Powered by Deep Web Technologies
Note: This page contains sample records for the topic "apel org contact" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


1

Applied Process Engineering Laborotory APEL | Open Energy Information  

Open Energy Info (EERE)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home5b9fcbce19 NoPublic Utilities Address: 160 East 300AlgoilEnergy Information the Army Permit:Films CorporationLaborotory APEL

2

MEMBERS ONLY | Join | Renew | Shop | About | Contact Us | Home ASME.ORG > News & Public Policy > Press Releases > Research Begun on New Fuel Cell Type  

E-Print Network [OSTI]

SEARCH ASME: MEMBERS ONLY | Join | Renew | Shop | About | Contact Us | Home ASME.ORG > News, the magazine reports on a fuel cell that cleans domestic wastewater while producing electrical energy. This new, takes the high concentration of organic matter found in wastewater and coverts it to energy. "Where

3

Contacts  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Contacts Contacts Bradbury Science Museum P.O. Box 1663 Mail Stop C330 Los Alamos National Laboratory Los Alamos, NM 87545 email: web-bsm@lanl.gov PHONE: 505-667-4444 FAX:...

4

Contacts  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformation InInformationCenterResearchCASLNanoporousTestimonyContact Us - WorkingContactContact

5

Contacts:  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc DocumentationP-Series to User GroupInformationE-Gov Contacts for E-GovContacts News News Home

6

Contacts  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation Proposed New SubstationCleanCommunity2Workshops 2008 To1Contact CommunityContact

7

2004 Geological Society of America. For permission to copy, contact Copyright Permissions, GSA, or editing@geosociety.org. Geology; October 2004; v. 32; no. 10; p. 925928; doi: 10.1130/G20561.1; 4 figures; Data Repository item 2004149. 925  

E-Print Network [OSTI]

as far east as the Texas panhandle (Fig. 2), and may have influenced the locus of Neogene extension2004 Geological Society of America. For permission to copy, contact Copyright Permissions, GSA, or editing@geosociety.org. Geology; October 2004; v. 32; no. 10; p. 925­928; doi: 10.1130/G20561.1; 4 figures

Pazzaglia, Frank J.

8

2004 Geological Society of America. For permission to copy, contact Copyright Permissions, GSA, or editing@geosociety.org. Geology; January 2004; v. 32; no. 1; p. 58; DOI 10.1130/G19957.1; 2 figures; Data Repository item 2004001. 5  

E-Print Network [OSTI]

2004 Geological Society of America. For permission to copy, contact Copyright Permissions, GSA, or editing@geosociety.org. Geology; January 2004; v. 32; no. 1; p. 5­8; DOI 10.1130/G19957.1; 2 figures; Data a speleothem-based ab- solutely dated record (using uranium-series data) of climate change for the southwestern

Asmerom, Yemane

9

nanotechweb.org TECHNOLOGY UPDATE  

E-Print Network [OSTI]

.jpg) The nanopillars (http://images.iop.org/objects/ntw/news/9/8/5/JRogers.jpg) Vertical arrays of semiconductor to construct using conventional semiconductor wafer technologies. However, researchers need to develop a way to fabricate contact electrodes that can bridge and span the gaps between the nanorods or pillars

Rogers, John A.

10

Contact us  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Contact us Participate with us Participate Become a Volunteer Share Your Stories Museum Fan Downloads Q&A Blog Contact us invisible utility element Contact us We want to hear from...

11

Contacts | NREL  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

list of important phone numbers. Contact a Staff Member at NREL Our searchable staff directory has contact information for staff. Questions or Comments? Please use our feedback...

12

Note: This copy is for your personal, non-commercial use only. To order presentation-ready copies for distribution to your colleagues or clients, contact us at www.rsna.org/rsnarights.  

E-Print Network [OSTI]

.J.H.); Department of Radiology, Harvard Medical School, Boston, Mass (S.J.A.); Division of Pediatric Radiology, DukeSPECIALREPORT Radiology: Volume 258: Number 3--March 2011 n radiology.rsna.org 889 Managing Radiation Use in Medical the Department of Radiology, Memorial Sloan- Kettering Cancer Center, 1275 York Ave, Suite C-278, New York, NY (H

Brenner, David Jonathan

13

Contact Us  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc DocumentationP-Series to User Group andCompositionalInitial ValidationContactContact Us Contact

14

Contact Us  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc DocumentationP-Series to User Group andCompositionalInitial ValidationContactContact Us Contact

15

Contact Us  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformation InInformationCenterResearchCASLNanoporousTestimony |IdahoVisionContact InContactContact

16

Contact Us  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformation InInformationCenterResearchCASLNanoporousTestimony |IdahoVisionContactContact Contact Us

17

Website Contact  

Broader source: Energy.gov [DOE]

Contact the website administrator with questions, comments, or issues related to the Federal Energy Management Program website. If your inquiry is in regard to a specific Web page, please include...

18

Workshop Contacts  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmosphericNuclear SecurityTensile Strain Switched FerromagnetismWaste and MaterialsWenjun1 TableContacts Workshop Contacts Questions?

19

ARM - Contacts  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformationbudapest Comments? We would love toContact Information Related Links TWP-ICE HomeContacts

20

WINDExchange: Contacts  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsrucLasDelivered energy consumption byAbout Printable Version Bookmark and Share Contacts

Note: This page contains sample records for the topic "apel org contact" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


21

Eyeglass allergic contact dermatitis  

E-Print Network [OSTI]

T, Iijima M, Maibach HI. Eyeglass frame allergic contactNakada T, Maibach HI. Eyeglass allergic contact dermatitis.Eyeglass allergic contact dermatitis Kimberly Scott 1 ,

Scott, Kimberly; Levender, Michelle M; Feldman, Steven R

2010-01-01T23:59:59.000Z

22

Contact Us  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc DocumentationP-Series to User Group andCompositionalInitial ValidationContact

23

ARM - Contacts  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformationbudapest Comments? We would love toContact Information Related Links TWP-ICE Home

24

ARM - Contacts  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformationbudapest Comments? We would love toContact Information Related Links TWP-ICE

25

LANL Contacts  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformation Desert Southwest Region serviceMission Statement Titan TargetInJupiter Lasertowards|Contacts

26

Contact Information  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformation InInformationCenterResearchCASLNanoporousTestimony |IdahoVisionContact In

27

Contact Us  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformation InInformationCenterResearchCASLNanoporousTestimony |IdahoVisionContact

28

Media Contact Raymond Mathews  

E-Print Network [OSTI]

.284.3535 or lowemuseum.org About the Artist: Paul Stankard (American, born 1943) was born in North Attleboro, MA. He

Shyu, Mei-Ling

29

www.publiclandsday.org Public Lands Program  

E-Print Network [OSTI]

awareness of local public lands and issues #12;www.publiclandsday.org Facebook.com - Fan Page http://www.facebook.com/pages/create.php #12;www.publiclandsday.org Facebook Fan Page http://www.facebook.com/pages/create.php #12;www.publiclandsday.org Facebook Fan Page #12;www.publiclandsday.org Facebook Fan Page #12;www.publiclandsday.org Facebook Event

US Army Corps of Engineers

30

Chemical Management Contacts  

Broader source: Energy.gov [DOE]

Contacts for additional information on Chemical Management and brief description on Energy Facility Contractors Group

31

Thermal contact resistance  

E-Print Network [OSTI]

This work deals with phenomena of thermal resistance for metallic surfaces in contact. The main concern of the work is to develop reliable and practical methods for prediction of the thermal contact resistance for various ...

Mikic, B. B.

1966-01-01T23:59:59.000Z

32

Contacts | Department of Energy  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious Rank EERE:YearRound-Up fromDepartmentTieCelebrate Earth CodestheatforContacts Contacts Contact Information

33

Contacts | Department of Energy  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious Rank EERE:YearRound-Up fromDepartmentTieCelebrate Earth CodestheatforContacts Contacts Contact

34

Federal NEPA Contacts  

Broader source: Energy.gov [DOE]

CEQ and most Federal agencies identify primary points of contact for NEPA compliance. Normally a senior environmental professional, environmental law attorney, or member of agency leadership, these...

35

Optical contact micrometer  

SciTech Connect (OSTI)

Certain examples provide optical contact micrometers and methods of use. An example optical contact micrometer includes a pair of opposable lenses to receive an object and immobilize the object in a position. The example optical contact micrometer includes a pair of opposable mirrors positioned with respect to the pair of lenses to facilitate viewing of the object through the lenses. The example optical contact micrometer includes a microscope to facilitate viewing of the object through the lenses via the mirrors; and an interferometer to obtain one or more measurements of the object.

Jacobson, Steven D.

2014-08-19T23:59:59.000Z

36

Hydrodynamics of air entrainment by moving contact lines T. S. Chan, S. Srivastava, A. Marchand, B. Andreotti, L. Biferale et al.  

E-Print Network [OSTI]

Hydrodynamics of air entrainment by moving contact lines T. S. Chan, S. Srivastava, A. Marchand, B://pof.aip.org/about/rights_and_permissions #12;PHYSICS OF FLUIDS 25, 074105 (2013) Hydrodynamics of air entrainment by moving contact lines T. S, as developed here, allows us to study the dependence of the critical capillary number for air entrainment

Snoeijer, Jacco

37

CancerProgressReport.org // AACR.org // #CancerProgress14 AACR CANCER  

E-Print Network [OSTI]

CancerProgressReport.org // AACR.org // #CancerProgress14 AACR CANCER PROGRESS REPORT 2014 TRA NSFO RMING LIVES THRO UG H RE SE ARC H #12;CancerProgressReport.org // AACR.org // #CancerProgress14 AACR CANCER PROGRESS REPORT 2014 TRANSFORMING LIVES THROUGH RESEARCH #12;II AACR Cancer Progress Report 2014

Sherman, S. Murray

38

Contact Us - Hanford Site  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformation InInformationCenterResearchCASLNanoporousTestimony |IdahoVisionContactContact Contact

39

Contact | ornl.gov  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation Proposed New SubstationCleanCommunity2Workshops 2008 To1Contact CommunityContact SHARE Contact

40

Contacts & Resources  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation Proposed New SubstationCleanCommunity2Workshops 2008 To1Contact CommunityContactContacts &

Note: This page contains sample records for the topic "apel org contact" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


41

Contact thermal lithography  

E-Print Network [OSTI]

Contact thermal lithography is a method for fabricating microscale patterns using heat transfer. In contrast to photolithography, where the minimum achievable feature size is proportional to the wavelength of light used ...

Schmidt, Aaron Jerome, 1979-

2004-01-01T23:59:59.000Z

42

Microcontrollers Images: http://en.wikipedia.org/wiki/File:Digital_Multimeter_Aka.jpg, http://en.wikipedia.org/wiki/File:Resistors_color_code.jpg, http://en.wikipedia.org/wiki/File:Lm356.jpg , http://en.wikipedia.org/  

E-Print Network [OSTI]

://en.wikipedia.org/wiki/File:Digital_Multimeter_Aka.jpg, http://en.wikipedia.org/wiki/File:Resistors_color_code.jpg, http://en.wikipedia.org/wiki/File:Lm356.jpg://en.wikipedia.org/wiki/File:Digital_Multimeter_Aka.jpg, http://en.wikipedia.org/wiki/File:Resistors_color_code.jpg, http://en.wikipedia.org/wiki/File:Lm356.jpg://en.wikipedia.org/wiki/File:Digital_Multimeter_Aka.jpg, http://en.wikipedia.org/wiki/File:Resistors_color_code.jpg, http://en.wikipedia.org/wiki/File:Lm356.jpg

Smith, James Andrew

43

Contact urticaria to raw potato  

E-Print Network [OSTI]

allergen in latex-induced potato allergy. Ann Allergy Asthmaof allergy to cooked potatoes in children. Allergy 2007;62(contact dermatitis from potato flesh. Contact Dermatitis

Lagrn, Z Martnez de; Frutos, FJ Ortiz de; Arribas, M Gonzlez de; Vanaclocha-Sebastin, F

2009-01-01T23:59:59.000Z

44

Bilevel contact solar cells  

SciTech Connect (OSTI)

This patent describes a solar cell. It comprises a body of semiconductor material having at least one P/N junction therein, the body including a front face having no electrodes thereon, and a bilevel elevation back face having at least one P-doped region at a first level interdigitated with at least one N-doped region at a second level, wherein the at least one P-doped region and the at least one N-doped region partially overlap to form at least one compensated region; and a positive electrode contacting the at lease one P-doped region and a negative electrode contacting the at least one N-doped region, both electrodes contacting the solar cell on the back face.

Sinton, R.A.

1991-10-01T23:59:59.000Z

45

Contact Us - Hanford Site  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc DocumentationP-Series to User Group andCompositionalInitial ValidationContactContact Us

46

Contacts | Advanced Photon Source  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc DocumentationP-Series to User GroupInformationE-Gov Contacts for E-Gov LeAnnProjectContacts

47

Contacts: Tel: Locations: Tel:  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc DocumentationP-Series to User GroupInformationE-Gov Contacts for E-GovContacts News News

48

Contact JLab | Jefferson Lab  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformation InInformationCenterResearchCASLNanoporousTestimony |IdahoVisionContact InContact Visiting

49

Contact Us - Pantex Plant  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformation InInformationCenterResearchCASLNanoporousTestimony |IdahoVisionContactContact

50

Contact Us | EMSL  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformation InInformationCenterResearchCASLNanoporousTestimonyContact Us - Working WithContact Us »

51

Contact Us | NREL  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformation InInformationCenterResearchCASLNanoporousTestimonyContact Us - Working WithContact Us

52

Contact: Nathan Howard  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation Proposed New SubstationCleanCommunity2Workshops 2008 To1Contact CommunityContact SHARENathan

53

Contacts | Argonne National Laboratory  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation Proposed New SubstationCleanCommunity2Workshops 2008O" ContactsContacts for the

54

Sandia National Laboratories: Contacts  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmosphericNuclear Security Administration the1 -the Mid-Infrared0EnergySandia Involves Wind-Farm OwnersContacts SSLS Contacts On

55

IEEE Computer Society: http://computer.org Computer: http://computer.org/computer  

E-Print Network [OSTI]

IEEE Computer Society: http://computer.org Computer: http://computer.org/computer computer@computer.org IEEE Computer Society Publications Office: +1 714 821 8380 COVER FEATURES GUEST EDITOR'S INTRODUCTION 28 Computational Photography--The Next Big Step Oliver Bimber Computational photography extends

Stanford University

56

www.free4vn.org oldroad www.vsofts.net oldroadwww.free4vn.org oldroad  

E-Print Network [OSTI]

www.free4vn.org oldroad #12;www.vsofts.net oldroadwww.free4vn.org oldroad #12;www.vsofts.net oldroadwww.free4vn.org oldroad #12;www.vsofts.net oldroadwww.free4vn.org oldroad #12;www.vsofts.net oldroadwww.free4vn.org oldroad #12;www.vsofts.net oldroadwww.free4vn.org oldroad #12;www

Giridhar, K.

57

CONTACT INFO BUILDING SHELTER  

E-Print Network [OSTI]

CONTACT INFO SIGNALS BUILDING SHELTER THE DISABLED B.E.R.T. TEAM B.E.R.T.* EMERGENCY RESPONSE GUIDE, SIUC*Building Emergency Response Team Siren* Long Blast: Tornado High/Low: Any Other Emergency Radio needed. 2. Find two or three B.E.R.T. "buddies" who are willing to help you in the event of an emergency

King, David G.

58

Technology Advertising Contact Information  

E-Print Network [OSTI]

Overview #12;Technology Advertising Contact Information Alex Sheath 8596 4063 asheath Overview Our online Technology section is geared towards an IT professional environment, reaching a range of technology enthusiasts from every day gadget consumers to business decision makers where enterprise solutions

Peters, Richard

59

Contact Center Sales Office  

E-Print Network [OSTI]

PSTN Contact Center India Plant Ohio Sales Office Russia Remote Worker Arizona Plant China GPS petrochemical industry. The demands to improve supply and demand balances and increase business velocity have of diverse organizations in the petrochemical industry ­ from crude oil to refinery to processing

Fisher, Kathleen

60

Contact stress sensor  

DOE Patents [OSTI]

A method for producing a contact stress sensor that includes one or more MEMS fabricated sensor elements, where each sensor element of includes a thin non-recessed portion, a recessed portion and a pressure sensitive element adjacent to the recessed portion. An electric circuit is connected to the pressure sensitive element. The circuit includes a pressure signal circuit element configured to provide a signal upon movement of the pressure sensitive element.

Kotovsky, Jack

2014-02-11T23:59:59.000Z

Note: This page contains sample records for the topic "apel org contact" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


61

ARM - NSA Contacts  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc Documentation RUC : XDCResearchWarmingMethane Background Information OutreachContacts NSA

62

Contacts / Hours - Hanford Site  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformation InInformationCenterResearchCASLNanoporousTestimonyContact Us -

63

Find us on Facebook myscienceacademy.org  

E-Print Network [OSTI]

Find us on Facebook myscienceacademy.org 144,123 people like myscienceacademy.org. Facebook social In Recommendations Log in to Facebook to see your friends' recommendations. 24 Places That Look Not Normal this. 10 Famous Drug Myths 559 people recommend this. Facebook social plugin Share by Email reddit

Chiao, Jung-Chih

64

Coordinating Partners www.nwocenter.org  

E-Print Network [OSTI]

science, technology, engineering, and mathematics (STEM) education for people of all ages 241Math-372-2718 Fax: 419-372-2738 To join NWO and receive updates on NWO activities Visit: www.nwocenter.org www.nwocenter.org Teacher/Pre-service and Higher Education Faculty Professional Development NWO Inquiry Series in STEM

Moore, Paul A.

65

DOE Radiation Records Contacts List  

Broader source: Energy.gov [DOE]

DOE radiation records contact list for individuals to obtain records of occupational exposure directly from a DOE site.

66

Uniform Methods Project Contacts | Department of Energy  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Contacts Uniform Methods Project Contacts The primary contacts for the Uniform Methods Project are: U.S. Department of Energy Michael Li Carla Frisch National Renewable Energy...

67

Transmission - Contact Information  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsrucLas ConchasPassiveSubmittedStatusButler TinaContact-Information-Transmission Sign In About |

68

Transmission Contact Information  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsrucLas ConchasPassiveSubmittedStatusButler TinaContact-Information-Transmission Sign In

69

ARM - Instrument Contacts  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformation InInformation InExplosionAnnouncements MediagovCampaignsList ofgovInstrumentsContacts

70

SRNL LDRD - Program Contacts  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmosphericNuclear Security Administration the1 -the Mid-Infrared0 ResourceAwards SAGE Awards ,#2446SmallnAbout LDRDProgram Contacts

71

FOR IMMEDIATE RELEASE CONTACT:  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation ProposedUsing ZirconiaPolicy andExsolutionFES Committees of9,of Energy8 CH2M CONTACT:

72

ARM - Contact Information  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformationbudapest Comments? We would love toContact Information Related Links TWP-ICE Home Tropical

73

Contacts | Department of Energy  

Energy Savers [EERE]

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious RankCombustion |Energyon ArmedWaste andAccessCO2Administrative Operations Contacts for theAbout the State

74

Geothermal: Contact Us  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation ProposedUsingFun with Big Sky Learning FunNeuTel2011Programmatic ReportsContact Us Geothermal

75

How to Contact NERSC  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformation Desert Southwest Region service area.Portal SolarAbout Energy.govHonorsAbout » Contact us

76

Climate VISION: Contact Us  

Office of Scientific and Technical Information (OSTI)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) "ofEarlyEnergyDepartmentNationalRestart ofMeasuring DopamineEnergy,6. Radiative Forcing of ClimateCONTACT US

77

Contact Us - SRSCRO  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformation InInformationCenterResearchCASLNanoporousTestimony |IdahoVisionContactContactcontact

78

Contacts | Jefferson Lab  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformation InInformationCenterResearchCASLNanoporousTestimonyContact Us - News Media Assembling A

79

Fermilab | Contact Fermilab  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformation Desert Southwest Region service area. TheEPSCI Home It isGasERPSpun OffTechnologies|21,Contact

80

NREL: Library - Contacts  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmosphericNuclear Security Administration the Contributions and Achievements ofLizResultsGeothermal Energy TheContacts A photo

Note: This page contains sample records for the topic "apel org contact" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


81

Media Contact: Will Callicott  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsrucLas Conchas recovery challenge fund LasDubey MathematicaMeasuring andSecurity Contact: Will

82

Contact | The Ames Laboratory  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation Proposed New SubstationCleanCommunity2Workshops 2008 To1 BuildingContactCoordinators|

83

Contact Issue 1  

E-Print Network [OSTI]

, '\\ ..... ,. '" ' ; ') I f. I , j ------------------~ The tall lean Earthman stepped up to the8!nterprise trio who had just beamed down onto his porch. "Welcome to the Kes sler Colonr.' gentlemen, " he greeted them. "I'm Leon Kessler at your service l' The man... DEDICATION This zi_e is dedicated to all STAR TREK raas who saw aad uaderstood that special quality ia the "Kirk/Spock Relatioash!p", aad to WILLIAM SHATNER .ad LEONARD NIMOY, who made it happe_. ? Copyright December, 1915, CONTACT. No reprlats...

Multiple Contributors

1976-01-01T23:59:59.000Z

84

FOR ADDITIONAL INFORMATION on scientific ocean drilling,please contact Joint Oceanographic Institutions,Inc.,1200 New York Avenue,NW,Suite 400,  

E-Print Network [OSTI]

FOR ADDITIONAL INFORMATION on scientific ocean drilling,please contact Joint Oceanographic:www.joiscience.org; Phone:(202)232-3900. Design of this map was supported by the Ocean Drilling Program under° 20° 20° Deep Sea Drilling Project THE DEEP SEA DRILLING PROJECT (DSDP; 1968-1983) pioneered

85

UNITED WAY OF ANCHORAGE CODE WEB ADDRESS United Way of Anchorage 71830 www.liveunitedanchorage.org  

E-Print Network [OSTI]

.pathwaycenter.org Renewable Energy Alaska Project 88020 alaskarenewableenergy.org Special Olympics Alaska Inc 55282 www 35694 www.hfhanchorage.org Kids' Corps, Inc. 30881 kcialaska.org Lutheran Social Services of Alaska Inc

Pantaleone, Jim

86

Method for forming metal contacts  

DOE Patents [OSTI]

Methods of forming metal contacts with metal inks in the manufacture of photovoltaic devices are disclosed. The metal inks are selectively deposited on semiconductor coatings by inkjet and aerosol apparatus. The composite is heated to selective temperatures where the metal inks burn through the coating to form an electrical contact with the semiconductor. Metal layers are then deposited on the electrical contacts by light induced or light assisted plating.

Reddington, Erik; Sutter, Thomas C; Bu, Lujia; Cannon, Alexandra; Habas, Susan E; Curtis, Calvin J; Miedaner, Alexander; Ginley, David S; Van Hest, Marinus Franciscus Antonius Maria

2013-09-17T23:59:59.000Z

87

Natural Language Engineering http://journals.cambridge.org/NLE  

E-Print Network [OSTI]

Natural Language Engineering http://journals.cambridge.org/NLE Additional services for Natural1351324912000289 Request Permissions : Click here Downloaded from http://journals.cambridge.org/NLE, IP address information retrieval (search with Google, Bing, etc.), but

Bergler, Sabine

88

Oakwood Healthcare, 2014. All rights reserved. oakwood.org/foundation For more information, visit oakwood.org/foundation  

E-Print Network [OSTI]

©Oakwood Healthcare, 2014. All rights reserved. oakwood.org/foundation For more information, visit oakwood.org/foundation Oakwood Healthcare Foundation cordially invites you to Clays For Kids Sporting

Finley Jr., Russell L.

