Sample records for apel org contact

  1. Applied Process Engineering Laborotory APEL | Open Energy Information

    Open Energy Info (EERE)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home5b9fcbce19 NoPublic Utilities Address: 160 East 300AlgoilEnergy Information the Army Permit:Films CorporationLaborotory APEL

  2. MEMBERS ONLY | Join | Renew | Shop | About | Contact Us | Home ASME.ORG > News & Public Policy > Press Releases > Research Begun on New Fuel Cell Type

    E-Print Network [OSTI]

    SEARCH ASME: MEMBERS ONLY | Join | Renew | Shop | About | Contact Us | Home ASME.ORG > News, the magazine reports on a fuel cell that cleans domestic wastewater while producing electrical energy. This new, takes the high concentration of organic matter found in wastewater and coverts it to energy. "Where

  3. Contacts

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Contacts Contacts Bradbury Science Museum P.O. Box 1663 Mail Stop C330 Los Alamos National Laboratory Los Alamos, NM 87545 email: web-bsm@lanl.gov PHONE: 505-667-4444 FAX:...

  4. Contacts

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformation InInformationCenterResearchCASLNanoporousTestimonyContact Us - WorkingContactContact

  5. Contacts:

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc DocumentationP-Series to User GroupInformationE-Gov Contacts for E-GovContacts News News Home

  6. Contacts

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation Proposed New SubstationCleanCommunity2Workshops 2008 To1Contact CommunityContact

  7. 2004 Geological Society of America. For permission to copy, contact Copyright Permissions, GSA, or editing@geosociety.org. Geology; October 2004; v. 32; no. 10; p. 925928; doi: 10.1130/G20561.1; 4 figures; Data Repository item 2004149. 925

    E-Print Network [OSTI]

    Pazzaglia, Frank J.

    as far east as the Texas panhandle (Fig. 2), and may have influenced the locus of Neogene extension2004 Geological Society of America. For permission to copy, contact Copyright Permissions, GSA, or editing@geosociety.org. Geology; October 2004; v. 32; no. 10; p. 925­928; doi: 10.1130/G20561.1; 4 figures

  8. 2004 Geological Society of America. For permission to copy, contact Copyright Permissions, GSA, or editing@geosociety.org. Geology; January 2004; v. 32; no. 1; p. 58; DOI 10.1130/G19957.1; 2 figures; Data Repository item 2004001. 5

    E-Print Network [OSTI]

    Asmerom, Yemane

    2004 Geological Society of America. For permission to copy, contact Copyright Permissions, GSA, or editing@geosociety.org. Geology; January 2004; v. 32; no. 1; p. 5­8; DOI 10.1130/G19957.1; 2 figures; Data a speleothem-based ab- solutely dated record (using uranium-series data) of climate change for the southwestern

  9. nanotechweb.org TECHNOLOGY UPDATE

    E-Print Network [OSTI]

    Rogers, John A.

    .jpg) The nanopillars (http://images.iop.org/objects/ntw/news/9/8/5/JRogers.jpg) Vertical arrays of semiconductor to construct using conventional semiconductor wafer technologies. However, researchers need to develop a way to fabricate contact electrodes that can bridge and span the gaps between the nanorods or pillars

  10. Contact us

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Contact us Participate with us Participate Become a Volunteer Share Your Stories Museum Fan Downloads Q&A Blog Contact us invisible utility element Contact us We want to hear from...

  11. Contacts | NREL

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    list of important phone numbers. Contact a Staff Member at NREL Our searchable staff directory has contact information for staff. Questions or Comments? Please use our feedback...

  12. Note: This copy is for your personal, non-commercial use only. To order presentation-ready copies for distribution to your colleagues or clients, contact us at www.rsna.org/rsnarights.

    E-Print Network [OSTI]

    Brenner, David Jonathan

    .J.H.); Department of Radiology, Harvard Medical School, Boston, Mass (S.J.A.); Division of Pediatric Radiology, DukeSPECIALREPORT Radiology: Volume 258: Number 3--March 2011 n radiology.rsna.org 889 Managing Radiation Use in Medical the Department of Radiology, Memorial Sloan- Kettering Cancer Center, 1275 York Ave, Suite C-278, New York, NY (H

  13. Contact Us

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc DocumentationP-Series to User Group andCompositionalInitial ValidationContactContact Us Contact

  14. Contact Us

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc DocumentationP-Series to User Group andCompositionalInitial ValidationContactContact Us Contact

  15. Contact Us

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformation InInformationCenterResearchCASLNanoporousTestimony |IdahoVisionContact InContactContact

  16. Contact Us

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformation InInformationCenterResearchCASLNanoporousTestimony |IdahoVisionContactContact Contact Us

  17. Website Contact

    Broader source: Energy.gov [DOE]

    Contact the website administrator with questions, comments, or issues related to the Federal Energy Management Program website. If your inquiry is in regard to a specific Web page, please include...

  18. Workshop Contacts

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmosphericNuclear SecurityTensile Strain Switched FerromagnetismWaste and MaterialsWenjun1 TableContacts Workshop Contacts Questions?

  19. ARM - Contacts

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformationbudapest Comments? We would love toContact Information Related Links TWP-ICE HomeContacts

  20. WINDExchange: Contacts

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsrucLasDelivered energy consumption byAbout Printable Version Bookmark and Share Contacts

  1. Eyeglass allergic contact dermatitis

    E-Print Network [OSTI]

    Scott, Kimberly; Levender, Michelle M; Feldman, Steven R

    2010-01-01T23:59:59.000Z

    T, Iijima M, Maibach HI. Eyeglass frame allergic contactNakada T, Maibach HI. Eyeglass allergic contact dermatitis.Eyeglass allergic contact dermatitis Kimberly Scott 1 ,

  2. Contact Us

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc DocumentationP-Series to User Group andCompositionalInitial ValidationContact

  3. ARM - Contacts

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformationbudapest Comments? We would love toContact Information Related Links TWP-ICE Home

  4. ARM - Contacts

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformationbudapest Comments? We would love toContact Information Related Links TWP-ICE

  5. LANL Contacts

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformation Desert Southwest Region serviceMission Statement Titan TargetInJupiter Lasertowards|Contacts

  6. Contact Information

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformation InInformationCenterResearchCASLNanoporousTestimony |IdahoVisionContact In

  7. Contact Us

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformation InInformationCenterResearchCASLNanoporousTestimony |IdahoVisionContact

  8. Media Contact Raymond Mathews

    E-Print Network [OSTI]

    Shyu, Mei-Ling

    .284.3535 or lowemuseum.org About the Artist: Paul Stankard (American, born 1943) was born in North Attleboro, MA. He

  9. www.publiclandsday.org Public Lands Program

    E-Print Network [OSTI]

    US Army Corps of Engineers

    awareness of local public lands and issues #12;www.publiclandsday.org Facebook.com - Fan Page http://www.facebook.com/pages/create.php #12;www.publiclandsday.org Facebook Fan Page http://www.facebook.com/pages/create.php #12;www.publiclandsday.org Facebook Fan Page #12;www.publiclandsday.org Facebook Fan Page #12;www.publiclandsday.org Facebook Event

  10. Chemical Management Contacts

    Broader source: Energy.gov [DOE]

    Contacts for additional information on Chemical Management and brief description on Energy Facility Contractors Group

  11. Thermal contact resistance

    E-Print Network [OSTI]

    Mikic, B. B.

    1966-01-01T23:59:59.000Z

    This work deals with phenomena of thermal resistance for metallic surfaces in contact. The main concern of the work is to develop reliable and practical methods for prediction of the thermal contact resistance for various ...

  12. Contacts | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious Rank EERE:YearRound-Up fromDepartmentTieCelebrate Earth CodestheatforContacts Contacts Contact Information

  13. Contacts | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious Rank EERE:YearRound-Up fromDepartmentTieCelebrate Earth CodestheatforContacts Contacts Contact

  14. Federal NEPA Contacts

    Broader source: Energy.gov [DOE]

    CEQ and most Federal agencies identify primary points of contact for NEPA compliance. Normally a senior environmental professional, environmental law attorney, or member of agency leadership, these...

  15. Optical contact micrometer

    SciTech Connect (OSTI)

    Jacobson, Steven D.

    2014-08-19T23:59:59.000Z

    Certain examples provide optical contact micrometers and methods of use. An example optical contact micrometer includes a pair of opposable lenses to receive an object and immobilize the object in a position. The example optical contact micrometer includes a pair of opposable mirrors positioned with respect to the pair of lenses to facilitate viewing of the object through the lenses. The example optical contact micrometer includes a microscope to facilitate viewing of the object through the lenses via the mirrors; and an interferometer to obtain one or more measurements of the object.

  16. Hydrodynamics of air entrainment by moving contact lines T. S. Chan, S. Srivastava, A. Marchand, B. Andreotti, L. Biferale et al.

    E-Print Network [OSTI]

    Snoeijer, Jacco

    Hydrodynamics of air entrainment by moving contact lines T. S. Chan, S. Srivastava, A. Marchand, B://pof.aip.org/about/rights_and_permissions #12;PHYSICS OF FLUIDS 25, 074105 (2013) Hydrodynamics of air entrainment by moving contact lines T. S, as developed here, allows us to study the dependence of the critical capillary number for air entrainment

  17. CancerProgressReport.org // AACR.org // #CancerProgress14 AACR CANCER

    E-Print Network [OSTI]

    Sherman, S. Murray

    CancerProgressReport.org // AACR.org // #CancerProgress14 AACR CANCER PROGRESS REPORT 2014 TRA NSFO RMING LIVES THRO UG H RE SE ARC H #12;CancerProgressReport.org // AACR.org // #CancerProgress14 AACR CANCER PROGRESS REPORT 2014 TRANSFORMING LIVES THROUGH RESEARCH #12;II AACR Cancer Progress Report 2014

  18. Contact Us - Hanford Site

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformation InInformationCenterResearchCASLNanoporousTestimony |IdahoVisionContactContact Contact

  19. Contact | ornl.gov

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation Proposed New SubstationCleanCommunity2Workshops 2008 To1Contact CommunityContact SHARE Contact

  20. Contacts & Resources

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation Proposed New SubstationCleanCommunity2Workshops 2008 To1Contact CommunityContactContacts &

  1. Contact thermal lithography

    E-Print Network [OSTI]

    Schmidt, Aaron Jerome, 1979-

    2004-01-01T23:59:59.000Z

    Contact thermal lithography is a method for fabricating microscale patterns using heat transfer. In contrast to photolithography, where the minimum achievable feature size is proportional to the wavelength of light used ...

  2. Microcontrollers Images: http://en.wikipedia.org/wiki/File:Digital_Multimeter_Aka.jpg, http://en.wikipedia.org/wiki/File:Resistors_color_code.jpg, http://en.wikipedia.org/wiki/File:Lm356.jpg , http://en.wikipedia.org/

    E-Print Network [OSTI]

    Smith, James Andrew

    ://en.wikipedia.org/wiki/File:Digital_Multimeter_Aka.jpg, http://en.wikipedia.org/wiki/File:Resistors_color_code.jpg, http://en.wikipedia.org/wiki/File:Lm356.jpg://en.wikipedia.org/wiki/File:Digital_Multimeter_Aka.jpg, http://en.wikipedia.org/wiki/File:Resistors_color_code.jpg, http://en.wikipedia.org/wiki/File:Lm356.jpg://en.wikipedia.org/wiki/File:Digital_Multimeter_Aka.jpg, http://en.wikipedia.org/wiki/File:Resistors_color_code.jpg, http://en.wikipedia.org/wiki/File:Lm356.jpg

  3. Contact urticaria to raw potato

    E-Print Network [OSTI]

    Lagrn, Z Martnez de; Frutos, FJ Ortiz de; Arribas, M Gonzlez de; Vanaclocha-Sebastin, F

    2009-01-01T23:59:59.000Z

    allergen in latex-induced potato allergy. Ann Allergy Asthmaof allergy to cooked potatoes in children. Allergy 2007;62(contact dermatitis from potato flesh. Contact Dermatitis

  4. Bilevel contact solar cells

    SciTech Connect (OSTI)

    Sinton, R.A.

    1991-10-01T23:59:59.000Z

    This patent describes a solar cell. It comprises a body of semiconductor material having at least one P/N junction therein, the body including a front face having no electrodes thereon, and a bilevel elevation back face having at least one P-doped region at a first level interdigitated with at least one N-doped region at a second level, wherein the at least one P-doped region and the at least one N-doped region partially overlap to form at least one compensated region; and a positive electrode contacting the at lease one P-doped region and a negative electrode contacting the at least one N-doped region, both electrodes contacting the solar cell on the back face.

  5. Contact Us - Hanford Site

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc DocumentationP-Series to User Group andCompositionalInitial ValidationContactContact Us

  6. Contacts | Advanced Photon Source

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc DocumentationP-Series to User GroupInformationE-Gov Contacts for E-Gov LeAnnProjectContacts

  7. Contacts: Tel: Locations: Tel:

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc DocumentationP-Series to User GroupInformationE-Gov Contacts for E-GovContacts News News

  8. Contact JLab | Jefferson Lab

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformation InInformationCenterResearchCASLNanoporousTestimony |IdahoVisionContact InContact Visiting

  9. Contact Us - Pantex Plant

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformation InInformationCenterResearchCASLNanoporousTestimony |IdahoVisionContactContact

  10. Contact Us | EMSL

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformation InInformationCenterResearchCASLNanoporousTestimonyContact Us - Working WithContact Us »

  11. Contact Us | NREL

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformation InInformationCenterResearchCASLNanoporousTestimonyContact Us - Working WithContact Us

  12. Contact: Nathan Howard

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation Proposed New SubstationCleanCommunity2Workshops 2008 To1Contact CommunityContact SHARENathan

  13. Contacts | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation Proposed New SubstationCleanCommunity2Workshops 2008O" ContactsContacts for the

  14. Sandia National Laboratories: Contacts

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmosphericNuclear Security Administration the1 -the Mid-Infrared0EnergySandia Involves Wind-Farm OwnersContacts SSLS Contacts On

  15. IEEE Computer Society: http://computer.org Computer: http://computer.org/computer

    E-Print Network [OSTI]

    Stanford University

    IEEE Computer Society: http://computer.org Computer: http://computer.org/computer computer@computer.org IEEE Computer Society Publications Office: +1 714 821 8380 COVER FEATURES GUEST EDITOR'S INTRODUCTION 28 Computational Photography--The Next Big Step Oliver Bimber Computational photography extends

  16. www.free4vn.org oldroad www.vsofts.net oldroadwww.free4vn.org oldroad

    E-Print Network [OSTI]

    Giridhar, K.

    www.free4vn.org oldroad #12;www.vsofts.net oldroadwww.free4vn.org oldroad #12;www.vsofts.net oldroadwww.free4vn.org oldroad #12;www.vsofts.net oldroadwww.free4vn.org oldroad #12;www.vsofts.net oldroadwww.free4vn.org oldroad #12;www.vsofts.net oldroadwww.free4vn.org oldroad #12;www

  17. CONTACT INFO BUILDING SHELTER

    E-Print Network [OSTI]

    King, David G.

    CONTACT INFO SIGNALS BUILDING SHELTER THE DISABLED B.E.R.T. TEAM B.E.R.T.* EMERGENCY RESPONSE GUIDE, SIUC*Building Emergency Response Team Siren* Long Blast: Tornado High/Low: Any Other Emergency Radio needed. 2. Find two or three B.E.R.T. "buddies" who are willing to help you in the event of an emergency

  18. Technology Advertising Contact Information

    E-Print Network [OSTI]

    Peters, Richard

    Overview #12;Technology Advertising Contact Information Alex Sheath 8596 4063 asheath Overview Our online Technology section is geared towards an IT professional environment, reaching a range of technology enthusiasts from every day gadget consumers to business decision makers where enterprise solutions

  19. Contact Center Sales Office

    E-Print Network [OSTI]

    Fisher, Kathleen

    PSTN Contact Center India Plant Ohio Sales Office Russia Remote Worker Arizona Plant China GPS petrochemical industry. The demands to improve supply and demand balances and increase business velocity have of diverse organizations in the petrochemical industry ­ from crude oil to refinery to processing

  20. Contact stress sensor

    DOE Patents [OSTI]

    Kotovsky, Jack

    2014-02-11T23:59:59.000Z

    A method for producing a contact stress sensor that includes one or more MEMS fabricated sensor elements, where each sensor element of includes a thin non-recessed portion, a recessed portion and a pressure sensitive element adjacent to the recessed portion. An electric circuit is connected to the pressure sensitive element. The circuit includes a pressure signal circuit element configured to provide a signal upon movement of the pressure sensitive element.

  1. ARM - NSA Contacts

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc Documentation RUC : XDCResearchWarmingMethane Background Information OutreachContacts NSA

  2. Contacts / Hours - Hanford Site

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformation InInformationCenterResearchCASLNanoporousTestimonyContact Us -

  3. Find us on Facebook myscienceacademy.org

    E-Print Network [OSTI]

    Chiao, Jung-Chih

    Find us on Facebook myscienceacademy.org 144,123 people like myscienceacademy.org. Facebook social In Recommendations Log in to Facebook to see your friends' recommendations. 24 Places That Look Not Normal this. 10 Famous Drug Myths 559 people recommend this. Facebook social plugin Share by Email reddit

  4. Coordinating Partners www.nwocenter.org

    E-Print Network [OSTI]

    Moore, Paul A.

    science, technology, engineering, and mathematics (STEM) education for people of all ages 241Math-372-2718 Fax: 419-372-2738 To join NWO and receive updates on NWO activities Visit: www.nwocenter.org www.nwocenter.org Teacher/Pre-service and Higher Education Faculty Professional Development NWO Inquiry Series in STEM

  5. DOE Radiation Records Contacts List

    Broader source: Energy.gov [DOE]

    DOE radiation records contact list for individuals to obtain records of occupational exposure directly from a DOE site.

  6. Uniform Methods Project Contacts | Department of Energy

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Contacts Uniform Methods Project Contacts The primary contacts for the Uniform Methods Project are: U.S. Department of Energy Michael Li Carla Frisch National Renewable Energy...

  7. Transmission - Contact Information

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsrucLas ConchasPassiveSubmittedStatusButler TinaContact-Information-Transmission Sign In About |

  8. Transmission Contact Information

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsrucLas ConchasPassiveSubmittedStatusButler TinaContact-Information-Transmission Sign In

  9. ARM - Instrument Contacts

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformation InInformation InExplosionAnnouncements MediagovCampaignsList ofgovInstrumentsContacts

  10. SRNL LDRD - Program Contacts

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmosphericNuclear Security Administration the1 -the Mid-Infrared0 ResourceAwards SAGE Awards ,#2446SmallnAbout LDRDProgram Contacts

  11. FOR IMMEDIATE RELEASE CONTACT:

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation ProposedUsing ZirconiaPolicy andExsolutionFES Committees of9,of Energy8 CH2M CONTACT:

  12. ARM - Contact Information

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformationbudapest Comments? We would love toContact Information Related Links TWP-ICE Home Tropical

  13. Contacts | Department of Energy

    Energy Savers [EERE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious RankCombustion |Energyon ArmedWaste andAccessCO2Administrative Operations Contacts for theAbout the State

  14. Geothermal: Contact Us

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation ProposedUsingFun with Big Sky Learning FunNeuTel2011Programmatic ReportsContact Us Geothermal

  15. How to Contact NERSC

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformation Desert Southwest Region service area.Portal SolarAbout Energy.govHonorsAbout » Contact us

  16. Climate VISION: Contact Us

    Office of Scientific and Technical Information (OSTI)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) "ofEarlyEnergyDepartmentNationalRestart ofMeasuring DopamineEnergy,6. Radiative Forcing of ClimateCONTACT US

  17. Contact Us - SRSCRO

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformation InInformationCenterResearchCASLNanoporousTestimony |IdahoVisionContactContactcontact

  18. Contacts | Jefferson Lab

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformation InInformationCenterResearchCASLNanoporousTestimonyContact Us - News Media Assembling A

  19. Fermilab | Contact Fermilab

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformation Desert Southwest Region service area. TheEPSCI Home It isGasERPSpun OffTechnologies|21,Contact

  20. NREL: Library - Contacts

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmosphericNuclear Security Administration the Contributions and Achievements ofLizResultsGeothermal Energy TheContacts A photo

  1. Media Contact: Will Callicott

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsrucLas Conchas recovery challenge fund LasDubey MathematicaMeasuring andSecurity Contact: Will

  2. Contact | The Ames Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation Proposed New SubstationCleanCommunity2Workshops 2008 To1 BuildingContactCoordinators|

  3. Contact Issue 1

    E-Print Network [OSTI]

    Multiple Contributors

    1976-01-01T23:59:59.000Z

    , '\\ ..... ,. '" ' ; ') I f. I , j ------------------~ The tall lean Earthman stepped up to the8!nterprise trio who had just beamed down onto his porch. "Welcome to the Kes sler Colonr.' gentlemen, " he greeted them. "I'm Leon Kessler at your service l' The man... DEDICATION This zi_e is dedicated to all STAR TREK raas who saw aad uaderstood that special quality ia the "Kirk/Spock Relatioash!p", aad to WILLIAM SHATNER .ad LEONARD NIMOY, who made it happe_. ? Copyright December, 1915, CONTACT. No reprlats...

  4. FOR ADDITIONAL INFORMATION on scientific ocean drilling,please contact Joint Oceanographic Institutions,Inc.,1200 New York Avenue,NW,Suite 400,

    E-Print Network [OSTI]

    FOR ADDITIONAL INFORMATION on scientific ocean drilling,please contact Joint Oceanographic:www.joiscience.org; Phone:(202)232-3900. Design of this map was supported by the Ocean Drilling Program under° 20° 20° Deep Sea Drilling Project THE DEEP SEA DRILLING PROJECT (DSDP; 1968-1983) pioneered

  5. UNITED WAY OF ANCHORAGE CODE WEB ADDRESS United Way of Anchorage 71830 www.liveunitedanchorage.org

    E-Print Network [OSTI]

    Pantaleone, Jim

    .pathwaycenter.org Renewable Energy Alaska Project 88020 alaskarenewableenergy.org Special Olympics Alaska Inc 55282 www 35694 www.hfhanchorage.org Kids' Corps, Inc. 30881 kcialaska.org Lutheran Social Services of Alaska Inc

  6. Method for forming metal contacts

    DOE Patents [OSTI]

    Reddington, Erik; Sutter, Thomas C; Bu, Lujia; Cannon, Alexandra; Habas, Susan E; Curtis, Calvin J; Miedaner, Alexander; Ginley, David S; Van Hest, Marinus Franciscus Antonius Maria

    2013-09-17T23:59:59.000Z

    Methods of forming metal contacts with metal inks in the manufacture of photovoltaic devices are disclosed. The metal inks are selectively deposited on semiconductor coatings by inkjet and aerosol apparatus. The composite is heated to selective temperatures where the metal inks burn through the coating to form an electrical contact with the semiconductor. Metal layers are then deposited on the electrical contacts by light induced or light assisted plating.

  7. Natural Language Engineering http://journals.cambridge.org/NLE

    E-Print Network [OSTI]

    Bergler, Sabine

    Natural Language Engineering http://journals.cambridge.org/NLE Additional services for Natural1351324912000289 Request Permissions : Click here Downloaded from http://journals.cambridge.org/NLE, IP address information retrieval (search with Google, Bing, etc.), but

  8. Oakwood Healthcare, 2014. All rights reserved. oakwood.org/foundation For more information, visit oakwood.org/foundation

    E-Print Network [OSTI]

    Finley Jr., Russell L.

    ©Oakwood Healthcare, 2014. All rights reserved. oakwood.org/foundation For more information, visit oakwood.org/foundation Oakwood Healthcare Foundation cordially invites you to Clays For Kids Sporting

  9. Solar cell with back side contacts

    DOE Patents [OSTI]

    Nielson, Gregory N; Okandan, Murat; Cruz-Campa, Jose Luis; Resnick, Paul J; Wanlass, Mark Woodbury; Clews, Peggy J

    2013-12-24T23:59:59.000Z

    A III-V solar cell is described herein that includes all back side contacts. Additionally, the positive and negative electrical contacts contact compoud semiconductor layers of the solar cell other than the absorbing layer of the solar cell. That is, the positive and negative electrical contacts contact passivating layers of the solar cell.

