit


22th International Meeting on org. geochem. The fate of organic matter in mangrove sediments  

E-Print Network (OSTI)

22th International Meeting on org. geochem. The fate of organic matter in mangrove sediments and the unvegetated sediments, and various vascular plants specific to these swamps. An elemental, pyrolytic sediments characterised by great changes in the redox conditions. Several specific results have already been

Boyer, Edmond


14 IAEI NEWS July . August 2012 www.iaei.org the conductors  

E-Print Network (OSTI)

14 IAEI NEWS July . August 2012 www.iaei.org the conductors The Conductors, Getting Solar Energy be generating energy for 40­50 years after installation. While power production may not be what it was when conditions of New Mexico for more 30 years without obvious signs of deterioration. PV Cable/PV Wire PV

Johnson, Eric E.


The Neutron Scattering Society of America http:///www.neutronscattering.org  

E-Print Network (OSTI)

The Neutron Scattering Society of America http:///www.neutronscattering.org Page 8 of 9 Dr. Claire of the Neutron Scattering Society of America (NSSA) with the citation "For pioneering a new methodology and computational chemistry" The Neutron Scattering Society of America (NSSA) established the Prize for Outstanding


http://www.jstor.org Antiminority Riots in Unified Germany: Cultural Conflicts and Mischanneled Political  

E-Print Network (OSTI)

Political Participation Author(s): Roger Karapin Source: Comparative Politics, Vol. 34, No. 2, (Jan., 2002), pp. 147-167 Published by: Ph.D. Program in Political Science of the City University of New York@jstor.org. #12;Antiminority Riots in Unified Germany CulturalConflictsandMischanneledPoliticalParticipation Roger

Qiu, Weigang


Transportation Cost and Benefit Analysis Congestion Costs Victoria Transport Policy Institute (www.vtpi.org)  

E-Print Network (OSTI)

Transportation Cost and Benefit Analysis ­ Congestion Costs Victoria Transport Policy Institute (www.vtpi.org) Page 5.5-1 5.5 Congestion This chapter examines traffic congestion costs, that is, delay that affect congestion, various estimates of congestion costs, and the benefits of congestion reductions

O'Donnell, Tom


5 SEPTEMBER 2014 VOL 345 ISSUE 6201 1195SCIENCE sciencemag.org/products LIFE SCIENCE TECHNOLOGIES  

E-Print Network (OSTI)

5 SEPTEMBER 2014 � VOL 345 ISSUE 6201 1195SCIENCE sciencemag.org/products LIFE SCIENCE TECHNOLOGIES NEW PRODUCTS: SAMPLE PREP Produced by the Science/AAAS Custom Publishing Office NGS Library Prep MagSi-NGSPREP is a magnetic, bead- based tool that offers an efficient solution for DNA cleanup and size selection in next

Napp, Nils


www.osa-opn.org Jingyun Fan, Alan Migdall and Lijun Wang  

E-Print Network (OSTI)

;www.osa-opn.org28 | OPN March 2007 satisfying energy conservation wp = wsignal + widler, and the phase history itself. The two ma- jor methods for doing this are steganography, which refers to hiding a message (rarely used in modern times) and cryptography, or the hiding of the meaning of a message. Nowadays

Migdall, Alan