89

Solar cell with back side contacts  

DOE Patents [OSTI]

A III-V solar cell is described herein that includes all back side contacts. Additionally, the positive and negative electrical contacts contact compoud semiconductor layers of the solar cell other than the absorbing layer of the solar cell. That is, the positive and negative electrical contacts contact passivating layers of the solar cell.

Nielson, Gregory N; Okandan, Murat; Cruz-Campa, Jose Luis; Resnick, Paul J; Wanlass, Mark Woodbury; Clews, Peggy J

2013-12-24T23:59:59.000Z

90

Bourses thses Org Domaine Dure Dead line Particularit Lien  

E-Print Network [OSTI]

neurodénératives FONDATION MOTRICE avril http://www.lafondationmotrice.org/in dex://www.fdv-paris.org/fr/ecole- doctorale-fdv/ FONDATION MOTRICE avril may France ou étranger http://www.lafondationmotrice.org/in dex

Arleo, Angelo

91

UN Chronicle | Indispensable for Sustainable Development http://www.un.org/Pubs/chronicle/2007/issue1/0107p20.htm 1 of 3 5/15/2007 4:43 PM  

E-Print Network [OSTI]

UN Chronicle | Indispensable for Sustainable Development http://www.un.org/Pubs/chronicle/2007 for Sustainable Development By Jeffrey D. Sachs E-mail this article to a friend Print Home | Archive | Franais | Contact Us | Subscribe | Links Article Global sustainable development and security are deeply

92

Protein folding using contact maps  

E-Print Network [OSTI]

We present the development of the idea to use dynamics in the space of contact maps as a computational approach to the protein folding problem. We first introduce two important technical ingredients, the reconstruction of a three dimensional conformation from a contact map and the Monte Carlo dynamics in contact map space. We then discuss two approximations to the free energy of the contact maps and a method to derive energy parameters based on perceptron learning. Finally we present results, first for predictions based on threading and then for energy minimization of crambin and of a set of 6 immunoglobulins. The main result is that we proved that the two simple approximations we studied for the free energy are not suitable for protein folding. Perspectives are discussed in the last section.

Michele Vendruscolo; Eytan Domany

1999-01-21T23:59:59.000Z

93

Method for lubricating contacting surfaces  

DOE Patents [OSTI]

A method is provided for tribological lubrication of sliding contact surfaces, where two surfaces are in contact and in motion relative to each other, operating in a vapor-phase environment containing at least one alcohol compound at a concentration sufficiently high to provide one monolayer of coverage on at least one of the surfaces, where the alcohol compound continuously reacts at the surface to provide lubrication.

Dugger, Michael T. (Tijeras, NM); Ohlhausen, James A. (Albuquerque, NM); Asay, David B. (Boalsburg, PA); Kim, Seong H. (State College, PA)

2011-12-06T23:59:59.000Z

94

FOIA Contacts | Department of Energy  

Energy Savers [EERE]

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious RankCombustion |Energy UsageAUDITVehicles »Exchange Visitors Program Exchange VisitorsContacts FOIA Contacts

95

For permission to copy, contact editing@geosociety.org 2006 Geological Society of America  

E-Print Network [OSTI]

the kinematics of fold growth. Where rivers cut through growing anticlines, flights of abandoned fluvial terraces across much of the fold. The Kashi-Atushi terraces show clear evidence of abandoned axial surfaces, con the development of hydrocarbon reservoirs, potential seismic haz- ards related to faulting or folding

Scharer, Kate

96

For permission to copy, contact editing@geosociety.org 2003 Geological Society of America1492  

E-Print Network [OSTI]

. Orthogonal jointing during coeval igneous degassing and normal faulting, Yucca Mountain, Nevada William M Tuff at Yucca Mountain, Ne- vada. The joints formed within a month of ignimbrite deposition, prior northwest- trending basin in the Yucca Mountain area. During initial ignimbrite cooling, joint swarms formed

Perfect, Ed

97

For permission to copy, contact editing@geosociety.org 2004 Geological Society of America368  

E-Print Network [OSTI]

Production Re- search Company (EPR), northwest Euro- E-mail: kgm@rci.rutgers.edu. pean sections, and Russian- duction Research Company (EPR) defined a depositional sequence as a ``stratigraphic unit composed

98

For permission to copy, contact editing@geosociety.org 2007 Geological Society of America  

E-Print Network [OSTI]

The significance of the stratigraphic record in Kents Cavern, Devon, United Kingdom, to the interpretation passages. The Kents Cavern record of continuous, repeated sedimentation events followed by frost shat and establishes Kents Cavern as a site of international scientific interest. Keywords: Kents Cavern, middle

McFarlane, Donald A.

99

For permission to copy, contact editing@geosociety.org 2002 Geological Society of America 665  

E-Print Network [OSTI]

of the late Pleistocene Lake Michigan Lobe, Laurentide Ice Sheet Christopher W. Breemer* Peter U. Clark Roy ice flow characteristic of the low- gradient Lake Michigan Lobe of the south- ern Laurentide Ice Sheet ice pressure. To evaluate the basal water pressures of the Lake Michigan Lobe, we used the ground

Kurapov, Alexander

100

For permission to copy, contact editing@geosociety.org 2006 Geological Society of America  

E-Print Network [OSTI]

carbonates. The oolitic units are similar to quiet-water ooids that form today in low-energy settings ABSTRACT Dark-gray oolitic units characterized by oversized ooids with primary radial cal- cite fabrics in their dark color, cerebroid outlines, broken and recoated grains, abundant inclusions, highly restricted

Husinec, Antun

Note: This page contains sample records for the topic "apel org contact" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


101

For permission to copy, contact editing@geosociety.org 2005 Geological Society of America  

E-Print Network [OSTI]

enrichment of light rare earth elements (LREEs) versus heavy rare earth elements (REEs) or in melt in SiO2 and not sufficiently light rare earth element (LREE) enriched to form continental crust was rare but occurred over short intervals in the middle of the section. The TalkeetnaVolcanic Formation

102

For permission to copy, contact editing@geosociety.org 2003 Geological Society of America 373  

E-Print Network [OSTI]

record from the Finger Lakes, New York: Impact of acid rain on a buffered terrane C.K. Lajewski H rain have been conducted in areas with low acid-neutralizing, or buffering, capaci- ty. In contrast- tionally been thought to be ``insensitive'' to the effects of acid rain. To address this fun- damental

Patterson, William P.

103

For permission to copy, contact editing@geosociety.org 2007 Geological Society of America  

E-Print Network [OSTI]

and stable isotopes of hydrogen and oxygen. Solute chemistry and isotopic signatures of seeps are distinct Antarctic Ice Sheet. Moreover, glaciers do not form in the valley bottoms because the sublimation and melt evaporation and sublimation (Fountain et al., 1999). Ice-cemented permafrost occurs in the upper 1 m

Fountain, Andrew G.

104

For permission to copy, contact editing@geosociety.org 2007 Geological Society of America  

E-Print Network [OSTI]

@usc.edu. E-mail: fjp3@lehigh.edu. § Present address: Tetra Tech EM Inc., Albuquer- que, New Mexico 87110, USA Sciences, University of Southern California, Los Angeles, Cal- ifornia 90089, USA; e-mail: kfrankel§ Department of Earth and Environmental Sciences, Lehigh University, Bethlehem, Pennsylvania 18015, USA A B C D

Pazzaglia, Frank J.

105

For permission to copy, contact editing@geosociety.org 2011 Geological Society of America  

E-Print Network [OSTI]

, and substantial economic resources (most notably evaporite minerals, coal, oil, and oil shale). The Eocene Green, 1996) and oil shale (Dyni, 2006). Studies of ancient lake systems often fail to adequately consider

Janecke, Susanne

106

Utility Energy Service Contract Contacts | Department of Energy  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

Contacts Utility Energy Service Contract Contacts For more information about utility energy service contracts, contact: Contact Organization David McAndrew 202-586-7722 Federal...

107

JUNE 2014VOLUME 2 NON PROFIT ORG.  

E-Print Network [OSTI]

JUNE 2014VOLUME 2 THE TEEA MESSENGER NON PROFIT ORG. U.S. POSTAGE PAID PERMIT NO. 65 MARBLE FALLS. 2014 TEEA STATE CONFERENCE SCHEDULE MULTI PURPOSE EVENT CENTER WICHITA FALLS, TEXAS SEPTEMBER 9 & 10, 2014 Tuesday 8:00 11:00 AM Registration 8:30 & 10:30 AM Free 1 hour Wichita Falls Tours for TEEA

108

Communication www.rsc.org/chemcomm  

E-Print Network [OSTI]

Communication www.rsc.org/chemcomm CHEMCOMM Electron beam induced in situ clusterisation of 1D Zr-Borkowskib and Malcolm L. H. Green*a a Wolfson Catalysis Centre (Carbon Nanotechnology Group), Inorganic Chemistry Laboratory, University of Oxford, South Parks Road, Oxford, UK OX1 3QR. E-mail: malcolm.green@chem.ox.ac.uk b

Dunin-Borkowski, Rafal E.

109

NAZ EDUCATION PIPELINE the-naz.org  

E-Print Network [OSTI]

NAZ EDUCATION PIPELINE the-naz.org 1200 W. Broadway #250 | Minneapolis, MN 55411 | Family Academy is a foundational component of the NAZ "cradle to career" pipeline. NAZ families can enroll in the Family Academy college ready. Families and children move through a "cradle to career" pipeline that provides

Amin, S. Massoud

110

www.electricitypolicy.org.uk EPRGWORKINGPAPER  

E-Print Network [OSTI]

www.electricitypolicy.org.uk EPRGWORKINGPAPER Abstract Do homes that are more energy efficient consume less energy?: A structural equation model for England's residential sector EPRG Working Paper 1117 Cambridge Working Paper in Economics 1139 Scott Kelly Energy consumption from the residential sector

Aickelin, Uwe

111

www.electricitypolicy.org.uk EPRGWORKINGPAPER  

E-Print Network [OSTI]

Energy plc in 1996. The company was unusual in being a wholly nuclear merchant power generator a simple conclusion that nuclear power cannot survive in such markets. A restructured British Energy Groupwww.electricitypolicy.org.uk EPRGWORKINGPAPER Abstract Nuclear Power and Deregulated Electricity

Aickelin, Uwe

112

fieldmuseum.org/schools THE FIELD MUSEUM  

E-Print Network [OSTI]

fieldmuseum.org/schools THE FIELD MUSEUM #12;The Field Museum | Field Trip Planning Guide for Educators 2 Welcome to The Field Museum! The Field Museum is an exciting place to explore and learn time. Taking a field trip to the Museum o ers students and teachers an opportunity to interact

Patterson, Bruce D.

113

fieldmuseum.org/schools THE FIELD MUSEUM  

E-Print Network [OSTI]

fieldmuseum.org/schools THE FIELD MUSEUM #12;The Field Museum | Field Trip Planning Guide for Educators 2 Welcome to The Field Museum! The Field Museum is an exciting place to explore and learn. Taking a field trip to the Museum o ers students and teachers an opportunity to interact with real

Patterson, Bruce D.

114

Contacts of space--times  

SciTech Connect (OSTI)

The concept of contact between manifolds is applied to space--times of general relativity. For a given background space--time a contact approximation of second order is defined and interpreted both from the point of view of a metric pertubation and of a higher order tangent manifold. In the first case, an application to the high frequency gravitational wave hypothesis is suggested. In the second case, a constant curvature tangent bundle is constructed and suggested as a means to define a ten parameter local space--time symmetry.

Maia, M.D.

1981-03-01T23:59:59.000Z

115

Non- contacting capacitive diagnostic device  

DOE Patents [OSTI]

A non-contacting capacitive diagnostic device includes a pulsed light source for producing an electric field in a semiconductor or photovoltaic device or material to be evaluated and a circuit responsive to the electric field. The circuit is not in physical contact with the device or material being evaluated and produces an electrical signal characteristic of the electric field produced in the device or material. The diagnostic device permits quality control and evaluation of semiconductor or photovoltaic device properties in continuous manufacturing processes.

Ellison, Timothy

2005-07-12T23:59:59.000Z

116

Contact Us | Department of Energy  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc DocumentationP-Series to User GroupInformation Administration (EIA)DonUs Contact UsContact

117

Contact Us | Department of Energy  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc DocumentationP-Series to User GroupInformation Administration (EIA)DonUs Contact UsContactUs

118

Contact Us | The Ames Laboratory  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc DocumentationP-Series to User GroupInformation Administration (EIA)DonUsContact UsContact Us

119

Sandia National Laboratories: Contact Us  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformation Desert Southwest RegionatSearch WelcomeScience SSRL ScienceCRFCareersandContact Us Contact Us

120

Contact OAK RIDGE NATIONAL LABORATORY  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformation InInformationCenterResearchCASLNanoporousTestimony |IdahoVisionContact InContact

Note: This page contains sample records for the topic "apel org contact" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


121

Contact Us | Argonne National Laboratory  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformation InInformationCenterResearchCASLNanoporousTestimonyContact Us - Working With UsContact Us

122

Contact | Photosynthetic Antenna Research Center  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformation InInformationCenterResearchCASLNanoporousTestimonyContact Us - WorkingContact

123

Improved Electrical Contact For Dowhhole Drilling Networks  

DOE Patents [OSTI]

An electrical contact system for transmitting information across tool joints while minimizing signal reflections that occur at the tool joints includes a first electrical contact comprising an annular resilient material. An annular conductor is embedded within the annular resilient material and has a surface exposed from the annular resilient material. A second electrical contact is provided that is substantially equal to the first electrical contact. Likewise, the second electrical contact has an annular resilient material and an annular conductor. The two electrical contacts configured to contact one another such that the annular conductors of each come into physical contact. The annular resilient materials of each electrical contact each have dielectric characteristics and dimensions that are adjusted to provide desired impedance to the electrical contacts.

Hall, David R. (Provo, UT); Hall, Jr., H. Tracy (Provo, UT); Pixton, David S. (Lehi, UT); Dahlgren, Scott (Provo, UT); Fox, Joe (Spanish Fork, UT); Sneddon, Cameron (Provo, UT)

2005-08-16T23:59:59.000Z

124

Microsoft PowerPoint - Nov 2009 PI Org Chart (web) | Department...  

Broader source: Energy.gov (indexed) [DOE]

Microsoft PowerPoint - Nov 2009 PI Org Chart (web) Microsoft PowerPoint - Nov 2009 PI Org Chart (web) PI Organization chart Microsoft PowerPoint - Nov 2009 PI Org Chart (web) More...

125

Contact Symmetries and Hamiltonian Thermodynamics  

E-Print Network [OSTI]

It has been shown that contact geometry is the proper framework underlying classical thermodynamics and that thermodynamic fluctuations are captured by an additional metric structure related to Fisher's Information Matrix. In this work we analyze several unaddressed aspects about the application of contact and metric geometry to thermodynamics. We consider here the Thermodynamic Phase Space and start by investigating the role of gauge transformations and Legendre symmetries for metric contact manifolds and their significance in thermodynamics. Then we present a novel mathematical characterization of first order phase transitions as equilibrium processes on the Thermodynamic Phase Space for which the Legendre symmetry is broken. Moreover, we use contact Hamiltonian dynamics to represent thermodynamic processes in a way that resembles the classical Hamiltonian formulation of conservative mechanics and we show that the relevant Hamiltonian coincides with the irreversible entropy production along thermodynamic processes. Therefore, we use such property to give a geometric definition of thermodynamically admissible fluctuations according to the Second Law of thermodynamics. Finally, we show that the length of a curve describing a thermodynamic process measures its entropy production.

A. Bravetti; C. S. Lopez-Monsalvo; F. Nettel

2015-02-22T23:59:59.000Z

126

University Assessment Contacts Academic Units  

E-Print Network [OSTI]

.j.arp@oregonstate.edu 541-737-2331 Notes: Agricultural and Resource Economics Assessment Rep: Email: Phone: Penelope DiebelUniversity Assessment Contacts Academic Units COLLEGE OF AGRICULTURAL SCIENCES Assessment Rep.Capalbo@oregonstate.edu 541-737-5639 Notes: Agricultural Education and Agricultural Sciences Assessment Rep: Email: Phone

Escher, Christine

127

Contact Information Elias M. Marvinney  

E-Print Network [OSTI]

Contact Information Elias M. Marvinney 619 Fillmore St Davis, CA 95616 Cell: 617-721-9636 Email: emarvinney@ucdavis.edu Employment History University of California Davis, College of Agriculture accounts for upstream emissions associated with material production and transport, fuel combustion

DeJong, Theodore

128

APRIL 18, 2013 Media Contact  

E-Print Network [OSTI]

Solar Project State Partners with Project Owners to Purchase Conservation Land The California Department of Fish and Wildlife (CDFW), the California Energy Commission (Energy Commission) and the Ivanpah SolarAPRIL 18, 2013 Media Contact: Jordan Traverso, CDFW Communications, (916) 654-9937 California

129

FOR ADDITIONAL INFORMATION on scientific ocean drilling,please contact Integrated Ocean Drilling Program,Texas A&M University,1000 Discovery Drive,  

E-Print Network [OSTI]

FOR ADDITIONAL INFORMATION on scientific ocean drilling,please contact Integrated Ocean Drilling.E-mail:information@iodp.tamu.edu; Web:www.iodp-usio.org;Telephone:(979) 845-2673. Design of this map was supported by the Ocean Drilling in this publication do not reflect the views of NSF or Texas A&M University. Deep Sea Drilling Project Legs 1­96,Ocean

130

www.chelanpud.org 2010 -Our Goals For Financial Stability  

E-Print Network [OSTI]

TotalPortfolio #12;www.chelanpud.org Current Market Position - Total 0% 10% 20% 30% 40% 50% 60% 70% 80% 90% 100% 2013

131

Contact  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc DocumentationP-Series to User Group andCompositionalInitial Validation andPWRContaCt The nuclear

132

Contacts  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc DocumentationP-Series to User GroupInformation AdministrationEnvironmental Review-NEPAContacts

133

Contacts  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc DocumentationP-Series to User GroupInformation AdministrationEnvironmental

134

CONTACT  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformation InInformationCenterResearchCASL Symposium: CelebratingMission Welcomefor

135

Contact  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformation InInformationCenterResearchCASLNanoporousTestimony |IdahoVision Predict,Researchhome /

136

Solar cell contact formation using laser ablation  

DOE Patents [OSTI]

The formation of solar cell contacts using a laser is described. A method of fabricating a back-contact solar cell includes forming a poly-crystalline material layer above a single-crystalline substrate. The method also includes forming a dielectric material stack above the poly-crystalline material layer. The method also includes forming, by laser ablation, a plurality of contacts holes in the dielectric material stack, each of the contact holes exposing a portion of the poly-crystalline material layer; and forming conductive contacts in the plurality of contact holes.

Harley, Gabriel; Smith, David; Cousins, Peter

2012-12-04T23:59:59.000Z

137

Solar cell contact formation using laser ablation  

DOE Patents [OSTI]

The formation of solar cell contacts using a laser is described. A method of fabricating a back-contact solar cell includes forming a poly-crystalline material layer above a single-crystalline substrate. The method also includes forming a dielectric material stack above the poly-crystalline material layer. The method also includes forming, by laser ablation, a plurality of contacts holes in the dielectric material stack, each of the contact holes exposing a portion of the poly-crystalline materiat layer; and forming conductive contacts in the plurality of contact holes.

Harley, Gabriel; Smith, David D.; Cousins, Peter John

2014-07-22T23:59:59.000Z

138

Details of Forestry Commission and DARDNI Plant Health Contacts for UK Points of Entry UK Principle Ports Contacts Contact Details  

E-Print Network [OSTI]

Ports Contacts Contact Details Felixstowe Richard Fergusson Pat Mitchell Philip Evans Roland Fry Fax Other GB Ports John Hunter Joanne McAuley Fax 0131-314-6148 Tel : 0131-314-6182 or Tel : 0131

139

Communication www.rsc.org/chemcomm  

E-Print Network [OSTI]

Communication www.rsc.org/chemcomm CHEMCOMM Condensation of acetonitrile into N on the web 8th June 2001 Acetonitrile reacts with a dinuclear nickel(II) complex [Ni2(m-OH)2(tpa)2](ClO4{HNNC(Me)­NNC(Me)­NH}2. Acetonitrile is one of the common solvents that is widely used to study processes in solution

Nazarenko, Alexander

140

Clean Cities Program Contacts (Fact Sheet)  

SciTech Connect (OSTI)

This fact sheet provides contact information for program staff of the U.S. Department of Energy's Clean Cities program, as well as contact information for the nearly 100 local Clean Cities coalitions across the country.

Not Available

2012-03-01T23:59:59.000Z

Note: This page contains sample records for the topic "apel org contact" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


141

University of Michigan -Traveler Contact Information Name __________________________________  

E-Print Network [OSTI]

University of Michigan - Traveler Contact Information Name __________________________________ Phone __________________________________ Email __________________________________ University of Michigan/Clinic __________________________________ Address __________________________________ Phone __________________________________ University of Michigan

Eustice, Ryan

142

Electrical Contacts to Individual Colloidal Semiconductor Nanorods  

E-Print Network [OSTI]

stable nanostructured electrical devices with interestingElectrical Contacts to Individual Colloidal Semiconductorand its effect on electrical properties has important

Trudeau, Paul-Emile

2008-01-01T23:59:59.000Z

143

www.ResponsiblePurchasing.org Sustainable Purchasing 101  

E-Print Network [OSTI]

.ResponsiblePurchasing.org RPN Nonprofit, ~200 members ·States ·Local governments ·Federal agencies ·Colleges and universities.ResponsiblePurchasing.org EPPs are... · Made with recycled content · Highly energy efficient · Designed to be long lasting · Recyclable or compostable · Made from renewable resources · Less toxic than conventional goods · Manufactured

Escher, Christine

144

Optimization of Modelica Models with JModelica.org and Optimica  

E-Print Network [OSTI]

Optimization of Modelica Models with JModelica.org and Optimica #12;Outline Modelica Dynamic Modelica Dynamic optimization and Optimica The JModelica.org open source project Applications What's next? #12;What is Modelica? A language for modeling of complex heterogeneous physical systems Open

145

Internship Program www.studycli.org Internship Program  

E-Print Network [OSTI]

Internship Program www.studycli.org Internship Program In an effort to strengthen the CLI community to introduce CLI's Internship Program. If interested, please email CLI at intern@studycli.org to set up a brief Skype interview. CLI's Internship Program fee is $1960 per month. Eligibility Requirements 1) Completed

Virginia Tech

146

Natural Language Engineering http://journals.cambridge.org/NLE  

E-Print Network [OSTI]

Natural Language Engineering http://journals.cambridge.org/NLE Additional services for Natural1351324912000101 Request Permissions : Click here Downloaded from http://journals.cambridge.org/NLE, IP address: 79 as anchors that delimit the search space. We use a large monolingual corpus to rank and filter

Wintner, Shuly

147

Natural Language Engineering http://journals.cambridge.org/NLE  

E-Print Network [OSTI]

Natural Language Engineering http://journals.cambridge.org/NLE Additional services for Natural Permissions : Click here Downloaded from http://journals.cambridge.org/NLE, IP address: 79.181.48.102 on 29-processing steps for a variety of natural language processing applications, from search and information extraction

Wintner, Shuly

148

Advanced Source/Drain and Contact Design for Nanoscale CMOS  

E-Print Network [OSTI]

Barrier Modeling of Metal and Silicide Contacts, IEEE Elec.Redistributions in Metal and Silicide Contacts, IEEE Trans.Redistributions in Metal and Silicide Contacts, IEEE Trans.