  10. Bourses thses Org Domaine Dure Dead line Particularit Lien

    E-Print Network [OSTI]

    Arleo, Angelo

    neurodénératives FONDATION MOTRICE avril http://www.lafondationmotrice.org/in dex://www.fdv-paris.org/fr/ecole- doctorale-fdv/ FONDATION MOTRICE avril may France ou étranger http://www.lafondationmotrice.org/in dex

  11. UN Chronicle | Indispensable for Sustainable Development http://www.un.org/Pubs/chronicle/2007/issue1/0107p20.htm 1 of 3 5/15/2007 4:43 PM

    E-Print Network [OSTI]

    UN Chronicle | Indispensable for Sustainable Development http://www.un.org/Pubs/chronicle/2007 for Sustainable Development By Jeffrey D. Sachs E-mail this article to a friend Print Home | Archive | Franais | Contact Us | Subscribe | Links Article Global sustainable development and security are deeply

  12. Protein folding using contact maps

    E-Print Network [OSTI]

    Michele Vendruscolo; Eytan Domany

    1999-01-21T23:59:59.000Z

    We present the development of the idea to use dynamics in the space of contact maps as a computational approach to the protein folding problem. We first introduce two important technical ingredients, the reconstruction of a three dimensional conformation from a contact map and the Monte Carlo dynamics in contact map space. We then discuss two approximations to the free energy of the contact maps and a method to derive energy parameters based on perceptron learning. Finally we present results, first for predictions based on threading and then for energy minimization of crambin and of a set of 6 immunoglobulins. The main result is that we proved that the two simple approximations we studied for the free energy are not suitable for protein folding. Perspectives are discussed in the last section.

  13. Method for lubricating contacting surfaces

    DOE Patents [OSTI]

    Dugger, Michael T. (Tijeras, NM); Ohlhausen, James A. (Albuquerque, NM); Asay, David B. (Boalsburg, PA); Kim, Seong H. (State College, PA)

    2011-12-06T23:59:59.000Z

    A method is provided for tribological lubrication of sliding contact surfaces, where two surfaces are in contact and in motion relative to each other, operating in a vapor-phase environment containing at least one alcohol compound at a concentration sufficiently high to provide one monolayer of coverage on at least one of the surfaces, where the alcohol compound continuously reacts at the surface to provide lubrication.

  14. FOIA Contacts | Department of Energy

    Energy Savers [EERE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious RankCombustion |Energy UsageAUDITVehicles »Exchange Visitors Program Exchange VisitorsContacts FOIA Contacts

  15. For permission to copy, contact editing@geosociety.org 2006 Geological Society of America

    E-Print Network [OSTI]

    Scharer, Kate

    the kinematics of fold growth. Where rivers cut through growing anticlines, flights of abandoned fluvial terraces across much of the fold. The Kashi-Atushi terraces show clear evidence of abandoned axial surfaces, con the development of hydrocarbon reservoirs, potential seismic haz- ards related to faulting or folding

  16. For permission to copy, contact editing@geosociety.org 2003 Geological Society of America1492

    E-Print Network [OSTI]

    Perfect, Ed

    . Orthogonal jointing during coeval igneous degassing and normal faulting, Yucca Mountain, Nevada William M Tuff at Yucca Mountain, Ne- vada. The joints formed within a month of ignimbrite deposition, prior northwest- trending basin in the Yucca Mountain area. During initial ignimbrite cooling, joint swarms formed

  17. For permission to copy, contact editing@geosociety.org 2004 Geological Society of America368

    E-Print Network [OSTI]

    Production Re- search Company (EPR), northwest Euro- E-mail: kgm@rci.rutgers.edu. pean sections, and Russian- duction Research Company (EPR) defined a depositional sequence as a ``stratigraphic unit composed

  18. For permission to copy, contact editing@geosociety.org 2007 Geological Society of America

    E-Print Network [OSTI]

    McFarlane, Donald A.

    The significance of the stratigraphic record in Kents Cavern, Devon, United Kingdom, to the interpretation passages. The Kents Cavern record of continuous, repeated sedimentation events followed by frost shat and establishes Kents Cavern as a site of international scientific interest. Keywords: Kents Cavern, middle

  19. For permission to copy, contact editing@geosociety.org 2002 Geological Society of America 665

    E-Print Network [OSTI]

    Kurapov, Alexander

    of the late Pleistocene Lake Michigan Lobe, Laurentide Ice Sheet Christopher W. Breemer* Peter U. Clark Roy ice flow characteristic of the low- gradient Lake Michigan Lobe of the south- ern Laurentide Ice Sheet ice pressure. To evaluate the basal water pressures of the Lake Michigan Lobe, we used the ground

  20. For permission to copy, contact editing@geosociety.org 2006 Geological Society of America

    E-Print Network [OSTI]

    Husinec, Antun

    carbonates. The oolitic units are similar to quiet-water ooids that form today in low-energy settings ABSTRACT Dark-gray oolitic units characterized by oversized ooids with primary radial cal- cite fabrics in their dark color, cerebroid outlines, broken and recoated grains, abundant inclusions, highly restricted

  1. For permission to copy, contact editing@geosociety.org 2005 Geological Society of America

    E-Print Network [OSTI]

    enrichment of light rare earth elements (LREEs) versus heavy rare earth elements (REEs) or in melt in SiO2 and not sufficiently light rare earth element (LREE) enriched to form continental crust was rare but occurred over short intervals in the middle of the section. The TalkeetnaVolcanic Formation

  2. For permission to copy, contact editing@geosociety.org 2003 Geological Society of America 373

    E-Print Network [OSTI]

    Patterson, William P.

    record from the Finger Lakes, New York: Impact of acid rain on a buffered terrane C.K. Lajewski H rain have been conducted in areas with low acid-neutralizing, or buffering, capaci- ty. In contrast- tionally been thought to be ``insensitive'' to the effects of acid rain. To address this fun- damental

  3. For permission to copy, contact editing@geosociety.org 2007 Geological Society of America

    E-Print Network [OSTI]

    Fountain, Andrew G.

    and stable isotopes of hydrogen and oxygen. Solute chemistry and isotopic signatures of seeps are distinct Antarctic Ice Sheet. Moreover, glaciers do not form in the valley bottoms because the sublimation and melt evaporation and sublimation (Fountain et al., 1999). Ice-cemented permafrost occurs in the upper 1 m

  4. For permission to copy, contact editing@geosociety.org 2007 Geological Society of America

    E-Print Network [OSTI]

    Pazzaglia, Frank J.

    @usc.edu. E-mail: fjp3@lehigh.edu. § Present address: Tetra Tech EM Inc., Albuquer- que, New Mexico 87110, USA Sciences, University of Southern California, Los Angeles, Cal- ifornia 90089, USA; e-mail: kfrankel§ Department of Earth and Environmental Sciences, Lehigh University, Bethlehem, Pennsylvania 18015, USA A B C D

  5. For permission to copy, contact editing@geosociety.org 2011 Geological Society of America

    E-Print Network [OSTI]

    Janecke, Susanne

    , and substantial economic resources (most notably evaporite minerals, coal, oil, and oil shale). The Eocene Green, 1996) and oil shale (Dyni, 2006). Studies of ancient lake systems often fail to adequately consider

  6. Utility Energy Service Contract Contacts | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Contacts Utility Energy Service Contract Contacts For more information about utility energy service contracts, contact: Contact Organization David McAndrew 202-586-7722 Federal...

  7. JUNE 2014VOLUME 2 NON PROFIT ORG.

    E-Print Network [OSTI]

    JUNE 2014VOLUME 2 THE TEEA MESSENGER NON PROFIT ORG. U.S. POSTAGE PAID PERMIT NO. 65 MARBLE FALLS. 2014 TEEA STATE CONFERENCE SCHEDULE MULTI PURPOSE EVENT CENTER WICHITA FALLS, TEXAS SEPTEMBER 9 & 10, 2014 Tuesday 8:00 11:00 AM Registration 8:30 & 10:30 AM Free 1 hour Wichita Falls Tours for TEEA

  8. Communication www.rsc.org/chemcomm

    E-Print Network [OSTI]

    Dunin-Borkowski, Rafal E.

    Communication www.rsc.org/chemcomm CHEMCOMM Electron beam induced in situ clusterisation of 1D Zr-Borkowskib and Malcolm L. H. Green*a a Wolfson Catalysis Centre (Carbon Nanotechnology Group), Inorganic Chemistry Laboratory, University of Oxford, South Parks Road, Oxford, UK OX1 3QR. E-mail: malcolm.green@chem.ox.ac.uk b

  9. NAZ EDUCATION PIPELINE the-naz.org

    E-Print Network [OSTI]

    Amin, S. Massoud

    NAZ EDUCATION PIPELINE the-naz.org 1200 W. Broadway #250 | Minneapolis, MN 55411 | Family Academy is a foundational component of the NAZ "cradle to career" pipeline. NAZ families can enroll in the Family Academy college ready. Families and children move through a "cradle to career" pipeline that provides

  10. www.electricitypolicy.org.uk EPRGWORKINGPAPER

    E-Print Network [OSTI]

    Aickelin, Uwe

    www.electricitypolicy.org.uk EPRGWORKINGPAPER Abstract Do homes that are more energy efficient consume less energy?: A structural equation model for England's residential sector EPRG Working Paper 1117 Cambridge Working Paper in Economics 1139 Scott Kelly Energy consumption from the residential sector

  11. www.electricitypolicy.org.uk EPRGWORKINGPAPER

    E-Print Network [OSTI]

    Aickelin, Uwe

    Energy plc in 1996. The company was unusual in being a wholly nuclear merchant power generator a simple conclusion that nuclear power cannot survive in such markets. A restructured British Energy Groupwww.electricitypolicy.org.uk EPRGWORKINGPAPER Abstract Nuclear Power and Deregulated Electricity

  12. fieldmuseum.org/schools THE FIELD MUSEUM

    E-Print Network [OSTI]

    Patterson, Bruce D.

    fieldmuseum.org/schools THE FIELD MUSEUM #12;The Field Museum | Field Trip Planning Guide for Educators 2 Welcome to The Field Museum! The Field Museum is an exciting place to explore and learn time. Taking a field trip to the Museum o ers students and teachers an opportunity to interact

  13. fieldmuseum.org/schools THE FIELD MUSEUM

    E-Print Network [OSTI]

    Patterson, Bruce D.

    fieldmuseum.org/schools THE FIELD MUSEUM #12;The Field Museum | Field Trip Planning Guide for Educators 2 Welcome to The Field Museum! The Field Museum is an exciting place to explore and learn. Taking a field trip to the Museum o ers students and teachers an opportunity to interact with real

  14. Contacts of space--times

    SciTech Connect (OSTI)

    Maia, M.D.

    1981-03-01T23:59:59.000Z

    The concept of contact between manifolds is applied to space--times of general relativity. For a given background space--time a contact approximation of second order is defined and interpreted both from the point of view of a metric pertubation and of a higher order tangent manifold. In the first case, an application to the high frequency gravitational wave hypothesis is suggested. In the second case, a constant curvature tangent bundle is constructed and suggested as a means to define a ten parameter local space--time symmetry.

  15. Non- contacting capacitive diagnostic device

    DOE Patents [OSTI]

    Ellison, Timothy

    2005-07-12T23:59:59.000Z

    A non-contacting capacitive diagnostic device includes a pulsed light source for producing an electric field in a semiconductor or photovoltaic device or material to be evaluated and a circuit responsive to the electric field. The circuit is not in physical contact with the device or material being evaluated and produces an electrical signal characteristic of the electric field produced in the device or material. The diagnostic device permits quality control and evaluation of semiconductor or photovoltaic device properties in continuous manufacturing processes.

  16. Contact Us | Department of Energy

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc DocumentationP-Series to User GroupInformation Administration (EIA)DonUs Contact UsContact

  17. Contact Us | Department of Energy

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc DocumentationP-Series to User GroupInformation Administration (EIA)DonUs Contact UsContactUs

  18. Contact Us | The Ames Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc DocumentationP-Series to User GroupInformation Administration (EIA)DonUsContact UsContact Us

  19. Sandia National Laboratories: Contact Us

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformation Desert Southwest RegionatSearch WelcomeScience SSRL ScienceCRFCareersandContact Us Contact Us

  20. Contact OAK RIDGE NATIONAL LABORATORY

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformation InInformationCenterResearchCASLNanoporousTestimony |IdahoVisionContact InContact

  1. Contact Us | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformation InInformationCenterResearchCASLNanoporousTestimonyContact Us - Working With UsContact Us

  2. Contact | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformation InInformationCenterResearchCASLNanoporousTestimonyContact Us - WorkingContact

  3. Improved Electrical Contact For Dowhhole Drilling Networks

    DOE Patents [OSTI]

    Hall, David R. (Provo, UT); Hall, Jr., H. Tracy (Provo, UT); Pixton, David S. (Lehi, UT); Dahlgren, Scott (Provo, UT); Fox, Joe (Spanish Fork, UT); Sneddon, Cameron (Provo, UT)

    2005-08-16T23:59:59.000Z

    An electrical contact system for transmitting information across tool joints while minimizing signal reflections that occur at the tool joints includes a first electrical contact comprising an annular resilient material. An annular conductor is embedded within the annular resilient material and has a surface exposed from the annular resilient material. A second electrical contact is provided that is substantially equal to the first electrical contact. Likewise, the second electrical contact has an annular resilient material and an annular conductor. The two electrical contacts configured to contact one another such that the annular conductors of each come into physical contact. The annular resilient materials of each electrical contact each have dielectric characteristics and dimensions that are adjusted to provide desired impedance to the electrical contacts.

  4. Microsoft PowerPoint - Nov 2009 PI Org Chart (web) | Department...

    Broader source: Energy.gov (indexed) [DOE]

    Microsoft PowerPoint - Nov 2009 PI Org Chart (web) Microsoft PowerPoint - Nov 2009 PI Org Chart (web) PI Organization chart Microsoft PowerPoint - Nov 2009 PI Org Chart (web) More...

  5. Contact Symmetries and Hamiltonian Thermodynamics

    E-Print Network [OSTI]

    A. Bravetti; C. S. Lopez-Monsalvo; F. Nettel

    2015-02-22T23:59:59.000Z

    It has been shown that contact geometry is the proper framework underlying classical thermodynamics and that thermodynamic fluctuations are captured by an additional metric structure related to Fisher's Information Matrix. In this work we analyze several unaddressed aspects about the application of contact and metric geometry to thermodynamics. We consider here the Thermodynamic Phase Space and start by investigating the role of gauge transformations and Legendre symmetries for metric contact manifolds and their significance in thermodynamics. Then we present a novel mathematical characterization of first order phase transitions as equilibrium processes on the Thermodynamic Phase Space for which the Legendre symmetry is broken. Moreover, we use contact Hamiltonian dynamics to represent thermodynamic processes in a way that resembles the classical Hamiltonian formulation of conservative mechanics and we show that the relevant Hamiltonian coincides with the irreversible entropy production along thermodynamic processes. Therefore, we use such property to give a geometric definition of thermodynamically admissible fluctuations according to the Second Law of thermodynamics. Finally, we show that the length of a curve describing a thermodynamic process measures its entropy production.

  6. University Assessment Contacts Academic Units

    E-Print Network [OSTI]

    Escher, Christine

    .j.arp@oregonstate.edu 541-737-2331 Notes: Agricultural and Resource Economics Assessment Rep: Email: Phone: Penelope DiebelUniversity Assessment Contacts Academic Units COLLEGE OF AGRICULTURAL SCIENCES Assessment Rep.Capalbo@oregonstate.edu 541-737-5639 Notes: Agricultural Education and Agricultural Sciences Assessment Rep: Email: Phone

  7. Contact Information Elias M. Marvinney

    E-Print Network [OSTI]

    DeJong, Theodore

    Contact Information Elias M. Marvinney 619 Fillmore St Davis, CA 95616 Cell: 617-721-9636 Email: emarvinney@ucdavis.edu Employment History University of California Davis, College of Agriculture accounts for upstream emissions associated with material production and transport, fuel combustion

  8. APRIL 18, 2013 Media Contact

    E-Print Network [OSTI]

    Solar Project State Partners with Project Owners to Purchase Conservation Land The California Department of Fish and Wildlife (CDFW), the California Energy Commission (Energy Commission) and the Ivanpah SolarAPRIL 18, 2013 Media Contact: Jordan Traverso, CDFW Communications, (916) 654-9937 California

  9. FOR ADDITIONAL INFORMATION on scientific ocean drilling,please contact Integrated Ocean Drilling Program,Texas A&M University,1000 Discovery Drive,

    E-Print Network [OSTI]

    FOR ADDITIONAL INFORMATION on scientific ocean drilling,please contact Integrated Ocean Drilling.E-mail:information@iodp.tamu.edu; Web:www.iodp-usio.org;Telephone:(979) 845-2673. Design of this map was supported by the Ocean Drilling in this publication do not reflect the views of NSF or Texas A&M University. Deep Sea Drilling Project Legs 1­96,Ocean

  10. www.chelanpud.org 2010 -Our Goals For Financial Stability

    E-Print Network [OSTI]

    TotalPortfolio #12;www.chelanpud.org Current Market Position - Total 0% 10% 20% 30% 40% 50% 60% 70% 80% 90% 100% 2013

  11. Contact

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc DocumentationP-Series to User Group andCompositionalInitial Validation andPWRContaCt The nuclear

  12. Contacts

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc DocumentationP-Series to User GroupInformation AdministrationEnvironmental Review-NEPAContacts

  13. Contacts

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc DocumentationP-Series to User GroupInformation AdministrationEnvironmental

  14. CONTACT

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformation InInformationCenterResearchCASL Symposium: CelebratingMission Welcomefor

  15. Contact

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformation InInformationCenterResearchCASLNanoporousTestimony |IdahoVision Predict,Researchhome /

  16. Solar cell contact formation using laser ablation

    DOE Patents [OSTI]

    Harley, Gabriel; Smith, David; Cousins, Peter

    2012-12-04T23:59:59.000Z

    The formation of solar cell contacts using a laser is described. A method of fabricating a back-contact solar cell includes forming a poly-crystalline material layer above a single-crystalline substrate. The method also includes forming a dielectric material stack above the poly-crystalline material layer. The method also includes forming, by laser ablation, a plurality of contacts holes in the dielectric material stack, each of the contact holes exposing a portion of the poly-crystalline material layer; and forming conductive contacts in the plurality of contact holes.

  17. Solar cell contact formation using laser ablation

    DOE Patents [OSTI]

    Harley, Gabriel; Smith, David D.; Cousins, Peter John

    2014-07-22T23:59:59.000Z

    The formation of solar cell contacts using a laser is described. A method of fabricating a back-contact solar cell includes forming a poly-crystalline material layer above a single-crystalline substrate. The method also includes forming a dielectric material stack above the poly-crystalline material layer. The method also includes forming, by laser ablation, a plurality of contacts holes in the dielectric material stack, each of the contact holes exposing a portion of the poly-crystalline materiat layer; and forming conductive contacts in the plurality of contact holes.

  18. Details of Forestry Commission and DARDNI Plant Health Contacts for UK Points of Entry UK Principle Ports Contacts Contact Details

    E-Print Network [OSTI]

    Ports Contacts Contact Details Felixstowe Richard Fergusson Pat Mitchell Philip Evans Roland Fry Fax Other GB Ports John Hunter Joanne McAuley Fax 0131-314-6148 Tel : 0131-314-6182 or Tel : 0131

  19. Communication www.rsc.org/chemcomm

    E-Print Network [OSTI]

    Nazarenko, Alexander

    Communication www.rsc.org/chemcomm CHEMCOMM Condensation of acetonitrile into N on the web 8th June 2001 Acetonitrile reacts with a dinuclear nickel(II) complex [Ni2(m-OH)2(tpa)2](ClO4{HNNC(Me)­NNC(Me)­NH}2. Acetonitrile is one of the common solvents that is widely used to study processes in solution

  20. Clean Cities Program Contacts (Fact Sheet)

    SciTech Connect (OSTI)

    Not Available

    2012-03-01T23:59:59.000Z

    This fact sheet provides contact information for program staff of the U.S. Department of Energy's Clean Cities program, as well as contact information for the nearly 100 local Clean Cities coalitions across the country.

  1. University of Michigan -Traveler Contact Information Name __________________________________

    E-Print Network [OSTI]

    Eustice, Ryan

    University of Michigan - Traveler Contact Information Name __________________________________ Phone __________________________________ Email __________________________________ University of Michigan/Clinic __________________________________ Address __________________________________ Phone __________________________________ University of Michigan

  2. Electrical Contacts to Individual Colloidal Semiconductor Nanorods

    E-Print Network [OSTI]

    Trudeau, Paul-Emile

    2008-01-01T23:59:59.000Z

    stable nanostructured electrical devices with interestingElectrical Contacts to Individual Colloidal Semiconductorand its effect on electrical properties has important

  3. www.ResponsiblePurchasing.org Sustainable Purchasing 101

    E-Print Network [OSTI]

    Escher, Christine

    .ResponsiblePurchasing.org RPN Nonprofit, ~200 members ·States ·Local governments ·Federal agencies ·Colleges and universities.ResponsiblePurchasing.org EPPs are... · Made with recycled content · Highly energy efficient · Designed to be long lasting · Recyclable or compostable · Made from renewable resources · Less toxic than conventional goods · Manufactured

  4. Optimization of Modelica Models with JModelica.org and Optimica

    E-Print Network [OSTI]

    Optimization of Modelica Models with JModelica.org and Optimica #12;Outline Modelica Dynamic Modelica Dynamic optimization and Optimica The JModelica.org open source project Applications What's next? #12;What is Modelica? A language for modeling of complex heterogeneous physical systems Open

  5. Internship Program www.studycli.org Internship Program

    E-Print Network [OSTI]

    Virginia Tech

    Internship Program www.studycli.org Internship Program In an effort to strengthen the CLI community to introduce CLI's Internship Program. If interested, please email CLI at intern@studycli.org to set up a brief Skype interview. CLI's Internship Program fee is $1960 per month. Eligibility Requirements 1) Completed

  6. Natural Language Engineering http://journals.cambridge.org/NLE

    E-Print Network [OSTI]

    Wintner, Shuly

    Natural Language Engineering http://journals.cambridge.org/NLE Additional services for Natural1351324912000101 Request Permissions : Click here Downloaded from http://journals.cambridge.org/NLE, IP address: 79 as anchors that delimit the search space. We use a large monolingual corpus to rank and filter

  7. Natural Language Engineering http://journals.cambridge.org/NLE

    E-Print Network [OSTI]

    Wintner, Shuly

    Natural Language Engineering http://journals.cambridge.org/NLE Additional services for Natural Permissions : Click here Downloaded from http://journals.cambridge.org/NLE, IP address: 79.181.48.102 on 29-processing steps for a variety of natural language processing applications, from search and information extraction

  8. Advanced Source/Drain and Contact Design for Nanoscale CMOS

    E-Print Network [OSTI]

    Vega, Reinaldo

    2010-01-01T23:59:59.000Z

    Barrier Modeling of Metal and Silicide Contacts, IEEE Elec.Redistributions in Metal and Silicide Contacts, IEEE Trans.Redistributions in Metal and Silicide Contacts, IEEE Trans.