Vega, Reinaldo

2010-01-01T23:59:59.000Z

149

Contact DMSE | The Ames Laboratory  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc DocumentationP-Series to User Group andCompositionalInitial Validation andPWRContaCt TheContact

150

Contact Information | The Ames Laboratory  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc DocumentationP-Series to User Group andCompositionalInitial Validation andPWRContaCtContact

151

Contact Information | The Ames Laboratory  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc DocumentationP-Series to User Group andCompositionalInitial ValidationContact Information Human

152

Contact Us | Argonne National Laboratory  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc DocumentationP-Series to User GroupInformation Administration (EIA)Don HillebrandContact Us

153

Contact Us | DOE Data Explorer  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc DocumentationP-Series to User GroupInformation Administration (EIA)Don HillebrandContact

154

Contact Us | Department of Energy  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc DocumentationP-Series to User GroupInformation Administration (EIA)DonUs Contact Us For

155

Contact Us | Department of Energy  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc DocumentationP-Series to User GroupInformation Administration (EIA)DonUs Contact Us

156

Contact Us | Department of Energy  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc DocumentationP-Series to User GroupInformation Administration (EIA)DonUs Contact

157

Contact Us | The Ames Laboratory  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc DocumentationP-Series to User GroupInformation Administration (EIA)DonUsContact Us

158

Contacts | National Nuclear Security Administration  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc DocumentationP-Series to User GroupInformationE-Gov Contacts for E-Gov

159

Contact EM | Department of Energy  

Energy Savers [EERE]

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious RankCombustion |Energy UsageAUDITVehiclesTankless orAChief MedicalDepartmentWorking withAbout Us » Contact

160

Contact Us | Department of Energy  

Energy Savers [EERE]

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious RankCombustion |Energy UsageAUDITVehiclesTankless orAChief MedicalDepartmentWorking withAbout Us »Contact Us

Note: This page contains sample records for the topic "apel org contact" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


161

Contact Us | Department of Energy  

Energy Savers [EERE]

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious RankCombustion |Energy UsageAUDITVehiclesTankless orAChief MedicalDepartmentWorking withAbout Us »Contact

162

Contact Us | Department of Energy  

Energy Savers [EERE]

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious RankCombustion |Energy UsageAUDITVehiclesTankless orAChief MedicalDepartmentWorking withAbout UsContact Us

163

Contact Us | Department of Energy  

Energy Savers [EERE]

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious RankCombustion |Energy UsageAUDITVehiclesTankless orAChief MedicalDepartmentWorking withAbout UsContact UsUs

164

Contact Us | Department of Energy  

Energy Savers [EERE]

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious RankCombustion |Energy UsageAUDITVehiclesTankless orAChief MedicalDepartmentWorking withAbout UsContact

165

Contact Us | Department of Energy  

Energy Savers [EERE]

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious RankCombustion |Energy UsageAUDITVehiclesTankless orAChief MedicalDepartmentWorking withAboutUs » Contact Us

166

Contact Us | Department of Energy  

Energy Savers [EERE]

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious RankCombustion |Energy UsageAUDITVehiclesTankless orAChief MedicalDepartmentWorking withAboutUs » Contact

167

contact | netl.doe.gov  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsrucLasDelivered energy consumption byAbout SRNL HomeYoungClean EnergyContact NETL Technology

168

contact | netl.doe.gov  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsrucLasDelivered energy consumption byAbout SRNL HomeYoungClean EnergyContact NETL TechnologyOn-Site

169

contacts | netl.doe.gov  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsrucLasDelivered energy consumption byAbout SRNL HomeYoungClean EnergyContact NETL

170

contacts | netl.doe.gov  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsrucLasDelivered energy consumption byAbout SRNL HomeYoungClean EnergyContact NETLcontacts

171

EMSL Integration 2015: Contacts | EMSL  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation Proposed NewcatalystNeutronEnvironment > Voluntary ReportingAbout Us Doc.prepared2Contacts

172

Sandia National Laboratories: PV Contacts  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmosphericNuclear Security Administration the1 -theErik Spoerke SSLSMolten-Salt StorageNoLong RangePILSResourcesPV Contacts PV

173

Media Contacts | Argonne National Laboratory  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsrucLas Conchas recovery challenge fund LasDubey MathematicaMeasuring andSecurity Contact:

174

contacts | netl.doe.gov  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmosphericNuclear SecurityTensile Strain Switched5 Industrial Carbon Capture and Storage CleanDiscoveryCompletedContacts Operating

175

Contact Information | The Ames Laboratory  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation Proposed New SubstationCleanCommunity2Workshops 2008 To1 Building 9201-1 wasFAboutContact

176

Contact Information | The Ames Laboratory  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation Proposed New SubstationCleanCommunity2Workshops 2008 To1 Building 9201-1 wasFAboutContact

177

Contact Information | The Ames Laboratory  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation Proposed New SubstationCleanCommunity2Workshops 2008 To1 Building 9201-1 wasFAboutContact

178

Contact Us | The Ames Laboratory  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation Proposed New SubstationCleanCommunity2Workshops 2008 To1 BuildingContact UsNNSAContact Us

179

University of Delaware | Contact CCEI  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformation Desert Southwest RegionatSearchScheduledProductionCCEIResearch Thrust PyrolysisContact

Note: This page contains sample records for the topic "apel org contact" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


181

Rolling Contact Fatigue of Ceramics  

SciTech Connect (OSTI)

High hardness, low coefficient of thermal expansion and high temperature capability are properties also suited to rolling element materials. Silicon nitride (Si{sub 3}N{sub 4}) has been found to have a good combination of properties suitable for these applications. However, much is still not known about rolling contact fatigue (RCF) behavior, which is fundamental information to assess the lifetime of the material. Additionally, there are several test techniques that are employed internationally whose measured RCF performances are often irreconcilable. Due to the lack of such information, some concern for the reliability of ceramic bearings still remains. This report surveys a variety of topics pertaining to RCF. Surface defects (cracks) in Si{sub 3}N{sub 4} and their propagation during RCF are discussed. Five methods to measure RCF are then briefly overviewed. Spalling, delamination, and rolling contact wear are discussed. Lastly, methods to destructively (e.g., C-sphere flexure strength testing) and non-destructively identify potential RCF-limiting flaws in Si{sub 3}N{sub 4} balls are described.

Wereszczak, Andrew A [ORNL; Wang, W. [Bournemouth University, Bournemouth, United Kingdom; Wang, Y. [Bournemouth University, Bournemouth, United Kingdom; Hadfield, M. [Bournemouth University, Bournemouth, United Kingdom; Kanematsu, W. [National Institute of Advanced Industrial Science and Technology, Japan; Kirkland, Timothy Philip [ORNL; Jadaan, Osama M. [University of Wisconsin, Platteville

2006-09-01T23:59:59.000Z

182

GEOLOGY, February 2007 119Geology, February 2007; v. 35; no. 2; p. 119122; doi: 10.1130/G23133A.1; 3 figures; Data Repository item 2007034. 2007 Geological Society of America. For permission to copy, contact Copyright Permissions, GSA, or editing@geosoci  

E-Print Network [OSTI]

; Arbogast, 1996; Holliday, 2001). The 1930s dust storms are generally attributed to the effects of drought transport predat- ing widespread agriculture. Loess deposits can record changing effective moisture to copy, contact Copyright Permissions, GSA, or editing@geosociety.org. INTRODUCTION Droughts of the 1930s

Loope, David B.

183

Pg. 1 -http://www.eduteka.org/EstandaresDocentesUnesco.php Pg. 2 -http://www.eduteka.org/EstandaresDocentesUnesco.php  

E-Print Network [OSTI]

Pág. 1 - http://www.eduteka.org/EstandaresDocentesUnesco.php #12;Pág. 2 - http://www.eduteka.org/EstandaresDocentesUnesco.php UNESCO ESTÁNDARES DE COMPETENCIAS EN TIC PARA DOCENTES http://portal.unesco.org/es/ev.php-URL_ID=41553 UNESCO cumple con: #12;Pág. 3 - http://www.eduteka.org/EstandaresDocentesUnesco.php a) su función como

Vásquez, Carlos

184

BISON Contact Improvements CASL FY14 Report  

SciTech Connect (OSTI)

The BISON code is the foundation for multiple fuel performance modeling efforts, and is cur- rently under heavy development. For a variety of fuel forms, the effects of heat conduction across a gap and mechanical contact between components of a fuel system are very significant. It is thus critical that BISON have robust capabilities for enforcement of thermal and mechanical contact. BISONs solver robustness has generally been quite good before mechanical contact between the fuel and cladding occurs, but there have been significant challenges obtaining converged so- lutions once that contact occurs and the solver begins to enforce mechanical contact constraints. During the current year, significant development effort has been focused on the enforcement of mechanical contact to provide improved solution robustness. In addition to this work to improve mechanical contact robustness, an investigation into ques- tionable results attributable to thermal contact has been performed. This investigation found that the order of integration typically used on the surfaces involved in thermal contact was not suffi- ciently high. To address this problem, a new option was provided to permit the use of a different integration order for surfaces, and new usage recommendations were provided.

B. W. Spencer; J. D. Hales; D. R. Gaston; D. A. Karpeev; R. L. Williamson; S. R. Novascone; D. M. Perez; R. J. Gardner; K. A. Gamble

2014-09-01T23:59:59.000Z

185

Clean Cities Program Contacts (Fact Sheet)  

SciTech Connect (OSTI)

This fact sheet contains contact information for program staff and coalition coordinators for the U.S. Department of Energy's Clean Cities program.

Not Available

2012-10-01T23:59:59.000Z

186

Clean Cities Program Contacts (Fact Sheet)  

SciTech Connect (OSTI)

This fact sheet contains contact information for program staff and coalition coordinators for the U.S. Department of Energy's Clean Cities program.

Not Available

2013-01-01T23:59:59.000Z

187

Clean Cities Program Contacts (Fact Sheet)  

SciTech Connect (OSTI)

This fact sheet contains contact information for program staff and coalition coordinators for the U.S. Department of Energy's Clean Cities program.

Not Available

2012-09-01T23:59:59.000Z

188

Contact Form - DOE Directives, Delegations, and Requirements  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Contact Form by Diane Johnson Directives are the Department of Energy's Primary means of establishing policies, requirements, responsibilities, and procedures for Departmental...

189

Goldschmidt Conference Abstracts Mineralogical Magazine www.minersoc.org  

E-Print Network [OSTI]

Goldschmidt Conference Abstracts Mineralogical Magazine www.minersoc.org 1279 Role of Fe- and Mn by mineral surface area, mineralogy, pH, redox, polyvalent cations, ionic strength, and the chemical

Sparks, Donald L.

190

Silicone oil contamination and electrical contact resistance degradation of low-force gold contacts.  

SciTech Connect (OSTI)

Hot-switched low-force gold electrical contact testing was performed using a nanomechanical test apparatus to ascertain the sensitivity of simulated microelectromechanical systems (MEMS) contact to silicone oil contamination. The observed cyclic contact resistance degradation was dependent on both closure rate and noncontact applied voltage. The decomposition of silicone oil from electrical arcing was hypothesized as the degradation mechanism.

Dugger, Michael Thomas; Dickrell, Daniel John, III

2006-02-01T23:59:59.000Z

191

Title of Document | 1 LOCAL UNION CONTACT LIST  

E-Print Network [OSTI]

on the following web site: http://atyourservice.ucop.edu/employees/policies/labor_relations/index.html Code., Suite C San Diego CA 92110 (619) 296-4937 Web site: www.cueunion.org SX Service American Federation) 296-0342 Web site: www.afscme3299.org EX Patient Care Technical American Federation of State, County

Gleeson, Joseph G.

192

Electrical contact resistance degradation of a hot-switched simulated metal MEMS contact.  

SciTech Connect (OSTI)

Electrical contact resistance testing was performed by hot-switching a simulated gold-platinum metal microelectromechanical systems contact. The experimental objective was to determine the sensitivity of the contact resistance degradation to current level and environment. The contact resistance increased sharply after 100 hot-switched cycles in air. Hot-switching at a reduced current and in nitrogen atmosphere curtailed contact resistance degradation by several orders of magnitude. The mechanism responsible for the resistance degradation was found to be arc-induced decomposition of adsorbed surface contaminants.

Dugger, Michael Thomas; Dickrell, Daniel John, III

2005-03-01T23:59:59.000Z

193

Contact SSRL | Stanford Synchrotron Radiation Lightsource  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformation InInformationCenterResearchCASLNanoporousTestimony |IdahoVisionContact InContactContact Us

194

Contact Us | Y-12 National Security Complex  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformation InInformationCenterResearchCASLNanoporousTestimonyContact Us - WorkingContact Us Contact

195

Contact us | Energy Frontier Research Centers  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformation InInformationCenterResearchCASLNanoporousTestimonyContact Us - WorkingContact UsContact us

196

Contact | MIT-Harvard Center for Excitonics  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformation InInformationCenterResearchCASLNanoporousTestimonyContact Us - WorkingContact UsContact

197

Contact Us | Linac Coherent Light Source  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation Proposed New SubstationCleanCommunity2Workshops 2008 To1 BuildingContact Us ContactContact

198

2005, in Etudes croles nXXVIII n1,Contacts de croles, croles en contacts, L'Harmattan, 23-57. CONTACTS DE CREOLES A MANA (GUYANE FRANAISE)  

E-Print Network [OSTI]

2005, in Etudes créoles n°XXVIII n°1,Contacts de créoles, créoles en contacts, L'Harmattan, 23°1,Contacts de créoles, créoles en contacts, L'Harmattan, 23-57. 2 de langues, notamment à la gestion

Paris-Sud XI, Université de

199

Contact Information College of Business and Economics  

E-Print Network [OSTI]

Contact Information College of Business and Economics Center for Business Research and Economic Research and Economic Development Center What's your challenge? We help businesses and organizations can lie in Accountancy, Economics, Information Technology and Supply Chain Management, International

Barrash, Warren

200

Front contact solar cell with formed emitter  

SciTech Connect (OSTI)

A bipolar solar cell includes a backside junction formed by an N-type silicon substrate and a P-type polysilicon emitter formed on the backside of the solar cell. An antireflection layer may be formed on a textured front surface of the silicon substrate. A negative polarity metal contact on the front side of the solar cell makes an electrical connection to the substrate, while a positive polarity metal contact on the backside of the solar cell makes an electrical connection to the polysilicon emitter. An external electrical circuit may be connected to the negative and positive metal contacts to be powered by the solar cell. The positive polarity metal contact may form an infrared reflecting layer with an underlying dielectric layer for increased solar radiation collection.

Cousins, Peter John

2014-11-04T23:59:59.000Z

Note: This page contains sample records for the topic "apel org contact" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


201

Front contact solar cell with formed emitter  

DOE Patents [OSTI]

A bipolar solar cell includes a backside junction formed by an N-type silicon substrate and a P-type polysilicon emitter formed on the backside of the solar cell. An antireflection layer may be formed on a textured front surface of the silicon substrate. A negative polarity metal contact on the front side of the solar cell makes an electrical connection to the substrate, while a positive polarity metal contact on the backside of the solar cell makes an electrical connection to the polysilicon emitter. An external electrical circuit may be connected to the negative and positive metal contacts to be powered by the solar cell. The positive polarity metal contact may form an infrared reflecting layer with an underlying dielectric layer for increased solar radiation collection.

Cousins, Peter John (Menlo Park, CA)

2012-07-17T23:59:59.000Z

202

Contact fatigue : life prediction and palliatives  

E-Print Network [OSTI]

Fretting fatigue is defined as damage resulting from small magnitude (0.5-50 microns) displacement between contacting bodies where at least one of the bodies has an applied bulk stress. The applicability and limits of a ...

Conner, Brett P. (Brett Page), 1975-

2002-01-01T23:59:59.000Z

203

DOE Headquarters Contact Information: Employee Concerns Program...  

Broader source: Energy.gov (indexed) [DOE]

Office ECP Contact Information: Albuquerque Complex (NNSA) Eva Glow Brownlow Michelle Rodriguez de Varela Hotline: 800-688-5713 Fax: 505-845-4020 E-mail: ecp@nnsa.doe.gov...

204

NUMERICAL MODELING OF CATHODE CONTACT MATERIAL DENSIFICATION  

SciTech Connect (OSTI)

Numerical modeling was used to simulate the constrained sintering process of the cathode contact layer during assembly of solid oxide fuel cells (SOFCs). A finite element model based on the continuum theory for sintering of porous bodies was developed and used to investigate candidate low-temperature cathode contact materials. Constitutive parameters for various contact materials under investigation were estimated from dilatometry screening tests, and the influence of processing time, processing temperature, initial grain size, and applied compressive stress on the free sintering response was predicted for selected candidate materials. The densification behavior and generated stresses within a 5-cell planar SOFC stack during sintering, high temperature operation, and room temperature shutdown were predicted. Insufficient constrained densification was observed in the stack at the proposed heat treatment, but beneficial effects of reduced grain size, compressive stack preload, and reduced thermal expansion coefficient on the contact layer densification and stresses were observed.

Koeppel, Brian J.; Liu, Wenning N.; Stephens, Elizabeth V.; Khaleel, Mohammad A.

2011-11-01T23:59:59.000Z

205

Clean Cities Program Contacts (Fact Sheet)  

SciTech Connect (OSTI)

Contact information for the U.S. Department of Energy's Clean Cities program staff and for the coordinators of the nearly 100 local Clean Cities coalitions across the country.

Not Available

2013-12-01T23:59:59.000Z

206

The contact angle in inviscid fluid mechanics  

E-Print Network [OSTI]

We show that in general, the specification of a contact angle condition at the contact line in inviscid fluid motions is incompatible with the classical field equations and boundary conditions generally applicable to them. The limited conditions under which such a specification is permissible are derived; however, these include cases where the static meniscus is not flat. In view of this situation, the status of the many `solutions' in the literature which prescribe a contact angle in potential flows comes into question. We suggest that these solutions which attempt to incorporate a phenomenological, but incompatible, condition are in some, imprecise sense `weak-type solutions'; they satisfy or are likely to satisfy, at least in the limit, the governing equations and boundary conditions everywhere except in the neighbourhood of the contact line. We discuss the implications of the result for the analysis of inviscid flows with free surfaces.

P N Shankar; R Kidambi

2005-08-17T23:59:59.000Z

207

Louise Guy, Administrative Contact College of Education  

E-Print Network [OSTI]

provide leadership, scholarship and training across the following programs: · Educational Specialist/Severe Disabilities, Orientation & Mobility, and Vocational Special Education). · Certificate programs offeredLouise Guy, Administrative Contact College of Education Department of Special Education 1600

208

Cooperativity and Contact Order in Protein Folding  

E-Print Network [OSTI]

The effects of cooperativity are studied within Go-Lennard-Jones models of proteins by making the contact interactions dependent on the proximity to the native conformation. The kinetic universality classes are found to remain the same as in the absence of cooperativity. For a fixed native geometry, small changes in the effective contact map may affect the folding times in a chance way and to the extent that is comparable to the shift in the folding times due to cooperativity. The contact order controlls folding scenarios: the average times necessary to bring pairs of amino acids into their near native separations depend on the sequential distances within the pairs. This dependence is largely monotonic, regardless of the cooperativity, and the dominant trend could be described by a single parameter like the average contact order. However, it is the deviations from the trend which are usually found to set the net folding times.

Marek Cieplak

2004-01-11T23:59:59.000Z

209

Colorado State University Extension Contact: Joanne Littlefield  

E-Print Network [OSTI]

Colorado State University Extension Contact: Joanne Littlefield Director, Outreach and Engagement weather situation in Colorado is requiring often quick property and safety decisions; recovery efforts and rapidly shifting conditions along Colorado's Front Range. From food safety issues related to crops

Stephens, Graeme L.

210

Archived BPRC Web Links: http://www.arcus.org/trec/vbc/index.php?act=home  

E-Print Network [OSTI]

Archived BPRC Web Links: http://www.arcus.org/trec/vbc/index.php?act=home "Explore Antarctica guide. http://www.marinetech.org/rov_competition/2007/international_comp_2007.php International Student or call 614-292-3416. http://www.nsta.org/main/news/stories/nsta_story.php?news_story_ID=53499

Howat, Ian M.

211

GREAT MINDSTHINK ELECTRIC / WWW.EVS26.ORG Mitigation of Vehicle Fast Charge  

E-Print Network [OSTI]

GREAT MINDSTHINK ELECTRIC / WWW.EVS26.ORG Mitigation of Vehicle Fast Charge Grid Impacts-55080 #12;GREAT MINDSTHINK ELECTRIC / WWW.EVS26.ORG Electric Vehicle Grid Integration 2 Cross Cutting & TESTING DEPLOYMENT & PARTNERSHIPS Tx Tx Tx #12;GREAT MINDSTHINK ELECTRIC / WWW.EVS26.ORG3 Vehicle Test

212

StepGreen.org: Increasing energy saving behaviors via social networks Jennifer Mankoff1  

E-Print Network [OSTI]

StepGreen.org: Increasing energy saving behaviors via social networks Jennifer Mankoff1 , Susan R and evaluation of StepGreen.org, a site intended to promote energy-saving behaviors. We present the results of StepGreen.org (Figure 1), a site intended to motivate people to make energy-reducing changes

Mankoff, Jennifer

213

ElasticPlastic Spherical Contact Modeling Including Roughness Effects  

E-Print Network [OSTI]

A multilevel model for elasticplastic contact between ajunction growth of an elasticplastic spherical contact. J.nite element based elasticplastic model for the contact of

Li, L.; Etsion, I.; Talke, F. E.

2010-01-01T23:59:59.000Z

214

Exploring Korean Americans Interracial Contact Experiences During Recreational Sport Activities  

E-Print Network [OSTI]

This thesis follows the style of Journal of Leisure Research. 2 of friendship, as an essential condition for successful intergroup contact (Pettigrew, 1997; Pettigrew & Tropp, 2006). Since the contact hypothesis was first introduced, intergroup contact... conditions for successful intergroup contact. Their meta-analysis of 713 independent samples from 515 intergroup contact studies revealed four important findings First, 17 intergroup contact typically reduces intergroup prejudice. Second, the positive...

Lee, Kang Jae

2010-07-14T23:59:59.000Z

215

EERE Information Center Contact, PIA, The Office of Energy Efficiency...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Information Center Contact, PIA, The Office of Energy Efficiency and Renewable Energy (EERE) EERE Information Center Contact, PIA, The Office of Energy Efficiency and Renewable...

216

Cell Phone Allergic Contact Dermatitis: Case Report and Review  

E-Print Network [OSTI]

testing in a sample of cell phones in Denmark. ContactCell phone allergic contact dermatitis: Case report andcombination of increased cell phone ownership and unlimited

Rajpara, Anand; Feldman, Steven R

2010-01-01T23:59:59.000Z

217

Contact: Nancy Ross, 510-251-1600 x106, nross@pacinst.org Dr. Peter Gleick Calls on the Senate  

E-Print Network [OSTI]

allocation and use among neighboring states, unmitigated water contamination from both known and new to Move on Specific Water Policy Reforms Recommends Fundamental Changes to Ensure Sustainable Water national water policy. Dr. Gleick, one of the world's leading experts on freshwater issues, testified

218

PFP: Protein Function Prediction server For any questions regarding PFP contact the administration at info@kiharalab.org  

E-Print Network [OSTI]

also click on "Load Sample" link to load this sequence in the text box and follow the next steps "Enter Query Sequence(s)". Consider the following sequence that you can enter. >sp|P56851|EP3B. Clicking on "Clear" link will clear the text box for sequence and load default ESG parameters in the boxes

Kihara, Daisuke

219

Electric Field and Humidity Trigger Contact Electrification  

E-Print Network [OSTI]

Here, we study the old problem of why identical insulators can charge one another on contact. We perform several experiments showing that, if driven by a preexisting electric field, charge is transferred between contacting insulators. This happens because the insulator surfaces adsorb small amounts of water from a humid atmosphere. We believe the electric field then separates positively from negatively charged ions prevailing within the water, which we believe to be hydronium and hydroxide ions, such that at the point of contact, positive ions of one insulator neutralize negative ions of the other one, charging both of them. This mechanism can explain for the first time the observation made four decades ago that wind-blown sand discharges in sparks if and only if a thunderstorm is nearby.

Zhang, Yanzhen; Liu, Yonghong; Wang, Xiaolong; Zhang, Rui; Shen, Yang; Ji, Renjie; Cai, Baoping

2015-01-01T23:59:59.000Z

220

Electric Field and Humidity Trigger Contact Electrification  

E-Print Network [OSTI]

Here, we study the old problem of why identical insulators can charge one another on contact. We perform several experiments showing that, if driven by a preexisting electric field, charge is transferred between contacting insulators. This happens because the insulator surfaces adsorb small amounts of water from a humid atmosphere. We believe the electric field then separates positively from negatively charged ions prevailing within the water, which we believe to be hydronium and hydroxide ions, such that at the point of contact, positive ions of one insulator neutralize negative ions of the other one, charging both of them. This mechanism can explain for the first time the observation made four decades ago that wind-blown sand discharges in sparks if and only if a thunderstorm is nearby.

Yanzhen Zhang; Thomas Phtz; Yonghong Liu; Xiaolong Wang; Rui Zhang; Yang Shen; Renjie Ji; Baoping Cai

2015-01-14T23:59:59.000Z

Note: This page contains sample records for the topic "apel org contact" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


221

Contacts for Integrating Renewable Energy into Federal Construction Projects  

Broader source: Energy.gov [DOE]

Contacts to learn more about integrating renewable energy technologies into Federal construction projects.

222

Ohmic contacts to n-GaSb  

E-Print Network [OSTI]

in the semiconductor is measured during the deposition of the metal contact. In using method 1, the I-V characteristics is plotted. The thermionic emission theory predicts the current-voltage characteristics of Schottky diodes as [13]: J(rhcrmionic) = A" T' exp... of different work functions. This situation is also true for metal contacts to n-GaSb. Polyakov et al. [14] examined the Schottky diodes of Al, Au, In, Pd, Ga, and Sb on Te doped n-GaSb. They used the C-V measurements methods. They reported that barrier...

Yang, Zhengchong

2012-06-07T23:59:59.000Z

223

Contact Us | National Nuclear Security Administration  

National Nuclear Security Administration (NNSA)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) "ofEarlyEnergyDepartment ofDepartment ofofOxford SiteToledoSampling at the GrandSr:s I1Us |Contact Us Contact

224

Contact Upper Great Plains Regional Office  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc DocumentationP-Series to User Group andCompositionalInitial ValidationContact InformationContact

225

Contact Us | Photosynthetic Antenna Research Center  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc DocumentationP-Series to User GroupInformation Administration (EIA)DonUs ContactLosContact

226

Contact Us | Y-12 National Security Complex  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc DocumentationP-Series to User GroupInformation Administration (EIA)DonUsContact UsContact

227

Contacts for Services | Department of Energy  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc DocumentationP-Series to User GroupInformationE-Gov Contacts for E-Gov LeAnnProjectContacts for

228

Contact Information | Princeton Plasma Physics Lab  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformation InInformationCenterResearchCASLNanoporousTestimony |IdahoVisionContact InContact

229

Contact Us - Working With Us | NREL  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformation InInformationCenterResearchCASLNanoporousTestimonyContact Us - Working With Us Contact us

230

Contact Us | Center for Energy Efficient Materials  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformation InInformationCenterResearchCASLNanoporousTestimonyContact Us - Working With UsContact

231

Contact Us | Y-12 National Security Complex  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation Proposed New SubstationCleanCommunity2Workshops 2008 To1 BuildingContact UsNNSAContactContact

232

Contacts For "A" | EMSL  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation Proposed New SubstationCleanCommunity2Workshops 2008 To1ContactA" Contacts For

233

Contacts For "B" | EMSL  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation Proposed New SubstationCleanCommunity2Workshops 2008 To1ContactA" Contacts ForB"

234

Contacts For "C" | EMSL  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation Proposed New SubstationCleanCommunity2Workshops 2008 To1ContactA" Contacts

235

Contacts For "D" | EMSL  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation Proposed New SubstationCleanCommunity2Workshops 2008 To1ContactA" ContactsD"

236

Contacts For "E" | EMSL  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation Proposed New SubstationCleanCommunity2Workshops 2008 To1ContactA" ContactsD"E"

237

Contacts For "G" | EMSL  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation Proposed New SubstationCleanCommunity2Workshops 2008 To1ContactA"G" Contacts For

238

Contacts For "H" | EMSL  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation Proposed New SubstationCleanCommunity2Workshops 2008 To1ContactA"G" Contacts

239

Contacts For "I" | EMSL  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation Proposed New SubstationCleanCommunity2Workshops 2008 To1ContactA"G" ContactsI"

240

Contacts For "K" | EMSL  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation Proposed New SubstationCleanCommunity2Workshops 2008 To1ContactA"G"K" Contacts

Note: This page contains sample records for the topic "apel org contact" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


241

Contacts For "S" | EMSL  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation Proposed New SubstationCleanCommunity2Workshops 2008O" Contacts ForS" Contacts For

242

Contacts For "T" | EMSL  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation Proposed New SubstationCleanCommunity2Workshops 2008O" Contacts ForS" Contacts

243

Contacts | Y-12 National Security Complex  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation Proposed New SubstationCleanCommunity2Workshops 2008O" ContactsContacts for

244

www.egec.org Nuremberg, 15 October 2013  

E-Print Network [OSTI]

and Technology ­ a report from EGC 2013 Dr. Burkhard Sanner European Geothermal Energy Council, Brussels #12;www.egec.org Content European Geothermal Energy Council · Market and application · Technological development The European Geothermal Energy Congress in June 2013 in Pisa (EGC 2013) brought together ca 500 experts from

Oak Ridge National Laboratory

245

www.asq.org 7 Foundations for Quality  

E-Print Network [OSTI]

www.asq.org 7 Foundations for Quality Management of Scientific Data Products NICOLE M. RADZIWILL of this research is to provide a conceptual foundation for the management of data quality as it applies management (TQM) philosophy, total information quality management (TIQM), and total data quality management

Radziwill, Nicole

246

www.cambridge.org/us/9780521194280 Molecular Machines in  

E-Print Network [OSTI]

www.cambridge.org/us/9780521194280 Molecular Machines in Biology Workshop of the Cell Joachim Frank Columbia University, New York About the Book The concept of molecular machines in biology has transformed, translation, protein folding, and protein degradation, are all carried out by molecular machines. This volume

Grishok, Alla

247

www.VadoseZoneJournal.org Vadose Zone Journal  

E-Print Network [OSTI]

and internationally. The high proportion of scholarly submissions from international scien- tists outsidewww.VadoseZoneJournal.org Vadose Zone Journal: The First Ten Years We proudly present a special section inspired by the 10-year anniversary of Vadose Zone Journal. From the outset, the journal

Vrugt, Jasper A.

248

GEOLOGY | August 2012 | www.gsapubs.org 747 INTRODUCTION  

E-Print Network [OSTI]

GEOLOGY | August 2012 | www.gsapubs.org 747 INTRODUCTION Reduced organic carbon is the primary carbon and light, alternative energy sources, such as Fe(II), must be avail- able in order for life(II) as an energy source for microbial metabolism as well as supply a source of inorganic carbon for fixation

Loope, David B.

249

The China Quarterly http://journals.cambridge.org/CQY  

E-Print Network [OSTI]

The China Quarterly http://journals.cambridge.org/CQY Additional services for The China Quarterly here Lowincome Housing in Chinese Cities: Policies and Practices Youqin Huang The China Quarterly (2012). Lowincome Housing in Chinese Cities: Policies and Practices. The China Quarterly, 212, pp

Huang, Youqin

250

The China Quarterly http://journals.cambridge.org/CQY  

E-Print Network [OSTI]

The China Quarterly http://journals.cambridge.org/CQY Additional services for The China Quarterly and Boston: Brill, 2012. vii + 394 pp., 133.00 $182.00. ISBN 9789004218444 Benjamin A. Elman The China this article: Benjamin A. Elman (2012). The China Quarterly, 212, pp 11451148 doi:10.1017/ S0305741012001440

Elman, Benjamin

251

www.newphytologist.org 1 Blackwell Publishing, Ltd.  

E-Print Network [OSTI]

www.newphytologist.org 1 Research Blackwell Publishing, Ltd. Mutations in CAX1 produce phenotypes calcium-proton antiporter CAX1. · cax1 mutants have most of the phenotypes associated with tolerance-of-function cax1 mutations could produce all these phenotypes characteristic of plants adapted to serpentine soils

Bradshaw, Toby

252

Journal of Fluid Mechanics http://journals.cambridge.org/FLM  

E-Print Network [OSTI]

Journal of Fluid Mechanics http://journals.cambridge.org/FLM Additional services for Journal of Fluid Mechanics: Email alerts: Click here Subscriptions: Click here Commercial reprints: Click here, John R. Lister and M. Grae Worster Journal of Fluid Mechanics / Volume 700 / June 2012, pp 63 76 DOI

Worster, M. Grae

253

Journal of Fluid Mechanics http://journals.cambridge.org/FLM  

E-Print Network [OSTI]

Journal of Fluid Mechanics http://journals.cambridge.org/FLM Additional services for Journal of Fluid Mechanics: Email alerts: Click here Subscriptions: Click here Commercial reprints: Click here. Woodhouse and Raymond E. Goldstein Journal of Fluid Mechanics / Volume 705 / August 2012, pp 165 175 DOI

Goldstein, Raymond E.

254

Journal of Fluid Mechanics http://journals.cambridge.org/FLM  

E-Print Network [OSTI]

Journal of Fluid Mechanics http://journals.cambridge.org/FLM Additional services for Journal of Fluid Mechanics: Email alerts: Click here Subscriptions: Click here Commercial reprints: Click here. Pegler and M. Grae Worster Journal of Fluid Mechanics / Volume 696 / April 2012, pp 152 174 DOI: 10

Worster, M. Grae

255

Journal of Fluid Mechanics http://journals.cambridge.org/FLM  

E-Print Network [OSTI]

Journal of Fluid Mechanics http://journals.cambridge.org/FLM Additional services for Journal of Fluid Mechanics: Email alerts: Click here Subscriptions: Click here Commercial reprints: Click here and E. I. Parau Journal of Fluid Mechanics / Volume 688 / December 2011, pp 528 550 DOI: 10.1017/jfm

Parau, Emilian I.

256

Journal of Fluid Mechanics http://journals.cambridge.org/FLM  

E-Print Network [OSTI]

Journal of Fluid Mechanics http://journals.cambridge.org/FLM Additional services for Journal of Fluid Mechanics: Email alerts: Click here Subscriptions: Click here Commercial reprints: Click here. Paoletti and Harry L. Swinney Journal of Fluid Mechanics / Volume 706 / September 2012, pp 571 583 DOI: 10

Texas at Austin. University of

257

www.sensor-ip.org Sustainability Impact Assessment  

E-Print Network [OSTI]

www.sensor-ip.org May 2005 Sustainability Impact Assessment: Tools for Environmental, Social countries constitute the consortium, which develops science based ex-ante Sustainability Impact Assessment regions. SENSOR directly responds to the European sustainability objectives as applied to land use

258

https://doyouliveunited.org 1. Enter you user ID  

E-Print Network [OSTI]

Search' button. 7. Enter you search terms for the agency of your choice and click on `Search'. #12;httpshttps://doyouliveunited.org 1. Enter you user ID: your email address Enter your password: welcome be different then the options listed here. 5. For a payroll pledge, enter the amount per pay or the total

259

www.rsc.org Registered Charity Number 207890  

E-Print Network [OSTI]

www.rsc.org Registered Charity Number 207890 As featured in: SeeWeitz et al., Lab Chip, 2008, 8 silanes. These silanes allow us to tailor the surface chemistry of the interface and to use lithographic tech- niques to spatially pattern the wettability. To demonstrate the utility of this approach, we

260

http://journals.cambridge.org/ROB Additional services for Robotica  

E-Print Network [OSTI]

Robotica http://journals.cambridge.org/ROB Additional services for Robotica: Email alerts: Click predictive controller for robots to follow a virtual leader Dongbing Gu and Huosheng Hu Robotica / Volume 27. Robotica, 27, pp 905-913 doi:10.1017/S0263574708005316 Request Permissions : Click here Downloaded from

Hu, Huosheng

Note: This page contains sample records for the topic "apel org contact" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


261

http://journals.cambridge.org/ROB Additional services for Robotica  

E-Print Network [OSTI]

Robotica http://journals.cambridge.org/ROB Additional services for Robotica: Email alerts: Click and Vicente Matellán Robotica / Volume 26 / Issue 06 / November 2008, pp 817 - 830 DOI: 10.1017/S (2008). A hybrid approach to fast and accurate localization for legged robots. Robotica, 26, pp 817

Hu, Huosheng

262

http://journals.cambridge.org/ROB Additional services for Robotica  

E-Print Network [OSTI]

Robotica http://journals.cambridge.org/ROB Additional services for Robotica: Email alerts: Click and Y. Ahmet ekerciolu Robotica / FirstView Article / October 2014, pp 1 - 13 DOI: 10.1017/S formation control of networked mobile robots in environments with obstacles. Robotica, Available on CJO 2014

Sekercioglu, Y. Ahmet

263

http://journals.cambridge.org/ROB Additional services for Robotica  

E-Print Network [OSTI]

Robotica http://journals.cambridge.org/ROB Additional services for Robotica: Email alerts: Click. Goldberg Robotica / Volume 13 / Issue 06 / November 1995, pp 565 573 DOI: 10.1017/S0263574700018646 algorithms for automatic planning by robots in stochastic environments. Robotica,13, pp 565573 doi:10.1017/S

Goldberg, Ken

264

http://journals.cambridge.org/ROB Additional services for Robotica  

E-Print Network [OSTI]

Robotica http://journals.cambridge.org/ROB Additional services for Robotica: Email alerts: Click Robotica / FirstView Article / September 2012, pp 1 8 DOI: 10.1017/S0263574711000774, Published online: 25 on taskoriented workspace. Robotica, Available on CJO 2011 doi:10.1017/S0263574711000774 Request Permissions

Kim, Jongwon

265

http://journals.cambridge.org/ROB Additional services for Robotica  

E-Print Network [OSTI]

Robotica http://journals.cambridge.org/ROB Additional services for Robotica: Email alerts: Click Robotica / Volume 24 / Issue 04 / July 2006, pp 429 - 431 DOI: 10.1017/S0263574705002420, Published online positioning method for a humanoid robot. Robotica, 24, pp 429-431 doi:10.1017/S0263574705002420 Request

Hu, Huosheng

266

The Neutron Scattering Society www.neutronscattering.org  

E-Print Network [OSTI]

The Neutron Scattering Society of America www.neutronscattering.org Press Release February 11, 2008 The Neutron Scattering Society of America is pleased to announce the election as Fellows of the Society of in application of neutron scattering to studies of surfaces and crystal field excitations as well as his

Homes, Christopher C.

267

The Neutron Scattering Society www.neutronscattering.org  

E-Print Network [OSTI]

The Neutron Scattering Society of America www.neutronscattering.org Press Release, February 4, 2008 The Neutron Scattering Society of America is pleased to announce the 2008 recipients of its 3 major prizes. The Neutron Scattering Society of America (NSSA) established the Clifford G. Shull Prize in Neutron Science

Chen, Sow-Hsin

268

ISSN 1464-0325 www.rsc.org/jem  

E-Print Network [OSTI]

ISSN 1464-0325 www.rsc.org/jem Cutting-Edge Research on Environmental Processes & Impacts Volume 10 | Number 11 | November 2008 | Pages 1241­1372 Journal of Environmental Monitoring Cover Benitez et al. Microbial activity in contaminated soils 10th Anniversary Focus Leal Filho Rainforest depletion and climate

Granada, Universidad de

269

Department Name: Education Studies Org. #: 2125 Position Title: Office Worker  

E-Print Network [OSTI]

Department Name: Education Studies Org. #: 2125 Position Title: Office Worker WLS Level: 1 Position-year); and 2. Students of any classification whose work is characterized by highly structured tasks or outcomes for departmental functions and/or programs. This level is assigned to the following: 1. Student managers

Baltisberger, Jay H.

270

Department Name: Education Studies Org. #: 2125 Position Title: Building Monitor  

E-Print Network [OSTI]

Department Name: Education Studies Org. #: 2125 Position Title: Building Monitor WLS Level: 4 if entering mid-year); and 2. Students of any classification whose work is characterized by highly structured for departmental functions and/or programs. This level is assigned to the following: 1. Student managers

Baltisberger, Jay H.

271

Department Name: Education Studies Org. #: 2125 Position Title: Office Associate  

E-Print Network [OSTI]

Department Name: Education Studies Org. #: 2125 Position Title: Office Associate WLS Levels: 3 -- 4 if entering mid-year); and 2. Students of any classification whose work is characterized by highly structured for departmental functions and/or programs. This level is assigned to the following: Student managers

Baltisberger, Jay H.

272

Department Name: Education Studies Org. #: 2125 Position Title: Janitor  

E-Print Network [OSTI]

Department Name: Education Studies Org. #: 2125 Position Title: Janitor WLS Level: 1 Position Code-year); and 2. Students of any classification whose work is characterized by highly structured tasks or outcomes for departmental functions and/or programs. This level is assigned to the following: 1. Student managers

Baltisberger, Jay H.

273

EPJ Photovoltaics 2, 20301 (2011) www.epj-pv.org  

E-Print Network [OSTI]

EPJ Photovoltaics 2, 20301 (2011) www.epj-pv.org DOI: 10.1051/epjpv/2011001 c Owned by the authors, published by EDP Sciences, 2011 EPJ PhotovoltaicsEPJ Photovoltaics Geometrical optimization and electrical online: 1 April 2011 Abstract This article investigates the optimal efficiency of a photovoltaic system

Paris-Sud XI, Universit de

2011-01-01T23:59:59.000Z

274

August 2013 EPL, 103 (2013) 46003 www.epljournal.org  

E-Print Network [OSTI]

its energy in a fairly compact cas- cade, forming a concentrated area of high-energy density. So farAugust 2013 EPL, 103 (2013) 46003 www.epljournal.org doi: 10.1209/0295-5075/103/46003 High-energy-00014 Helsinki, Finland, EU 2 EURATOM/CCFE Fusion Association, Culham Centre for Fusion Energy

2013-01-01T23:59:59.000Z

275

www.electricitypolicy.org.uk EPRGWORKINGPAPERNON-TECHNICALSUMMARY  

E-Print Network [OSTI]

www.electricitypolicy.org.uk EPRGWORKINGPAPERNON-TECHNICALSUMMARY Do homes that are more energy efficient consume less energy?: A structural equation model of the English residential sector EPRG Working Paper 1117 Cambridge Working Paper in Economics 1139 Scott Kelly Energy consumption from the residential

Aickelin, Uwe

276

www.VadoseZoneJournal.org Soil Architecture and  

E-Print Network [OSTI]

www.VadoseZoneJournal.org Soil Architecture and Physicochemical Func ons: An Introduc on Soils func engineers with the best educa on possible. The 16 papers in this special sec on on soil architecture measurement, visualiza on, and modeling of soil structure (architecture) and physical, chemical

Wildenschild, Dorthe

277

www.vics.org1 September 27, 2011  

E-Print Network [OSTI]

replenishments and promotional needs Bulk: Liquid chemical, fuel and energy industry transportation specialists America and China Port Logistics: Transloading, distribution, warehousing and port dray services-modal and brokerage services to meet demand #12;www.vics.org6 Fuel cost volatility Alternative, data-based, lane

Lin, Xiaodong

278

Laser and Particle Beams http://journals.cambridge.org/LPB  

E-Print Network [OSTI]

Laser and Particle Beams http://journals.cambridge.org/LPB Additional services for Laser, J. Limpouch, R. Liska and P. Váchal Laser and Particle Beams / Volume 30 / Issue 03 / September 2012 of annularlaserbeamdriven plasma jets from massive planar targets. Laser and Particle Beams,30, pp 445457 doi:10.1017/S

Liska, Richard

279

www.globalsubsidies.org THE GLOBAL SUBSIDIES INITIATIVE  

E-Print Network [OSTI]

www.globalsubsidies.org THE GLOBAL SUBSIDIES INITIATIVE UNTOLD BILLIONS: FOSSIL-FUEL SUBSIDIES, THEIR IMPACTS AND THE PATH TO REFORM The Politics of Fossil-Fuel Subsidies #12;THE GLOBAL SUBSIDIES INITIATIVE | UNTOLD BILLIONS: FOSSIL-FUEL SUBSIDIES, THEIR IMPACTS AND THE PATH TO REFORM Page II The Politics

Toohey, Darin W.

280

www.electricitypolicy.org.uk EPRGWORKINGPAPERNON-TECHNICALSUMMARY  

E-Print Network [OSTI]

nuclear power company British Energy ran into financial crisis in 2002 and had to be rescuedwww.electricitypolicy.org.uk EPRGWORKINGPAPERNON-TECHNICALSUMMARY Nuclear Power and Deregulated Electricity Markets: Lessons from British Energy EPRG Working Paper 0808 Simon Taylor When the privatised

Aickelin, Uwe

Note: This page contains sample records for the topic "apel org contact" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


281

www.electricitypolicy.org.uk EPRGWORKINGPAPERNON-TECHNICALSUMMARY  

E-Print Network [OSTI]

for gas-fired power the bulk of the costs relate to the purchase of fuel. Nuclear energy planning forceswww.electricitypolicy.org.uk EPRGWORKINGPAPERNON-TECHNICALSUMMARY Financing the Nuclear Renaissance with nuclear power. The cost structure of nuclear power differs significantly from that of fossil

Aickelin, Uwe

282

www.rsc.org Registered Charity Number 207890  

E-Print Network [OSTI]

to stabilize the drops and make the droplet interface biocompatible. Title: Biocompatible surfactants for water-in-fluorocarbon.rsc.org/loc | Lab on a Chip Biocompatible surfactants for water-in-fluorocarbon emulsions C. Holtze,*a A. C. Rowat806706f Drops of water-in-fluorocarbon emulsions have great potential for compartmentalizing both

283

CONTACT INFORMATION The KAVLI NANOSCIENCE INSTITUTE  

E-Print Network [OSTI]

CONTACT INFORMATION The KAVLI NANOSCIENCE INSTITUTE California Institute of Technology 1200 E structures. The Holliston Parking Structure is nearest Steele Laboratory. rev052708 The KAVLI NANOSCIENCE to users from academia, government, and industry. The Kavli Nanoscience Institute has been founded through

284

Thermodynamics of nuclei in thermal contact  

E-Print Network [OSTI]

The behaviour of a di-nuclear system in the regime of strong pairing correlations is studied with the methods of statistical mechanics. It is shown that the thermal averaging is strong enough to assure the application of thermodynamical methods to the energy exchange between the two nuclei in contact. In particular, thermal averaging justifies the definition of a nuclear temperature.