  9. Contact DMSE | The Ames Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc DocumentationP-Series to User Group andCompositionalInitial Validation andPWRContaCt TheContact

  10. Contact Information | The Ames Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc DocumentationP-Series to User Group andCompositionalInitial Validation andPWRContaCtContact

  11. Contact Information | The Ames Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc DocumentationP-Series to User Group andCompositionalInitial ValidationContact Information Human

  12. Contact Us | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc DocumentationP-Series to User GroupInformation Administration (EIA)Don HillebrandContact Us

  13. Contact Us | DOE Data Explorer

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc DocumentationP-Series to User GroupInformation Administration (EIA)Don HillebrandContact

  14. Contact Us | Department of Energy

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc DocumentationP-Series to User GroupInformation Administration (EIA)DonUs Contact Us For

  15. Contact Us | Department of Energy

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc DocumentationP-Series to User GroupInformation Administration (EIA)DonUs Contact Us

  16. Contact Us | Department of Energy

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc DocumentationP-Series to User GroupInformation Administration (EIA)DonUs Contact

  17. Contact Us | The Ames Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc DocumentationP-Series to User GroupInformation Administration (EIA)DonUsContact Us

  18. Contacts | National Nuclear Security Administration

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc DocumentationP-Series to User GroupInformationE-Gov Contacts for E-Gov

  19. Contact EM | Department of Energy

    Energy Savers [EERE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious RankCombustion |Energy UsageAUDITVehiclesTankless orAChief MedicalDepartmentWorking withAbout Us » Contact

  20. Contact Us | Department of Energy

    Energy Savers [EERE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious RankCombustion |Energy UsageAUDITVehiclesTankless orAChief MedicalDepartmentWorking withAbout Us »Contact Us

  1. Contact Us | Department of Energy

    Energy Savers [EERE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious RankCombustion |Energy UsageAUDITVehiclesTankless orAChief MedicalDepartmentWorking withAbout Us »Contact

  2. Contact Us | Department of Energy

    Energy Savers [EERE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious RankCombustion |Energy UsageAUDITVehiclesTankless orAChief MedicalDepartmentWorking withAbout UsContact Us

  3. Contact Us | Department of Energy

    Energy Savers [EERE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious RankCombustion |Energy UsageAUDITVehiclesTankless orAChief MedicalDepartmentWorking withAbout UsContact UsUs

  4. Contact Us | Department of Energy

    Energy Savers [EERE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious RankCombustion |Energy UsageAUDITVehiclesTankless orAChief MedicalDepartmentWorking withAbout UsContact

  5. Contact Us | Department of Energy

    Energy Savers [EERE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious RankCombustion |Energy UsageAUDITVehiclesTankless orAChief MedicalDepartmentWorking withAboutUs » Contact Us

  6. Contact Us | Department of Energy

    Energy Savers [EERE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious RankCombustion |Energy UsageAUDITVehiclesTankless orAChief MedicalDepartmentWorking withAboutUs » Contact

  7. contact | netl.doe.gov

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsrucLasDelivered energy consumption byAbout SRNL HomeYoungClean EnergyContact NETL Technology

  8. contact | netl.doe.gov

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsrucLasDelivered energy consumption byAbout SRNL HomeYoungClean EnergyContact NETL TechnologyOn-Site

  9. contacts | netl.doe.gov

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsrucLasDelivered energy consumption byAbout SRNL HomeYoungClean EnergyContact NETL

  10. contacts | netl.doe.gov

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsrucLasDelivered energy consumption byAbout SRNL HomeYoungClean EnergyContact NETLcontacts

  11. EMSL Integration 2015: Contacts | EMSL

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation Proposed NewcatalystNeutronEnvironment > Voluntary ReportingAbout Us Doc.prepared2Contacts

  12. Sandia National Laboratories: PV Contacts

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmosphericNuclear Security Administration the1 -theErik Spoerke SSLSMolten-Salt StorageNoLong RangePILSResourcesPV Contacts PV

  13. Media Contacts | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsrucLas Conchas recovery challenge fund LasDubey MathematicaMeasuring andSecurity Contact:

  14. contacts | netl.doe.gov

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmosphericNuclear SecurityTensile Strain Switched5 Industrial Carbon Capture and Storage CleanDiscoveryCompletedContacts Operating

  15. Contact Information | The Ames Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation Proposed New SubstationCleanCommunity2Workshops 2008 To1 Building 9201-1 wasFAboutContact

  16. Contact Information | The Ames Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation Proposed New SubstationCleanCommunity2Workshops 2008 To1 Building 9201-1 wasFAboutContact

  17. Contact Information | The Ames Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation Proposed New SubstationCleanCommunity2Workshops 2008 To1 Building 9201-1 wasFAboutContact

  18. Contact Us | The Ames Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation Proposed New SubstationCleanCommunity2Workshops 2008 To1 BuildingContact UsNNSAContact Us

  19. University of Delaware | Contact CCEI

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformation Desert Southwest RegionatSearchScheduledProductionCCEIResearch Thrust PyrolysisContact

  20. Programs Beamlines Contact/GL Programs Beamlines Contact/GL Programs Beamlines Contact/GL Contact/GL Spectroscopy (SPC) 20ID S. Heald Inelastic and Nuclear 3ID T. Gog Imaging (IMG) 2BM F. DeCarlo S. Pasky

    E-Print Network [OSTI]

    Kemner, Ken

    Programs Beamlines Contact/GL Programs Beamlines Contact/GL Programs Beamlines Contact/GL Contact/GL

  1. Rolling Contact Fatigue of Ceramics

    SciTech Connect (OSTI)

    Wereszczak, Andrew A [ORNL; Wang, W. [Bournemouth University, Bournemouth, United Kingdom; Wang, Y. [Bournemouth University, Bournemouth, United Kingdom; Hadfield, M. [Bournemouth University, Bournemouth, United Kingdom; Kanematsu, W. [National Institute of Advanced Industrial Science and Technology, Japan; Kirkland, Timothy Philip [ORNL; Jadaan, Osama M. [University of Wisconsin, Platteville

    2006-09-01T23:59:59.000Z

    High hardness, low coefficient of thermal expansion and high temperature capability are properties also suited to rolling element materials. Silicon nitride (Si{sub 3}N{sub 4}) has been found to have a good combination of properties suitable for these applications. However, much is still not known about rolling contact fatigue (RCF) behavior, which is fundamental information to assess the lifetime of the material. Additionally, there are several test techniques that are employed internationally whose measured RCF performances are often irreconcilable. Due to the lack of such information, some concern for the reliability of ceramic bearings still remains. This report surveys a variety of topics pertaining to RCF. Surface defects (cracks) in Si{sub 3}N{sub 4} and their propagation during RCF are discussed. Five methods to measure RCF are then briefly overviewed. Spalling, delamination, and rolling contact wear are discussed. Lastly, methods to destructively (e.g., C-sphere flexure strength testing) and non-destructively identify potential RCF-limiting flaws in Si{sub 3}N{sub 4} balls are described.

  2. GEOLOGY, February 2007 119Geology, February 2007; v. 35; no. 2; p. 119122; doi: 10.1130/G23133A.1; 3 figures; Data Repository item 2007034. 2007 Geological Society of America. For permission to copy, contact Copyright Permissions, GSA, or editing@geosoci

    E-Print Network [OSTI]

    Loope, David B.

    ; Arbogast, 1996; Holliday, 2001). The 1930s dust storms are generally attributed to the effects of drought transport predat- ing widespread agriculture. Loess deposits can record changing effective moisture to copy, contact Copyright Permissions, GSA, or editing@geosociety.org. INTRODUCTION Droughts of the 1930s

  3. Pg. 1 -http://www.eduteka.org/EstandaresDocentesUnesco.php Pg. 2 -http://www.eduteka.org/EstandaresDocentesUnesco.php

    E-Print Network [OSTI]

    Vásquez, Carlos

    Pág. 1 - http://www.eduteka.org/EstandaresDocentesUnesco.php #12;Pág. 2 - http://www.eduteka.org/EstandaresDocentesUnesco.php UNESCO ESTÁNDARES DE COMPETENCIAS EN TIC PARA DOCENTES http://portal.unesco.org/es/ev.php-URL_ID=41553 UNESCO cumple con: #12;Pág. 3 - http://www.eduteka.org/EstandaresDocentesUnesco.php a) su función como

  4. BISON Contact Improvements CASL FY14 Report

    SciTech Connect (OSTI)

    B. W. Spencer; J. D. Hales; D. R. Gaston; D. A. Karpeev; R. L. Williamson; S. R. Novascone; D. M. Perez; R. J. Gardner; K. A. Gamble

    2014-09-01T23:59:59.000Z

    The BISON code is the foundation for multiple fuel performance modeling efforts, and is cur- rently under heavy development. For a variety of fuel forms, the effects of heat conduction across a gap and mechanical contact between components of a fuel system are very significant. It is thus critical that BISON have robust capabilities for enforcement of thermal and mechanical contact. BISONs solver robustness has generally been quite good before mechanical contact between the fuel and cladding occurs, but there have been significant challenges obtaining converged so- lutions once that contact occurs and the solver begins to enforce mechanical contact constraints. During the current year, significant development effort has been focused on the enforcement of mechanical contact to provide improved solution robustness. In addition to this work to improve mechanical contact robustness, an investigation into ques- tionable results attributable to thermal contact has been performed. This investigation found that the order of integration typically used on the surfaces involved in thermal contact was not suffi- ciently high. To address this problem, a new option was provided to permit the use of a different integration order for surfaces, and new usage recommendations were provided.

  5. Clean Cities Program Contacts (Fact Sheet)

    SciTech Connect (OSTI)

    Not Available

    2012-10-01T23:59:59.000Z

    This fact sheet contains contact information for program staff and coalition coordinators for the U.S. Department of Energy's Clean Cities program.

  6. Clean Cities Program Contacts (Fact Sheet)

    SciTech Connect (OSTI)

    Not Available

    2013-01-01T23:59:59.000Z

    This fact sheet contains contact information for program staff and coalition coordinators for the U.S. Department of Energy's Clean Cities program.

  7. Clean Cities Program Contacts (Fact Sheet)

    SciTech Connect (OSTI)

    Not Available

    2012-09-01T23:59:59.000Z

    This fact sheet contains contact information for program staff and coalition coordinators for the U.S. Department of Energy's Clean Cities program.

  8. Contact Form - DOE Directives, Delegations, and Requirements

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Contact Form by Diane Johnson Directives are the Department of Energy's Primary means of establishing policies, requirements, responsibilities, and procedures for Departmental...

  9. Goldschmidt Conference Abstracts Mineralogical Magazine www.minersoc.org

    E-Print Network [OSTI]

    Sparks, Donald L.

    Goldschmidt Conference Abstracts Mineralogical Magazine www.minersoc.org 1279 Role of Fe- and Mn by mineral surface area, mineralogy, pH, redox, polyvalent cations, ionic strength, and the chemical

  10. Silicone oil contamination and electrical contact resistance degradation of low-force gold contacts.

    SciTech Connect (OSTI)

    Dugger, Michael Thomas; Dickrell, Daniel John, III

    2006-02-01T23:59:59.000Z

    Hot-switched low-force gold electrical contact testing was performed using a nanomechanical test apparatus to ascertain the sensitivity of simulated microelectromechanical systems (MEMS) contact to silicone oil contamination. The observed cyclic contact resistance degradation was dependent on both closure rate and noncontact applied voltage. The decomposition of silicone oil from electrical arcing was hypothesized as the degradation mechanism.

  11. Title of Document | 1 LOCAL UNION CONTACT LIST

    E-Print Network [OSTI]

    Gleeson, Joseph G.

    on the following web site: http://atyourservice.ucop.edu/employees/policies/labor_relations/index.html Code., Suite C San Diego CA 92110 (619) 296-4937 Web site: www.cueunion.org SX Service American Federation) 296-0342 Web site: www.afscme3299.org EX Patient Care Technical American Federation of State, County

  12. Electrical contact resistance degradation of a hot-switched simulated metal MEMS contact.

    SciTech Connect (OSTI)

    Dugger, Michael Thomas; Dickrell, Daniel John, III

    2005-03-01T23:59:59.000Z

    Electrical contact resistance testing was performed by hot-switching a simulated gold-platinum metal microelectromechanical systems contact. The experimental objective was to determine the sensitivity of the contact resistance degradation to current level and environment. The contact resistance increased sharply after 100 hot-switched cycles in air. Hot-switching at a reduced current and in nitrogen atmosphere curtailed contact resistance degradation by several orders of magnitude. The mechanism responsible for the resistance degradation was found to be arc-induced decomposition of adsorbed surface contaminants.

  13. Contact SSRL | Stanford Synchrotron Radiation Lightsource

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformation InInformationCenterResearchCASLNanoporousTestimony |IdahoVisionContact InContactContact Us

  14. Contact Us | Y-12 National Security Complex

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformation InInformationCenterResearchCASLNanoporousTestimonyContact Us - WorkingContact Us Contact

  15. Contact us | Energy Frontier Research Centers

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformation InInformationCenterResearchCASLNanoporousTestimonyContact Us - WorkingContact UsContact us

  16. Contact | MIT-Harvard Center for Excitonics

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformation InInformationCenterResearchCASLNanoporousTestimonyContact Us - WorkingContact UsContact

  17. Contact Us | Linac Coherent Light Source

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation Proposed New SubstationCleanCommunity2Workshops 2008 To1 BuildingContact Us ContactContact

  18. 2005, in Etudes croles nXXVIII n1,Contacts de croles, croles en contacts, L'Harmattan, 23-57. CONTACTS DE CREOLES A MANA (GUYANE FRANAISE)

    E-Print Network [OSTI]

    Paris-Sud XI, Université de

    2005, in Etudes créoles n°XXVIII n°1,Contacts de créoles, créoles en contacts, L'Harmattan, 23°1,Contacts de créoles, créoles en contacts, L'Harmattan, 23-57. 2 de langues, notamment à la gestion

  19. Contact Information College of Business and Economics

    E-Print Network [OSTI]

    Barrash, Warren

    Contact Information College of Business and Economics Center for Business Research and Economic Research and Economic Development Center What's your challenge? We help businesses and organizations can lie in Accountancy, Economics, Information Technology and Supply Chain Management, International

  20. Front contact solar cell with formed emitter

    SciTech Connect (OSTI)

    Cousins, Peter John

    2014-11-04T23:59:59.000Z

    A bipolar solar cell includes a backside junction formed by an N-type silicon substrate and a P-type polysilicon emitter formed on the backside of the solar cell. An antireflection layer may be formed on a textured front surface of the silicon substrate. A negative polarity metal contact on the front side of the solar cell makes an electrical connection to the substrate, while a positive polarity metal contact on the backside of the solar cell makes an electrical connection to the polysilicon emitter. An external electrical circuit may be connected to the negative and positive metal contacts to be powered by the solar cell. The positive polarity metal contact may form an infrared reflecting layer with an underlying dielectric layer for increased solar radiation collection.

  1. Front contact solar cell with formed emitter

    DOE Patents [OSTI]

    Cousins, Peter John (Menlo Park, CA)

    2012-07-17T23:59:59.000Z

    A bipolar solar cell includes a backside junction formed by an N-type silicon substrate and a P-type polysilicon emitter formed on the backside of the solar cell. An antireflection layer may be formed on a textured front surface of the silicon substrate. A negative polarity metal contact on the front side of the solar cell makes an electrical connection to the substrate, while a positive polarity metal contact on the backside of the solar cell makes an electrical connection to the polysilicon emitter. An external electrical circuit may be connected to the negative and positive metal contacts to be powered by the solar cell. The positive polarity metal contact may form an infrared reflecting layer with an underlying dielectric layer for increased solar radiation collection.

  2. Contact fatigue : life prediction and palliatives

    E-Print Network [OSTI]

    Conner, Brett P. (Brett Page), 1975-

    2002-01-01T23:59:59.000Z

    Fretting fatigue is defined as damage resulting from small magnitude (0.5-50 microns) displacement between contacting bodies where at least one of the bodies has an applied bulk stress. The applicability and limits of a ...

  3. DOE Headquarters Contact Information: Employee Concerns Program...

    Broader source: Energy.gov (indexed) [DOE]

    Office ECP Contact Information: Albuquerque Complex (NNSA) Eva Glow Brownlow Michelle Rodriguez de Varela Hotline: 800-688-5713 Fax: 505-845-4020 E-mail: ecp@nnsa.doe.gov...

  4. NUMERICAL MODELING OF CATHODE CONTACT MATERIAL DENSIFICATION

    SciTech Connect (OSTI)

    Koeppel, Brian J.; Liu, Wenning N.; Stephens, Elizabeth V.; Khaleel, Mohammad A.

    2011-11-01T23:59:59.000Z

    Numerical modeling was used to simulate the constrained sintering process of the cathode contact layer during assembly of solid oxide fuel cells (SOFCs). A finite element model based on the continuum theory for sintering of porous bodies was developed and used to investigate candidate low-temperature cathode contact materials. Constitutive parameters for various contact materials under investigation were estimated from dilatometry screening tests, and the influence of processing time, processing temperature, initial grain size, and applied compressive stress on the free sintering response was predicted for selected candidate materials. The densification behavior and generated stresses within a 5-cell planar SOFC stack during sintering, high temperature operation, and room temperature shutdown were predicted. Insufficient constrained densification was observed in the stack at the proposed heat treatment, but beneficial effects of reduced grain size, compressive stack preload, and reduced thermal expansion coefficient on the contact layer densification and stresses were observed.

  5. Clean Cities Program Contacts (Fact Sheet)

    SciTech Connect (OSTI)

    Not Available

    2013-12-01T23:59:59.000Z

    Contact information for the U.S. Department of Energy's Clean Cities program staff and for the coordinators of the nearly 100 local Clean Cities coalitions across the country.

  6. The contact angle in inviscid fluid mechanics

    E-Print Network [OSTI]

    P N Shankar; R Kidambi

    2005-08-17T23:59:59.000Z

    We show that in general, the specification of a contact angle condition at the contact line in inviscid fluid motions is incompatible with the classical field equations and boundary conditions generally applicable to them. The limited conditions under which such a specification is permissible are derived; however, these include cases where the static meniscus is not flat. In view of this situation, the status of the many `solutions' in the literature which prescribe a contact angle in potential flows comes into question. We suggest that these solutions which attempt to incorporate a phenomenological, but incompatible, condition are in some, imprecise sense `weak-type solutions'; they satisfy or are likely to satisfy, at least in the limit, the governing equations and boundary conditions everywhere except in the neighbourhood of the contact line. We discuss the implications of the result for the analysis of inviscid flows with free surfaces.

  7. Louise Guy, Administrative Contact College of Education

    E-Print Network [OSTI]

    provide leadership, scholarship and training across the following programs: · Educational Specialist/Severe Disabilities, Orientation & Mobility, and Vocational Special Education). · Certificate programs offeredLouise Guy, Administrative Contact College of Education Department of Special Education 1600

  8. Cooperativity and Contact Order in Protein Folding

    E-Print Network [OSTI]

    Marek Cieplak

    2004-01-11T23:59:59.000Z

    The effects of cooperativity are studied within Go-Lennard-Jones models of proteins by making the contact interactions dependent on the proximity to the native conformation. The kinetic universality classes are found to remain the same as in the absence of cooperativity. For a fixed native geometry, small changes in the effective contact map may affect the folding times in a chance way and to the extent that is comparable to the shift in the folding times due to cooperativity. The contact order controlls folding scenarios: the average times necessary to bring pairs of amino acids into their near native separations depend on the sequential distances within the pairs. This dependence is largely monotonic, regardless of the cooperativity, and the dominant trend could be described by a single parameter like the average contact order. However, it is the deviations from the trend which are usually found to set the net folding times.

  9. Colorado State University Extension Contact: Joanne Littlefield

    E-Print Network [OSTI]

    Stephens, Graeme L.

    Colorado State University Extension Contact: Joanne Littlefield Director, Outreach and Engagement weather situation in Colorado is requiring often quick property and safety decisions; recovery efforts and rapidly shifting conditions along Colorado's Front Range. From food safety issues related to crops

  10. Archived BPRC Web Links: http://www.arcus.org/trec/vbc/index.php?act=home

    E-Print Network [OSTI]

    Howat, Ian M.

    Archived BPRC Web Links: http://www.arcus.org/trec/vbc/index.php?act=home "Explore Antarctica guide. http://www.marinetech.org/rov_competition/2007/international_comp_2007.php International Student or call 614-292-3416. http://www.nsta.org/main/news/stories/nsta_story.php?news_story_ID=53499

  11. GREAT MINDSTHINK ELECTRIC / WWW.EVS26.ORG Mitigation of Vehicle Fast Charge

    E-Print Network [OSTI]

    GREAT MINDSTHINK ELECTRIC / WWW.EVS26.ORG Mitigation of Vehicle Fast Charge Grid Impacts-55080 #12;GREAT MINDSTHINK ELECTRIC / WWW.EVS26.ORG Electric Vehicle Grid Integration 2 Cross Cutting & TESTING DEPLOYMENT & PARTNERSHIPS Tx Tx Tx #12;GREAT MINDSTHINK ELECTRIC / WWW.EVS26.ORG3 Vehicle Test

  12. StepGreen.org: Increasing energy saving behaviors via social networks Jennifer Mankoff1

    E-Print Network [OSTI]

    Mankoff, Jennifer

    StepGreen.org: Increasing energy saving behaviors via social networks Jennifer Mankoff1 , Susan R and evaluation of StepGreen.org, a site intended to promote energy-saving behaviors. We present the results of StepGreen.org (Figure 1), a site intended to motivate people to make energy-reducing changes

  13. ElasticPlastic Spherical Contact Modeling Including Roughness Effects

    E-Print Network [OSTI]

    Li, L.; Etsion, I.; Talke, F. E.

    2010-01-01T23:59:59.000Z

    A multilevel model for elasticplastic contact between ajunction growth of an elasticplastic spherical contact. J.nite element based elasticplastic model for the contact of

  14. Exploring Korean Americans Interracial Contact Experiences During Recreational Sport Activities

    E-Print Network [OSTI]

    Lee, Kang Jae

    2010-07-14T23:59:59.000Z

    This thesis follows the style of Journal of Leisure Research. 2 of friendship, as an essential condition for successful intergroup contact (Pettigrew, 1997; Pettigrew & Tropp, 2006). Since the contact hypothesis was first introduced, intergroup contact... conditions for successful intergroup contact. Their meta-analysis of 713 independent samples from 515 intergroup contact studies revealed four important findings First, 17 intergroup contact typically reduces intergroup prejudice. Second, the positive...

  15. EERE Information Center Contact, PIA, The Office of Energy Efficiency...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Information Center Contact, PIA, The Office of Energy Efficiency and Renewable Energy (EERE) EERE Information Center Contact, PIA, The Office of Energy Efficiency and Renewable...

  16. Cell Phone Allergic Contact Dermatitis: Case Report and Review

    E-Print Network [OSTI]

    Rajpara, Anand; Feldman, Steven R

    2010-01-01T23:59:59.000Z

    testing in a sample of cell phones in Denmark. ContactCell phone allergic contact dermatitis: Case report andcombination of increased cell phone ownership and unlimited

  17. Contact: Nancy Ross, 510-251-1600 x106, nross@pacinst.org Dr. Peter Gleick Calls on the Senate

    E-Print Network [OSTI]

    allocation and use among neighboring states, unmitigated water contamination from both known and new to Move on Specific Water Policy Reforms Recommends Fundamental Changes to Ensure Sustainable Water national water policy. Dr. Gleick, one of the world's leading experts on freshwater issues, testified

  18. PFP: Protein Function Prediction server For any questions regarding PFP contact the administration at info@kiharalab.org

    E-Print Network [OSTI]

    Kihara, Daisuke

    also click on "Load Sample" link to load this sequence in the text box and follow the next steps "Enter Query Sequence(s)". Consider the following sequence that you can enter. >sp|P56851|EP3B. Clicking on "Clear" link will clear the text box for sequence and load default ESG parameters in the boxes

  19. Electric Field and Humidity Trigger Contact Electrification

    E-Print Network [OSTI]

    Zhang, Yanzhen; Liu, Yonghong; Wang, Xiaolong; Zhang, Rui; Shen, Yang; Ji, Renjie; Cai, Baoping

    2015-01-01T23:59:59.000Z

    Here, we study the old problem of why identical insulators can charge one another on contact. We perform several experiments showing that, if driven by a preexisting electric field, charge is transferred between contacting insulators. This happens because the insulator surfaces adsorb small amounts of water from a humid atmosphere. We believe the electric field then separates positively from negatively charged ions prevailing within the water, which we believe to be hydronium and hydroxide ions, such that at the point of contact, positive ions of one insulator neutralize negative ions of the other one, charging both of them. This mechanism can explain for the first time the observation made four decades ago that wind-blown sand discharges in sparks if and only if a thunderstorm is nearby.

  20. Electric Field and Humidity Trigger Contact Electrification

    E-Print Network [OSTI]

    Yanzhen Zhang; Thomas Phtz; Yonghong Liu; Xiaolong Wang; Rui Zhang; Yang Shen; Renjie Ji; Baoping Cai

    2015-01-14T23:59:59.000Z

    Here, we study the old problem of why identical insulators can charge one another on contact. We perform several experiments showing that, if driven by a preexisting electric field, charge is transferred between contacting insulators. This happens because the insulator surfaces adsorb small amounts of water from a humid atmosphere. We believe the electric field then separates positively from negatively charged ions prevailing within the water, which we believe to be hydronium and hydroxide ions, such that at the point of contact, positive ions of one insulator neutralize negative ions of the other one, charging both of them. This mechanism can explain for the first time the observation made four decades ago that wind-blown sand discharges in sparks if and only if a thunderstorm is nearby.

  1. Contacts for Integrating Renewable Energy into Federal Construction Projects

    Broader source: Energy.gov [DOE]

    Contacts to learn more about integrating renewable energy technologies into Federal construction projects.

  2. Ohmic contacts to n-GaSb

    E-Print Network [OSTI]

    Yang, Zhengchong

    2012-06-07T23:59:59.000Z

    in the semiconductor is measured during the deposition of the metal contact. In using method 1, the I-V characteristics is plotted. The thermionic emission theory predicts the current-voltage characteristics of Schottky diodes as [13]: J(rhcrmionic) = A" T' exp... of different work functions. This situation is also true for metal contacts to n-GaSb. Polyakov et al. [14] examined the Schottky diodes of Al, Au, In, Pd, Ga, and Sb on Te doped n-GaSb. They used the C-V measurements methods. They reported that barrier...