Karl-Heinz Schmidt; Beatriz Jurado

2010-10-05T23:59:59.000Z

285

Thin Silicon MEMS Contact-Stress Sensor  

SciTech Connect (OSTI)

This work offers the first, thin, MEMS contact-stress (CS) sensor capable of accurate in situ measruement of time-varying, contact-stress between two solid interfaces (e.g. in vivo cartilage contact-stress and body armor dynamic loading). This CS sensor is a silicon-based device with a load sensitive diaphragm. The diaphragm is doped to create piezoresistors arranged in a full Wheatstone bridge. The sensor is similar in performance to established silicon pressure sensors, but it is reliably produced to a thickness of 65 {micro}m. Unlike commercial devices or other research efforts, this CS sensor, including packaging, is extremely thin (< 150 {micro}m fully packaged) so that it can be unobtrusively placed between contacting structures. It is built from elastic, well-characterized materials, providing accurate and high-speed (50+ kHz) measurements over a potential embedded lifetime of decades. This work explored sensor designs for an interface load range of 0-2 MPa; however, the CS sensor has a flexible design architecture to measure a wide variety of interface load ranges.

Kotovsky, J; Tooker, A; Horsley, D A

2009-12-07T23:59:59.000Z

286

For additional information, contact: Department of Ecology  

E-Print Network [OSTI]

For additional information, contact: Department of Ecology Montana State University 310 Lewis Hall P.O. Box 173460 Bozeman, MT 59717-3460 Tel: 406-994-4548 Fax: 406-994-3190 www.montana.edu/ecology/ ecology@montana.edu The Department of Ecology at Montana State University offers undergraduate majors

Maxwell, Bruce D.

287

subcollector Schottky collector contact & interconnect metals  

E-Print Network [OSTI]

base collector depletion layer subcollector ohmic metal (a) base collector depletion layer Schottky metal base emitter collector collector We emitter base emitter emitter We Wc Wc (b) Schottky collector contact & interconnect metals Emitter & collector Ohmics undoped collector depletion layer base N

Rodwell, Mark J. W.

288

Contact Anosov flows and the FBI transform  

E-Print Network [OSTI]

This paper is about spectral properties of transfer operators for contact Anosov flows. The main result gives the essential spectral radius of the transfer operators acting on the so-called anisotropic Sobolev space exactly in terms of dynamical exponents. Also we provide a simplified proof by using the FBI transform.

Tsujii, Masato

2010-01-01T23:59:59.000Z

289

Contact Details Journeying Beyond Breast Cancer  

E-Print Network [OSTI]

Home About Contact Details Facebook Search Journeying Beyond Breast Cancer making sense of the cancer experience Feeds: Posts Comments Cancer-fighting fountain pen May 20, 2009 by JBBC A research team be used both as a research tool in the development of next-generation cancer treatments

Espinosa, Horacio D.

290

Contact details: School of Architecture, BCU  

E-Print Network [OSTI]

With 90% of the UK population living in urban areas, improving urban sustainability has become a pressing Economic Fabric This work package investigated opportunities and barriers to achieving sustainable is to be sustainable in the widest sense. Contact details: Centre for Urban and Regional Studies, U0B Dr. Austin Barber

Birmingham, University of

291

For more information, contact University Parking  

E-Print Network [OSTI]

.275.4524 Have a Flat Tire? Car Won't Start? Need Directions? V.A.P. VEHICLE ASSISTANCE PROGRAM University Tire? Car Won't Start? Contact University Parking and Transportation's Vehicle Assistance Program (V-icer assistance during winter months ·Tire inflations Inclement Travel Information When inclement weather

Mahon, Bradford Z.

292

An extraordinary film sponsored by the Earth Engineering Center (EEC) www.eecny.org, www.wtert.org  

E-Print Network [OSTI]

An extraordinary film sponsored by the Earth Engineering Center (EEC) www.eecny.org, www University Rapid economic development in the last few decades has been accompanied by the generation Engineering Center - The Wang Jiuliang film (1 hour) -Concluding remarks by Mr. Ling Qiu (M.S. candidate, SEAS

293

Northwest Straits Commission, 10441 Bayview Edison Rd., Mt. Vernon WA 98273 phone: 360.428-1064 e-mail: info@nwstraits.org web: www.nwstraits.org  

E-Print Network [OSTI]

Ocean acidification is a change in seawater chemistry due to the absorption of carbon dioxide. It is a local and global problem; a consequence of man-made carbon emissions. In Puget Sound, shellfish-mail: info@nwstraits.org web: www.nwstraits.org Ocean Acidification: Local action in the Northwest Straits

294

Lactation Room Locations Building Location Room Details Contact Name Contact Info Instructions  

E-Print Network [OSTI]

, hot water heater, educational info Natalie Blais narnold@pitt.edu Contact Natalie to receive and request a key to this locked room. Public Health A712 Crabtree Hall table, chairs, storage cabinet, fridge

Jiang, Huiqiang

295

Electrical contact arrangement for a coating process  

DOE Patents [OSTI]

A protective coating is applied to the electrically conductive surface of a reflective coating of a solar mirror by biasing a conductive member having a layer of a malleable electrically conductive material, e.g. a paste, against a portion of the conductive surface while moving an electrodepositable coating composition over the conductive surface. The moving of the electrodepositable coating composition over the conductive surface includes moving the solar mirror through a flow curtain of the electrodepositable coating composition and submerging the solar mirror in a pool of the electrodepositable coating composition. The use of the layer of a malleable electrically conductive material between the conductive member and the conductive surface compensates for irregularities in the conductive surface being contacted during the coating process thereby reducing the current density at the electrical contact area.

Kabagambe, Benjamin; McCamy, James W; Boyd, Donald W

2013-09-17T23:59:59.000Z

296

Direct contact, binary fluid geothermal boiler  

DOE Patents [OSTI]

Energy is extracted from geothermal brines by direct contact with a working fluid such as isobutane which is immiscible with the brine in a geothermal boiler. The geothermal boiler provides a distributor arrangement which efficiently contacts geothermal brine with the isobutane in order to prevent the entrainment of geothermal brine in the isobutane vapor which is directed to a turbine. Accordingly the problem of brine carry-over through the turbine causes corrosion and scaling thereof is eliminated. Additionally the heat exchanger includes straightening vanes for preventing startup and other temporary fluctuations in the transitional zone of the boiler from causing brine carryover into the turbine. Also a screen is provided in the heat exchanger to coalesce the working fluid and to assist in defining the location of the transitional zone where the geothermal brine and the isobutane are initially mixed.

Rapier, Pascal M. (Richmond, CA)

1982-01-01T23:59:59.000Z

297

Active alignment/contact verification system  

DOE Patents [OSTI]

A system involving an active (i.e. electrical) technique for the verification of: 1) close tolerance mechanical alignment between two component, and 2) electrical contact between mating through an elastomeric interface. For example, the two components may be an alumina carrier and a printed circuit board, two mating parts that are extremely small, high density parts and require alignment within a fraction of a mil, as well as a specified interface point of engagement between the parts. The system comprises pairs of conductive structures defined in the surfaces layers of the alumina carrier and the printed circuit board, for example. The first pair of conductive structures relate to item (1) above and permit alignment verification between mating parts. The second pair of conductive structures relate to item (2) above and permit verification of electrical contact between mating parts.

Greenbaum, William M. (Modesto, CA)

2000-01-01T23:59:59.000Z

298

Non-Contact Gaging with Laser Probe  

SciTech Connect (OSTI)

A gage has been constructed using conventional (high end) components for the application of measuring fragile syntactic foam parts in a non-contact mode. Success with this approach has been achieved through a novel method of transferring (mapping) high accuracy local measurements of a coated aluminum master, taken on a Leitz Coordinate Measurement Machine (CMM), to the gage software system. The mapped data is then associated with local voltage readings from two (inner and outer) laser triangulating probes. This couples discreet laser probe offset and linearity characteristics to the measured master geometry. The gage software compares real part measured data against the master data to provide non-contact part inspection that results in a high accuracy and low uncertainty performance. Uncertainty from the part surface becomes the prevailing contributor to the gaging process. The gaging process provides a high speed, hands off measurement with nearly zero impedance.

Clinesmith, Mike

2009-03-20T23:59:59.000Z

299

Photoinduced electron transfer in contact ion pairs  

SciTech Connect (OSTI)

Contact ion pair (CIP) formation is especially relevant to the reactivity of organic and organometallic nucleophiles and electrophiles in solution. The authors felt that the intermolecular charge-transfer (CT) absorptions which commonly accompany the interaction of uncharged nucleophiles (donors) with electrophiles (acceptors) could also provide the experimental means to assess CIP behavior. Accordingly they examined the CT excitations from CIPs of carbonylmetallate anions in this study, since they are known to be effective nucleophiles with relatively low ionization potentials.

Bockman, T.M.; Kochi, J.K.

1988-02-17T23:59:59.000Z

300

Renewable Energy Contacts | Department of Energy  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious Rank EERE: AlternativeEnvironment,Institutes and LaunchesRelated FinancialUtility District |Contacts

Note: This page contains sample records for the topic "apel org contact" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


301

Property:Geothermal/Contact | Open Energy Information  

Open Energy Info (EERE)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data CenterFranconia, Virginia: Energy ResourcesLoadingPenobscot County, Maine:Plug PowerAddressDataFormatGeothermal/Contact" Showing 25

302

Influence of surfactant on single ion track etching , Leo C.T.; Apel2  

E-Print Network [OSTI]

, reproducible break-through times are achieved. Above 0.1 vol.-% surfactant concentration cylindrical channels heavy ion or fission fragment to supply the energy necessary for rendering a cylindrical volume around shapes are possible, such as narrow and wide cones, spherical troughs, barrels, and bottle necked

Yu, K.N.

303

rsta.royalsocietypublishing.org Cite this article: Fernandez-Oto C, Tlidi M,  

E-Print Network [OSTI]

. Introduction Transport processes such as diffraction, dispersion, diffusion or thermal diffusivity are modelledrsta.royalsocietypublishing.org Research Cite this article: Fernandez-Oto C, Tlidi M, Escaff D

Gavilan, Marcel G. Clerc

304

Photovoltaic Electrical Contact and Cell Coating Basics | Department...  

Broader source: Energy.gov (indexed) [DOE]

p-type seminconductor, and back contact. A typical solar cell consists of a glass or plastic cover, an antireflective coating, a front contact to allow electrons to enter a...

305

Oak Ridge Site Specific Advisory Board Contacts | Department...  

Office of Environmental Management (EM)

Contacts Oak Ridge Site Specific Advisory Board Contacts Mailing Address Oak Ridge Site Specific Advisory Board P.O. Box 2001, EM-91 Oak Ridge, TN 37831 Phone Numbers (865)...

306

Protein folding using contact maps Michele Vendruscolo and Eytan Domany  

E-Print Network [OSTI]

Protein folding using contact maps Michele Vendruscolo and Eytan Domany Department of Physics 26 I. INTRODUCTION Computational approaches to protein folding are divided into two main categories protein fold prediction. Contact maps are a particularly manageable representation of protein structure

Domany, Eytan

307

atomic aluminum contacts: Topics by E-print Network  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

rear-contact solar cell, we 59 LOSS ANALYSIS OF BACK-CONTACT BACK-JUNCTION THIN-FILM MONOCRYSTALLINE SILICON SOLAR CELLS Renewable Energy Websites Summary: of the...

308

2/21/2014 terragreen.teriin.org/popup.php?section_id=1905&category_id=10 http://terragreen.teriin.org/popup.php?section_id=1905&category_id=10 1/2  

E-Print Network [OSTI]

2/21/2014 terragreen.teriin.org/popup.php?section_id=1905&category_id=10 http://terragreen.teriin.org/popup.php in the material because of the durable nickel alloy and smart aerodynamic design. #12;2/21/2014 terragreen.teriin.org/popup.php?section_id=1905&category_id=10 http://terragreen.teriin.org/popup.php?section_id=1905&category_id=10 2/2 "The

Chiao, Jung-Chih

309

ASYMPTOTIC SHAPE FOR THE CONTACT PROCESS IN RANDOM ENVIRONMENT  

E-Print Network [OSTI]

ASYMPTOTIC SHAPE FOR THE CONTACT PROCESS IN RANDOM ENVIRONMENT OLIVIER GARET AND REGINE MARCHAND in stationary random environment. These theorems gen- eralize known results for the classical contact process environment, when the contact process survives, the set Ht/t almost surely converges to a compact set

Paris-Sud XI, Universit de

310

Ohmic contact metallization on p-type indium phosphide  

E-Print Network [OSTI]

contact resistivities comparable to those of Au-based contacts, determined by the Cox and Strack structure, can be obtained for a pure Pd contact on p-InP (hole concentration -3xlOl' cm-'). The defects can be identified to be related with phosphorus...

Park, Moonho

1993-01-01T23:59:59.000Z

311

Electrical Contacts to Molecular Layers by Nanotransfer Printing  

E-Print Network [OSTI]

Electrical Contacts to Molecular Layers by Nanotransfer Printing Yueh-Lin Loo, David V. Lang, John of electrical contact. Results show that the nTP method produces superior devices in which the electrical for making electrical contacts in molecular electronics. Organic molecules whose electronic properties can

Rogers, John A.

312

Role of chemical termination in edge contact to graphene  

SciTech Connect (OSTI)

Edge contacts to graphene can offer excellent contact properties. Role of different chemical terminations is examined by using ab initio density functional theory and quantum transport simulations. It is found that edge termination by group VI elements O and S offers considerably lower contact resistance compared to H and group VII element F. The results can be understood by significantly larger binding energy and shorter binding distance between the metal contact and these group VI elements, which results in considerably lower interface potential barrier and larger transmission. The qualitative conclusion applies to a variety of contact metal materials.

Gao, Qun; Guo, Jing, E-mail: guoj@ufl.edu [Department of Electrical and Computer Engineering, University of Florida, Gainesville, Florida 32611 (United States)

2014-05-01T23:59:59.000Z

313

Silicon point contact concentrator solar cells  

SciTech Connect (OSTI)

Experimental results are presented for thin high resistivity concentrator silicon solar cells which use a back-side point-contact geometry. Cells of 130 and 233 micron thickness were fabricated and characterized. The thin cells were found to have efficiencies greater than 22 percent for incident solar intensities of 3 to 30 W/sq cm. Efficiency peaked at 23 percent at 11 W/sq cm measured at 22-25 C. Strategies for obtaining higher efficiencies with this solar cell design are discussed. 8 references.

Sinton, R.A.; Kwark, Y.; Swirhun, S.; Swanson, R.M.

1985-08-01T23:59:59.000Z

314

Federal NEPA Contacts | Department of Energy  

Office of Environmental Management (EM)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) "of EnergyEnergyENERGY TAX POLICIES ANDIndustrialEnergy Federal EfficiencyReportingNEPA Contacts Federal

315

Center for Advanced Solar Photophysics | Contacts  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc DocumentationP-Series to someone6Energy,MUSEUM DISPLAYCareersCathy-Ehli Sign InCenterContacts

316

Contact Information | Princeton Plasma Physics Lab  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc DocumentationP-Series to User Group andCompositionalInitial Validation andPWRContaCtContact

317

Contact OSUR Program | Princeton Plasma Physics Lab  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc DocumentationP-Series to User Group andCompositionalInitial ValidationContact Information

318

Contact Us | National Nuclear Security Administration  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc DocumentationP-Series to User GroupInformation Administration (EIA)DonUs ContactLos Alamos

319

Contact Us-About-PHaSe-EFRC  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc DocumentationP-Series to User GroupInformation Administration (EIA)DonUsContact

320

Contacts for Enterprise Architecture | Department of Energy  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc DocumentationP-Series to User GroupInformationE-Gov Contacts for E-Gov LeAnn Oliver

Note: This page contains sample records for the topic "apel org contact" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


321

Contacts for IT Planning | Department of Energy  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc DocumentationP-Series to User GroupInformationE-Gov Contacts for E-Gov LeAnn

322

NREL: Email Contact for NREL Newsroom  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsrucLas Conchas recoveryLaboratory | National Nuclearover twoPrintable Version Email Contact for NREL

323

NREL: Energy Systems Integration Facility - Contact Us  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsrucLas Conchas recoveryLaboratory | National Nuclearover twoPrintableContact Us For more information

324

Geothermal Technologies Office Contacts | Department of Energy  

Office of Environmental Management (EM)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) "of Energy Power.pdf11-161-LNG | Department of EnergyGeothermal Technologies Office Contacts Geothermal

325

ORISE: Contact Us | Worker Health Studies  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsrucLas Conchas recoveryLaboratory |CHEMPACK Mapping Application ORISECenterMaking aContact Us

326

Laboratory Equipment Donation Program - Contact Us  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: VegetationEquipment Surfaces and Interfaces Sample6, 2011 LOSEngineering&Dynamos ProfessorContact Us

327

DOE Research and Development Accomplishments Contact Us  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc DocumentationP-Series to UserProduct: Crude OilPublicDNALostPlasma PhysicsDOE Plans2BlogContact

328

ARM - ARM Engineering and Operations Contacts  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformation Desert SouthwestTechnologies |NovemberARMContactsARM Engineering and Operations Contacts About

329

RAPID/Contact | Open Energy Information  

Open Energy Info (EERE)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home5b9fcbce19 No revisionEnvReviewNonInvasiveExploration JumpSanyalTempWellheadWahkiakum CountyPzero JumpQuestionQuinhagakContact

330

Contact CEFRC - Combustion Energy Frontier Research Center  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformation InInformationCenterResearchCASLNanoporousTestimony |IdahoVisionContact In This

331

Contact Hanford Fire Department - Hanford Site  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformation InInformationCenterResearchCASLNanoporousTestimony |IdahoVisionContact In ThisDepartment

332

Contact Us | Argonne Leadership Computing Facility  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformation InInformationCenterResearchCASLNanoporousTestimonyContact Us - Working With Us

333

Fermilab | Illinois Accelerator Research Center | Contact IARC  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformation Desert Southwest Region service area. TheEPSCI Home It isGasERPSpunphoto Fermilab atContact

334

SciTech Connect: Contact Us  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsrucLas ConchasPassiveSubmitted for USMaterialstheterahertzon HomeScholarshipsSciDBsmartContact

335

Contact Information Systems | The Ames Laboratory  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation Proposed New SubstationCleanCommunity2Workshops 2008 To1 Building 9201-1 wasFAbout UsContact

336

Contact Us | Y-12 National Security Complex  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation Proposed New SubstationCleanCommunity2Workshops 2008 To1 BuildingContact UsNNSAContact

337

Contacts For "F" | EMSL  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation Proposed New SubstationCleanCommunity2Workshops 2008 To1ContactA"

338

Contacts For "J" | EMSL  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation Proposed New SubstationCleanCommunity2Workshops 2008 To1ContactA"G"

339

Contacts For "L" | EMSL  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation Proposed New SubstationCleanCommunity2Workshops 2008 To1ContactA"G"K"

340

Contacts For "M" | EMSL  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation Proposed New SubstationCleanCommunity2Workshops 2008 To1ContactA"G"K"M"

Note: This page contains sample records for the topic "apel org contact" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


341

Contacts For "O" | EMSL  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation Proposed New SubstationCleanCommunity2Workshops 2008O" Contacts For "O" Shaun

342

Contacts For "P" | EMSL  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation Proposed New SubstationCleanCommunity2Workshops 2008O" Contacts For "O"

343

Contacts For "Q" | EMSL  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation Proposed New SubstationCleanCommunity2Workshops 2008O" Contacts For "O"Q"

344

Contacts For "R" | EMSL  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation Proposed New SubstationCleanCommunity2Workshops 2008O" Contacts For

345

Contacts For "V" | EMSL  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation Proposed New SubstationCleanCommunity2Workshops 2008O" Contacts ForS"

346

Contacts For "W" | EMSL  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation Proposed New SubstationCleanCommunity2Workshops 2008O" Contacts ForS"W"

347

Contacts For "Z" | EMSL  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation Proposed New SubstationCleanCommunity2Workshops 2008O" Contacts ForS"W"Z"

348

Air Entrainment by Viscous Contact Lines  

E-Print Network [OSTI]

The entrainment of air by advancing contact lines is studied by plunging a solid plate into a very viscous liquid. Above a threshold velocity, we observe the formation of an extended air film, typically 10 microns thick, which subsequently decays into air bubbles. Exploring a large range of viscous liquids, we find an unexpectedly weak dependence of entrainment speed on liquid viscosity, pointing towards a crucial role of the flow inside the air film. This induces a striking asymmetry between wetting and dewetting: while the breakup of the air film strongly resembles the dewetting of a liquid film, the wetting speeds are larger by orders of magnitude.

Marchand, Antonin; Snoeijer, Jacco H; Andreotti, Bruno

2011-01-01T23:59:59.000Z

349

Method of forming contacts for a back-contact solar cell  

DOE Patents [OSTI]

Methods of forming contacts for back-contact solar cells are described. In one embodiment, a method includes forming a thin dielectric layer on a substrate, forming a polysilicon layer on the thin dielectric layer, forming and patterning a solid-state p-type dopant source on the polysilicon layer, forming an n-type dopant source layer over exposed regions of the polysilicon layer and over a plurality of regions of the solid-state p-type dopant source, and heating the substrate to provide a plurality of n-type doped polysilicon regions among a plurality of p-type doped polysilicon regions.

Manning, Jane

2013-07-23T23:59:59.000Z

350

10 IAEI NEWS September.October 2009 www.iaei.org connecting the inverter  

E-Print Network [OSTI]

10 IAEI NEWS September.October 2009 www.iaei.org connecting the inverter by John Wiles CONNECTING THE INVERTER CONNECTING THE INVERTER 10 IAEI NEWS September.October 2009 #12;www.iaei.org September.October 2009 IAEI NEWS 11 connecting the inverter C onnecting the utility-interactive inverter prop- erly

Johnson, Eric E.

351

HARVARD UNIVERSITY VENDOR JUSTIFICATION/PRICE VERIFICATION FORM TUB AND ORG NAME: ___________________________ACCT.CODE:________________________________________________________DATE:_______  

E-Print Network [OSTI]

HARVARD UNIVERSITY VENDOR JUSTIFICATION/PRICE VERIFICATION FORM TUB AND ORG NAME/Org/Object/Fund/Activity/Sub-Activity/Root WEB VOUCHER NO:____________VENDOR:____________________! Grant !!!! Contract !!!!Cooperative Agreement (please check one) The Federal Government requires vendor selection justification and price verification

Heller, Eric

352

A RESTful API for exchanging Materials Data in the AFLOWLIB.org consortium  

E-Print Network [OSTI]

A RESTful API for exchanging Materials Data in the AFLOWLIB.org consortium Richard H. Taylor1, an Application Program Interface (API) follow- ing REST principles is introduced for the AFLOWLIB.org materials through a RESTful API and a python library enabling ad-hoc ap- plications [17]. Other examples of online

Curtarolo, Stefano

353

SARKAR ET AL. VOL. 8 ' NO. 4 ' 39924003 ' 2014 www.acsnano.org  

E-Print Network [OSTI]

SARKAR ET AL. VOL. 8 ' NO. 4 ' 3992­4003 ' 2014 www.acsnano.org 3992 March 03, 2014 C 2014 American Chemical Society MoS2 Field-Effect Transistor for Next- Generation Label-Free Biosensors Deblina Sarkar ARTICLE #12;SARKAR ET AL. VOL. 8 ' NO. 4 ' 3992­4003 ' 2014 www.acsnano.org 3993 have also been used

354

For Immediate release: 08/09/2011 Contact: Ingrid Wright  

E-Print Network [OSTI]

to Obtain ISO 9001 Certification Congressman Silvestre Reyes will recognize Xceed Resources (http://www.xceedresources.org) as the First Non-Profit to obtain ISO 9001 certification. Xceed Resources was able to achieve ISO 9001 Texas. ISO 9001 certification assures customers and clients that Xceed's quality management systems

Ward, Karen

355

Topic suggestions? Comments? Contact us at snapshot@pnl.gov  

E-Print Network [OSTI]

. Patrick Davis Program Manager Vehicle Technologies Sunita Satyapal Acting Program Manager Hydrogen, Fuel Cells and Infrastructure Technologies Sharing Best practices www.h2bestpractices.org reporting Lessons. The database serves as a voluntary reporting tool for capturing records of events involving hydrogen

356

Re: Affordable Textbooks, Fall Semester Update In a message dated 10/28/2010 10:28:50 A.M. Eastern Daylight Time, nicole@studentpirgs.org  

E-Print Network [OSTI]

.M. Eastern Daylight Time, nicole@studentpirgs.org writes: Hi everyone, There have been some exciting

Garfunkel, Eric

357

Contact structure for use in catalytic distillation  

DOE Patents [OSTI]

A method is described for conducting catalytic chemical reactions and fractionation of the reaction mixture comprising feeding reactants into a distillation column reactor, contracting said reactant in liquid phase with a fixed bed catalyst in the form of a contact catalyst structure consisting of closed porous containers containing the catalyst for the reaction and a clip means to hold and support said containers, which are disposed above, i.e., on the distillation trays in the tower. The trays have weir means to provide a liquid level on the trays to substantially cover the containers. In other words, the trays function in their ordinary manner with the addition thereto of the catalyst. The reaction mixture is concurrently fractionated in the column. 7 figs.

Jones, E.M. Jr.

1984-03-27T23:59:59.000Z

358

Contact structure for use in catalytic distillation  

DOE Patents [OSTI]

A method and apparatus are disclosed for conducting catalytic chemical reactions and fractionation of the reaction mixture, comprising and feeding reactants into a distillation column reactor contracting said reactant in a liquid phase with a fixed bed catalyst in the form of a contact catalyst structure, consisting of closed porous containers containing the catalyst for the reaction and a clip means to hold and support said containers, which are disposed above, i.e., on the distillation trays in the tower. The trays have weir means to provide a liquid level on the trays to substantially cover the containers. In other words, the trays function in their ordinary manner with the addition thereto of the catalyst. The reaction mixture is concurrently fractionated in the column. 7 figs.

Jones, E.M. Jr.

1985-08-20T23:59:59.000Z

359

Contact structure for use in catalytic distillation  

DOE Patents [OSTI]

A method for conducting catalytic chemical reactions and fractionation of the reaction mixture comprising feeding reactants into a distillation column reactor contracting said reactant in liquid phase with a fixed bed catalyst in the form of a contact catalyst structure consisting of closed porous containers containing the catatlyst for the reaction and a clip means to hold and support said containers, which are disposed above, i.e., on the distillation trays in the tower. The trays have weir means to provide a liquid level on the trays to substantially cover the containers. In other words, the trays function in their ordinary manner with the addition thereto of the catalyst. The reaction mixture is concurrently fractionated in the column.

Jones, Jr., Edward M. (Friendswood, TX)

1984-01-01T23:59:59.000Z

360

Contact structure for use in catalytic distillation  

DOE Patents [OSTI]

A method and apparatus for conducting catalytic chemical reactions and fractionation of the reaction mixture, comprising and feeding reactants into a distillation column reactor contracting said reactant in a liquid phase with a fixed bed catalyst in the form of a contact catalyst structure, consisting of closed porous containers containing the catalyst for the reaction and a clip means to hold and support said containers, which are disposed above, i.e., on the distillation trays in the tower. The trays have weir means to provide a liquid level on the trays to substantially cover the containers. In other words, the trays function in their ordinary manner with the addition thereto of the catalyst. The reaction mixture is concurrently fractionated in the column.

Jones, Jr., Edward M. (Friendswood, TX)

1985-01-01T23:59:59.000Z

Note: This page contains sample records for the topic "apel org contact" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


361

SciTech Connect: Passivated Tunneling Contacts to N-Type Wafer...  

Office of Scientific and Technical Information (OSTI)

Golden, CO. Sponsoring Org: USDOE Office of Energy Efficiency and Renewable Energy Solar Energy Technologies Office Country of Publication: United States Language: English...

362

The contact of elastic regular wavy surfaces revisited  

E-Print Network [OSTI]

We revisit the classic problem of an elastic solid with a two-dimensional wavy surface squeezed against an elastic flat half-space from infinitesimal to full contact. Through extensive numerical calculations and analytic derivations, we discover previously overlooked transition regimes. These are seen in particular in the evolution with applied load of the contact area and perimeter, the mean pressure and the probability density of contact pressure. These transitions are correlated with the contact area shape, which is affected by long range elastic interactions. Our analysis has implications for general random rough surfaces, as similar local transitions occur continuously at detached areas or coalescing contact zones. We show that the probability density of null contact pressures is non-zero at full contact. This might suggest revisiting the conditions necessary for applying Persson's model at partial contacts and guide the comparisons with numerical simulations. We also address the evaluation of the contact perimeter for discrete geometries and the applicability of Westergaard's solution for three-dimensional geometries.

Vladislav A. Yastrebov; Guillaume Anciaux Jean-Francois Molinari

2014-09-05T23:59:59.000Z

363

Nanoscale contact engineering for Si/Silicide nanowire devices.  

E-Print Network [OSTI]

??Metal silicides have been used in silicon technology as contacts to achieve high device performance and desired device functions. The growth and applications of silicide (more)

Lin, Yung-Chen

2012-01-01T23:59:59.000Z

364

Contacts for the Assistant General Counsel for Legislation, Regulation...  

Energy Savers [EERE]

Legislation, Regulation, and Energy Efficiency Contacts for the Assistant General Counsel for Legislation, Regulation, and Energy Efficiency Office of the Assistant General Counsel...

365

Contacts for the Assistant General Counsel for Technology Transfer...  

Broader source: Energy.gov (indexed) [DOE]

Technology Transfer and Procurement Contacts for the Assistant General Counsel for Technology Transfer and Procurement Subject MatterFunctional Area Lead Backup Technology...

366

Registered_Lobbyist_Contact_Disclosure_Form.pdf | Department...  

Broader source: Energy.gov (indexed) [DOE]

egisteredLobbyistContactDisclosureForm.pdf More Documents & Publications Lobbyist Disclosure Form - AltEn Interested Parties - Shipp Interested Parties - Smith Dawson & Andrews...

367

Ohmic contacts for high-temperature GaP devices  

E-Print Network [OSTI]

REMOVAL 10 13 24 24 26 50 50 52 78 80 83 98 98 99 100 TABLE OF CONTENTS (Continued) APPENDIX D ? 6 LIFT-OFF PREMETAL PREPARATION APPENDIX D ? 7 METAL LIFTOFF Page 100 100 vi LIST OP TABLES Table I Relative High Temperature... with a variety of III-V compound semi- conductors and contact metals. By using a ruby or a COe laser with Au-Sn or Ag-Sn contact metals, specific contact resistances as low as 8. 6 x 19 " 0-cm were reported. (The specific contact resistance...

Van der Hoeven, Willem Bernard

2012-06-07T23:59:59.000Z

368

A Drucker-Prager model for elastic contact with friction; A Drucker-Prager model for elastic contact with friction.  

E-Print Network [OSTI]

?? In mumerical contact simulations with friction, the simple Coloumb law is usually employed. Standard plasticity models are difficult to use since the balance enforced (more)

wu, yunxian

2011-01-01T23:59:59.000Z

369

Contact Information: Jeff Williams, MLIS phone (858) 822-2218  

E-Print Network [OSTI]

Contact Information: Jeff Williams, MLIS phone (858) 822-2218 Biology Librarian fax (858) 822-2219 UCSD Biomedical Library j12williams@ucsd.edu Life Sciences Newsletter UCSD Biomedical Library Fall 2004 contact me at (858) 822-2218 or j12williams@ucsd.edu Top Biology Resources ­ http

California at San Diego, University of

370

RELATIVISTIC HEAVY-ION PHYSICS WITHOUT NUCLEAR CONTACT  

E-Print Network [OSTI]

RELATIVISTIC HEAVY-ION PHYSICS WITHOUT NUCLEAR CONTACT The large electromagnetic field generated physics research--for example, for investigating nuclear structure, hadronic structure, atomic physics Berkeley Laboratory--it became clear that heavy-ion physics without nuclear contact could be very useful

Bertulani, Carlos A. - Department of Physics and Astronomy, Texas A&M University

371

Contact Information: Sophia Radlowski, Assistant to the Director for Budgeting  

E-Print Network [OSTI]

Contact Information: Sophia Radlowski, Assistant to the Director for Budgeting Contact regarding will be mailed to you by Sophia Radlowski. 1. Read the offer letter carefully. If you agree to the terms, please form, original drug-free workplace statement, and copy of IDs listed above to: Sophia Radlowski UIC

Illinois at Chicago, University of

372

Energy-efficient Contact Probing in Opportunistic Mobile Networks  

E-Print Network [OSTI]

a trade-off between energy efficiency and the contact opportunities in OppNets. In this paper, in order proposed model. Finally, based on the proposed model, we analyze the trade- off between energy efficiency to a trade-off between energy efficiency and contact opportunities. For strategies which use a constant

Wu, Jie

373

Making Contact: Getting the Group Communicating with Groupware  

E-Print Network [OSTI]

is that people must be in contact with one another. Relationships must be established, and many interactions that overcomes distance barriers is available. Many mundane factors interfere with making contact. People must, people must find each other with minimal effort. People must also select one or more of the many

Greenberg, Saul

374

Event Logistics Checklist and Contacts Questions to consider  

E-Print Network [OSTI]

will my space need to include? 4. How many people will be attending? a. For every 250 people, one security/Chairs/Tents Questions to Consider: 1. Will people be sitting at your event? 2. How many people are attending? 3. Do you people, an EMT is expected. GTPD can provide contacts for EMTs. Relevant Contacts: 1. Beverly Peace

Sherrill, David

375

Air Entrainment by Viscous Contact Lines Antonin Marchand1  

E-Print Network [OSTI]

Air Entrainment by Viscous Contact Lines Antonin Marchand1 , Tak Shing Chan2 , Jacco H. Snoeijer2) The entrainment of air by advancing contact lines is studied by plunging a solid plate into a very viscous liquid by orders of magnitude. Objects that impact on a liquid interface can entrain small bubbles of air

376

Neutron irradiation effects on metal-gallium nitride contacts  

SciTech Connect (OSTI)

We have measured the effect of fast and thermal neutrons on GaN Schottky barriers and ohmic contacts using currentvoltage and transmission line method electrical techniques, optical, atomic force and scanning electron microscopy morphological techniques, and X-ray photoemission spectroscopy chemical techniques. These studies reveal a 10{sup 15}?n/cm{sup 2} neutron threshold for Schottky barrier ideality factor increases, a 10{sup 15}?n/cm{sup 2} fast plus thermal neutron threshold for ohmic contact sheet and contact resistance increases, and 10{sup 16}?n/cm{sup 2} neutron fluence threshold for major device degradation identified with thermally driven diffusion of Ga and N into the metal contacts and surface phase changes. These results demonstrate the need for protecting metal-GaN contacts in device applications subject to neutron radiation.

Katz, Evan J.; Lin, Chung-Han; Zhang, Zhichun [Department of Electrical and Computer Engineering, The Ohio State University, Columbus, Ohio 43210 (United States); Qiu, Jie; Cao, Lei [Nuclear Engineering Program, Department of Mechanical and Aerospace Engineering, The Ohio State University, Columbus, Ohio 43210 (United States); Mishra, Umesh K. [Departments of Electrical and Computer Engineering and Materials Science and Engineering University of California, Santa Barbara, California 93106 (United States); Brillson, Leonard J., E-mail: brillson.1@osu.edu [Department of Electrical and Computer Engineering, The Ohio State University, Columbus, Ohio 43210 (United States); Department of Physics and Center for Materials Research, The Ohio State University, Columbus, Ohio 43210 (United States)

2014-03-28T23:59:59.000Z

377

Generalized nuclear contacts and the nucleon's momentum distributions  

E-Print Network [OSTI]

The general nuclear contact matrices are defined, taking into consideration all partial waves and finite-range interactions, extending Tan's work for the zero range model. The properties of these matrices are discussed and the relations between the contacts and the one-nucleon and two-nucleon momentum distributions are derived. Using these relations, a new asymptotic connection between the one-nucleon and two-nucleon momentum distributions, describing the two-body short-range correlations in nuclei, is obtained. Using available numerical data, we extract few connections between the different contacts and verify their relations to the momentum distributions. The numerical data also allows us to identify the main nucleon momentum range affected by two-body short-range correlations. Utilizing these relations and the numerical data, we also verify a previous independent prediction connecting between the Levinger constant and the contacts. This work provides an important indication for the relevance of the contact...

Weiss, Ronen; Barnea, Nir

2015-01-01T23:59:59.000Z

378

Method and apparatus for high-efficiency direct contact condensation  

DOE Patents [OSTI]

A direct contact condenser having a downward vapor flow chamber and an upward vapor flow chamber, wherein each of the vapor flow chambers includes a plurality of cooling liquid supplying pipes and a vapor-liquid contact medium disposed thereunder to facilitate contact and direct heat exchange between the vapor and cooling liquid. The contact medium includes a plurality of sheets arranged to form vertical interleaved channels or passageways for the vapor and cooling liquid streams. The upward vapor flow chamber also includes a second set of cooling liquid supplying pipes disposed beneath the vapor-liquid contact medium which operate intermittently in response to a pressure differential within the upward vapor flow chamber. The condenser further includes separate wells for collecting condensate and cooling liquid from each of the vapor flow chambers. In alternate embodiments, the condenser includes a cross-current flow chamber and an upward flow chamber, a plurality of upward flow chambers, or a single upward flow chamber. The method of use of the direct contact condenser of this invention includes passing a vapor stream sequentially through the downward and upward vapor flow chambers, where the vapor is condensed as a result of heat exchange with the cooling liquid in the contact medium. The concentration of noncondensable gases in the resulting condensate-liquid mixtures can be minimized by controlling the partial pressure of the vapor, which depends in part upon the geometry of the vapor-liquid contact medium. In another aspect of this invention, the physical and chemical performance of a direct contact condenser can be predicted based on the vapor and coolant compositions, the condensation conditions, and the geometric properties of the contact medium. 39 figs.

Bharathan, D.; Parent, Y.; Hassani, A.V.

1999-07-20T23:59:59.000Z

379

Method and apparatus for high-efficiency direct contact condensation  

DOE Patents [OSTI]

A direct contact condenser having a downward vapor flow chamber and an upward vapor flow chamber, wherein each of the vapor flow chambers includes a plurality of cooling liquid supplying pipes and a vapor-liquid contact medium disposed thereunder to facilitate contact and direct heat exchange between the vapor and cooling liquid. The contact medium includes a plurality of sheets arranged to form vertical interleaved channels or passageways for the vapor and cooling liquid streams. The upward vapor flow chamber also includes a second set of cooling liquid supplying pipes disposed beneath the vapor-liquid contact medium which operate intermittently in response to a pressure differential within the upward vapor flow chamber. The condenser further includes separate wells for collecting condensate and cooling liquid from each of the vapor flow chambers. In alternate embodiments, the condenser includes a cross-current flow chamber and an upward flow chamber, a plurality of upward flow chambers, or a single upward flow chamber. The method of use of the direct contact condenser of this invention includes passing a vapor stream sequentially through the downward and upward vapor flow chambers, where the vapor is condensed as a result of heat exchange with the cooling liquid in the contact medium. The concentration of noncondensable gases in the resulting condensate-liquid mixtures can be minimized by controlling the partial pressure of the vapor, which depends in part upon the geometry of the vapor-liquid contact medium. In another aspect of this invention, the physical and chemical performance of a direct contact condenser can be predicted based on the vapor and coolant compositions, the condensation conditions. and the geometric properties of the contact medium.

Bharathan, Desikan (Lakewood, CO); Parent, Yves (Golden, CO); Hassani, A. Vahab (Golden, CO)

1999-01-01T23:59:59.000Z

380

ISSUE 17 MAY 2014 A NAACP ECONOMIC PROGRAMS PUBLICATION WWW.NAACP.ORG/ECON  

E-Print Network [OSTI]

ANNIVERSARY #12;ISSUE 15 January 2014 NGLE THE A NAACP ECONOMIC PROGRAMS PUBLICATION EDITOR: NICOLE E. KENNEY is the very bottom of hardships." -W.E.B. Du Bois WWW.NAACP.ORG/ECON BROWNV.BOARDOFEDUCATION 60TH ANNIVERSARY

California at Santa Barbara, University of

Note: This page contains sample records for the topic "apel org contact" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


381

BOOKS ET AL. 31 JULY 2009 VOL 325 SCIENCE www.sciencemag.org540  

E-Print Network [OSTI]

BOOKS ET AL. 31 JULY 2009 VOL 325 SCIENCE www.sciencemag.org540 geoengineering schemes have little option but to try vari- ous geoengineering schemes to moderate what he feels

Shneiderman, Ben

382

www.iisd.org/tkn 2012 The International Institute for Sustainable Development The Australian Government's  

E-Print Network [OSTI]

www.iisd.org/tkn 2012 The International Institute for Sustainable Development The Australian July 2012 #12; 2012 The International Institute for Sustainable Development TKN REPORT JULY 2012 Institute for Sustainable Development Published by the International Institute for Sustainable Development

383

http://occr.christiantimes.org.hk/art_0123.htm 1 Christianity and Culture  

E-Print Network [OSTI]

http://occr.christiantimes.org.hk/art_0123.htm 1 Christianity and Culture Jerry Solomon Jerry Solomon field ministries Probe Ministries "Mind Games" College Prep Criswell College University measurement, statistics and methodological studies Cisco Systems PDF PDF html

Yu, Alex

384

Meteoritics & Planetary Science 38, Nr 6, 871885 (2003) Abstract available online at http://meteoritics.org  

E-Print Network [OSTI]

Meteoritics & Planetary Science 38, Nr 6, 871­885 (2003) Abstract available online at http://meteoritics.org 871 © Meteoritical Society, 2003. Printed in USA. Searching for the source regions of martian

Hamilton, Victoria E.

385

rspb.royalsocietypublishing.org Cite this article: Trumble BC, Smith EA,  

E-Print Network [OSTI]

rspb.royalsocietypublishing.org Research Cite this article: Trumble BC, Smith EA, O'Connor KA A. Smith3,4, Kathleen A. O'Connor3,4, Hillard S. Kaplan5 and Michael D. Gurven2 1 Institute

Smith, Eric Alden

386

www.bluesci.orgIssue 14 Lent 2009 Randomness . Electronic Paper . Huntington's Disease  

E-Print Network [OSTI]

www.bluesci.orgIssue 14 Lent 2009 Randomness . Electronic Paper . Huntington's Disease Stories from by Darwinian Chemistry Selection of the fittest molecules Biological Warfare Does biodefence research make us

Cambridge, University of

387

Analysis of a-Si:H/TCO contact resistance for the Si heterojunction back-contact solar cell  

E-Print Network [OSTI]

Analysis of a-Si:H/TCO contact resistance for the Si heterojunction back-contact solar cell Seung- circuit voltage (Voc) and the conversion efficiency of the Si solar cell. Recently, a-Si:H heterojunction (heterojunction with intrinsic thin layer) cell [1] even with practical-sized Czochralski-grown (CZ) wafer. The a-Si:H

Park, Byungwoo

388

Contact Resistance for "End-Contacted" Metal-Graphene and Metal-Nanotube Interfaces from Quantum Mechanics  

E-Print Network [OSTI]

ballistic conductance,12-14 and high thermal conductivity.15 Indeed, significant progress has been made layer graphene has been demonstrated to exhibit high electron mobility (15 000 cm2 /(V s)) and thermalContact Resistance for "End-Contacted" Metal-Graphene and Metal-Nanotube Interfaces from Quantum

Goddard III, William A.

389

Method of forming contacts for a back-contact solar cell  

DOE Patents [OSTI]

Methods of forming contacts for solar cells are described. In one embodiment, a method includes forming a silicon layer above a substrate, forming and patterning a solid-state p-type dopant source on the silicon layer, forming an n-type dopant source layer over exposed regions of the silicon layer and over a plurality of regions of the solid-state p-type dopant source, and heating the substrate to provide a plurality of n-type doped silicon regions among a plurality of p-type doped silicon regions.

Manning, Jane

2014-07-15T23:59:59.000Z

390

Journal of Materials Research http://journals.cambridge.org/JMR  

E-Print Network [OSTI]

and heated freezer windows.8 A dom- inant market for TCOs is provided by flat-panel displays (TCOs) are currently used in products such as flat-panel displays. The prevailing n-type conductivity (ITO), as a transparent electrode. ITO is also used as the front contact in photovoltaic solar cells.9

McCluskey, Matthew

391

Mechanical contact by constraints and split-based preconditioning  

SciTech Connect (OSTI)

An accurate implementation of glued mechanical contact was developed in MOOSE based on its Constraint system. This approach results in a superior convergence of elastic structure problems, in particular in BISON. Adaptation of this technique to frictionless and frictional contact models is under way. Additionally, the improved convergence of elastic problems results from the application of the split-based preconditioners to constraint-based systems. This yields a substantial increase in the robustness of elastic solvers when the number of nodes in contact is increased and/or the mesh is refined.

Dmitry Karpeyev; Derek Gaston; Jason Hales; Steven Novascone

2014-03-01T23:59:59.000Z

392

The hierarchical properties of contact networks in granular packings  

E-Print Network [OSTI]

The topological structure resulting from the network of contacts between grains (contact network) is studied for very large samples of disorderly-packed monosized spheres with densities ranging from 0.58 to 0.64. The hierarchical organization of such a structure is studied by means of a topological map which starts from a given sphere and moves outwards in concentric shells through the contact network. We find that the topological density of disordered sphere packing is larger than the topological density of equivalent lattice sphere packings.