  3. Contact Us | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) "ofEarlyEnergyDepartment ofDepartment ofofOxford SiteToledoSampling at the GrandSr:s I1Us |Contact Us Contact

  4. Contact Upper Great Plains Regional Office

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc DocumentationP-Series to User Group andCompositionalInitial ValidationContact InformationContact

  5. Contact Us | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc DocumentationP-Series to User GroupInformation Administration (EIA)DonUs ContactLosContact

  6. Contact Us | Y-12 National Security Complex

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc DocumentationP-Series to User GroupInformation Administration (EIA)DonUsContact UsContact

  7. Contacts for Services | Department of Energy

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc DocumentationP-Series to User GroupInformationE-Gov Contacts for E-Gov LeAnnProjectContacts for

  8. Contact Information | Princeton Plasma Physics Lab

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformation InInformationCenterResearchCASLNanoporousTestimony |IdahoVisionContact InContact

  9. Contact Us - Working With Us | NREL

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformation InInformationCenterResearchCASLNanoporousTestimonyContact Us - Working With Us Contact us

  10. Contact Us | Center for Energy Efficient Materials

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformation InInformationCenterResearchCASLNanoporousTestimonyContact Us - Working With UsContact

  11. Contact Us | Y-12 National Security Complex

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation Proposed New SubstationCleanCommunity2Workshops 2008 To1 BuildingContact UsNNSAContactContact

  12. Contacts For "A" | EMSL

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation Proposed New SubstationCleanCommunity2Workshops 2008 To1ContactA" Contacts For

  13. Contacts For "B" | EMSL

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation Proposed New SubstationCleanCommunity2Workshops 2008 To1ContactA" Contacts ForB"

  14. Contacts For "C" | EMSL

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation Proposed New SubstationCleanCommunity2Workshops 2008 To1ContactA" Contacts

  15. Contacts For "D" | EMSL

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation Proposed New SubstationCleanCommunity2Workshops 2008 To1ContactA" ContactsD"

  16. Contacts For "E" | EMSL

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation Proposed New SubstationCleanCommunity2Workshops 2008 To1ContactA" ContactsD"E"

  17. Contacts For "G" | EMSL

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation Proposed New SubstationCleanCommunity2Workshops 2008 To1ContactA"G" Contacts For

  18. Contacts For "H" | EMSL

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation Proposed New SubstationCleanCommunity2Workshops 2008 To1ContactA"G" Contacts

  19. Contacts For "I" | EMSL

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation Proposed New SubstationCleanCommunity2Workshops 2008 To1ContactA"G" ContactsI"

  20. Contacts For "K" | EMSL

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation Proposed New SubstationCleanCommunity2Workshops 2008 To1ContactA"G"K" Contacts

  1. Contacts For "S" | EMSL

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation Proposed New SubstationCleanCommunity2Workshops 2008O" Contacts ForS" Contacts For

  2. Contacts For "T" | EMSL

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation Proposed New SubstationCleanCommunity2Workshops 2008O" Contacts ForS" Contacts

  3. Contacts | Y-12 National Security Complex

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation Proposed New SubstationCleanCommunity2Workshops 2008O" ContactsContacts for

  4. www.egec.org Nuremberg, 15 October 2013

    E-Print Network [OSTI]

    Oak Ridge National Laboratory

    and Technology ­ a report from EGC 2013 Dr. Burkhard Sanner European Geothermal Energy Council, Brussels #12;www.egec.org Content European Geothermal Energy Council · Market and application · Technological development The European Geothermal Energy Congress in June 2013 in Pisa (EGC 2013) brought together ca 500 experts from

  5. www.asq.org 7 Foundations for Quality

    E-Print Network [OSTI]

    Radziwill, Nicole

    www.asq.org 7 Foundations for Quality Management of Scientific Data Products NICOLE M. RADZIWILL of this research is to provide a conceptual foundation for the management of data quality as it applies management (TQM) philosophy, total information quality management (TIQM), and total data quality management

  6. www.cambridge.org/us/9780521194280 Molecular Machines in

    E-Print Network [OSTI]

    Grishok, Alla

    www.cambridge.org/us/9780521194280 Molecular Machines in Biology Workshop of the Cell Joachim Frank Columbia University, New York About the Book The concept of molecular machines in biology has transformed, translation, protein folding, and protein degradation, are all carried out by molecular machines. This volume

  7. www.VadoseZoneJournal.org Vadose Zone Journal

    E-Print Network [OSTI]

    Vrugt, Jasper A.

    and internationally. The high proportion of scholarly submissions from international scien- tists outsidewww.VadoseZoneJournal.org Vadose Zone Journal: The First Ten Years We proudly present a special section inspired by the 10-year anniversary of Vadose Zone Journal. From the outset, the journal

  8. GEOLOGY | August 2012 | www.gsapubs.org 747 INTRODUCTION

    E-Print Network [OSTI]

    Loope, David B.

    GEOLOGY | August 2012 | www.gsapubs.org 747 INTRODUCTION Reduced organic carbon is the primary carbon and light, alternative energy sources, such as Fe(II), must be avail- able in order for life(II) as an energy source for microbial metabolism as well as supply a source of inorganic carbon for fixation

  9. The China Quarterly http://journals.cambridge.org/CQY

    E-Print Network [OSTI]

    Huang, Youqin

    The China Quarterly http://journals.cambridge.org/CQY Additional services for The China Quarterly here Lowincome Housing in Chinese Cities: Policies and Practices Youqin Huang The China Quarterly (2012). Lowincome Housing in Chinese Cities: Policies and Practices. The China Quarterly, 212, pp

  10. The China Quarterly http://journals.cambridge.org/CQY

    E-Print Network [OSTI]

    Elman, Benjamin

    The China Quarterly http://journals.cambridge.org/CQY Additional services for The China Quarterly and Boston: Brill, 2012. vii + 394 pp., 133.00 $182.00. ISBN 9789004218444 Benjamin A. Elman The China this article: Benjamin A. Elman (2012). The China Quarterly, 212, pp 11451148 doi:10.1017/ S0305741012001440

  11. www.newphytologist.org 1 Blackwell Publishing, Ltd.

    E-Print Network [OSTI]

    Bradshaw, Toby

    www.newphytologist.org 1 Research Blackwell Publishing, Ltd. Mutations in CAX1 produce phenotypes calcium-proton antiporter CAX1. · cax1 mutants have most of the phenotypes associated with tolerance-of-function cax1 mutations could produce all these phenotypes characteristic of plants adapted to serpentine soils

  12. Journal of Fluid Mechanics http://journals.cambridge.org/FLM

    E-Print Network [OSTI]

    Worster, M. Grae

    Journal of Fluid Mechanics http://journals.cambridge.org/FLM Additional services for Journal of Fluid Mechanics: Email alerts: Click here Subscriptions: Click here Commercial reprints: Click here, John R. Lister and M. Grae Worster Journal of Fluid Mechanics / Volume 700 / June 2012, pp 63 76 DOI

  13. Journal of Fluid Mechanics http://journals.cambridge.org/FLM

    E-Print Network [OSTI]

    Goldstein, Raymond E.

    Journal of Fluid Mechanics http://journals.cambridge.org/FLM Additional services for Journal of Fluid Mechanics: Email alerts: Click here Subscriptions: Click here Commercial reprints: Click here. Woodhouse and Raymond E. Goldstein Journal of Fluid Mechanics / Volume 705 / August 2012, pp 165 175 DOI

  14. Journal of Fluid Mechanics http://journals.cambridge.org/FLM

    E-Print Network [OSTI]

    Worster, M. Grae

    Journal of Fluid Mechanics http://journals.cambridge.org/FLM Additional services for Journal of Fluid Mechanics: Email alerts: Click here Subscriptions: Click here Commercial reprints: Click here. Pegler and M. Grae Worster Journal of Fluid Mechanics / Volume 696 / April 2012, pp 152 174 DOI: 10

  15. Journal of Fluid Mechanics http://journals.cambridge.org/FLM

    E-Print Network [OSTI]

    Parau, Emilian I.

    Journal of Fluid Mechanics http://journals.cambridge.org/FLM Additional services for Journal of Fluid Mechanics: Email alerts: Click here Subscriptions: Click here Commercial reprints: Click here and E. I. Parau Journal of Fluid Mechanics / Volume 688 / December 2011, pp 528 550 DOI: 10.1017/jfm

  16. Journal of Fluid Mechanics http://journals.cambridge.org/FLM

    E-Print Network [OSTI]

    Texas at Austin. University of

    Journal of Fluid Mechanics http://journals.cambridge.org/FLM Additional services for Journal of Fluid Mechanics: Email alerts: Click here Subscriptions: Click here Commercial reprints: Click here. Paoletti and Harry L. Swinney Journal of Fluid Mechanics / Volume 706 / September 2012, pp 571 583 DOI: 10

  17. www.sensor-ip.org Sustainability Impact Assessment

    E-Print Network [OSTI]

    www.sensor-ip.org May 2005 Sustainability Impact Assessment: Tools for Environmental, Social countries constitute the consortium, which develops science based ex-ante Sustainability Impact Assessment regions. SENSOR directly responds to the European sustainability objectives as applied to land use

  18. https://doyouliveunited.org 1. Enter you user ID

    E-Print Network [OSTI]

    Search' button. 7. Enter you search terms for the agency of your choice and click on `Search'. #12;httpshttps://doyouliveunited.org 1. Enter you user ID: your email address Enter your password: welcome be different then the options listed here. 5. For a payroll pledge, enter the amount per pay or the total

  19. www.rsc.org Registered Charity Number 207890

    E-Print Network [OSTI]

    www.rsc.org Registered Charity Number 207890 As featured in: SeeWeitz et al., Lab Chip, 2008, 8 silanes. These silanes allow us to tailor the surface chemistry of the interface and to use lithographic tech- niques to spatially pattern the wettability. To demonstrate the utility of this approach, we

  20. http://journals.cambridge.org/ROB Additional services for Robotica

    E-Print Network [OSTI]

    Hu, Huosheng

    Robotica http://journals.cambridge.org/ROB Additional services for Robotica: Email alerts: Click predictive controller for robots to follow a virtual leader Dongbing Gu and Huosheng Hu Robotica / Volume 27. Robotica, 27, pp 905-913 doi:10.1017/S0263574708005316 Request Permissions : Click here Downloaded from

  1. http://journals.cambridge.org/ROB Additional services for Robotica

    E-Print Network [OSTI]

    Hu, Huosheng

    Robotica http://journals.cambridge.org/ROB Additional services for Robotica: Email alerts: Click and Vicente Matellán Robotica / Volume 26 / Issue 06 / November 2008, pp 817 - 830 DOI: 10.1017/S (2008). A hybrid approach to fast and accurate localization for legged robots. Robotica, 26, pp 817

  2. http://journals.cambridge.org/ROB Additional services for Robotica

    E-Print Network [OSTI]

    Sekercioglu, Y. Ahmet

    Robotica http://journals.cambridge.org/ROB Additional services for Robotica: Email alerts: Click and Y. Ahmet ekerciolu Robotica / FirstView Article / October 2014, pp 1 - 13 DOI: 10.1017/S formation control of networked mobile robots in environments with obstacles. Robotica, Available on CJO 2014

  3. http://journals.cambridge.org/ROB Additional services for Robotica

    E-Print Network [OSTI]

    Goldberg, Ken

    Robotica http://journals.cambridge.org/ROB Additional services for Robotica: Email alerts: Click. Goldberg Robotica / Volume 13 / Issue 06 / November 1995, pp 565 573 DOI: 10.1017/S0263574700018646 algorithms for automatic planning by robots in stochastic environments. Robotica,13, pp 565573 doi:10.1017/S

  4. http://journals.cambridge.org/ROB Additional services for Robotica

    E-Print Network [OSTI]

    Kim, Jongwon

    Robotica http://journals.cambridge.org/ROB Additional services for Robotica: Email alerts: Click Robotica / FirstView Article / September 2012, pp 1 8 DOI: 10.1017/S0263574711000774, Published online: 25 on taskoriented workspace. Robotica, Available on CJO 2011 doi:10.1017/S0263574711000774 Request Permissions

  5. http://journals.cambridge.org/ROB Additional services for Robotica

    E-Print Network [OSTI]

    Hu, Huosheng

    Robotica http://journals.cambridge.org/ROB Additional services for Robotica: Email alerts: Click Robotica / Volume 24 / Issue 04 / July 2006, pp 429 - 431 DOI: 10.1017/S0263574705002420, Published online positioning method for a humanoid robot. Robotica, 24, pp 429-431 doi:10.1017/S0263574705002420 Request

  6. The Neutron Scattering Society www.neutronscattering.org

    E-Print Network [OSTI]

    Homes, Christopher C.

    The Neutron Scattering Society of America www.neutronscattering.org Press Release February 11, 2008 The Neutron Scattering Society of America is pleased to announce the election as Fellows of the Society of in application of neutron scattering to studies of surfaces and crystal field excitations as well as his

  7. The Neutron Scattering Society www.neutronscattering.org

    E-Print Network [OSTI]

    Chen, Sow-Hsin

    The Neutron Scattering Society of America www.neutronscattering.org Press Release, February 4, 2008 The Neutron Scattering Society of America is pleased to announce the 2008 recipients of its 3 major prizes. The Neutron Scattering Society of America (NSSA) established the Clifford G. Shull Prize in Neutron Science

  8. ISSN 1464-0325 www.rsc.org/jem

    E-Print Network [OSTI]

    Granada, Universidad de

    ISSN 1464-0325 www.rsc.org/jem Cutting-Edge Research on Environmental Processes & Impacts Volume 10 | Number 11 | November 2008 | Pages 1241­1372 Journal of Environmental Monitoring Cover Benitez et al. Microbial activity in contaminated soils 10th Anniversary Focus Leal Filho Rainforest depletion and climate

  9. Department Name: Education Studies Org. #: 2125 Position Title: Office Worker

    E-Print Network [OSTI]

    Baltisberger, Jay H.

    Department Name: Education Studies Org. #: 2125 Position Title: Office Worker WLS Level: 1 Position-year); and 2. Students of any classification whose work is characterized by highly structured tasks or outcomes for departmental functions and/or programs. This level is assigned to the following: 1. Student managers

  10. Department Name: Education Studies Org. #: 2125 Position Title: Building Monitor

    E-Print Network [OSTI]

    Baltisberger, Jay H.

    Department Name: Education Studies Org. #: 2125 Position Title: Building Monitor WLS Level: 4 if entering mid-year); and 2. Students of any classification whose work is characterized by highly structured for departmental functions and/or programs. This level is assigned to the following: 1. Student managers

  11. Department Name: Education Studies Org. #: 2125 Position Title: Office Associate

    E-Print Network [OSTI]

    Baltisberger, Jay H.

    Department Name: Education Studies Org. #: 2125 Position Title: Office Associate WLS Levels: 3 -- 4 if entering mid-year); and 2. Students of any classification whose work is characterized by highly structured for departmental functions and/or programs. This level is assigned to the following: Student managers

  12. Department Name: Education Studies Org. #: 2125 Position Title: Janitor

    E-Print Network [OSTI]

    Baltisberger, Jay H.

    Department Name: Education Studies Org. #: 2125 Position Title: Janitor WLS Level: 1 Position Code-year); and 2. Students of any classification whose work is characterized by highly structured tasks or outcomes for departmental functions and/or programs. This level is assigned to the following: 1. Student managers

  13. EPJ Photovoltaics 2, 20301 (2011) www.epj-pv.org

    E-Print Network [OSTI]

    Paris-Sud XI, Universit de

    2011-01-01T23:59:59.000Z

    EPJ Photovoltaics 2, 20301 (2011) www.epj-pv.org DOI: 10.1051/epjpv/2011001 c Owned by the authors, published by EDP Sciences, 2011 EPJ PhotovoltaicsEPJ Photovoltaics Geometrical optimization and electrical online: 1 April 2011 Abstract This article investigates the optimal efficiency of a photovoltaic system

  14. August 2013 EPL, 103 (2013) 46003 www.epljournal.org

    E-Print Network [OSTI]

    2013-01-01T23:59:59.000Z

    its energy in a fairly compact cas- cade, forming a concentrated area of high-energy density. So farAugust 2013 EPL, 103 (2013) 46003 www.epljournal.org doi: 10.1209/0295-5075/103/46003 High-energy-00014 Helsinki, Finland, EU 2 EURATOM/CCFE Fusion Association, Culham Centre for Fusion Energy

  15. www.electricitypolicy.org.uk EPRGWORKINGPAPERNON-TECHNICALSUMMARY

    E-Print Network [OSTI]

    Aickelin, Uwe

    www.electricitypolicy.org.uk EPRGWORKINGPAPERNON-TECHNICALSUMMARY Do homes that are more energy efficient consume less energy?: A structural equation model of the English residential sector EPRG Working Paper 1117 Cambridge Working Paper in Economics 1139 Scott Kelly Energy consumption from the residential

  16. www.VadoseZoneJournal.org Soil Architecture and

    E-Print Network [OSTI]

    Wildenschild, Dorthe

    www.VadoseZoneJournal.org Soil Architecture and Physicochemical Func ons: An Introduc on Soils func engineers with the best educa on possible. The 16 papers in this special sec on on soil architecture measurement, visualiza on, and modeling of soil structure (architecture) and physical, chemical

  17. www.vics.org1 September 27, 2011

    E-Print Network [OSTI]

    Lin, Xiaodong

    replenishments and promotional needs Bulk: Liquid chemical, fuel and energy industry transportation specialists America and China Port Logistics: Transloading, distribution, warehousing and port dray services-modal and brokerage services to meet demand #12;www.vics.org6 Fuel cost volatility Alternative, data-based, lane

  18. Laser and Particle Beams http://journals.cambridge.org/LPB

    E-Print Network [OSTI]

    Liska, Richard

    Laser and Particle Beams http://journals.cambridge.org/LPB Additional services for Laser, J. Limpouch, R. Liska and P. Váchal Laser and Particle Beams / Volume 30 / Issue 03 / September 2012 of annularlaserbeamdriven plasma jets from massive planar targets. Laser and Particle Beams,30, pp 445457 doi:10.1017/S

  19. www.globalsubsidies.org THE GLOBAL SUBSIDIES INITIATIVE

    E-Print Network [OSTI]

    Toohey, Darin W.

    www.globalsubsidies.org THE GLOBAL SUBSIDIES INITIATIVE UNTOLD BILLIONS: FOSSIL-FUEL SUBSIDIES, THEIR IMPACTS AND THE PATH TO REFORM The Politics of Fossil-Fuel Subsidies #12;THE GLOBAL SUBSIDIES INITIATIVE | UNTOLD BILLIONS: FOSSIL-FUEL SUBSIDIES, THEIR IMPACTS AND THE PATH TO REFORM Page II The Politics

  20. www.electricitypolicy.org.uk EPRGWORKINGPAPERNON-TECHNICALSUMMARY

    E-Print Network [OSTI]

    Aickelin, Uwe

    nuclear power company British Energy ran into financial crisis in 2002 and had to be rescuedwww.electricitypolicy.org.uk EPRGWORKINGPAPERNON-TECHNICALSUMMARY Nuclear Power and Deregulated Electricity Markets: Lessons from British Energy EPRG Working Paper 0808 Simon Taylor When the privatised

  1. www.electricitypolicy.org.uk EPRGWORKINGPAPERNON-TECHNICALSUMMARY

    E-Print Network [OSTI]

    Aickelin, Uwe

    for gas-fired power the bulk of the costs relate to the purchase of fuel. Nuclear energy planning forceswww.electricitypolicy.org.uk EPRGWORKINGPAPERNON-TECHNICALSUMMARY Financing the Nuclear Renaissance with nuclear power. The cost structure of nuclear power differs significantly from that of fossil

  2. www.rsc.org Registered Charity Number 207890

    E-Print Network [OSTI]

    to stabilize the drops and make the droplet interface biocompatible. Title: Biocompatible surfactants for water-in-fluorocarbon.rsc.org/loc | Lab on a Chip Biocompatible surfactants for water-in-fluorocarbon emulsions C. Holtze,*a A. C. Rowat806706f Drops of water-in-fluorocarbon emulsions have great potential for compartmentalizing both

  3. CONTACT INFORMATION The KAVLI NANOSCIENCE INSTITUTE

    E-Print Network [OSTI]

    CONTACT INFORMATION The KAVLI NANOSCIENCE INSTITUTE California Institute of Technology 1200 E structures. The Holliston Parking Structure is nearest Steele Laboratory. rev052708 The KAVLI NANOSCIENCE to users from academia, government, and industry. The Kavli Nanoscience Institute has been founded through

  4. Thermodynamics of nuclei in thermal contact

    E-Print Network [OSTI]

    Karl-Heinz Schmidt; Beatriz Jurado

    2010-10-05T23:59:59.000Z

    The behaviour of a di-nuclear system in the regime of strong pairing correlations is studied with the methods of statistical mechanics. It is shown that the thermal averaging is strong enough to assure the application of thermodynamical methods to the energy exchange between the two nuclei in contact. In particular, thermal averaging justifies the definition of a nuclear temperature.

  5. Thin Silicon MEMS Contact-Stress Sensor

    SciTech Connect (OSTI)

    Kotovsky, J; Tooker, A; Horsley, D A

    2009-12-07T23:59:59.000Z

    This work offers the first, thin, MEMS contact-stress (CS) sensor capable of accurate in situ measruement of time-varying, contact-stress between two solid interfaces (e.g. in vivo cartilage contact-stress and body armor dynamic loading). This CS sensor is a silicon-based device with a load sensitive diaphragm. The diaphragm is doped to create piezoresistors arranged in a full Wheatstone bridge. The sensor is similar in performance to established silicon pressure sensors, but it is reliably produced to a thickness of 65 {micro}m. Unlike commercial devices or other research efforts, this CS sensor, including packaging, is extremely thin (< 150 {micro}m fully packaged) so that it can be unobtrusively placed between contacting structures. It is built from elastic, well-characterized materials, providing accurate and high-speed (50+ kHz) measurements over a potential embedded lifetime of decades. This work explored sensor designs for an interface load range of 0-2 MPa; however, the CS sensor has a flexible design architecture to measure a wide variety of interface load ranges.

  6. For additional information, contact: Department of Ecology

    E-Print Network [OSTI]

    Maxwell, Bruce D.

    For additional information, contact: Department of Ecology Montana State University 310 Lewis Hall P.O. Box 173460 Bozeman, MT 59717-3460 Tel: 406-994-4548 Fax: 406-994-3190 www.montana.edu/ecology/ ecology@montana.edu The Department of Ecology at Montana State University offers undergraduate majors

  7. subcollector Schottky collector contact & interconnect metals

    E-Print Network [OSTI]

    Rodwell, Mark J. W.

    base collector depletion layer subcollector ohmic metal (a) base collector depletion layer Schottky metal base emitter collector collector We emitter base emitter emitter We Wc Wc (b) Schottky collector contact & interconnect metals Emitter & collector Ohmics undoped collector depletion layer base N

  8. Contact Anosov flows and the FBI transform

    E-Print Network [OSTI]

    Tsujii, Masato

    2010-01-01T23:59:59.000Z

    This paper is about spectral properties of transfer operators for contact Anosov flows. The main result gives the essential spectral radius of the transfer operators acting on the so-called anisotropic Sobolev space exactly in terms of dynamical exponents. Also we provide a simplified proof by using the FBI transform.

  9. Contact Details Journeying Beyond Breast Cancer

    E-Print Network [OSTI]

    Espinosa, Horacio D.

    Home About Contact Details Facebook Search Journeying Beyond Breast Cancer making sense of the cancer experience Feeds: Posts Comments Cancer-fighting fountain pen May 20, 2009 by JBBC A research team be used both as a research tool in the development of next-generation cancer treatments

  10. Contact details: School of Architecture, BCU

    E-Print Network [OSTI]

    Birmingham, University of

    With 90% of the UK population living in urban areas, improving urban sustainability has become a pressing Economic Fabric This work package investigated opportunities and barriers to achieving sustainable is to be sustainable in the widest sense. Contact details: Centre for Urban and Regional Studies, U0B Dr. Austin Barber

  11. For more information, contact University Parking

    E-Print Network [OSTI]

    Mahon, Bradford Z.