T. Aste; T. J. Senden

2005-04-14T23:59:59.000Z

393

Contacts - Madison Dynamo Experiment - Cary Forest Group - UW Plasma  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation Proposed New SubstationCleanCommunity2Workshops 2008 To1Contact CommunityContactContacts

394

Contact Information: Jeff Williams, MLIS phone (858) 822-2218  

E-Print Network [OSTI]

Contact Information: Jeff Williams, MLIS phone (858) 822-2218 Biology Librarian fax (858) 822-2219 UCSD Biomedical Library j12williams@ucsd.edu Life Sciences Newsletter UCSD Biomedical Library Spring

California at San Diego, University of

395

Extrapolating Sparse Large-Scale GPS Traces for Contact Evaluation  

E-Print Network [OSTI]

, such as access points and cell towers, and occasionally also their geo- graphic location. However, given the larger transmission ranges of network elements, whether a short-range contact could take place can only

Ott, Jörg

396

Optics, mask and resist implications on contact CDU  

SciTech Connect (OSTI)

Mask and condenser roughness plays important in contact CDU. Resist blur drives both dose requirements and mask specs. Correlation methods can be used to measure mask contributions to CDU.

Naulleau, Patrick

2010-06-01T23:59:59.000Z

397

Influence of surface roughness and waviness upon thermal contact resistance  

E-Print Network [OSTI]

This work deals with the phenomenon of thermal resistance between contacting solids. Attention is directed towards contiguous solids possessing both surface roughness and waviness. When two such surfaces are brought together ...

Yovanovich, M. Michael

1967-01-01T23:59:59.000Z

398

Images in Emergency Medicine: Irritant Contact Dermatitis from Jet Fuel  

E-Print Network [OSTI]

and penetration of JP-8 jet fuel and its components. Toxicoland other kerosene-based fuels have been shown to cause skinContact Dermatitis from Jet Fuel Christopher C. Trigger, MD

Trigger, Christopher C; Eilbert, Wesley

2009-01-01T23:59:59.000Z

399

Dynamics of clusters and molecules in contact with an environment  

E-Print Network [OSTI]

(embedded, deposited) Fundamental studies on mechanisms (irradiation, deposition) (Nano) Contacts with insulators (ionic crystals, rare gases...) Low energy dynamics (optical response, deposition) Laser irradiation #12;Time Dependent Density Functional Theory (TDDFT) Ensemble of orbitals (1 electron

Giraud, Olivier

400

Impedance Control of a Pneumatic Actuator for Contact Tasks  

E-Print Network [OSTI]

of a pneumatic system is that of compliant actuation. By virtue of the compressibility of air, a pneumatic and stable force control, less damage during inadvertent contact, and the potential for energy storage." [1

Barth, Eric J.

Note: This page contains sample records for the topic "apel org contact" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


401

Centralized processing of contact-handled TRU waste feasibility analysis  

SciTech Connect (OSTI)

This report presents work for the feasibility study of central processing of contact-handled TRU waste. Discussion of scenarios, transportation options, summary of cost estimates, and institutional issues are a few of the subjects discussed. (JDL)

Not Available

1986-12-01T23:59:59.000Z

402

Hearing Material 1 Perception of Material from Contact Sounds  

E-Print Network [OSTI]

of simulated enviroments. This circumstance is unfortunate, when one considers that sounds provide important, the force of impact, and the location of contact relative to object geometry. In this paper we concentrate

Pai, Dinesh

403

Measurement of normal contact stiffness of fractal rough surfaces  

E-Print Network [OSTI]

We investigate the effects of roughness and fractality on the normal contact stiffness of rough surfaces. Samples of isotropically roughened aluminium surfaces are considered. The roughness and fractal dimension were altered through blasting using different sized particles. Subsequently, surface mechanical attrition treatment (SMAT) was applied to the surfaces in order to modify the surface at the microscale. The surface topology was characterised by interferometry based profilometry. The normal contact stiffness was measured through nanoindentation with a flat tip utilising the partial unloading method. We focus on establishing the relationships between surface stiffness and roughness, combined with the effects of fractal dimension. The experimental results, for a wide range of surfaces, showed that the measured contact stiffness depended very closely on surfaces' root mean squared (RMS) slope and their fractal dimension, with correlation coefficients of around 90\\%, whilst a relatively weak correlation coefficient of 57\\% was found between the contact stiffness and RMS roughness.

Chongpu Zhai; Sbastien Bevand; Yixiang Gan; Dorian Hanaor; Gwnalle Proust; Bruno Guelorget; Delphine Retraint

2014-09-03T23:59:59.000Z

404

2014 EMPLOYEE BENEFIT INSURANCE PLAN CONTACTS Health Insurance  

E-Print Network [OSTI]

2014 EMPLOYEE BENEFIT INSURANCE PLAN CONTACTS Health Insurance Anthem Blue Cross and Blue Shield www.anthem.com ? BlueAdvantage Point of Service Plan (HMO/POS) ? PRIME Health Plan (PPO) and Custom Plus Health Plan Phone

405

Graded Materials for Resistance to Contact Deformation and Damage  

E-Print Network [OSTI]

Graded Materials for Resistance to Contact Deformation and Damage S. Suresh The mechanical response as diverse as tribology, geology, optoelectronics, biomechanics, fracture mechanics, and nanotechnology changes in the elastic properties of sands, soils, and rocks beneath Earth's surface in- fluence

Suresh, Subra

406

aluminum alloyed contacts: Topics by E-print Network  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Modarres Razavi, Sonia 2012-02-14 116 LOSS ANALYSIS OF BACK-CONTACT BACK-JUNCTION THIN-FILM MONOCRYSTALLINE SILICON SOLAR CELLS Renewable Energy Websites Summary: of the...

407

Au-free Ohmic Contacts to Gallium Nitride and Graphene  

E-Print Network [OSTI]

This work deals with Au-free contact metallization schemes for gallium nitride (GaN) and graphene semiconductors. Graphene and gallium nitride are promising materials that can potentially be integrated together in the near future for high frequency...

Ravikirthi, Pradhyumna

2014-08-10T23:59:59.000Z

408

Multifrequency Imaging in the Intermittent Contact Mode of Atomic...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

of the intermittent-contact (IC) 1-4 and noncontact (NC) 5 modes of atomic force micro- scopy (AFM) has opened a pathway towards high-resolution nondestructive imaging of...

409

A multi-scale iterative approach for finite element modeling of thermal contact resistance  

E-Print Network [OSTI]

Surface topography has long been considered a key factor in the performance of many contact applications including thermal contact resistance. However, essentially all analytical and numerical models of thermal contact ...

Thompson, Mary Kathryn, 1980-

2007-01-01T23:59:59.000Z

410

Degradation of Iris Recognition Performance Due to Non-Cosmetic Prescription Contact Lenses  

E-Print Network [OSTI]

stated as: "Subjects can generally be recognized through eyeglasses or contact lenses. Colored contact with the recognition technology" [5] and "Successful identification can be made through eyeglasses and contact lenses

Bowyer, Kevin W.

411

Published: March 16, 2011 r 2011 American Chemical Society 1603 dx.doi.org/10.1021/nl104514m |Nano Lett. 2011, 11, 16031608  

E-Print Network [OSTI]

Published: March 16, 2011 r 2011 American Chemical Society 1603 dx.doi.org/10.1021/nl104514m |Nano Lett. 2011, 11, 1603­1608 LETTER pubs.acs.org/NanoLett Light Propagation in Curved Silver Nanowire

Wang, Zhong L.

412

8/11/2014 BarryOno Collection https://web.archive.org/web/20071117013221/http://www.bl.uk/collections/onoweb.html 1/2  

E-Print Network [OSTI]

8/11/2014 BarryOno Collection https://web.archive.org/web/20071117013221/http;8/11/2014 BarryOno Collection https://web.archive.org/web/20071117013221/http

413

Direct-contact closed-loop heat exchanger  

DOE Patents [OSTI]

A high temperature heat exchanger with a closed loop and a heat transfer liquid within the loop, the closed loop having a first horizontal channel with inlet and outlet means for providing direct contact of a first fluid at a first temperature with the heat transfer liquid, a second horizontal channel with inlet and outlet means for providing direct contact of a second fluid at a second temperature with the heat transfer liquid, and means for circulating the heat transfer liquid.

Berry, Gregory F. (Naperville, IL); Minkov, Vladimir (Skokie, IL); Petrick, Michael (Joliet, IL)

1984-01-01T23:59:59.000Z

414

Fiber tip interferometry for non-contact ultrasonic NDE  

E-Print Network [OSTI]

FIBER TIP INTERFEROMETRY FOR NON-CONTACT ULTRASONIC NDE A Thesis by Neal Andrew Schumacher Submitted to the Office of Graduate Studies of Texas A&M University in partial fulfillment of the requirements for the degree of MASTER OF SCIENCE... August 1990 Major Subject: Mechanical Engineering FIBER TIP INTERFEROMETRY FOR NON-CONTACT ULTRASONIC NDE A Thesis by Neal Andrew Schumacher Approved as to style and content by: Christian P. Burger (Chair of Committee) Hans Schuessler...

Schumacher, Neal Andrew

2012-06-07T23:59:59.000Z

415

Superconductor-normal-superconductor with distributed Sharvin point contacts  

DOE Patents [OSTI]

A non-linear superconducting junction device comprising a layer of high transient temperature superconducting material which is superconducting at an operating temperature, a layer of metal in contact with the layer of high temperature superconducting material and which remains non-superconducting at the operating temperature, and a metal material which is superconducting at the operating temperature and which forms distributed Sharvin point contacts with the metal layer.

Holcomb, Matthew J. (San Mateo County, CA); Little, William A. (Santa Clara County, CA)

1994-01-01T23:59:59.000Z

416

Electronic Non-Contacting Linear Position Measuring System  

DOE Patents [OSTI]

A non-contacting linear position location system employs a special transmission line to encode and transmit magnetic signals to a receiver on the object whose position is to be measured. The invention is useful as a non-contact linear locator of moving objects, e.g., to determine the location of a magnetic-levitation train for the operation of the linear-synchronous motor drive system.

Post, Richard F. (Walnut Creek, CA)

2005-06-14T23:59:59.000Z

417

Amorphous silicon passivated contacts for diffused junction silicon solar cells  

SciTech Connect (OSTI)

Carrier recombination at the metal contacts is a major obstacle in the development of high-performance crystalline silicon homojunction solar cells. To address this issue, we insert thin intrinsic hydrogenated amorphous silicon [a-Si:H(i)] passivating films between the dopant-diffused silicon surface and aluminum contacts. We find that with increasing a-Si:H(i) interlayer thickness (from 0 to 16?nm) the recombination loss at metal-contacted phosphorus (n{sup +}) and boron (p{sup +}) diffused surfaces decreases by factors of ?25 and ?10, respectively. Conversely, the contact resistivity increases in both cases before saturating to still acceptable values of ? 50 m? cm{sup 2} for n{sup +} and ?100 m? cm{sup 2} for p{sup +} surfaces. Carrier transport towards the contacts likely occurs by a combination of carrier tunneling and aluminum spiking through the a-Si:H(i) layer, as supported by scanning transmission electron microscopyenergy dispersive x-ray maps. We explain the superior contact selectivity obtained on n{sup +} surfaces by more favorable band offsets and capture cross section ratios of recombination centers at the c-Si/a-Si:H(i) interface.

Bullock, J., E-mail: james.bullock@anu.edu.au; Yan, D.; Wan, Y.; Cuevas, A. [Research School of Engineering, The Australian National University, Canberra, ACT 0200 (Australia); Demaurex, B.; Hessler-Wyser, A.; De Wolf, S. [cole Polytechnique Fdrale de Lausanne (EPFL), Institute of micro engineering (IMT), Photovoltaics and Thin Film Electronic Laboratory, Maladire 71, CH-200 Neuchtel (Switzerland)

2014-04-28T23:59:59.000Z

418

Contact angles in the pseudopotential lattice Boltzmann modeling of wetting  

E-Print Network [OSTI]

In this paper, we aim to investigate the implementation of contact angles in the pseudopotential lattice Boltzmann modeling of wetting at a large density ratio. The pseudopotential lattice Boltzmann model [X. Shan and H. Chen, Phys. Rev. E 49, 2941 (1994)] is a popular mesoscopic model for simulating multiphase flows and interfacial dynamics. In this model, the contact angle is usually realized by a fluid-solid interaction. Two widely used fluid-solid interactions: the density-based interaction and the pseudopotential-based interaction, as well as a modified pseudopotential-based interaction formulated in the present paper, are numerically investigated and compared in terms of the achievable contact angles, the maximum and the minimum densities, and the spurious currents. It is found that the pseudopotential-based interaction works well for simulating small static (liquid) contact angles, however, is unable to reproduce static contact angles close to 180 degrees. Meanwhile, it is found that the proposed modified pseudopotential-based interaction performs better in light of the maximum and the minimum densities and is overall more suitable for simulating large contact angles as compared with the other two types of fluid-solid interactions. Furthermore, the spurious currents are found to be enlarged when the fluid-solid interaction force is introduced. Increasing the kinematic viscosity ratio between the vapor and liquid phases is shown to be capable of reducing the spurious currents caused by the fluid-solid interactions.

Q. Li; K. H. Luo; Q. J. Kang; Q. Chen

2014-10-21T23:59:59.000Z

419

www.iaei.org November . December 2014 IAEI NEWS 1110 IAEI NEWS November . December 2014 www.iaei.org PERSPECTIVES ON PV |  

E-Print Network [OSTI]

1500 volts. And, standalone, off grid PV systems and utility- interactive PV systems with battery.iaei.org PERSPECTIVES ON PV | Safety First -- for the Inspector Photovoltaic (PV) power systems are generally in and local code requirements. A thorough inspection of a PV system will ensure that those requirements have

Johnson, Eric E.

420

r XXXX American Chemical Society A dx.doi.org/10.1021/jp112139h |J. Phys. Chem. C XXXX, XXX, 000000 pubs.acs.org/JPCC  

E-Print Network [OSTI]

Information ' INTRODUCTION Dye-sensitized solar cells (DSCs) have displayed significant potential to compete on transparent conducting oxide platforms for their use in dye-sensitized solar cells (DSCs) in a similar fashion­000 ARTICLE pubs.acs.org/JPCC SiO2 Aerogel Templated, Porous TiO2 Photoanodes for Enhanced Performance in Dye-Sensitized

Note: This page contains sample records for the topic "apel org contact" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


421

r XXXX American Chemical Society A dx.doi.org/10.1021/ja107719u |J. Am. Chem. Soc. XXXX, XXX, 000000 pubs.acs.org/JACS  

E-Print Network [OSTI]

these problems, including using carbide, nitride, or metal oxides as catalyst supports.3,8 Meta­000 ARTICLE pubs.acs.org/JACS Stabilization of Electrocatalytic Metal Nanoparticles at Metal-Metal Oxide, Washington 99164, United States bS Supporting Information ABSTRACT: Carbon-supported precious metal catalysts

Aksay, Ilhan A.

422

r XXXX American Chemical Society A dx.doi.org/10.1021/nl201470j |Nano Lett. XXXX, XXX, 000000 pubs.acs.org/NanoLett  

E-Print Network [OSTI]

­000 LETTER pubs.acs.org/NanoLett Interconnected Silicon Hollow Nanospheres for Lithium-Ion Battery Anodes silicon structure.13 This electrochem- ical conditioning method is promising, but limited capacities (960 the diffusion-induced stress evolution and investigated the volume expansion of the same single hollow spheres

Cui, Yi

423

r XXXX American Chemical Society A dx.doi.org/10.1021/jp1083967 |J. Phys. Chem. C XXXX, XXX, 000000 pubs.acs.org/JPCC  

E-Print Network [OSTI]

000 ARTICLE pubs.acs.org/JPCC Structure and Energetics of Thin Film Water Santiago Romero-Vargas Castrillon Engineering, Princeton University, Princeton, New Jersey 08544-5263, United States Physics Department, Brooklyn College of the City University of New York, Brooklyn, New York 11210, United States 1

Aksay, Ilhan A.

424

Contact Detection and Constraints Enforcement for the Simulation of Pellet/Clad Thermo-Mechanical Contact in Nuclear Fuel Rods  

E-Print Network [OSTI]

As fission process heats up the fuel rods, UO2 pellets stacked on top of each other swell both radially and axially, while the surrounding Zircaloy cladding creeps down, so that the pellets eventually come into contact with the clad...

Lebrun-Grandi, Damien Thomas

2014-03-05T23:59:59.000Z

425

Ultra-low contact resistance at an epitaxial metal/oxide heterojunctio...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Ultra-low contact resistance at an epitaxial metaloxide heterojunction through interstitial site doping. Ultra-low contact resistance at an epitaxial metaloxide heterojunction...

426

E-Print Network 3.0 - advanced biocompatible contact Sample Search...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

biocompatible contact Search Powered by Explorit Topic List Advanced Search Sample search results for: advanced biocompatible contact Page: << < 1 2 3 4 5 > >> 1 Knowledge Transfer...

427

E-Print Network 3.0 - airborne allergic contact Sample Search...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Items that "contact" the eye or promote irritation (i.e. foreign objects... , chemicals, etc.) Contact lens products, eye drops or eye ointments Anatomical abnormalities of...

428

E-Print Network 3.0 - action contacts directory Sample Search...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

contacts directory Search Powered by Explorit Topic List Advanced Search Sample search results for: action contacts directory Page: << < 1 2 3 4 5 > >> 1 Faculty and Staff...

429

Graphitic Electrical Contacts to Metallic Single Walled Carbon Nanotubes Using Pt Electrodes  

E-Print Network [OSTI]

NANO LETTERS Graphitic Electrical Contacts to Metallicof the interfacial electrical resistance between nano- tubesprovide excellent electrical contacts to many types of

Collins, Philip G

2009-01-01T23:59:59.000Z

430

Web: www.MentalHealthFirstAid.org Email: BetsyS@TheNationalCouncil.org Phone: 202.684.7457 Mental Health First Aid: Military Members, Veterans and their Families  

E-Print Network [OSTI]

connected to care. WHAT IS MENTAL HEALTH FIRST AID Mental Health First Aid USA is a live training program service employees, school and college staff, clergy and caring citizens. WHY MENTAL HEALTH FIRST AIDWeb: www.MentalHealthFirstAid.org Email: BetsyS@TheNationalCouncil.org Phone: 202.684.7457 Mental

Amin, S. Massoud

431

8/13/12 Futurity.org What the world can learn from China's water crisis 1/5www.futurity.org/earth-environment/what-the-world-can-learn-from-china's-water-crisis/  

E-Print Network [OSTI]

of nutrients--and about 300 million rural residents lack access to safe drinking water. (Credit: Federico lack access to safe drinking water. Water can unleash fury. Recent floods in Beijing overwhelmed8/13/12 Futurity.org What the world can learn from China's water crisis 1/5www.futurity.org/earth

432

10/05/2013 10:34Cherwell.org -Oxford / News / Academic / The Hole Truth Page 1 of 2http://www.cherwell.org/news/academic/2013/05/09/the-hole-truth  

E-Print Network [OSTI]

Walsh has published 6 articles Photograph: WikiImages The Hole Truth New research by Oxford academics10/05/2013 10:34Cherwell.org - Oxford / News / Academic / The Hole Truth Page 1 of 2http://www.cherwell.org/news/academic Colleges Academic Town Worcester Provost battles with Exeter building plan Teddy Hall Earth Sciences dinner

Gardner, Andy

433

PLoS Biology | www.plosbiology.orgPLoS Biology | www.plosbiology.org 0032 January 2009 | Volume 7 | Issue 1 | e1000021 athematical modeling of the processes that  

E-Print Network [OSTI]

PLoS Biology | www.plosbiology.orgPLoS Biology | www.plosbiology.org 0032 January 2009 | Volume 7 (often called biological pattern formation) has a long and rich history [1,2]. These models proposed sets of those seen in the biological world, such as stripes, spots, or graded properties. Pattern formation

Nie, Qing

434

INTERNATIONAL OSTEOPOROSIS FOUNDATION RUE JUSTE-OLIVIER, 9 CH-1260 NYON SWITZERLAND T +41 22 994 01 00 F +41 22 994 01 01 INFO@IOFBONEHEALTH.ORG WWW.IOFBONEHEALTH.ORG  

E-Print Network [OSTI]

INTERNATIONAL OSTEOPOROSIS FOUNDATION RUE JUSTE-OLIVIER, 9 CH-1260 NYON SWITZERLAND T +41 22 994 01 00 F +41 22 994 01 01 INFO@IOFBONEHEALTH.ORG WWW.IOFBONEHEALTH.ORG OSTEOPOROSIS woman' released for World Osteoporosis Day shows urgent action must be taken to safeguard the quality

Shihadeh, Alan

435

Things to Do in Santa Cruz and the Area Wine tasting: http://www.santacruzca.org/things/wine-tasting.php?page=1#tpsearch  

E-Print Network [OSTI]

Things to Do in Santa Cruz and the Area Wine tasting: http://www.santacruzca.org/things/wine-tasting.php: http://www.santacruzca.org/things/parks.php Stand Up Paddling at the Harbor: www Giants, San Francisco Giants, Oakland A's Beaches in and around Santa Cruz: http://www.santacruzca.org/things/best-beaches.php

California at Santa Cruz, University of

436

http://www.jstor.org Male and Female Pollination Success in a Deceptive Orchid, a Selection Study  

E-Print Network [OSTI]

http://www.jstor.org Male and Female Pollination Success in a Deceptive Orchid, a Selection Study/08/2008 12:49 Your use of the JSTOR archive indicates your acceptance of JSTOR's Terms and Conditions of Use, available at http://www.jstor.org/page/info/about/policies/terms.jsp. JSTOR's Terms and Conditions of Use

Johnston, Mark

437

www.biosciencemag.org January 2011 / Vol. 61 No. 1 BioScience 19 Energetic Limits to Economic Growth  

E-Print Network [OSTI]

. We demonstrate a positive scaling relationship between per capita energy use and per capita gross status and ecological impact are correlated with energy use and GDP. We estimate global energy.iea.org/stats/index.asp) and World Resources Institute (WRI; http://earthtrends.wri.org/index.php).Per capita energy consumption

Brown, James H.

438

A RESTful API for exchanging materials data in the AFLOWLIB.org Richard H. Taylor a,b  

E-Print Network [OSTI]

A RESTful API for exchanging materials data in the AFLOWLIB.org consortium Richard H. Taylor a (API) following REST principles is introduced for the AFLOWLIB.org materials data repositories through a RESTful API and a python library enabling ad hoc applications [17]. Other examples of online

Curtarolo, Stefano

439

REALTIME MONITORING OF PIPELINES FOR THIRD-PARTY CONTACT  

SciTech Connect (OSTI)

Third-party contact with pipelines (typically caused by contact with a digging or drilling device) can result in mechanical damage to the pipe, in addition to coating damage that can initiate corrosion. Because this type of damage often goes unreported and can lead to eventual catastrophic failure of the pipe, a reliable, cost-effective method is needed for monitoring and reporting third-party contact events. The impressed alternating cycle current (IACC) pipeline monitoring method consists of impressing electrical signals on the pipe by generating a time-varying voltage between the pipe and the soil at periodic locations where pipeline access is available. The signal voltage between the pipe and ground is monitored continuously at receiving stations located some distance away. Third-party contact to the pipe that breaks through the coating changes the signal received at the receiving stations. In this project, the IACC monitoring method is being developed, tested, and demonstrated. Work performed to date includes (1) a technology assessment, (2) development of an IACC model to predict performance and assist with selection of signal operating parameters, (3) Investigation of potential interactions with cathodic protection systems, and (4) experimental measurements on buried pipe at a test site as well as on an operating pipeline. Initial results show that simulated contact can be detected. Future work will involve further refinement of the method and testing on operating pipelines.