    .275.4524 Have a Flat Tire? Car Won't Start? Need Directions? V.A.P. VEHICLE ASSISTANCE PROGRAM University Tire? Car Won't Start? Contact University Parking and Transportation's Vehicle Assistance Program (V-icer assistance during winter months ·Tire inflations Inclement Travel Information When inclement weather

  12. An extraordinary film sponsored by the Earth Engineering Center (EEC) www.eecny.org, www.wtert.org

    E-Print Network [OSTI]

    An extraordinary film sponsored by the Earth Engineering Center (EEC) www.eecny.org, www University Rapid economic development in the last few decades has been accompanied by the generation Engineering Center - The Wang Jiuliang film (1 hour) -Concluding remarks by Mr. Ling Qiu (M.S. candidate, SEAS

  13. Northwest Straits Commission, 10441 Bayview Edison Rd., Mt. Vernon WA 98273 phone: 360.428-1064 e-mail: info@nwstraits.org web: www.nwstraits.org

    E-Print Network [OSTI]

    Ocean acidification is a change in seawater chemistry due to the absorption of carbon dioxide. It is a local and global problem; a consequence of man-made carbon emissions. In Puget Sound, shellfish-mail: info@nwstraits.org web: www.nwstraits.org Ocean Acidification: Local action in the Northwest Straits

  14. Lactation Room Locations Building Location Room Details Contact Name Contact Info Instructions

    E-Print Network [OSTI]

    Jiang, Huiqiang

    , hot water heater, educational info Natalie Blais narnold@pitt.edu Contact Natalie to receive and request a key to this locked room. Public Health A712 Crabtree Hall table, chairs, storage cabinet, fridge

  15. Electrical contact arrangement for a coating process

    DOE Patents [OSTI]

    Kabagambe, Benjamin; McCamy, James W; Boyd, Donald W

    2013-09-17T23:59:59.000Z

    A protective coating is applied to the electrically conductive surface of a reflective coating of a solar mirror by biasing a conductive member having a layer of a malleable electrically conductive material, e.g. a paste, against a portion of the conductive surface while moving an electrodepositable coating composition over the conductive surface. The moving of the electrodepositable coating composition over the conductive surface includes moving the solar mirror through a flow curtain of the electrodepositable coating composition and submerging the solar mirror in a pool of the electrodepositable coating composition. The use of the layer of a malleable electrically conductive material between the conductive member and the conductive surface compensates for irregularities in the conductive surface being contacted during the coating process thereby reducing the current density at the electrical contact area.

  16. Direct contact, binary fluid geothermal boiler

    DOE Patents [OSTI]

    Rapier, Pascal M. (Richmond, CA)

    1982-01-01T23:59:59.000Z

    Energy is extracted from geothermal brines by direct contact with a working fluid such as isobutane which is immiscible with the brine in a geothermal boiler. The geothermal boiler provides a distributor arrangement which efficiently contacts geothermal brine with the isobutane in order to prevent the entrainment of geothermal brine in the isobutane vapor which is directed to a turbine. Accordingly the problem of brine carry-over through the turbine causes corrosion and scaling thereof is eliminated. Additionally the heat exchanger includes straightening vanes for preventing startup and other temporary fluctuations in the transitional zone of the boiler from causing brine carryover into the turbine. Also a screen is provided in the heat exchanger to coalesce the working fluid and to assist in defining the location of the transitional zone where the geothermal brine and the isobutane are initially mixed.

  17. Active alignment/contact verification system

    DOE Patents [OSTI]

    Greenbaum, William M. (Modesto, CA)

    2000-01-01T23:59:59.000Z

    A system involving an active (i.e. electrical) technique for the verification of: 1) close tolerance mechanical alignment between two component, and 2) electrical contact between mating through an elastomeric interface. For example, the two components may be an alumina carrier and a printed circuit board, two mating parts that are extremely small, high density parts and require alignment within a fraction of a mil, as well as a specified interface point of engagement between the parts. The system comprises pairs of conductive structures defined in the surfaces layers of the alumina carrier and the printed circuit board, for example. The first pair of conductive structures relate to item (1) above and permit alignment verification between mating parts. The second pair of conductive structures relate to item (2) above and permit verification of electrical contact between mating parts.

  18. Non-Contact Gaging with Laser Probe

    SciTech Connect (OSTI)

    Clinesmith, Mike

    2009-03-20T23:59:59.000Z

    A gage has been constructed using conventional (high end) components for the application of measuring fragile syntactic foam parts in a non-contact mode. Success with this approach has been achieved through a novel method of transferring (mapping) high accuracy local measurements of a coated aluminum master, taken on a Leitz Coordinate Measurement Machine (CMM), to the gage software system. The mapped data is then associated with local voltage readings from two (inner and outer) laser triangulating probes. This couples discreet laser probe offset and linearity characteristics to the measured master geometry. The gage software compares real part measured data against the master data to provide non-contact part inspection that results in a high accuracy and low uncertainty performance. Uncertainty from the part surface becomes the prevailing contributor to the gaging process. The gaging process provides a high speed, hands off measurement with nearly zero impedance.

  19. Photoinduced electron transfer in contact ion pairs

    SciTech Connect (OSTI)

    Bockman, T.M.; Kochi, J.K.

    1988-02-17T23:59:59.000Z

    Contact ion pair (CIP) formation is especially relevant to the reactivity of organic and organometallic nucleophiles and electrophiles in solution. The authors felt that the intermolecular charge-transfer (CT) absorptions which commonly accompany the interaction of uncharged nucleophiles (donors) with electrophiles (acceptors) could also provide the experimental means to assess CIP behavior. Accordingly they examined the CT excitations from CIPs of carbonylmetallate anions in this study, since they are known to be effective nucleophiles with relatively low ionization potentials.

  20. Renewable Energy Contacts | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious Rank EERE: AlternativeEnvironment,Institutes and LaunchesRelated FinancialUtility District |Contacts

  1. Property:Geothermal/Contact | Open Energy Information

    Open Energy Info (EERE)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data CenterFranconia, Virginia: Energy ResourcesLoadingPenobscot County, Maine:Plug PowerAddressDataFormatGeothermal/Contact" Showing 25

  2. Influence of surfactant on single ion track etching , Leo C.T.; Apel2

    E-Print Network [OSTI]

    Yu, K.N.

    , reproducible break-through times are achieved. Above 0.1 vol.-% surfactant concentration cylindrical channels heavy ion or fission fragment to supply the energy necessary for rendering a cylindrical volume around shapes are possible, such as narrow and wide cones, spherical troughs, barrels, and bottle necked

  3. rsta.royalsocietypublishing.org Cite this article: Fernandez-Oto C, Tlidi M,

    E-Print Network [OSTI]

    Gavilan, Marcel G. Clerc

    . Introduction Transport processes such as diffraction, dispersion, diffusion or thermal diffusivity are modelledrsta.royalsocietypublishing.org Research Cite this article: Fernandez-Oto C, Tlidi M, Escaff D

  4. Photovoltaic Electrical Contact and Cell Coating Basics | Department...

    Broader source: Energy.gov (indexed) [DOE]

    p-type seminconductor, and back contact. A typical solar cell consists of a glass or plastic cover, an antireflective coating, a front contact to allow electrons to enter a...

  5. Oak Ridge Site Specific Advisory Board Contacts | Department...

    Office of Environmental Management (EM)

    Contacts Oak Ridge Site Specific Advisory Board Contacts Mailing Address Oak Ridge Site Specific Advisory Board P.O. Box 2001, EM-91 Oak Ridge, TN 37831 Phone Numbers (865)...

  6. Protein folding using contact maps Michele Vendruscolo and Eytan Domany

    E-Print Network [OSTI]

    Domany, Eytan

    Protein folding using contact maps Michele Vendruscolo and Eytan Domany Department of Physics 26 I. INTRODUCTION Computational approaches to protein folding are divided into two main categories protein fold prediction. Contact maps are a particularly manageable representation of protein structure

  7. atomic aluminum contacts: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    rear-contact solar cell, we 59 LOSS ANALYSIS OF BACK-CONTACT BACK-JUNCTION THIN-FILM MONOCRYSTALLINE SILICON SOLAR CELLS Renewable Energy Websites Summary: of the...

  8. 2/21/2014 terragreen.teriin.org/popup.php?section_id=1905&category_id=10 http://terragreen.teriin.org/popup.php?section_id=1905&category_id=10 1/2

    E-Print Network [OSTI]

    Chiao, Jung-Chih

    2/21/2014 terragreen.teriin.org/popup.php?section_id=1905&category_id=10 http://terragreen.teriin.org/popup.php in the material because of the durable nickel alloy and smart aerodynamic design. #12;2/21/2014 terragreen.teriin.org/popup.php?section_id=1905&category_id=10 http://terragreen.teriin.org/popup.php?section_id=1905&category_id=10 2/2 "The

  9. ASYMPTOTIC SHAPE FOR THE CONTACT PROCESS IN RANDOM ENVIRONMENT

    E-Print Network [OSTI]

    Paris-Sud XI, Universit de

    ASYMPTOTIC SHAPE FOR THE CONTACT PROCESS IN RANDOM ENVIRONMENT OLIVIER GARET AND REGINE MARCHAND in stationary random environment. These theorems gen- eralize known results for the classical contact process environment, when the contact process survives, the set Ht/t almost surely converges to a compact set

  10. Ohmic contact metallization on p-type indium phosphide

    E-Print Network [OSTI]

    Park, Moonho

    1993-01-01T23:59:59.000Z

    contact resistivities comparable to those of Au-based contacts, determined by the Cox and Strack structure, can be obtained for a pure Pd contact on p-InP (hole concentration -3xlOl' cm-'). The defects can be identified to be related with phosphorus...

  11. Electrical Contacts to Molecular Layers by Nanotransfer Printing

    E-Print Network [OSTI]

    Rogers, John A.

    Electrical Contacts to Molecular Layers by Nanotransfer Printing Yueh-Lin Loo, David V. Lang, John of electrical contact. Results show that the nTP method produces superior devices in which the electrical for making electrical contacts in molecular electronics. Organic molecules whose electronic properties can

  12. Role of chemical termination in edge contact to graphene

    SciTech Connect (OSTI)

    Gao, Qun; Guo, Jing, E-mail: guoj@ufl.edu [Department of Electrical and Computer Engineering, University of Florida, Gainesville, Florida 32611 (United States)

    2014-05-01T23:59:59.000Z

    Edge contacts to graphene can offer excellent contact properties. Role of different chemical terminations is examined by using ab initio density functional theory and quantum transport simulations. It is found that edge termination by group VI elements O and S offers considerably lower contact resistance compared to H and group VII element F. The results can be understood by significantly larger binding energy and shorter binding distance between the metal contact and these group VI elements, which results in considerably lower interface potential barrier and larger transmission. The qualitative conclusion applies to a variety of contact metal materials.

  13. Silicon point contact concentrator solar cells

    SciTech Connect (OSTI)

    Sinton, R.A.; Kwark, Y.; Swirhun, S.; Swanson, R.M.

    1985-08-01T23:59:59.000Z

    Experimental results are presented for thin high resistivity concentrator silicon solar cells which use a back-side point-contact geometry. Cells of 130 and 233 micron thickness were fabricated and characterized. The thin cells were found to have efficiencies greater than 22 percent for incident solar intensities of 3 to 30 W/sq cm. Efficiency peaked at 23 percent at 11 W/sq cm measured at 22-25 C. Strategies for obtaining higher efficiencies with this solar cell design are discussed. 8 references.

  14. Federal NEPA Contacts | Department of Energy

    Office of Environmental Management (EM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) "of EnergyEnergyENERGY TAX POLICIES ANDIndustrialEnergy Federal EfficiencyReportingNEPA Contacts Federal

  15. Center for Advanced Solar Photophysics | Contacts

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc DocumentationP-Series to someone6Energy,MUSEUM DISPLAYCareersCathy-Ehli Sign InCenterContacts

  16. Contact Information | Princeton Plasma Physics Lab

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc DocumentationP-Series to User Group andCompositionalInitial Validation andPWRContaCtContact

  17. Contact OSUR Program | Princeton Plasma Physics Lab

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc DocumentationP-Series to User Group andCompositionalInitial ValidationContact Information

  18. Contact Us | National Nuclear Security Administration

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc DocumentationP-Series to User GroupInformation Administration (EIA)DonUs ContactLos Alamos

  19. Contact Us-About-PHaSe-EFRC

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc DocumentationP-Series to User GroupInformation Administration (EIA)DonUsContact

  20. Contacts for Enterprise Architecture | Department of Energy

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc DocumentationP-Series to User GroupInformationE-Gov Contacts for E-Gov LeAnn Oliver

  1. Contacts for IT Planning | Department of Energy

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc DocumentationP-Series to User GroupInformationE-Gov Contacts for E-Gov LeAnn

  2. NREL: Email Contact for NREL Newsroom

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsrucLas Conchas recoveryLaboratory | National Nuclearover twoPrintable Version Email Contact for NREL

  3. NREL: Energy Systems Integration Facility - Contact Us

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsrucLas Conchas recoveryLaboratory | National Nuclearover twoPrintableContact Us For more information

  4. Geothermal Technologies Office Contacts | Department of Energy

    Office of Environmental Management (EM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) "of Energy Power.pdf11-161-LNG | Department of EnergyGeothermal Technologies Office Contacts Geothermal

  5. ORISE: Contact Us | Worker Health Studies

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsrucLas Conchas recoveryLaboratory |CHEMPACK Mapping Application ORISECenterMaking aContact Us

  6. Laboratory Equipment Donation Program - Contact Us

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: VegetationEquipment Surfaces and Interfaces Sample6, 2011 LOSEngineering&Dynamos ProfessorContact Us

  7. DOE Research and Development Accomplishments Contact Us

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc DocumentationP-Series to UserProduct: Crude OilPublicDNALostPlasma PhysicsDOE Plans2BlogContact

  8. ARM - ARM Engineering and Operations Contacts

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformation Desert SouthwestTechnologies |NovemberARMContactsARM Engineering and Operations Contacts About

  9. RAPID/Contact | Open Energy Information

    Open Energy Info (EERE)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home5b9fcbce19 No revisionEnvReviewNonInvasiveExploration JumpSanyalTempWellheadWahkiakum CountyPzero JumpQuestionQuinhagakContact

  10. Contact CEFRC - Combustion Energy Frontier Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformation InInformationCenterResearchCASLNanoporousTestimony |IdahoVisionContact In This

  11. Contact Hanford Fire Department - Hanford Site

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformation InInformationCenterResearchCASLNanoporousTestimony |IdahoVisionContact In ThisDepartment

  12. Contact Us | Argonne Leadership Computing Facility

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformation InInformationCenterResearchCASLNanoporousTestimonyContact Us - Working With Us

  13. Fermilab | Illinois Accelerator Research Center | Contact IARC

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformation Desert Southwest Region service area. TheEPSCI Home It isGasERPSpunphoto Fermilab atContact

  14. SciTech Connect: Contact Us

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsrucLas ConchasPassiveSubmitted for USMaterialstheterahertzon HomeScholarshipsSciDBsmartContact

  15. Contact Information Systems | The Ames Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation Proposed New SubstationCleanCommunity2Workshops 2008 To1 Building 9201-1 wasFAbout UsContact

  16. Contact Us | Y-12 National Security Complex

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation Proposed New SubstationCleanCommunity2Workshops 2008 To1 BuildingContact UsNNSAContact

  17. Contacts For "F" | EMSL

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation Proposed New SubstationCleanCommunity2Workshops 2008 To1ContactA"

  18. Contacts For "J" | EMSL

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation Proposed New SubstationCleanCommunity2Workshops 2008 To1ContactA"G"

  19. Contacts For "L" | EMSL

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation Proposed New SubstationCleanCommunity2Workshops 2008 To1ContactA"G"K"

  20. Contacts For "M" | EMSL

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation Proposed New SubstationCleanCommunity2Workshops 2008 To1ContactA"G"K"M"

  1. Contacts For "O" | EMSL

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation Proposed New SubstationCleanCommunity2Workshops 2008O" Contacts For "O" Shaun

  2. Contacts For "P" | EMSL

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation Proposed New SubstationCleanCommunity2Workshops 2008O" Contacts For "O"

  3. Contacts For "Q" | EMSL

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation Proposed New SubstationCleanCommunity2Workshops 2008O" Contacts For "O"Q"

  4. Contacts For "R" | EMSL

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation Proposed New SubstationCleanCommunity2Workshops 2008O" Contacts For

  5. Contacts For "V" | EMSL

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation Proposed New SubstationCleanCommunity2Workshops 2008O" Contacts ForS"

  6. Contacts For "W" | EMSL

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation Proposed New SubstationCleanCommunity2Workshops 2008O" Contacts ForS"W"

  7. Contacts For "Z" | EMSL

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation Proposed New SubstationCleanCommunity2Workshops 2008O" Contacts ForS"W"Z"

  8. Air Entrainment by Viscous Contact Lines

    E-Print Network [OSTI]

    Marchand, Antonin; Snoeijer, Jacco H; Andreotti, Bruno

    2011-01-01T23:59:59.000Z

    The entrainment of air by advancing contact lines is studied by plunging a solid plate into a very viscous liquid. Above a threshold velocity, we observe the formation of an extended air film, typically 10 microns thick, which subsequently decays into air bubbles. Exploring a large range of viscous liquids, we find an unexpectedly weak dependence of entrainment speed on liquid viscosity, pointing towards a crucial role of the flow inside the air film. This induces a striking asymmetry between wetting and dewetting: while the breakup of the air film strongly resembles the dewetting of a liquid film, the wetting speeds are larger by orders of magnitude.

  9. Method of forming contacts for a back-contact solar cell

    DOE Patents [OSTI]

    Manning, Jane

    2013-07-23T23:59:59.000Z

    Methods of forming contacts for back-contact solar cells are described. In one embodiment, a method includes forming a thin dielectric layer on a substrate, forming a polysilicon layer on the thin dielectric layer, forming and patterning a solid-state p-type dopant source on the polysilicon layer, forming an n-type dopant source layer over exposed regions of the polysilicon layer and over a plurality of regions of the solid-state p-type dopant source, and heating the substrate to provide a plurality of n-type doped polysilicon regions among a plurality of p-type doped polysilicon regions.

  10. 10 IAEI NEWS September.October 2009 www.iaei.org connecting the inverter

    E-Print Network [OSTI]

    Johnson, Eric E.

    10 IAEI NEWS September.October 2009 www.iaei.org connecting the inverter by John Wiles CONNECTING THE INVERTER CONNECTING THE INVERTER 10 IAEI NEWS September.October 2009 #12;www.iaei.org September.October 2009 IAEI NEWS 11 connecting the inverter C onnecting the utility-interactive inverter prop- erly

  11. HARVARD UNIVERSITY VENDOR JUSTIFICATION/PRICE VERIFICATION FORM TUB AND ORG NAME: ___________________________ACCT.CODE:________________________________________________________DATE:_______

    E-Print Network [OSTI]

    Heller, Eric

    HARVARD UNIVERSITY VENDOR JUSTIFICATION/PRICE VERIFICATION FORM TUB AND ORG NAME/Org/Object/Fund/Activity/Sub-Activity/Root WEB VOUCHER NO:____________VENDOR:____________________! Grant !!!! Contract !!!!Cooperative Agreement (please check one) The Federal Government requires vendor selection justification and price verification

  12. A RESTful API for exchanging Materials Data in the AFLOWLIB.org consortium

    E-Print Network [OSTI]

    Curtarolo, Stefano

    A RESTful API for exchanging Materials Data in the AFLOWLIB.org consortium Richard H. Taylor1, an Application Program Interface (API) follow- ing REST principles is introduced for the AFLOWLIB.org materials through a RESTful API and a python library enabling ad-hoc ap- plications [17]. Other examples of online

  13. SARKAR ET AL. VOL. 8 ' NO. 4 ' 39924003 ' 2014 www.acsnano.org

    E-Print Network [OSTI]

    SARKAR ET AL. VOL. 8 ' NO. 4 ' 3992­4003 ' 2014 www.acsnano.org 3992 March 03, 2014 C 2014 American Chemical Society MoS2 Field-Effect Transistor for Next- Generation Label-Free Biosensors Deblina Sarkar ARTICLE #12;SARKAR ET AL. VOL. 8 ' NO. 4 ' 3992­4003 ' 2014 www.acsnano.org 3993 have also been used

  14. For Immediate release: 08/09/2011 Contact: Ingrid Wright

    E-Print Network [OSTI]

    Ward, Karen

    to Obtain ISO 9001 Certification Congressman Silvestre Reyes will recognize Xceed Resources (http://www.xceedresources.org) as the First Non-Profit to obtain ISO 9001 certification. Xceed Resources was able to achieve ISO 9001 Texas. ISO 9001 certification assures customers and clients that Xceed's quality management systems

  15. Topic suggestions? Comments? Contact us at snapshot@pnl.gov

    E-Print Network [OSTI]

    . Patrick Davis Program Manager Vehicle Technologies Sunita Satyapal Acting Program Manager Hydrogen, Fuel Cells and Infrastructure Technologies Sharing Best practices www.h2bestpractices.org reporting Lessons. The database serves as a voluntary reporting tool for capturing records of events involving hydrogen

  16. Re: Affordable Textbooks, Fall Semester Update In a message dated 10/28/2010 10:28:50 A.M. Eastern Daylight Time, nicole@studentpirgs.org

    E-Print Network [OSTI]

    Garfunkel, Eric

    .M. Eastern Daylight Time, nicole@studentpirgs.org writes: Hi everyone, There have been some exciting

  17. Contact structure for use in catalytic distillation

    DOE Patents [OSTI]

    Jones, E.M. Jr.

    1984-03-27T23:59:59.000Z

    A method is described for conducting catalytic chemical reactions and fractionation of the reaction mixture comprising feeding reactants into a distillation column reactor, contracting said reactant in liquid phase with a fixed bed catalyst in the form of a contact catalyst structure consisting of closed porous containers containing the catalyst for the reaction and a clip means to hold and support said containers, which are disposed above, i.e., on the distillation trays in the tower. The trays have weir means to provide a liquid level on the trays to substantially cover the containers. In other words, the trays function in their ordinary manner with the addition thereto of the catalyst. The reaction mixture is concurrently fractionated in the column. 7 figs.

  18. Contact structure for use in catalytic distillation

    DOE Patents [OSTI]

    Jones, E.M. Jr.

    1985-08-20T23:59:59.000Z

    A method and apparatus are disclosed for conducting catalytic chemical reactions and fractionation of the reaction mixture, comprising and feeding reactants into a distillation column reactor contracting said reactant in a liquid phase with a fixed bed catalyst in the form of a contact catalyst structure, consisting of closed porous containers containing the catalyst for the reaction and a clip means to hold and support said containers, which are disposed above, i.e., on the distillation trays in the tower. The trays have weir means to provide a liquid level on the trays to substantially cover the containers. In other words, the trays function in their ordinary manner with the addition thereto of the catalyst. The reaction mixture is concurrently fractionated in the column. 7 figs.

  19. Contact structure for use in catalytic distillation

    DOE Patents [OSTI]

    Jones, Jr., Edward M. (Friendswood, TX)

    1984-01-01T23:59:59.000Z

    A method for conducting catalytic chemical reactions and fractionation of the reaction mixture comprising feeding reactants into a distillation column reactor contracting said reactant in liquid phase with a fixed bed catalyst in the form of a contact catalyst structure consisting of closed porous containers containing the catatlyst for the reaction and a clip means to hold and support said containers, which are disposed above, i.e., on the distillation trays in the tower. The trays have weir means to provide a liquid level on the trays to substantially cover the containers. In other words, the trays function in their ordinary manner with the addition thereto of the catalyst. The reaction mixture is concurrently fractionated in the column.

  20. Contact structure for use in catalytic distillation

    DOE Patents [OSTI]

    Jones, Jr., Edward M. (Friendswood, TX)

    1985-01-01T23:59:59.000Z

    A method and apparatus for conducting catalytic chemical reactions and fractionation of the reaction mixture, comprising and feeding reactants into a distillation column reactor contracting said reactant in a liquid phase with a fixed bed catalyst in the form of a contact catalyst structure, consisting of closed porous containers containing the catalyst for the reaction and a clip means to hold and support said containers, which are disposed above, i.e., on the distillation trays in the tower. The trays have weir means to provide a liquid level on the trays to substantially cover the containers. In other words, the trays function in their ordinary manner with the addition thereto of the catalyst. The reaction mixture is concurrently fractionated in the column.

  1. SciTech Connect: Passivated Tunneling Contacts to N-Type Wafer...

    Office of Scientific and Technical Information (OSTI)

    Golden, CO. Sponsoring Org: USDOE Office of Energy Efficiency and Renewable Energy Solar Energy Technologies Office Country of Publication: United States Language: English...

  2. The contact of elastic regular wavy surfaces revisited

    E-Print Network [OSTI]

    Vladislav A. Yastrebov; Guillaume Anciaux Jean-Francois Molinari

    2014-09-05T23:59:59.000Z

    We revisit the classic problem of an elastic solid with a two-dimensional wavy surface squeezed against an elastic flat half-space from infinitesimal to full contact. Through extensive numerical calculations and analytic derivations, we discover previously overlooked transition regimes. These are seen in particular in the evolution with applied load of the contact area and perimeter, the mean pressure and the probability density of contact pressure. These transitions are correlated with the contact area shape, which is affected by long range elastic interactions. Our analysis has implications for general random rough surfaces, as similar local transitions occur continuously at detached areas or coalescing contact zones. We show that the probability density of null contact pressures is non-zero at full contact. This might suggest revisiting the conditions necessary for applying Persson's model at partial contacts and guide the comparisons with numerical simulations. We also address the evaluation of the contact perimeter for discrete geometries and the applicability of Westergaard's solution for three-dimensional geometries.

  3. Nanoscale contact engineering for Si/Silicide nanowire devices.

    E-Print Network [OSTI]

    Lin, Yung-Chen

    2012-01-01T23:59:59.000Z

    ??Metal silicides have been used in silicon technology as contacts to achieve high device performance and desired device functions. The growth and applications of silicide (more)

  4. Contacts for the Assistant General Counsel for Legislation, Regulation...

    Energy Savers [EERE]

    Legislation, Regulation, and Energy Efficiency Contacts for the Assistant General Counsel for Legislation, Regulation, and Energy Efficiency Office of the Assistant General Counsel...

  5. Contacts for the Assistant General Counsel for Technology Transfer...

    Broader source: Energy.gov (indexed) [DOE]

    Technology Transfer and Procurement Contacts for the Assistant General Counsel for Technology Transfer and Procurement Subject MatterFunctional Area Lead Backup Technology...

  6. Registered_Lobbyist_Contact_Disclosure_Form.pdf | Department...

    Broader source: Energy.gov (indexed) [DOE]

    egisteredLobbyistContactDisclosureForm.pdf More Documents & Publications Lobbyist Disclosure Form - AltEn Interested Parties - Shipp Interested Parties - Smith Dawson & Andrews...

  7. Ohmic contacts for high-temperature GaP devices

    E-Print Network [OSTI]

    Van der Hoeven, Willem Bernard

    2012-06-07T23:59:59.000Z

    REMOVAL 10 13 24 24 26 50 50 52 78 80 83 98 98 99 100 TABLE OF CONTENTS (Continued) APPENDIX D ? 6 LIFT-OFF PREMETAL PREPARATION APPENDIX D ? 7 METAL LIFTOFF Page 100 100 vi LIST OP TABLES Table I Relative High Temperature... with a variety of III-V compound semi- conductors and contact metals. By using a ruby or a COe laser with Au-Sn or Ag-Sn contact metals, specific contact resistances as low as 8. 6 x 19 " 0-cm were reported. (The specific contact resistance...

  8. A Drucker-Prager model for elastic contact with friction; A Drucker-Prager model for elastic contact with friction.

    E-Print Network [OSTI]

    wu, yunxian

    2011-01-01T23:59:59.000Z

    ?? In mumerical contact simulations with friction, the simple Coloumb law is usually employed. Standard plasticity models are difficult to use since the balance enforced (more)

  9. Contact Information: Jeff Williams, MLIS phone (858) 822-2218

    E-Print Network [OSTI]

    California at San Diego, University of

    Contact Information: Jeff Williams, MLIS phone (858) 822-2218 Biology Librarian fax (858) 822-2219 UCSD Biomedical Library j12williams@ucsd.edu Life Sciences Newsletter UCSD Biomedical Library Fall 2004 contact me at (858) 822-2218 or j12williams@ucsd.edu Top Biology Resources ­ http

  10. RELATIVISTIC HEAVY-ION PHYSICS WITHOUT NUCLEAR CONTACT

    E-Print Network [OSTI]

    Bertulani, Carlos A. - Department of Physics and Astronomy, Texas A&M University

    RELATIVISTIC HEAVY-ION PHYSICS WITHOUT NUCLEAR CONTACT The large electromagnetic field generated physics research--for example, for investigating nuclear structure, hadronic structure, atomic physics Berkeley Laboratory--it became clear that heavy-ion physics without nuclear contact could be very useful

  11. Contact Information: Sophia Radlowski, Assistant to the Director for Budgeting

    E-Print Network [OSTI]

    Illinois at Chicago, University of

    Contact Information: Sophia Radlowski, Assistant to the Director for Budgeting Contact regarding will be mailed to you by Sophia Radlowski. 1. Read the offer letter carefully. If you agree to the terms, please form, original drug-free workplace statement, and copy of IDs listed above to: Sophia Radlowski UIC

  12. Energy-efficient Contact Probing in Opportunistic Mobile Networks

    E-Print Network [OSTI]

    Wu, Jie

    a trade-off between energy efficiency and the contact opportunities in OppNets. In this paper, in order proposed model. Finally, based on the proposed model, we analyze the trade- off between energy efficiency to a trade-off between energy efficiency and contact opportunities. For strategies which use a constant

  13. Making Contact: Getting the Group Communicating with Groupware

    E-Print Network [OSTI]

    Greenberg, Saul

    is that people must be in contact with one another. Relationships must be established, and many interactions that overcomes distance barriers is available. Many mundane factors interfere with making contact. People must, people must find each other with minimal effort. People must also select one or more of the many

  14. Event Logistics Checklist and Contacts Questions to consider

    E-Print Network [OSTI]

    Sherrill, David

    will my space need to include? 4. How many people will be attending? a. For every 250 people, one security/Chairs/Tents Questions to Consider: 1. Will people be sitting at your event? 2. How many people are attending? 3. Do you people, an EMT is expected. GTPD can provide contacts for EMTs. Relevant Contacts: 1. Beverly Peace

  15. Air Entrainment by Viscous Contact Lines Antonin Marchand1

    E-Print Network [OSTI]

    Air Entrainment by Viscous Contact Lines Antonin Marchand1 , Tak Shing Chan2 , Jacco H. Snoeijer2) The entrainment of air by advancing contact lines is studied by plunging a solid plate into a very viscous liquid by orders of magnitude. Objects that impact on a liquid interface can entrain small bubbles of air

  16. Neutron irradiation effects on metal-gallium nitride contacts

    SciTech Connect (OSTI)

    Katz, Evan J.; Lin, Chung-Han; Zhang, Zhichun [Department of Electrical and Computer Engineering, The Ohio State University, Columbus, Ohio 43210 (United States); Qiu, Jie; Cao, Lei [Nuclear Engineering Program, Department of Mechanical and Aerospace Engineering, The Ohio State University, Columbus, Ohio 43210 (United States); Mishra, Umesh K. [Departments of Electrical and Computer Engineering and Materials Science and Engineering University of California, Santa Barbara, California 93106 (United States); Brillson, Leonard J., E-mail: brillson.1@osu.edu [Department of Electrical and Computer Engineering, The Ohio State University, Columbus, Ohio 43210 (United States); Department of Physics and Center for Materials Research, The Ohio State University, Columbus, Ohio 43210 (United States)

    2014-03-28T23:59:59.000Z

    We have measured the effect of fast and thermal neutrons on GaN Schottky barriers and ohmic contacts using currentvoltage and transmission line method electrical techniques, optical, atomic force and scanning electron microscopy morphological techniques, and X-ray photoemission spectroscopy chemical techniques. These studies reveal a 10{sup 15}?n/cm{sup 2} neutron threshold for Schottky barrier ideality factor increases, a 10{sup 15}?n/cm{sup 2} fast plus thermal neutron threshold for ohmic contact sheet and contact resistance increases, and 10{sup 16}?n/cm{sup 2} neutron fluence threshold for major device degradation identified with thermally driven diffusion of Ga and N into the metal contacts and surface phase changes. These results demonstrate the need for protecting metal-GaN contacts in device applications subject to neutron radiation.

  17. Generalized nuclear contacts and the nucleon's momentum distributions

    E-Print Network [OSTI]

    Weiss, Ronen; Barnea, Nir

    2015-01-01T23:59:59.000Z

    The general nuclear contact matrices are defined, taking into consideration all partial waves and finite-range interactions, extending Tan's work for the zero range model. The properties of these matrices are discussed and the relations between the contacts and the one-nucleon and two-nucleon momentum distributions are derived. Using these relations, a new asymptotic connection between the one-nucleon and two-nucleon momentum distributions, describing the two-body short-range correlations in nuclei, is obtained. Using available numerical data, we extract few connections between the different contacts and verify their relations to the momentum distributions. The numerical data also allows us to identify the main nucleon momentum range affected by two-body short-range correlations. Utilizing these relations and the numerical data, we also verify a previous independent prediction connecting between the Levinger constant and the contacts. This work provides an important indication for the relevance of the contact...

  18. Method and apparatus for high-efficiency direct contact condensation

    DOE Patents [OSTI]

    Bharathan, D.; Parent, Y.; Hassani, A.V.

    1999-07-20T23:59:59.000Z

    A direct contact condenser having a downward vapor flow chamber and an upward vapor flow chamber, wherein each of the vapor flow chambers includes a plurality of cooling liquid supplying pipes and a vapor-liquid contact medium disposed thereunder to facilitate contact and direct heat exchange between the vapor and cooling liquid. The contact medium includes a plurality of sheets arranged to form vertical interleaved channels or passageways for the vapor and cooling liquid streams. The upward vapor flow chamber also includes a second set of cooling liquid supplying pipes disposed beneath the vapor-liquid contact medium which operate intermittently in response to a pressure differential within the upward vapor flow chamber. The condenser further includes separate wells for collecting condensate and cooling liquid from each of the vapor flow chambers. In alternate embodiments, the condenser includes a cross-current flow chamber and an upward flow chamber, a plurality of upward flow chambers, or a single upward flow chamber. The method of use of the direct contact condenser of this invention includes passing a vapor stream sequentially through the downward and upward vapor flow chambers, where the vapor is condensed as a result of heat exchange with the cooling liquid in the contact medium. The concentration of noncondensable gases in the resulting condensate-liquid mixtures can be minimized by controlling the partial pressure of the vapor, which depends in part upon the geometry of the vapor-liquid contact medium. In another aspect of this invention, the physical and chemical performance of a direct contact condenser can be predicted based on the vapor and coolant compositions, the condensation conditions, and the geometric properties of the contact medium. 39 figs.

  19. Method and apparatus for high-efficiency direct contact condensation

    DOE Patents [OSTI]

    Bharathan, Desikan (Lakewood, CO); Parent, Yves (Golden, CO); Hassani, A. Vahab (Golden, CO)

    1999-01-01T23:59:59.000Z

    A direct contact condenser having a downward vapor flow chamber and an upward vapor flow chamber, wherein each of the vapor flow chambers includes a plurality of cooling liquid supplying pipes and a vapor-liquid contact medium disposed thereunder to facilitate contact and direct heat exchange between the vapor and cooling liquid. The contact medium includes a plurality of sheets arranged to form vertical interleaved channels or passageways for the vapor and cooling liquid streams. The upward vapor flow chamber also includes a second set of cooling liquid supplying pipes disposed beneath the vapor-liquid contact medium which operate intermittently in response to a pressure differential within the upward vapor flow chamber. The condenser further includes separate wells for collecting condensate and cooling liquid from each of the vapor flow chambers. In alternate embodiments, the condenser includes a cross-current flow chamber and an upward flow chamber, a plurality of upward flow chambers, or a single upward flow chamber. The method of use of the direct contact condenser of this invention includes passing a vapor stream sequentially through the downward and upward vapor flow chambers, where the vapor is condensed as a result of heat exchange with the cooling liquid in the contact medium. The concentration of noncondensable gases in the resulting condensate-liquid mixtures can be minimized by controlling the partial pressure of the vapor, which depends in part upon the geometry of the vapor-liquid contact medium. In another aspect of this invention, the physical and chemical performance of a direct contact condenser can be predicted based on the vapor and coolant compositions, the condensation conditions. and the geometric properties of the contact medium.

  20. ISSUE 17 MAY 2014 A NAACP ECONOMIC PROGRAMS PUBLICATION WWW.NAACP.ORG/ECON

    E-Print Network [OSTI]

    California at Santa Barbara, University of

    ANNIVERSARY #12;ISSUE 15 January 2014 NGLE THE A NAACP ECONOMIC PROGRAMS PUBLICATION EDITOR: NICOLE E. KENNEY is the very bottom of hardships." -W.E.B. Du Bois WWW.NAACP.ORG/ECON BROWNV.BOARDOFEDUCATION 60TH ANNIVERSARY

  1. BOOKS ET AL. 31 JULY 2009 VOL 325 SCIENCE www.sciencemag.org540

    E-Print Network [OSTI]

    Shneiderman, Ben

    BOOKS ET AL. 31 JULY 2009 VOL 325 SCIENCE www.sciencemag.org540 geoengineering schemes have little option but to try vari- ous geoengineering schemes to moderate what he feels

  2. www.iisd.org/tkn 2012 The International Institute for Sustainable Development The Australian Government's

    E-Print Network [OSTI]

    www.iisd.org/tkn 2012 The International Institute for Sustainable Development The Australian July 2012 #12; 2012 The International Institute for Sustainable Development TKN REPORT JULY 2012 Institute for Sustainable Development Published by the International Institute for Sustainable Development

  3. http://occr.christiantimes.org.hk/art_0123.htm 1 Christianity and Culture

    E-Print Network [OSTI]

    Yu, Alex

    http://occr.christiantimes.org.hk/art_0123.htm 1 Christianity and Culture Jerry Solomon Jerry Solomon field ministries Probe Ministries "Mind Games" College Prep Criswell College University measurement, statistics and methodological studies Cisco Systems PDF PDF html

  4. Meteoritics & Planetary Science 38, Nr 6, 871885 (2003) Abstract available online at http://meteoritics.org

    E-Print Network [OSTI]

    Hamilton, Victoria E.

    Meteoritics & Planetary Science 38, Nr 6, 871­885 (2003) Abstract available online at http://meteoritics.org 871 © Meteoritical Society, 2003. Printed in USA. Searching for the source regions of martian

  5. rspb.royalsocietypublishing.org Cite this article: Trumble BC, Smith EA,

    E-Print Network [OSTI]

    Smith, Eric Alden

    rspb.royalsocietypublishing.org Research Cite this article: Trumble BC, Smith EA, O'Connor KA A. Smith3,4, Kathleen A. O'Connor3,4, Hillard S. Kaplan5 and Michael D. Gurven2 1 Institute

  6. www.bluesci.orgIssue 14 Lent 2009 Randomness . Electronic Paper . Huntington's Disease

    E-Print Network [OSTI]

    Cambridge, University of

    www.bluesci.orgIssue 14 Lent 2009 Randomness . Electronic Paper . Huntington's Disease Stories from by Darwinian Chemistry Selection of the fittest molecules Biological Warfare Does biodefence research make us

  7. Analysis of a-Si:H/TCO contact resistance for the Si heterojunction back-contact solar cell

    E-Print Network [OSTI]

    Park, Byungwoo

    Analysis of a-Si:H/TCO contact resistance for the Si heterojunction back-contact solar cell Seung- circuit voltage (Voc) and the conversion efficiency of the Si solar cell. Recently, a-Si:H heterojunction (heterojunction with intrinsic thin layer) cell [1] even with practical-sized Czochralski-grown (CZ) wafer. The a-Si:H

  8. Contact Resistance for "End-Contacted" Metal-Graphene and Metal-Nanotube Interfaces from Quantum Mechanics

    E-Print Network [OSTI]

    Goddard III, William A.

    ballistic conductance,12-14 and high thermal conductivity.15 Indeed, significant progress has been made layer graphene has been demonstrated to exhibit high electron mobility (15 000 cm2 /(V s)) and thermalContact Resistance for "End-Contacted" Metal-Graphene and Metal-Nanotube Interfaces from Quantum

  9. Method of forming contacts for a back-contact solar cell

    DOE Patents [OSTI]

    Manning, Jane

    2014-07-15T23:59:59.000Z

    Methods of forming contacts for solar cells are described. In one embodiment, a method includes forming a silicon layer above a substrate, forming and patterning a solid-state p-type dopant source on the silicon layer, forming an n-type dopant source layer over exposed regions of the silicon layer and over a plurality of regions of the solid-state p-type dopant source, and heating the substrate to provide a plurality of n-type doped silicon regions among a plurality of p-type doped silicon regions.

  10. Journal of Materials Research http://journals.cambridge.org/JMR

    E-Print Network [OSTI]

    McCluskey, Matthew

    and heated freezer windows.8 A dom- inant market for TCOs is provided by flat-panel displays (TCOs) are currently used in products such as flat-panel displays. The prevailing n-type conductivity (ITO), as a transparent electrode. ITO is also used as the front contact in photovoltaic solar cells.9

  11. Mechanical contact by constraints and split-based preconditioning

    SciTech Connect (OSTI)

    Dmitry Karpeyev; Derek Gaston; Jason Hales; Steven Novascone

    2014-03-01T23:59:59.000Z

    An accurate implementation of glued mechanical contact was developed in MOOSE based on its Constraint system. This approach results in a superior convergence of elastic structure problems, in particular in BISON. Adaptation of this technique to frictionless and frictional contact models is under way. Additionally, the improved convergence of elastic problems results from the application of the split-based preconditioners to constraint-based systems. This yields a substantial increase in the robustness of elastic solvers when the number of nodes in contact is increased and/or the mesh is refined.

  12. The hierarchical properties of contact networks in granular packings

    E-Print Network [OSTI]

    T. Aste; T. J. Senden

    2005-04-14T23:59:59.000Z

    The topological structure resulting from the network of contacts between grains (contact network) is studied for very large samples of disorderly-packed monosized spheres with densities ranging from 0.58 to 0.64. The hierarchical organization of such a structure is studied by means of a topological map which starts from a given sphere and moves outwards in concentric shells through the contact network. We find that the topological density of disordered sphere packing is larger than the topological density of equivalent lattice sphere packings.

  13. Contacts - Madison Dynamo Experiment - Cary Forest Group - UW Plasma

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation Proposed New SubstationCleanCommunity2Workshops 2008 To1Contact CommunityContactContacts

  14. Contact Information: Jeff Williams, MLIS phone (858) 822-2218

    E-Print Network [OSTI]

    California at San Diego, University of

    Contact Information: Jeff Williams, MLIS phone (858) 822-2218 Biology Librarian fax (858) 822-2219 UCSD Biomedical Library j12williams@ucsd.edu Life Sciences Newsletter UCSD Biomedical Library Spring

  15. Extrapolating Sparse Large-Scale GPS Traces for Contact Evaluation

    E-Print Network [OSTI]

    Ott, Jörg

    , such as access points and cell towers, and occasionally also their geo- graphic location. However, given the larger transmission ranges of network elements, whether a short-range contact could take place can only

  16. Optics, mask and resist implications on contact CDU

    SciTech Connect (OSTI)

    Naulleau, Patrick

    2010-06-01T23:59:59.000Z

    Mask and condenser roughness plays important in contact CDU. Resist blur drives both dose requirements and mask specs. Correlation methods can be used to measure mask contributions to CDU.

  17. Influence of surface roughness and waviness upon thermal contact resistance

    E-Print Network [OSTI]

    Yovanovich, M. Michael

    1967-01-01T23:59:59.000Z

    This work deals with the phenomenon of thermal resistance between contacting solids. Attention is directed towards contiguous solids possessing both surface roughness and waviness. When two such surfaces are brought together ...

  18. Images in Emergency Medicine: Irritant Contact Dermatitis from Jet Fuel

    E-Print Network [OSTI]

    Trigger, Christopher C; Eilbert, Wesley

    2009-01-01T23:59:59.000Z

    and penetration of JP-8 jet fuel and its components. Toxicoland other kerosene-based fuels have been shown to cause skinContact Dermatitis from Jet Fuel Christopher C. Trigger, MD

  19. Dynamics of clusters and molecules in contact with an environment

    E-Print Network [OSTI]

    Giraud, Olivier

    (embedded, deposited) Fundamental studies on mechanisms (irradiation, deposition) (Nano) Contacts with insulators (ionic crystals, rare gases...) Low energy dynamics (optical response, deposition) Laser irradiation #12;Time Dependent Density Functional Theory (TDDFT) Ensemble of orbitals (1 electron

  20. Impedance Control of a Pneumatic Actuator for Contact Tasks

    E-Print Network [OSTI]

    Barth, Eric J.

    of a pneumatic system is that of compliant actuation. By virtue of the compressibility of air, a pneumatic and stable force control, less damage during inadvertent contact, and the potential for energy storage." [1

  1. Centralized processing of contact-handled TRU waste feasibility analysis

    SciTech Connect (OSTI)

    Not Available

    1986-12-01T23:59:59.000Z

    This report presents work for the feasibility study of central processing of contact-handled TRU waste. Discussion of scenarios, transportation options, summary of cost estimates, and institutional issues are a few of the subjects discussed. (JDL)

  2. Hearing Material 1 Perception of Material from Contact Sounds

    E-Print Network [OSTI]

    Pai, Dinesh

    of simulated enviroments. This circumstance is unfortunate, when one considers that sounds provide important, the force of impact, and the location of contact relative to object geometry. In this paper we concentrate

  3. Measurement of normal contact stiffness of fractal rough surfaces

    E-Print Network [OSTI]

    Chongpu Zhai; Sbastien Bevand; Yixiang Gan; Dorian Hanaor; Gwnalle Proust; Bruno Guelorget; Delphine Retraint

    2014-09-03T23:59:59.000Z

    We investigate the effects of roughness and fractality on the normal contact stiffness of rough surfaces. Samples of isotropically roughened aluminium surfaces are considered. The roughness and fractal dimension were altered through blasting using different sized particles. Subsequently, surface mechanical attrition treatment (SMAT) was applied to the surfaces in order to modify the surface at the microscale. The surface topology was characterised by interferometry based profilometry. The normal contact stiffness was measured through nanoindentation with a flat tip utilising the partial unloading method. We focus on establishing the relationships between surface stiffness and roughness, combined with the effects of fractal dimension. The experimental results, for a wide range of surfaces, showed that the measured contact stiffness depended very closely on surfaces' root mean squared (RMS) slope and their fractal dimension, with correlation coefficients of around 90\\%, whilst a relatively weak correlation coefficient of 57\\% was found between the contact stiffness and RMS roughness.

  4. 2014 EMPLOYEE BENEFIT INSURANCE PLAN CONTACTS Health Insurance

    E-Print Network [OSTI]

    2014 EMPLOYEE BENEFIT INSURANCE PLAN CONTACTS Health Insurance Anthem Blue Cross and Blue Shield www.anthem.com ? BlueAdvantage Point of Service Plan (HMO/POS) ? PRIME Health Plan (PPO) and Custom Plus Health Plan Phone

  5. Graded Materials for Resistance to Contact Deformation and Damage

    E-Print Network [OSTI]

    Suresh, Subra

    Graded Materials for Resistance to Contact Deformation and Damage S. Suresh The mechanical response as diverse as tribology, geology, optoelectronics, biomechanics, fracture mechanics, and nanotechnology changes in the elastic properties of sands, soils, and rocks beneath Earth's surface in- fluence

  6. aluminum alloyed contacts: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Modarres Razavi, Sonia 2012-02-14 116 LOSS ANALYSIS OF BACK-CONTACT BACK-JUNCTION THIN-FILM MONOCRYSTALLINE SILICON SOLAR CELLS Renewable Energy Websites Summary: of the...

  7. Au-free Ohmic Contacts to Gallium Nitride and Graphene

    E-Print Network [OSTI]

    Ravikirthi, Pradhyumna

    2014-08-10T23:59:59.000Z

    This work deals with Au-free contact metallization schemes for gallium nitride (GaN) and graphene semiconductors. Graphene and gallium nitride are promising materials that can potentially be integrated together in the near future for high frequency...

  8. Multifrequency Imaging in the Intermittent Contact Mode of Atomic...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    of the intermittent-contact (IC) 1-4 and noncontact (NC) 5 modes of atomic force micro- scopy (AFM) has opened a pathway towards high-resolution nondestructive imaging of...

  9. A multi-scale iterative approach for finite element modeling of thermal contact resistance

    E-Print Network [OSTI]

    Thompson, Mary Kathryn, 1980-

    2007-01-01T23:59:59.000Z

    Surface topography has long been considered a key factor in the performance of many contact applications including thermal contact resistance. However, essentially all analytical and numerical models of thermal contact ...

  10. Degradation of Iris Recognition Performance Due to Non-Cosmetic Prescription Contact Lenses

    E-Print Network [OSTI]

    Bowyer, Kevin W.

    stated as: "Subjects can generally be recognized through eyeglasses or contact lenses. Colored contact with the recognition technology" [5] and "Successful identification can be made through eyeglasses and contact lenses

  11. Published: March 16, 2011 r 2011 American Chemical Society 1603 dx.doi.org/10.1021/nl104514m |Nano Lett. 2011, 11, 16031608

    E-Print Network [OSTI]

    Wang, Zhong L.

    Published: March 16, 2011 r 2011 American Chemical Society 1603 dx.doi.org/10.1021/nl104514m |Nano Lett. 2011, 11, 1603­1608 LETTER pubs.acs.org/NanoLett Light Propagation in Curved Silver Nanowire

  12. 8/11/2014 BarryOno Collection https://web.archive.org/web/20071117013221/http://www.bl.uk/collections/onoweb.html 1/2

    E-Print Network [OSTI]

    8/11/2014 BarryOno Collection https://web.archive.org/web/20071117013221/http;8/11/2014 BarryOno Collection https://web.archive.org/web/20071117013221/http

  13. Direct-contact closed-loop heat exchanger

    DOE Patents [OSTI]

    Berry, Gregory F. (Naperville, IL); Minkov, Vladimir (Skokie, IL); Petrick, Michael (Joliet, IL)

    1984-01-01T23:59:59.000Z

    A high temperature heat exchanger with a closed loop and a heat transfer liquid within the loop, the closed loop having a first horizontal channel with inlet and outlet means for providing direct contact of a first fluid at a first temperature with the heat transfer liquid, a second horizontal channel with inlet and outlet means for providing direct contact of a second fluid at a second temperature with the heat transfer liquid, and means for circulating the heat transfer liquid.

  14. Fiber tip interferometry for non-contact ultrasonic NDE

    E-Print Network [OSTI]

    Schumacher, Neal Andrew

    2012-06-07T23:59:59.000Z

    FIBER TIP INTERFEROMETRY FOR NON-CONTACT ULTRASONIC NDE A Thesis by Neal Andrew Schumacher Submitted to the Office of Graduate Studies of Texas A&M University in partial fulfillment of the requirements for the degree of MASTER OF SCIENCE... August 1990 Major Subject: Mechanical Engineering FIBER TIP INTERFEROMETRY FOR NON-CONTACT ULTRASONIC NDE A Thesis by Neal Andrew Schumacher Approved as to style and content by: Christian P. Burger (Chair of Committee) Hans Schuessler...

  15. Superconductor-normal-superconductor with distributed Sharvin point contacts

    DOE Patents [OSTI]

    Holcomb, Matthew J. (San Mateo County, CA); Little, William A. (Santa Clara County, CA)

    1994-01-01T23:59:59.000Z

    A non-linear superconducting junction device comprising a layer of high transient temperature superconducting material which is superconducting at an operating temperature, a layer of metal in contact with the layer of high temperature superconducting material and which remains non-superconducting at the operating temperature, and a metal material which is superconducting at the operating temperature and which forms distributed Sharvin point contacts with the metal layer.

  16. Electronic Non-Contacting Linear Position Measuring System

    DOE Patents [OSTI]

    Post, Richard F. (Walnut Creek, CA)

    2005-06-14T23:59:59.000Z

    A non-contacting linear position location system employs a special transmission line to encode and transmit magnetic signals to a receiver on the object whose position is to be measured. The invention is useful as a non-contact linear locator of moving objects, e.g., to determine the location of a magnetic-levitation train for the operation of the linear-synchronous motor drive system.

  17. Amorphous silicon passivated contacts for diffused junction silicon solar cells

    SciTech Connect (OSTI)

    Bullock, J., E-mail: james.bullock@anu.edu.au; Yan, D.; Wan, Y.; Cuevas, A. [Research School of Engineering, The Australian National University, Canberra, ACT 0200 (Australia); Demaurex, B.; Hessler-Wyser, A.; De Wolf, S. [cole Polytechnique Fdrale de Lausanne (EPFL), Institute of micro engineering (IMT), Photovoltaics and Thin Film Electronic Laboratory, Maladire 71, CH-200 Neuchtel (Switzerland)

    2014-04-28T23:59:59.000Z

    Carrier recombination at the metal contacts is a major obstacle in the development of high-performance crystalline silicon homojunction solar cells. To address this issue, we insert thin intrinsic hydrogenated amorphous silicon [a-Si:H(i)] passivating films between the dopant-diffused silicon surface and aluminum contacts. We find that with increasing a-Si:H(i) interlayer thickness (from 0 to 16?nm) the recombination loss at metal-contacted phosphorus (n{sup +}) and boron (p{sup +}) diffused surfaces decreases by factors of ?25 and ?10, respectively. Conversely, the contact resistivity increases in both cases before saturating to still acceptable values of ? 50 m? cm{sup 2} for n{sup +} and ?100 m? cm{sup 2} for p{sup +} surfaces. Carrier transport towards the contacts likely occurs by a combination of carrier tunneling and aluminum spiking through the a-Si:H(i) layer, as supported by scanning transmission electron microscopyenergy dispersive x-ray maps. We explain the superior contact selectivity obtained on n{sup +} surfaces by more favorable band offsets and capture cross section ratios of recombination centers at the c-Si/a-Si:H(i) interface.

  18. Contact angles in the pseudopotential lattice Boltzmann modeling of wetting

    E-Print Network [OSTI]

    Q. Li; K. H. Luo; Q. J. Kang; Q. Chen

    2014-10-21T23:59:59.000Z

    In this paper, we aim to investigate the implementation of contact angles in the pseudopotential lattice Boltzmann modeling of wetting at a large density ratio. The pseudopotential lattice Boltzmann model [X. Shan and H. Chen, Phys. Rev. E 49, 2941 (1994)] is a popular mesoscopic model for simulating multiphase flows and interfacial dynamics. In this model, the contact angle is usually realized by a fluid-solid interaction. Two widely used fluid-solid interactions: the density-based interaction and the pseudopotential-based interaction, as well as a modified pseudopotential-based interaction formulated in the present paper, are numerically investigated and compared in terms of the achievable contact angles, the maximum and the minimum densities, and the spurious currents. It is found that the pseudopotential-based interaction works well for simulating small static (liquid) contact angles, however, is unable to reproduce static contact angles close to 180 degrees. Meanwhile, it is found that the proposed modified pseudopotential-based interaction performs better in light of the maximum and the minimum densities and is overall more suitable for simulating large contact angles as compared with the other two types of fluid-solid interactions. Furthermore, the spurious currents are found to be enlarged when the fluid-solid interaction force is introduced. Increasing the kinematic viscosity ratio between the vapor and liquid phases is shown to be capable of reducing the spurious currents caused by the fluid-solid interactions.

  19. www.iaei.org November . December 2014 IAEI NEWS 1110 IAEI NEWS November . December 2014 www.iaei.org PERSPECTIVES ON PV |

    E-Print Network [OSTI]

    Johnson, Eric E.

    1500 volts. And, standalone, off grid PV systems and utility- interactive PV systems with battery.iaei.org PERSPECTIVES ON PV | Safety First -- for the Inspector Photovoltaic (PV) power systems are generally in and local code requirements. A thorough inspection of a PV system will ensure that those requirements have

  20. r XXXX American Chemical Society A dx.doi.org/10.1021/jp112139h |J. Phys. Chem. C XXXX, XXX, 000000 pubs.acs.org/JPCC

    E-Print Network [OSTI]

    Information ' INTRODUCTION Dye-sensitized solar cells (DSCs) have displayed significant potential to compete on transparent conducting oxide platforms for their use in dye-sensitized solar cells (DSCs) in a similar fashion­000 ARTICLE pubs.acs.org/JPCC SiO2 Aerogel Templated, Porous TiO2 Photoanodes for Enhanced Performance in Dye-Sensitized

  1. r XXXX American Chemical Society A dx.doi.org/10.1021/ja107719u |J. Am. Chem. Soc. XXXX, XXX, 000000 pubs.acs.org/JACS

    E-Print Network [OSTI]

    Aksay, Ilhan A.

    these problems, including using carbide, nitride, or metal oxides as catalyst supports.3,8 Meta­000 ARTICLE pubs.acs.org/JACS Stabilization of Electrocatalytic Metal Nanoparticles at Metal-Metal Oxide, Washington 99164, United States bS Supporting Information ABSTRACT: Carbon-supported precious metal catalysts

  2. r XXXX American Chemical Society A dx.doi.org/10.1021/nl201470j |Nano Lett. XXXX, XXX, 000000 pubs.acs.org/NanoLett

    E-Print Network [OSTI]

    Cui, Yi

    ­000 LETTER pubs.acs.org/NanoLett Interconnected Silicon Hollow Nanospheres for Lithium-Ion Battery Anodes silicon structure.13 This electrochem- ical conditioning method is promising, but limited capacities (960 the diffusion-induced stress evolution and investigated the volume expansion of the same single hollow spheres

  3. r XXXX American Chemical Society A dx.doi.org/10.1021/jp1083967 |J. Phys. Chem. C XXXX, XXX, 000000 pubs.acs.org/JPCC

    E-Print Network [OSTI]

    Aksay, Ilhan A.

    000 ARTICLE pubs.acs.org/JPCC Structure and Energetics of Thin Film Water Santiago Romero-Vargas Castrillon Engineering, Princeton University, Princeton, New Jersey 08544-5263, United States Physics Department, Brooklyn College of the City University of New York, Brooklyn, New York 11210, United States 1

  4. Contact Detection and Constraints Enforcement for the Simulation of Pellet/Clad Thermo-Mechanical Contact in Nuclear Fuel Rods

    E-Print Network [OSTI]

    Lebrun-Grandi, Damien Thomas

    2014-03-05T23:59:59.000Z

    As fission process heats up the fuel rods, UO2 pellets stacked on top of each other swell both radially and axially, while the surrounding Zircaloy cladding creeps down, so that the pellets eventually come into contact with the clad...

  5. Ultra-low contact resistance at an epitaxial metal/oxide heterojunctio...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Ultra-low contact resistance at an epitaxial metaloxide heterojunction through interstitial site doping. Ultra-low contact resistance at an epitaxial metaloxide heterojunction...

  6. E-Print Network 3.0 - advanced biocompatible contact Sample Search...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    biocompatible contact Search Powered by Explorit Topic List Advanced Search Sample search results for: advanced biocompatible contact Page: << < 1 2 3 4 5 > >> 1 Knowledge Transfer...

  7. E-Print Network 3.0 - airborne allergic contact Sample Search...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Items that "contact" the eye or promote irritation (i.e. foreign objects... , chemicals, etc.) Contact lens products, eye drops or eye ointments Anatomical abnormalities of...

  8. E-Print Network 3.0 - action contacts directory Sample Search...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    contacts directory Search Powered by Explorit Topic List Advanced Search Sample search results for: action contacts directory Page: << < 1 2 3 4 5 > >> 1 Faculty and Staff...

  9. Graphitic Electrical Contacts to Metallic Single Walled Carbon Nanotubes Using Pt Electrodes

    E-Print Network [OSTI]

    Collins, Philip G

    2009-01-01T23:59:59.000Z

    NANO LETTERS Graphitic Electrical Contacts to Metallicof the interfacial electrical resistance between nano- tubesprovide excellent electrical contacts to many types of

  10. Web: www.MentalHealthFirstAid.org Email: BetsyS@TheNationalCouncil.org Phone: 202.684.7457 Mental Health First Aid: Military Members, Veterans and their Families

    E-Print Network [OSTI]

    Amin, S. Massoud

    connected to care. WHAT IS MENTAL HEALTH FIRST AID Mental Health First Aid USA is a live training program service employees, school and college staff, clergy and caring citizens. WHY MENTAL HEALTH FIRST AIDWeb: www.MentalHealthFirstAid.org Email: BetsyS@TheNationalCouncil.org Phone: 202.684.7457 Mental

  11. 8/13/12 Futurity.org What the world can learn from China's water crisis 1/5www.futurity.org/earth-environment/what-the-world-can-learn-from-china's-water-crisis/

    E-Print Network [OSTI]

    of nutrients--and about 300 million rural residents lack access to safe drinking water. (Credit: Federico lack access to safe drinking water. Water can unleash fury. Recent floods in Beijing overwhelmed8/13/12 Futurity.org What the world can learn from China's water crisis 1/5www.futurity.org/earth

  12. 10/05/2013 10:34Cherwell.org -Oxford / News / Academic / The Hole Truth Page 1 of 2http://www.cherwell.org/news/academic/2013/05/09/the-hole-truth

    E-Print Network [OSTI]

    Gardner, Andy

    Walsh has published 6 articles Photograph: WikiImages The Hole Truth New research by Oxford academics10/05/2013 10:34Cherwell.org - Oxford / News / Academic / The Hole Truth Page 1 of 2http://www.cherwell.org/news/academic Colleges Academic Town Worcester Provost battles with Exeter building plan Teddy Hall Earth Sciences dinner

  13. PLoS Biology | www.plosbiology.orgPLoS Biology | www.plosbiology.org 0032 January 2009 | Volume 7 | Issue 1 | e1000021 athematical modeling of the processes that

    E-Print Network [OSTI]

    Nie, Qing

    PLoS Biology | www.plosbiology.orgPLoS Biology | www.plosbiology.org 0032 January 2009 | Volume 7 (often called biological pattern formation) has a long and rich history [1,2]. These models proposed sets of those seen in the biological world, such as stripes, spots, or graded properties. Pattern formation

  14. INTERNATIONAL OSTEOPOROSIS FOUNDATION RUE JUSTE-OLIVIER, 9 CH-1260 NYON SWITZERLAND T +41 22 994 01 00 F +41 22 994 01 01 INFO@IOFBONEHEALTH.ORG WWW.IOFBONEHEALTH.ORG

    E-Print Network [OSTI]

    Shihadeh, Alan

    INTERNATIONAL OSTEOPOROSIS FOUNDATION RUE JUSTE-OLIVIER, 9 CH-1260 NYON SWITZERLAND T +41 22 994 01 00 F +41 22 994 01 01 INFO@IOFBONEHEALTH.ORG WWW.IOFBONEHEALTH.ORG OSTEOPOROSIS woman' released for World Osteoporosis Day shows urgent action must be taken to safeguard the quality

  15. Things to Do in Santa Cruz and the Area Wine tasting: http://www.santacruzca.org/things/wine-tasting.php?page=1#tpsearch

    E-Print Network [OSTI]

    California at Santa Cruz, University of

    Things to Do in Santa Cruz and the Area Wine tasting: http://www.santacruzca.org/things/wine-tasting.php: http://www.santacruzca.org/things/parks.php Stand Up Paddling at the Harbor: www Giants, San Francisco Giants, Oakland A's Beaches in and around Santa Cruz: http://www.santacruzca.org/things/best-beaches.php

  16. http://www.jstor.org Male and Female Pollination Success in a Deceptive Orchid, a Selection Study

    E-Print Network [OSTI]

    Johnston, Mark

    http://www.jstor.org Male and Female Pollination Success in a Deceptive Orchid, a Selection Study/08/2008 12:49 Your use of the JSTOR archive indicates your acceptance of JSTOR's Terms and Conditions of Use, available at http://www.jstor.org/page/info/about/policies/terms.jsp. JSTOR's Terms and Conditions of Use

  17. www.biosciencemag.org January 2011 / Vol. 61 No. 1 BioScience 19 Energetic Limits to Economic Growth

    E-Print Network [OSTI]

    Brown, James H.

    . We demonstrate a positive scaling relationship between per capita energy use and per capita gross status and ecological impact are correlated with energy use and GDP. We estimate global energy.iea.org/stats/index.asp) and World Resources Institute (WRI; http://earthtrends.wri.org/index.php).Per capita energy consumption

  18. A RESTful API for exchanging materials data in the AFLOWLIB.org Richard H. Taylor a,b

    E-Print Network [OSTI]

    Curtarolo, Stefano

    A RESTful API for exchanging materials data in the AFLOWLIB.org consortium Richard H. Taylor a (API) following REST principles is introduced for the AFLOWLIB.org materials data repositories through a RESTful API and a python library enabling ad hoc applications [17]. Other examples of online

  19. REALTIME MONITORING OF PIPELINES FOR THIRD-PARTY CONTACT

    SciTech Connect (OSTI)

    Gary L. Burkhardt; Alfred E. Crouch

    2004-10-01T23:59:59.000Z

    Third-party contact with pipelines (typically caused by contact with a digging or drilling device) can result in mechanical damage to the pipe, in addition to coating damage that can initiate corrosion. Because this type of damage often goes unreported and can lead to eventual catastrophic failure of the pipe, a reliable, cost-effective method is needed for monitoring and reporting third-party contact events. The impressed alternating cycle current (IACC) pipeline monitoring method consists of impressing electrical signals on the pipe by generating a time-varying voltage between the pipe and the soil at periodic locations where pipeline access is available. The signal voltage between the pipe and ground is monitored continuously at receiving stations located some distance away. Third-party contact to the pipe that breaks through the coating changes the signal received at the receiving stations. In this project, the IACC monitoring method is being developed, tested, and demonstrated. Work performed to date includes (1) a technology assessment, (2) development of an IACC model to predict performance and assist with selection of signal operating parameters, (3) Investigation of potential interactions with cathodic protection systems, and (4) experimental measurements on buried pipe at a test site as well as on an operating pipeline. Initial results show that simulated contact can be detected. Future work will involve further refinement of the method and testing on operating pipelines.

  20. REALTIME MONITORING OF PIPELINES FOR THIRD-PARTY CONTACT

    SciTech Connect (OSTI)

    Gary L. Burkhardt; Alfred E. Crouch; Jay L. Fisher

    2004-04-01T23:59:59.000Z

    Third-party contact with pipelines (typically caused by contact with a digging or drilling device) can result in mechanical damage to the pipe, in addition to coating damage that can initiate corrosion. Because this type of damage often goes unreported and can lead to eventual catastrophic failure of the pipe, a reliable, cost-effective method is needed for monitoring and reporting third-party contact events. The impressed alternating cycle current (IACC) pipeline monitoring method consists of impressing electrical signals on the pipe by generating a time-varying voltage between the pipe and the soil at periodic locations where pipeline access is available. The signal voltage between the pipe and ground is monitored continuously at receiving stations located some distance away. Third-party contact to the pipe that breaks through the coating changes the signal received at the receiving stations. In this project, the IACC monitoring method is being developed, tested, and demonstrated. Work performed to date includes a technology assessment, development of an IACC model to predict performance and assist with selection of signal operating parameters, and experimental measurements on a buried pipe at a test site. Initial results show that simulated contact can be detected. Future work will involve further refinement of the method and testing on operating pipelines.

  1. For more information, contact Michele Boyd at mboyd@psr.org. Updated July 13, 2009. Existing Subsidies and Incentives for New Nuclear Reactors

    E-Print Network [OSTI]

    Laughlin, Robert B.

    Subsidies and Incentives for New Nuclear Reactors Research and Development · Generation IV program in construction and operation licensing for 6 new reactors, including delays due to the Nuclear Regulatory-hour paid by ratepayers receiving electricity from nuclear reactors to pay for a geologic repository

  2. ESG: Extended Similarity Group method for protein function prediction For any questions regarding ESG contact the administration at info@kiharalab.org

    E-Print Network [OSTI]

    Kihara, Daisuke

    box titled "Enter Query Sequence(s)". Consider the following sequence that you can enter. >sp|P56851 KDKSSHMFIYISWYKIEHICTSDNWMDRFRNAYVWVQNPLKVLKCHQENSKNSYTESRSF NYIEFHCSMDGYVDSIEDLKMVEPIGN You can also click on "Load Sample" link to load this sequence in the text box and follow the next steps. Clicking on "Clear" link will clear the text box for sequence

  3. Enhanced Semiconductor Nanocrystal Conductance via Solution Grown Contacts

    SciTech Connect (OSTI)

    Sheldon, Matthew T.; Trudeau, Paul-Emile; Mokari, Taleb; Wang, Lin-Wang; Alivisatos, A. Paul

    2009-08-19T23:59:59.000Z

    We report a 100,000-fold increase in the conductance of individual CdSe nanorods when they are electrically contacted via direct solution phase growth of Au tips on the nanorod ends. Ensemble UV-Vis and X-Ray photoelectron spectroscopy indicate this enhancement does not result from alloying of the nanorod. Rather, low temperature tunneling and high temperature (250-400 K) thermionic emission across the junction at the Au contact reveal a 75percent lower interface barrier to conduction compared to a control sample. We correlate this barrier lowering with the electronic structure at the Au-CdSe interface. Our results emphasize the importance of nanocrystal surface structure for robust device performance and the advantage of this contact method.

  4. Existence and Regularity for Dynamic Viscoelastic Adhesive Contact with Damage

    SciTech Connect (OSTI)

    Kuttler, Kenneth L. [Department of Mathematics, Brigham Young University, Provo, UT 84602 (United States)], E-mail: klkuttler@math.byu.edu; Shillor, Meir [Department of Mathematics and Statistics, Oakland University, Rochester, MI 48309 (United States)], E-mail: shillor@oakland.edu; Fernandez, Jose R. [Departamento de Matematica Aplicada, Facultade de Matematicas, University of Santiago de Compostela, 15706 Santiago de Compostela (Spain)], E-mail: jramon@usc.es

    2006-01-15T23:59:59.000Z

    A model for the dynamic process of frictionless adhesive contact between a viscoelastic body and a reactive foundation, which takes into account the damage of the material resulting from tension or compression, is presented. Contact is described by the normal compliance condition. Material damage is modelled by the damage field, which measures the pointwise fractional decrease in the load-carrying capacity of the material, and its evolution is described by a differential inclusion. The model allows for different damage rates caused by tension or compression. The adhesion is modelled by the bonding field, which measures the fraction of active bonds on the contact surface. The existence of the unique weak solution is established using the theory of set-valued pseudomonotone operators introduced by Kuttler and Shillor (1999). Additional regularity of the solution is obtained when the problem data is more regular and satisfies appropriate compatibility conditions.

  5. Producing thin film photovoltaic modules with high integrity interconnects and dual layer contacts

    DOE Patents [OSTI]

    Jansen, Kai W. (Lawrenceville, NJ); Maley, Nagi (Exton, PA)

    2001-01-01T23:59:59.000Z

    High performance photovoltaic modules are produced with improved interconnects by a special process. Advantageously, the photovoltaic modules have a dual layer back (rear) contact and a front contact with at least one layer. The front contact and the inner layer of the back contact can comprise a transparent conductive oxide. The outer layer of the back contact can comprise a metal or metal oxide. The front contact can also have a dielectric layer. In one form, the dual layer back contact comprises a zinc oxide inner layer and an aluminum outer layer and the front contact comprises a tin oxide inner layer and a silicon dioxide dielectric outer layer. One or more amorphous silicon-containing thin film semiconductors can be deposited between the front and back contacts. The contacts can be positioned between a substrate and an optional superstrate. During production, the transparent conductive oxide layer of the front contact is scribed by a laser, then the amorphous silicon-containing semiconductors and inner layer of the dual layer back contact are simultaneously scribed and trenched (drilled) by the laser and the trench is subsequently filled with the same metal as the outer layer of the dual layer back contact to provide a superb mechanical and electrical interconnect between the front contact and the outer layer of the dual layer back contact. The outer layer of the dual layer back contact can then be scribed by the laser. For enhanced environmental protection, the photovoltaic modules can be encapsulated.

  6. REALTIME MONITORING OF PIPELINES FOR THIRD-PARTY CONTACT

    SciTech Connect (OSTI)

    Gary L. Burkhardt; Alred E. Crouch

    2005-04-01T23:59:59.000Z

    Third-party contact with pipelines (typically caused by contact with a digging or drilling device) can result in mechanical damage to the pipe, in addition to coating damage that can initiate corrosion. Because this type of damage often goes unreported and can lead to eventual catastrophic failure of the pipe, a reliable, cost-effective method is needed for monitoring and reporting third-party contact events. The impressed alternating cycle current (IACC) pipeline monitoring method consists of impressing electrical signals on the pipe by generating a time-varying voltage between the pipe and the soil at periodic locations where pipeline access is available. The signal voltage between the pipe and ground is monitored continuously at receiving stations located some distance away. Third-party contact to the pipe that breaks through the coating changes the signal received at the receiving stations. In this project, the IACC monitoring method is being developed, tested, and demonstrated. Work performed to date includes (1) a technology assessment, (2) development of an IACC model to predict performance and assist with selection of signal operating parameters, (3) Investigation of potential interactions with cathodic protection systems, and (4) experimental measurements on buried pipe at a test site as well as on an operating pipeline. Initial results showed that IACC signals could be successfully propagated over a distance of 3.5 miles, and that simulated contact can be detected up to a distance of 0.7 mile. Unexpected results were that the electrical impedance from the operating pipelines to the soil was very low and, therefore, the changes in impedance and signal resulting from third-party contact were unexpectedly low. Future work will involve further refinement of the method to resolve the issues with small signal change and additional testing on operating pipelines.

  7. Novel Composite Materials for SOFC Cathode-Interconnect Contact

    SciTech Connect (OSTI)

    J. H. Zhu

    2009-07-31T23:59:59.000Z

    This report summarized the research efforts and major conclusions of our University Coal Research Project, which focused on developing a new class of electrically-conductive, Cr-blocking, damage-tolerant Ag-perovksite composite materials for the cathode-interconnect contact of intermediate-temperature solid oxide fuel cell (SOFC) stacks. The Ag evaporation rate increased linearly with air flow rate initially and became constant for the air flow rate {ge} {approx} 1.0 cm {center_dot} s{sup -1}. An activation energy of 280 KJ.mol{sup -1} was obtained for Ag evaporation in both air and Ar+5%H{sub 2}+3%H{sub 2}O. The exposure environment had no measurable influence on the Ag evaporation rate as well as its dependence on the gas flow rate, while different surface morphological features were developed after thermal exposure in the oxidizing and reducing environments. Pure Ag is too volatile at the SOFC operating temperature and its evaporation rate needs to be reduced to facilitate its application as the cathode-interconnect contact. Based on extensive evaporation testing, it was found that none of the alloying additions reduced the evaporation rate of Ag over the long-term exposure, except the noble metals Au, Pt, and Pd; however, these noble elements are too expensive to justify their practical use in contact materials. Furthermore, the addition of La{sub 0.8}Sr{sub 0.2}MnO{sub 3} (LSM) into Ag to form a composite material also did not significantly modify the Ag evaporation rate. The Ag-perovskite composites with the perovskite being either (La{sub 0.6}Sr{sub 0.4})(Co{sub 0.8}Fe{sub 0.2})O{sub 3} (LSCF) or LSM were systematically evaluated as the contact material between the ferritic interconnect alloy Crofer 22 APU and the LSM cathode. The area specific resistances (ASRs) of the test specimens were shown to be highly dependent on the volume percentage and the type of the perovskite present in the composite contact material as well as the amount of thermal cycling that the specimens were subjected to during testing. The Ag-LSCF composite contact materials proved more effective in trapping Cr within the contact material and preventing Cr migration into the cathode than the Ag-LSM composites. Ag-perovskite composite contact materials are promising candidates for use in intermediate-temperature SOFC stacks with ferritic stainless steel interconnects due to their ability to maintain acceptably low ASRs while reducing Cr migration into the cathode material.

  8. Laminated photovoltaic modules using back-contact solar cells

    DOE Patents [OSTI]

    Gee, James M. (Albuquerque, NM); Garrett, Stephen E. (Albuquerque, NM); Morgan, William P. (Albuquerque, NM); Worobey, Walter (Albuquerque, NM)

    1999-09-14T23:59:59.000Z

    Photovoltaic modules which comprise back-contact solar cells, such as back-contact crystalline silicon solar cells, positioned atop electrically conductive circuit elements affixed to a planar support so that a circuit capable of generating electric power is created. The modules are encapsulated using encapsulant materials such as EVA which are commonly used in photovoltaic module manufacture. The module designs allow multiple cells to be electrically connected in a single encapsulation step rather than by sequential soldering which characterizes the currently used commercial practices.

  9. Topological complexity, contact order and protein folding rates

    E-Print Network [OSTI]

    P. F. N. Faisca; R. C. Ball

    2002-05-29T23:59:59.000Z

    Monte Carlo simulations of protein folding show the emergence of a strong correlation between the relative contact order parameter, CO, and the folding time, t, of two-state folding proteins for longer chains with number of amino acids, N>=54, and higher contact order, CO > 0.17. The correlation is particularly strong for N=80 corresponding to slow and more complex folding kinetics. These results are qualitatively compatible with experimental data where a general trend towards increasing t with CO is indeed observed in a set of proteins with chain length ranging from 41 to 154 amino acids.

  10. Contact information for the Cyclotron Institute REU Program

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc DocumentationP-Series to User GroupInformation Administration (EIA)DonUsContactContact

  11. Contacts | U.S. DOE Office of Science (SC)

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc DocumentationP-Series to User GroupInformationE-Gov Contacts for E-GovContacts News News Home

  12. Contact | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmosphericNuclear SecurityTensile Strain Switched5 Industrial CarbonArticlesHumanJune 2008 BasicCharlesCondensedContact EnergyContact

  13. Contact | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmosphericNuclear SecurityTensile Strain Switched5 Industrial CarbonArticlesHumanJune 2008 BasicCharlesCondensedContactContact Science

  14. Contact | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmosphericNuclear SecurityTensile Strain Switched5 Industrial CarbonArticlesHumanJune 2008 BasicCharlesCondensedContactContact

  15. Contact Us | ANSER Center | Argonne-Northwestern National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformation InInformationCenterResearchCASLNanoporousTestimonyContact Us - Working With Us Contact

  16. Contact information | Center for Bio-Inspired Solar Fuel Production

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformation InInformationCenterResearchCASLNanoporousTestimonyContact Us - WorkingContact Us

  17. For additional information, contact: Department of Agricultural Economics & Economics

    E-Print Network [OSTI]

    Lawrence, Rick L.

    For additional information, contact: Department of Agricultural Economics & Economics Montana State.montana.edu/econ agecon@montana.edu 1 2 AGRICULTURAL ECONOMICS & ECONOMICS KELLY GORHAM 1 Austin Owens traveled to Greece as mentors for students in Economics 101 4 Chris Stoddard was the recipient of a MSU Cox Family Faculty

  18. CONTACT: University Relations/News 304.293.6997

    E-Print Network [OSTI]

    Mohaghegh, Shahab

    CONTACT: University Relations/News 304.293.6997 Text of WVU presidential search committee. 28) by the West Virginia University presidential search committee asking the Board of Governors the presidential search at West Virginia University, I hereby move that the Presidential Search Committee: 1

  19. ECE 3301: General Electrical Engineering Credit / Contact hours: 3 / 3

    E-Print Network [OSTI]

    Gelfond, Michael

    ECE 3301: General Electrical Engineering Credit / Contact hours: 3 / 3 Course coordinator: Mary Baker Textbook(s) and/or other required material: Hambley, Allan R., Electrical Engineering Principles and Applications, fourth edition, Prentice Hall, 2007. Catalog description: Analysis of electric circuits

  20. Ohmic contacts to p-type GaP

    E-Print Network [OSTI]

    Jorge Estevez, Humberto Angel

    1996-01-01T23:59:59.000Z

    thickness used in this scheme. The samples were annealed for I @n at temperatures ranging from 3 5 0 to 4 5 0 'C. Lower values of the contact resistivity than those of the Si/Pd/Zn/Pd/p-GaP scheme were achieved by depositing an Aluminum layer on the top...

  1. Annular electrical contact apparatus for use in drill stem testing

    SciTech Connect (OSTI)

    Lancaster, C. E.

    1985-09-17T23:59:59.000Z

    In accordance with an illustrative embodiment of the present invention, a full bore drill stem testing system includes a tubular housing suspended in a well on a pipe string and having an open bore therethrough. An annular electrical contact sleeve is mounted on the wall of the housing surrounding the bore. A running tool that is lowered into the pipe string on electrical wireline includes inner and outer body members, with the outer body member carrying latch dogs that engage a shoulder in the housing to stop downward movement in a predetermined position. The inner body member carries a normally retracted annular elastomer element that has an electrical contact means on its outer periphery, and expander means responsive to upward movement of said inner body member relative to said outer body member is operable to expand the elastomer element to cause the contact means to engage the contact sleeve and enable drill stem test data to be transmitted to the surface via the electric wireline.

  2. For additional information, contact: Department of History, Philosophy

    E-Print Network [OSTI]

    For additional information, contact: Department of History, Philosophy & Religious Studies Montana "Philosophy of Science," "Nature and Religion" and "The Darwinian Revolution." The World The department offers courses ranging from "Latin American Perspectives" to "Religion of Ancient Egypt" to "Philosophies of Asia

  3. Test method Evaluating the influence of contacting fluids on polyethylene

    E-Print Network [OSTI]

    Thompson, Michael

    Test method Evaluating the influence of contacting fluids on polyethylene using acoustic emissions emissions Polyethylene Penetrant Toluene Aqueous detergent a b s t r a c t Identifying microstructural) on the structure of a semi-crystalline polymer (high density polyethylene, HDPE) over different periods of exposure

  4. For Immediate release: 06/14/12 Contact: Ingrid Wright

    E-Print Network [OSTI]

    Ward, Karen

    bays that will obtain a minimum Leadership in Engineering and Environmental Design (LEED) SilverFor Immediate release: 06/14/12 Contact: Ingrid Wright Civil Engineering Collaborates with City to Build New Fire Station The Civil Engineering Department at The University of Texas at El Paso has been

  5. FOR MORE INFORMATION, CONTACT: TP Straatsma, Initiative Lead

    E-Print Network [OSTI]

    FOR MORE INFORMATION, CONTACT: TP Straatsma, Initiative Lead 509-375-2802 tps@pnl.gov www.pnl.gov e Development of Exascale Algorithms for Molecular Modeling Lead investigator: Dr. Karol Kowalski Researchers Optimizations for Extreme Scale Systems Lead investigator: Dr. Daniel Chavarria Exascale systems will provide

  6. Current Producers of Developed Grasses Producers Contact Phone Number

    E-Print Network [OSTI]

    Rod 979-543-0121 Trinity Turf Nursery* Doug O'Conner 800-290-8873 Wharton Turfgrass Jimmy Kocurek 979 Turfgrass Jimmy Kocurek 979-532-4340 Wittig Grass Farms Allan Wittig 979-657-4496 Diamond Producers Contact Turfgrass Jimmy Kocurek 979-532-4340 Winstead Turf Farms* (AR, MS, TN) Bobby Winstead 800-624-8873 Wittig

  7. For Immediate release: 11/16/12 Contact: Ingrid Wright

    E-Print Network [OSTI]

    Ward, Karen

    Mobil, Lockheed Martin, General Motors, AT&T and more. Internship presenters will be Alan Alvillar UTEPFor Immediate release: 11/16/12 Contact: Ingrid Wright Engineering students host Internship Seminar Series The College of Engineering Tau Beta Pi, Malone Engineering Leadership Program, the Entering

  8. For Immediate release: 10/31/12 Contact: Ingrid Wright

    E-Print Network [OSTI]

    Ward, Karen

    Mobil, Lockheed Martin, General Motors, AT&T and more. Internship presenters will be Janet Gomez UTEPFor Immediate release: 10/31/12 Contact: Ingrid Wright Engineering students host Internship Seminar Series The College of Engineering Tau Beta Pi, Malone Engineering Leadership Program, the Entering

  9. For Immediate release: 11/07/12 Contact: Ingrid Wright

    E-Print Network [OSTI]

    Ward, Karen

    Mobil, Lockheed Martin, General Motors, AT&T and more. On Friday, internship presenters will be OliviaFor Immediate release: 11/07/12 Contact: Ingrid Wright Engineering students host Internship Seminar Series The College of Engineering Tau Beta Pi, Malone Engineering Leadership Program, the Entering

  10. For Immediate release: 10/25/12 Contact: Ingrid Wright

    E-Print Network [OSTI]

    Ward, Karen

    Mobil, Lockheed Martin, General Motors, AT&T and more. On October 26, there will be a special guestFor Immediate release: 10/25/12 Contact: Ingrid Wright Engineering students host Internship Seminar Series The College of Engineering Tau Beta Pi, Malone Engineering Leadership Program, the Entering

  11. Ballistic thermal point contacts made of GaAs nanopillars

    SciTech Connect (OSTI)

    Bartsch, Th.; Wetzel, A.; Sonnenberg, D.; Schmidt, M.; Heyn, Ch.; Hansen, W. [Institut fr Angewandte Physik und Zentrum fr Mikrostrukturforschung, Universitt Hamburg, Jungiusstr. 11, 20355 Hamburg (Germany)

    2013-12-04T23:59:59.000Z

    We measure the thermal conductance of GaAs pillars that are only a few nanometers long. Our observations can be understood with a simple model, in which the pillars constitute thermal point contacts between 3D phonon reservoirs. Moreover, first measurements of the electronic transport through these pillars are presented.

  12. For Immediate release: 10/05/11 Contact: Ingrid Wright

    E-Print Network [OSTI]

    Ward, Karen

    For Immediate release: 10/05/11 Contact: Ingrid Wright UTEP to Oversee Push for 'Green' Engineers develop new alternative energy sources and ways to increase energy efficiency. Heidi A. Taboada, Ph of the BuildinG a Regional Energy and Educational Network (BGREEN) project. The USDA announced the award Tuesday

  13. Method and apparatus for producing co-current fluid contact

    DOE Patents [OSTI]

    Trutna, W.R.

    1997-12-09T23:59:59.000Z

    An improved packing system and method are disclosed wherein a packing section includes a liquid distributor and a separator placed above the distributor so that gas rising through the liquid distributor contacts liquid in the distributor, forming a gas-liquid combination which rises in co-current flow to the separator. Liquid is collected in the separator, from which gas rises. 13 figs.

  14. For Immediate release: 03/20/12 Contact: Ingrid Wright

    E-Print Network [OSTI]

    Ward, Karen

    had the opportunity to tour the facility of Operational Test Command (OTC) at Fort Bliss for the firstFor Immediate release: 03/20/12 Contact: Ingrid Wright Electrical Engineering students visit Fort Bliss The University of Texas at El Paso's Department of Electrical and Computer Engineering students

  15. For Immediate release: 03/13/12 Contact: Ingrid Wright

    E-Print Network [OSTI]

    Ward, Karen

    For Immediate release: 03/13/12 Contact: Ingrid Wright UTEP to host symposium on energy science and Engineering Symposium starting at 8 a.m. Saturday, March 24, at the Double Tree Inn in El Paso The symposium assistant professor of mechanical engineering at UTEP. The event will feature keynote speaker Robert R

  16. Friction coefficient of soft contact lenses: measurements and modeling

    E-Print Network [OSTI]

    Sawyer, Wallace

    , FL 32611, USA Received 12 October 2004; accepted 16 January 2005 Tribological conditions for contact elastohydrodynamic lubrication. Finally, the largest contributors to the friction force in these experiments were comfort is related to friction. The mechanical properties of hydro- gels are extremely sensitive to water

  17. TO: HR and Business Contacts FROM: Division of Human Resources

    E-Print Network [OSTI]

    Almor, Amit

    MEMORANDUM TO: HR and Business Contacts FROM: Division of Human Resources DATE: October 25, 2013 RE: Human Resources Fall 2013 Forum The Division of Human Resources will sponsor an HR Forum from 1 to the Division of Human Resources' Organizational and Professional Development Office at hrtrain

  18. TO: HR and Business Contacts FROM: Division of Human Resources

    E-Print Network [OSTI]

    Almor, Amit

    TO: HR and Business Contacts FROM: Division of Human Resources DATE: September 6, 2012 RE: Human Resources Fall 2012 Forum The Division of Human Resources will sponsor an HR Forum from 1-4 p in person or by webinar. Any questions about the forum may be e-mailed to the Division of Human Resources

  19. TO: HR and Business Contacts FROM: Division of Human Resources

    E-Print Network [OSTI]

    Almor, Amit

    TO: HR and Business Contacts FROM: Division of Human Resources DATE: September 24, 2012 RE: Reminder: Human Resources Fall 2012 Forum This is a reminder that you will need to register online by the Division of Human Resources, this forum will include information about benefits updates to annual

  20. Detection of Heavy Metal Ions Based on Quantum Point Contacts

    E-Print Network [OSTI]

    Zhang, Yanchao

    . The ability to detect trace amounts of metal ions is important because of the toxicity of heavy metal ionsDetection of Heavy Metal Ions Based on Quantum Point Contacts Vasanth Rajagopalan, Salah Boussaad on many living organisms and the consequence of heavy metal ions not being biodegradable. To date, heavy

  1. On the Effect of Compliance in Robotic Contact Tasks Problem

    E-Print Network [OSTI]

    1 1995 ACC On the Effect of Compliance in Robotic Contact Tasks Problem Shahram Payandeh, Assistant Professor Experimental Robotics Laboratory (ERL) School of Engineering Science Simon Fraser University control of the robotic manipulator during its phase transition from free to constrained motions. One

  2. Media contact: FOR IMMEDIATE RELEASE Diana Hanford May 4, 2012

    E-Print Network [OSTI]

    Fernandez, Eduardo

    companies working in conjunction with the FAU College of Engineering and Computer Science, the FAU Charles EMedia contact: FOR IMMEDIATE RELEASE Diana Hanford May 4, 2012 Ambit Advertising and Public working on industry projects. Also included is a dedicated office for the annual FAU Business Plan

  3. Media contact: FOR IMMEDIATE RELEASE Diana Hanford September 24, 2012

    E-Print Network [OSTI]

    Belogay, Eugene A.

    to 22 technology companies working in conjunction with the FAU College of Engineering and ComputerMedia contact: FOR IMMEDIATE RELEASE Diana Hanford September 24, 2012 Ambit Advertising and Public by FAU student-based teams working on industry projects. It also serves as a knowledge resource center

  4. ENVS 404: Internship Syllabus Contact Information: Internship Coordinator

    E-Print Network [OSTI]

    1 ENVS 404: Internship Syllabus Contact Information: Internship Coordinator Peg Boulay Environmental Leadership Program Co-Director, Internship Coordinator and Academic Adviser 242 Columbia Hall 541-346-5945 boulay@uoregon.edu Note: The Internship Coordinator position may also be filled by a Graduate Teaching

  5. Simulations with Sliding and Intermittent Contact Matthew P. Kelly

    E-Print Network [OSTI]

    Ruina, Andy L.

    .edu March 5, 2014 Abstract When simulating a system that has intermittent contact, it is necessary or uses those [4] · Examples from my book (wheel and pulley) · Page 6 of Chatterjee and Ruina board. 4 Bouncing Ball Briefly discuss the results of my Simulations of a bouncing ball. 4.1 Zeno

  6. An Energy-Based Approach for Contact Force Computation

    E-Print Network [OSTI]

    Paris-Sud XI, Université de

    An Energy-Based Approach for Contact Force Computation Fran¸cois Faure Francois.Faure@imag.fr, i. The subsequent iterations consist of global redistributions of energy through the solids in order to restrict widely addressed in computer graphics research. The dynamics equations are now well-known and used

  7. Problems addressed in this course Teaching methodology, material, exams, contacts

    E-Print Network [OSTI]

    Wehenkel, Louis

    . The first look at a genome - Sequence analysis Bioinformatics - Lecture 1 Louis Wehenkel Department. The first look at a genome - Sequence analysis Problems addressed in this course Teaching methodology, material, exams, contacts Chapter 1. The first look at a genome - Sequence analysis Introduction

  8. Michael A. Santoro Title and Address: Contact Information

    E-Print Network [OSTI]

    Lin, Xiaodong

    of intellectual property, competitor information gathering, personal privacy law, and trade secrecy. ResearchMichael A. Santoro Title and Address: Contact Information: Professor Department of Management, Rutgers Flex Program MBA Program (2013) 2010 With Ronald J. Strauss, Best Paper in Ethics Award

  9. REALTIME MONITORING OF PIPELINES FOR THIRD-PARTY CONTACT

    SciTech Connect (OSTI)

    Gary L. Burkhardt; Alfred E. Crouch

    2005-10-01T23:59:59.000Z

    Third-party contact with pipelines (typically caused by contact with a digging or drilling device) can result in mechanical damage to the pipe, in addition to coating damage that can initiate corrosion. Because this type of damage often goes unreported and can lead to eventual catastrophic failure of the pipe, a reliable, cost-effective method is needed for monitoring and reporting third-party contact events. The impressed alternating cycle current (IACC) pipeline monitoring method consists of impressing electrical signals on the pipe by generating a time-varying voltage between the pipe and the soil at periodic locations where pipeline access is available. The signal voltage between the pipe and ground is monitored continuously at receiving stations located some distance away. Third-party contact to the pipe that breaks through the coating changes the signal received at the receiving stations. In this project, the IACC monitoring method is being developed, tested, and demonstrated. Work performed to date includes (1) a technology assessment, (2) development of an IACC model to predict performance and assist with selection of signal operating parameters, (3) investigation of potential interactions with cathodic protection systems, and (4) experimental measurements on operating pipelines. Based on information recently found in published studies, it is believed that the operation of IACC on a pipeline will cause no interference with CP systems. Initial results on operating pipelines showed that IACC signals could be successfully propagated over a distance of 3.5 miles, and that simulated contact can be detected up to a distance of 1.4 miles, depending on the pipeline and soil conditions.

  10. correspondence n engl j med 362;16 nejm.org april 22, 2010 1547

    E-Print Network [OSTI]

    de Bakker, Paul

    care reform ini- tiatives in China, Mexico, Iran, and elsewhere. Musgrove criticizes our Perspective- port.3 At that time, we published a thorough re- buttal.4 The United States spends more on health carecorrespondence n engl j med 362;16 nejm.org april 22, 2010 1547 Musgrove P. Judging health systems

  11. XU ET AL. VOL. 8 ' NO. 3 ' 26972703 ' 2014 www.acsnano.org

    E-Print Network [OSTI]

    Thibado, Paul M.

    XU ET AL. VOL. 8 ' NO. 3 ' 2697­2703 ' 2014 www.acsnano.org 2697 February 05, 2014 C 2014 American, and # Department of Physics, Shahid Rajaee Teacher Training University, Lavizan, Tehran 16788, Iran D irect effects.2,3 Among the most effective supports for Pt NPs in electro- chemical catalysis are carbon

  12. http://arXiv.org/physics/0507088 Teaching About Nature's Nuclear Reactors

    E-Print Network [OSTI]

    Learned, John

    http://arXiv.org/physics/0507088 Teaching About Nature's Nuclear Reactors J. Marvin Herndon reactors existed in uranium deposits on Earth long before Enrico Fermi built the first man-made nuclear reactors. The subject of planetocentric nuclear fission reactors can be a jumping off point for stimulating

  13. JOM January 201148 www.tms.org/jom.html OverviewOverviewNanomaterials for Renewable Energy

    E-Print Network [OSTI]

    JOM · January 201148 www.tms.org/jom.html OverviewOverviewNanomaterials for Renewable Energy Global to fundamental advances in direct renewable energy and ener- gy storage and conversion which are needed to enable renewable energy and meet the general energy challenges and associated environmental effects. This paper

  14. Renewable Energy Research Laboratory, UMass Amherst www.ceere.org/rerl

    E-Print Network [OSTI]

    Massachusetts at Amherst, University of

    Renewable Energy Research Laboratory, UMass Amherst www.ceere.org/rerl Community-Scale Wind Energy Fellow, Renewable Energy Research Laboratory, University of Massachusetts Supported by the The US, Renewable Energy Research Laboratory, University of Massachusetts Supported by the The US Department

  15. Renewable Energy Research Laboratory, UMass Amherst www.ceere.org/rerl

    E-Print Network [OSTI]

    Massachusetts at Amherst, University of

    Renewable Energy Research Laboratory, UMass Amherst www.ceere.org/rerl 1 Small Wind PowerSmall Wind Sally Wright, PE Staff Engineer Renewable Energy Research Laboratory University of Massachusetts, Amherst A Presentation to Co-op Power Sally Wright, PE Staff Engineer Renewable Energy Research Laboratory

  16. SEO ET AL. VOL. XXX ' NO. XX ' 000000 ' XXXX www.acsnano.org

    E-Print Network [OSTI]

    SEO ET AL. VOL. XXX ' NO. XX ' 000000 ' XXXX www.acsnano.org A C XXXX American Chemical Society Si Microwire Solar Cells: Improved Efficiency with a Conformal SiO2 Layer Kwanyong Seo,, Young J. Yu, Peter

  17. 22th International Meeting on org. geochem. The fate of organic matter in mangrove sediments

    E-Print Network [OSTI]

    Boyer, Edmond

    22th International Meeting on org. geochem. The fate of organic matter in mangrove sediments and the unvegetated sediments, and various vascular plants specific to these swamps. An elemental, pyrolytic sediments characterised by great changes in the redox conditions. Several specific results have already been

  18. INTERIOR LIGHTING CASE STUDY For more information, visit PARTNERSHIPDEMONSTRATIONS.ORG

    E-Print Network [OSTI]

    California at Davis, University of

    INTERIOR LIGHTING CASE STUDY » For more information, visit PARTNERSHIPDEMONSTRATIONS.ORG In 2013 the SPEED team collaborated with UC San Francisco to demonstrate three lighting retrofits of fluorescent the feasibility of adaptive corridor lighting retrofits for sites with different budgets and financing

  19. EXTERIOR LIGHTING CASE STUDY For more information, visit PARTNERSHIPDEMONSTRATIONS.ORG

    E-Print Network [OSTI]

    California at Davis, University of

    EXTERIOR LIGHTING CASE STUDY » For more information, visit PARTNERSHIPDEMONSTRATIONS.ORG In 2013, UC Santa Barbara partnered with the SPEED team to demonstrate network controlled LED lighting sensors. These lighting controls allowed all the units to be incorporated into an adaptive mesh network

  20. www.sciencemag.org SCIENCE VOL 337 10 AUGUST 2012 649 POLICYFORUM

    E-Print Network [OSTI]

    in water governance (table S2) but lack coor- dination. At the central government level, the Ministrywww.sciencemag.org SCIENCE VOL 337 10 AUGUST 2012 649 POLICYFORUM A water crisis has prompted the Chi- nese government to develop an ambi- tious water conservancy plan. How- ever, the plan may