Gary L. Burkhardt; Alfred E. Crouch

2004-10-01T23:59:59.000Z

440

REALTIME MONITORING OF PIPELINES FOR THIRD-PARTY CONTACT  

SciTech Connect (OSTI)

Third-party contact with pipelines (typically caused by contact with a digging or drilling device) can result in mechanical damage to the pipe, in addition to coating damage that can initiate corrosion. Because this type of damage often goes unreported and can lead to eventual catastrophic failure of the pipe, a reliable, cost-effective method is needed for monitoring and reporting third-party contact events. The impressed alternating cycle current (IACC) pipeline monitoring method consists of impressing electrical signals on the pipe by generating a time-varying voltage between the pipe and the soil at periodic locations where pipeline access is available. The signal voltage between the pipe and ground is monitored continuously at receiving stations located some distance away. Third-party contact to the pipe that breaks through the coating changes the signal received at the receiving stations. In this project, the IACC monitoring method is being developed, tested, and demonstrated. Work performed to date includes a technology assessment, development of an IACC model to predict performance and assist with selection of signal operating parameters, and experimental measurements on a buried pipe at a test site. Initial results show that simulated contact can be detected. Future work will involve further refinement of the method and testing on operating pipelines.

Gary L. Burkhardt; Alfred E. Crouch; Jay L. Fisher

2004-04-01T23:59:59.000Z

Note: This page contains sample records for the topic "apel org contact" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


441

For more information, contact Michele Boyd at mboyd@psr.org. Updated July 13, 2009. Existing Subsidies and Incentives for New Nuclear Reactors  

E-Print Network [OSTI]

Subsidies and Incentives for New Nuclear Reactors Research and Development · Generation IV program in construction and operation licensing for 6 new reactors, including delays due to the Nuclear Regulatory-hour paid by ratepayers receiving electricity from nuclear reactors to pay for a geologic repository

Laughlin, Robert B.

442

ESG: Extended Similarity Group method for protein function prediction For any questions regarding ESG contact the administration at info@kiharalab.org  

E-Print Network [OSTI]

box titled "Enter Query Sequence(s)". Consider the following sequence that you can enter. >sp|P56851 KDKSSHMFIYISWYKIEHICTSDNWMDRFRNAYVWVQNPLKVLKCHQENSKNSYTESRSF NYIEFHCSMDGYVDSIEDLKMVEPIGN You can also click on "Load Sample" link to load this sequence in the text box and follow the next steps. Clicking on "Clear" link will clear the text box for sequence

Kihara, Daisuke

443

Enhanced Semiconductor Nanocrystal Conductance via Solution Grown Contacts  

SciTech Connect (OSTI)

We report a 100,000-fold increase in the conductance of individual CdSe nanorods when they are electrically contacted via direct solution phase growth of Au tips on the nanorod ends. Ensemble UV-Vis and X-Ray photoelectron spectroscopy indicate this enhancement does not result from alloying of the nanorod. Rather, low temperature tunneling and high temperature (250-400 K) thermionic emission across the junction at the Au contact reveal a 75percent lower interface barrier to conduction compared to a control sample. We correlate this barrier lowering with the electronic structure at the Au-CdSe interface. Our results emphasize the importance of nanocrystal surface structure for robust device performance and the advantage of this contact method.

Sheldon, Matthew T.; Trudeau, Paul-Emile; Mokari, Taleb; Wang, Lin-Wang; Alivisatos, A. Paul

2009-08-19T23:59:59.000Z

444

Existence and Regularity for Dynamic Viscoelastic Adhesive Contact with Damage  

SciTech Connect (OSTI)

A model for the dynamic process of frictionless adhesive contact between a viscoelastic body and a reactive foundation, which takes into account the damage of the material resulting from tension or compression, is presented. Contact is described by the normal compliance condition. Material damage is modelled by the damage field, which measures the pointwise fractional decrease in the load-carrying capacity of the material, and its evolution is described by a differential inclusion. The model allows for different damage rates caused by tension or compression. The adhesion is modelled by the bonding field, which measures the fraction of active bonds on the contact surface. The existence of the unique weak solution is established using the theory of set-valued pseudomonotone operators introduced by Kuttler and Shillor (1999). Additional regularity of the solution is obtained when the problem data is more regular and satisfies appropriate compatibility conditions.

Kuttler, Kenneth L. [Department of Mathematics, Brigham Young University, Provo, UT 84602 (United States)], E-mail: klkuttler@math.byu.edu; Shillor, Meir [Department of Mathematics and Statistics, Oakland University, Rochester, MI 48309 (United States)], E-mail: shillor@oakland.edu; Fernandez, Jose R. [Departamento de Matematica Aplicada, Facultade de Matematicas, University of Santiago de Compostela, 15706 Santiago de Compostela (Spain)], E-mail: jramon@usc.es

2006-01-15T23:59:59.000Z

445

Producing thin film photovoltaic modules with high integrity interconnects and dual layer contacts  

DOE Patents [OSTI]

High performance photovoltaic modules are produced with improved interconnects by a special process. Advantageously, the photovoltaic modules have a dual layer back (rear) contact and a front contact with at least one layer. The front contact and the inner layer of the back contact can comprise a transparent conductive oxide. The outer layer of the back contact can comprise a metal or metal oxide. The front contact can also have a dielectric layer. In one form, the dual layer back contact comprises a zinc oxide inner layer and an aluminum outer layer and the front contact comprises a tin oxide inner layer and a silicon dioxide dielectric outer layer. One or more amorphous silicon-containing thin film semiconductors can be deposited between the front and back contacts. The contacts can be positioned between a substrate and an optional superstrate. During production, the transparent conductive oxide layer of the front contact is scribed by a laser, then the amorphous silicon-containing semiconductors and inner layer of the dual layer back contact are simultaneously scribed and trenched (drilled) by the laser and the trench is subsequently filled with the same metal as the outer layer of the dual layer back contact to provide a superb mechanical and electrical interconnect between the front contact and the outer layer of the dual layer back contact. The outer layer of the dual layer back contact can then be scribed by the laser. For enhanced environmental protection, the photovoltaic modules can be encapsulated.

Jansen, Kai W. (Lawrenceville, NJ); Maley, Nagi (Exton, PA)

2001-01-01T23:59:59.000Z

446

REALTIME MONITORING OF PIPELINES FOR THIRD-PARTY CONTACT  

SciTech Connect (OSTI)

Third-party contact with pipelines (typically caused by contact with a digging or drilling device) can result in mechanical damage to the pipe, in addition to coating damage that can initiate corrosion. Because this type of damage often goes unreported and can lead to eventual catastrophic failure of the pipe, a reliable, cost-effective method is needed for monitoring and reporting third-party contact events. The impressed alternating cycle current (IACC) pipeline monitoring method consists of impressing electrical signals on the pipe by generating a time-varying voltage between the pipe and the soil at periodic locations where pipeline access is available. The signal voltage between the pipe and ground is monitored continuously at receiving stations located some distance away. Third-party contact to the pipe that breaks through the coating changes the signal received at the receiving stations. In this project, the IACC monitoring method is being developed, tested, and demonstrated. Work performed to date includes (1) a technology assessment, (2) development of an IACC model to predict performance and assist with selection of signal operating parameters, (3) Investigation of potential interactions with cathodic protection systems, and (4) experimental measurements on buried pipe at a test site as well as on an operating pipeline. Initial results showed that IACC signals could be successfully propagated over a distance of 3.5 miles, and that simulated contact can be detected up to a distance of 0.7 mile. Unexpected results were that the electrical impedance from the operating pipelines to the soil was very low and, therefore, the changes in impedance and signal resulting from third-party contact were unexpectedly low. Future work will involve further refinement of the method to resolve the issues with small signal change and additional testing on operating pipelines.

Gary L. Burkhardt; Alred E. Crouch

2005-04-01T23:59:59.000Z

447

Novel Composite Materials for SOFC Cathode-Interconnect Contact  

SciTech Connect (OSTI)

This report summarized the research efforts and major conclusions of our University Coal Research Project, which focused on developing a new class of electrically-conductive, Cr-blocking, damage-tolerant Ag-perovksite composite materials for the cathode-interconnect contact of intermediate-temperature solid oxide fuel cell (SOFC) stacks. The Ag evaporation rate increased linearly with air flow rate initially and became constant for the air flow rate {ge} {approx} 1.0 cm {center_dot} s{sup -1}. An activation energy of 280 KJ.mol{sup -1} was obtained for Ag evaporation in both air and Ar+5%H{sub 2}+3%H{sub 2}O. The exposure environment had no measurable influence on the Ag evaporation rate as well as its dependence on the gas flow rate, while different surface morphological features were developed after thermal exposure in the oxidizing and reducing environments. Pure Ag is too volatile at the SOFC operating temperature and its evaporation rate needs to be reduced to facilitate its application as the cathode-interconnect contact. Based on extensive evaporation testing, it was found that none of the alloying additions reduced the evaporation rate of Ag over the long-term exposure, except the noble metals Au, Pt, and Pd; however, these noble elements are too expensive to justify their practical use in contact materials. Furthermore, the addition of La{sub 0.8}Sr{sub 0.2}MnO{sub 3} (LSM) into Ag to form a composite material also did not significantly modify the Ag evaporation rate. The Ag-perovskite composites with the perovskite being either (La{sub 0.6}Sr{sub 0.4})(Co{sub 0.8}Fe{sub 0.2})O{sub 3} (LSCF) or LSM were systematically evaluated as the contact material between the ferritic interconnect alloy Crofer 22 APU and the LSM cathode. The area specific resistances (ASRs) of the test specimens were shown to be highly dependent on the volume percentage and the type of the perovskite present in the composite contact material as well as the amount of thermal cycling that the specimens were subjected to during testing. The Ag-LSCF composite contact materials proved more effective in trapping Cr within the contact material and preventing Cr migration into the cathode than the Ag-LSM composites. Ag-perovskite composite contact materials are promising candidates for use in intermediate-temperature SOFC stacks with ferritic stainless steel interconnects due to their ability to maintain acceptably low ASRs while reducing Cr migration into the cathode material.

J. H. Zhu

2009-07-31T23:59:59.000Z

448

Laminated photovoltaic modules using back-contact solar cells  

DOE Patents [OSTI]

Photovoltaic modules which comprise back-contact solar cells, such as back-contact crystalline silicon solar cells, positioned atop electrically conductive circuit elements affixed to a planar support so that a circuit capable of generating electric power is created. The modules are encapsulated using encapsulant materials such as EVA which are commonly used in photovoltaic module manufacture. The module designs allow multiple cells to be electrically connected in a single encapsulation step rather than by sequential soldering which characterizes the currently used commercial practices.

Gee, James M. (Albuquerque, NM); Garrett, Stephen E. (Albuquerque, NM); Morgan, William P. (Albuquerque, NM); Worobey, Walter (Albuquerque, NM)

1999-09-14T23:59:59.000Z

449

Topological complexity, contact order and protein folding rates  

E-Print Network [OSTI]

Monte Carlo simulations of protein folding show the emergence of a strong correlation between the relative contact order parameter, CO, and the folding time, t, of two-state folding proteins for longer chains with number of amino acids, N>=54, and higher contact order, CO > 0.17. The correlation is particularly strong for N=80 corresponding to slow and more complex folding kinetics. These results are qualitatively compatible with experimental data where a general trend towards increasing t with CO is indeed observed in a set of proteins with chain length ranging from 41 to 154 amino acids.

P. F. N. Faisca; R. C. Ball

2002-05-29T23:59:59.000Z

450

Contact information for the Cyclotron Institute REU Program  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc DocumentationP-Series to User GroupInformation Administration (EIA)DonUsContactContact

451

Contacts | U.S. DOE Office of Science (SC)  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc DocumentationP-Series to User GroupInformationE-Gov Contacts for E-GovContacts News News Home

452

Contact | U.S. DOE Office of Science (SC)  

Office of Science (SC) Website

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmosphericNuclear SecurityTensile Strain Switched5 Industrial CarbonArticlesHumanJune 2008 BasicCharlesCondensedContact EnergyContact

453

Contact | U.S. DOE Office of Science (SC)  

Office of Science (SC) Website

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmosphericNuclear SecurityTensile Strain Switched5 Industrial CarbonArticlesHumanJune 2008 BasicCharlesCondensedContactContact Science

454

Contact | U.S. DOE Office of Science (SC)  

Office of Science (SC) Website

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmosphericNuclear SecurityTensile Strain Switched5 Industrial CarbonArticlesHumanJune 2008 BasicCharlesCondensedContactContact

455

Contact Us | ANSER Center | Argonne-Northwestern National Laboratory  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformation InInformationCenterResearchCASLNanoporousTestimonyContact Us - Working With Us Contact

456

Contact information | Center for Bio-Inspired Solar Fuel Production  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformation InInformationCenterResearchCASLNanoporousTestimonyContact Us - WorkingContact Us

457

For additional information, contact: Department of Agricultural Economics & Economics  

E-Print Network [OSTI]

For additional information, contact: Department of Agricultural Economics & Economics Montana State.montana.edu/econ agecon@montana.edu 1 2 AGRICULTURAL ECONOMICS & ECONOMICS KELLY GORHAM 1 Austin Owens traveled to Greece as mentors for students in Economics 101 4 Chris Stoddard was the recipient of a MSU Cox Family Faculty

Lawrence, Rick L.

458

CONTACT: University Relations/News 304.293.6997  

E-Print Network [OSTI]

CONTACT: University Relations/News 304.293.6997 Text of WVU presidential search committee. 28) by the West Virginia University presidential search committee asking the Board of Governors the presidential search at West Virginia University, I hereby move that the Presidential Search Committee: 1

Mohaghegh, Shahab

459

ECE 3301: General Electrical Engineering Credit / Contact hours: 3 / 3  

E-Print Network [OSTI]

ECE 3301: General Electrical Engineering Credit / Contact hours: 3 / 3 Course coordinator: Mary Baker Textbook(s) and/or other required material: Hambley, Allan R., Electrical Engineering Principles and Applications, fourth edition, Prentice Hall, 2007. Catalog description: Analysis of electric circuits

Gelfond, Michael

460

Ohmic contacts to p-type GaP  

E-Print Network [OSTI]

thickness used in this scheme. The samples were annealed for I @n at temperatures ranging from 3 5 0 to 4 5 0 'C. Lower values of the contact resistivity than those of the Si/Pd/Zn/Pd/p-GaP scheme were achieved by depositing an Aluminum layer on the top...

Jorge Estevez, Humberto Angel

1996-01-01T23:59:59.000Z

Note: This page contains sample records for the topic "apel org contact" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


461

Annular electrical contact apparatus for use in drill stem testing  

SciTech Connect (OSTI)

In accordance with an illustrative embodiment of the present invention, a full bore drill stem testing system includes a tubular housing suspended in a well on a pipe string and having an open bore therethrough. An annular electrical contact sleeve is mounted on the wall of the housing surrounding the bore. A running tool that is lowered into the pipe string on electrical wireline includes inner and outer body members, with the outer body member carrying latch dogs that engage a shoulder in the housing to stop downward movement in a predetermined position. The inner body member carries a normally retracted annular elastomer element that has an electrical contact means on its outer periphery, and expander means responsive to upward movement of said inner body member relative to said outer body member is operable to expand the elastomer element to cause the contact means to engage the contact sleeve and enable drill stem test data to be transmitted to the surface via the electric wireline.

Lancaster, C. E.

1985-09-17T23:59:59.000Z

462

For additional information, contact: Department of History, Philosophy  

E-Print Network [OSTI]

For additional information, contact: Department of History, Philosophy & Religious Studies Montana "Philosophy of Science," "Nature and Religion" and "The Darwinian Revolution." The World The department offers courses ranging from "Latin American Perspectives" to "Religion of Ancient Egypt" to "Philosophies of Asia

463

Test method Evaluating the influence of contacting fluids on polyethylene  

E-Print Network [OSTI]

Test method Evaluating the influence of contacting fluids on polyethylene using acoustic emissions emissions Polyethylene Penetrant Toluene Aqueous detergent a b s t r a c t Identifying microstructural) on the structure of a semi-crystalline polymer (high density polyethylene, HDPE) over different periods of exposure

Thompson, Michael

464

For Immediate release: 06/14/12 Contact: Ingrid Wright  

E-Print Network [OSTI]

bays that will obtain a minimum Leadership in Engineering and Environmental Design (LEED) SilverFor Immediate release: 06/14/12 Contact: Ingrid Wright Civil Engineering Collaborates with City to Build New Fire Station The Civil Engineering Department at The University of Texas at El Paso has been

Ward, Karen

465

FOR MORE INFORMATION, CONTACT: TP Straatsma, Initiative Lead  

E-Print Network [OSTI]

FOR MORE INFORMATION, CONTACT: TP Straatsma, Initiative Lead 509-375-2802 tps@pnl.gov www.pnl.gov e Development of Exascale Algorithms for Molecular Modeling Lead investigator: Dr. Karol Kowalski Researchers Optimizations for Extreme Scale Systems Lead investigator: Dr. Daniel Chavarria Exascale systems will provide

466

Current Producers of Developed Grasses Producers Contact Phone Number  

E-Print Network [OSTI]

Rod 979-543-0121 Trinity Turf Nursery* Doug O'Conner 800-290-8873 Wharton Turfgrass Jimmy Kocurek 979 Turfgrass Jimmy Kocurek 979-532-4340 Wittig Grass Farms Allan Wittig 979-657-4496 Diamond Producers Contact Turfgrass Jimmy Kocurek 979-532-4340 Winstead Turf Farms* (AR, MS, TN) Bobby Winstead 800-624-8873 Wittig

467

For Immediate release: 11/16/12 Contact: Ingrid Wright  

E-Print Network [OSTI]

Mobil, Lockheed Martin, General Motors, AT&T and more. Internship presenters will be Alan Alvillar UTEPFor Immediate release: 11/16/12 Contact: Ingrid Wright Engineering students host Internship Seminar Series The College of Engineering Tau Beta Pi, Malone Engineering Leadership Program, the Entering

Ward, Karen

468

For Immediate release: 10/31/12 Contact: Ingrid Wright  

E-Print Network [OSTI]

Mobil, Lockheed Martin, General Motors, AT&T and more. Internship presenters will be Janet Gomez UTEPFor Immediate release: 10/31/12 Contact: Ingrid Wright Engineering students host Internship Seminar Series The College of Engineering Tau Beta Pi, Malone Engineering Leadership Program, the Entering

Ward, Karen

469

For Immediate release: 11/07/12 Contact: Ingrid Wright  

E-Print Network [OSTI]

Mobil, Lockheed Martin, General Motors, AT&T and more. On Friday, internship presenters will be OliviaFor Immediate release: 11/07/12 Contact: Ingrid Wright Engineering students host Internship Seminar Series The College of Engineering Tau Beta Pi, Malone Engineering Leadership Program, the Entering

Ward, Karen

470

For Immediate release: 10/25/12 Contact: Ingrid Wright  

E-Print Network [OSTI]

Mobil, Lockheed Martin, General Motors, AT&T and more. On October 26, there will be a special guestFor Immediate release: 10/25/12 Contact: Ingrid Wright Engineering students host Internship Seminar Series The College of Engineering Tau Beta Pi, Malone Engineering Leadership Program, the Entering

Ward, Karen

471

Ballistic thermal point contacts made of GaAs nanopillars  

SciTech Connect (OSTI)

We measure the thermal conductance of GaAs pillars that are only a few nanometers long. Our observations can be understood with a simple model, in which the pillars constitute thermal point contacts between 3D phonon reservoirs. Moreover, first measurements of the electronic transport through these pillars are presented.

Bartsch, Th.; Wetzel, A.; Sonnenberg, D.; Schmidt, M.; Heyn, Ch.; Hansen, W. [Institut fr Angewandte Physik und Zentrum fr Mikrostrukturforschung, Universitt Hamburg, Jungiusstr. 11, 20355 Hamburg (Germany)

2013-12-04T23:59:59.000Z

472

For Immediate release: 10/05/11 Contact: Ingrid Wright  

E-Print Network [OSTI]

For Immediate release: 10/05/11 Contact: Ingrid Wright UTEP to Oversee Push for 'Green' Engineers develop new alternative energy sources and ways to increase energy efficiency. Heidi A. Taboada, Ph of the BuildinG a Regional Energy and Educational Network (BGREEN) project. The USDA announced the award Tuesday

Ward, Karen

473

Method and apparatus for producing co-current fluid contact  

DOE Patents [OSTI]

An improved packing system and method are disclosed wherein a packing section includes a liquid distributor and a separator placed above the distributor so that gas rising through the liquid distributor contacts liquid in the distributor, forming a gas-liquid combination which rises in co-current flow to the separator. Liquid is collected in the separator, from which gas rises. 13 figs.

Trutna, W.R.

1997-12-09T23:59:59.000Z

474

For Immediate release: 03/20/12 Contact: Ingrid Wright  

E-Print Network [OSTI]

had the opportunity to tour the facility of Operational Test Command (OTC) at Fort Bliss for the firstFor Immediate release: 03/20/12 Contact: Ingrid Wright Electrical Engineering students visit Fort Bliss The University of Texas at El Paso's Department of Electrical and Computer Engineering students

Ward, Karen

475

For Immediate release: 03/13/12 Contact: Ingrid Wright  

E-Print Network [OSTI]

For Immediate release: 03/13/12 Contact: Ingrid Wright UTEP to host symposium on energy science and Engineering Symposium starting at 8 a.m. Saturday, March 24, at the Double Tree Inn in El Paso The symposium assistant professor of mechanical engineering at UTEP. The event will feature keynote speaker Robert R

Ward, Karen

476

Friction coefficient of soft contact lenses: measurements and modeling  

E-Print Network [OSTI]

, FL 32611, USA Received 12 October 2004; accepted 16 January 2005 Tribological conditions for contact elastohydrodynamic lubrication. Finally, the largest contributors to the friction force in these experiments were comfort is related to friction. The mechanical properties of hydro- gels are extremely sensitive to water

Sawyer, Wallace

477

TO: HR and Business Contacts FROM: Division of Human Resources  

E-Print Network [OSTI]

MEMORANDUM TO: HR and Business Contacts FROM: Division of Human Resources DATE: October 25, 2013 RE: Human Resources Fall 2013 Forum The Division of Human Resources will sponsor an HR Forum from 1 to the Division of Human Resources' Organizational and Professional Development Office at hrtrain

Almor, Amit

478

TO: HR and Business Contacts FROM: Division of Human Resources  

E-Print Network [OSTI]

TO: HR and Business Contacts FROM: Division of Human Resources DATE: September 6, 2012 RE: Human Resources Fall 2012 Forum The Division of Human Resources will sponsor an HR Forum from 1-4 p in person or by webinar. Any questions about the forum may be e-mailed to the Division of Human Resources

Almor, Amit

479

TO: HR and Business Contacts FROM: Division of Human Resources  

E-Print Network [OSTI]

TO: HR and Business Contacts FROM: Division of Human Resources DATE: September 24, 2012 RE: Reminder: Human Resources Fall 2012 Forum This is a reminder that you will need to register online by the Division of Human Resources, this forum will include information about benefits updates to annual

Almor, Amit

480

Detection of Heavy Metal Ions Based on Quantum Point Contacts  

E-Print Network [OSTI]

. The ability to detect trace amounts of metal ions is important because of the toxicity of heavy metal ionsDetection of Heavy Metal Ions Based on Quantum Point Contacts Vasanth Rajagopalan, Salah Boussaad on many living organisms and the consequence of heavy metal ions not being biodegradable. To date, heavy

Zhang, Yanchao

Note: This page contains sample records for the topic "apel org contact" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


481

On the Effect of Compliance in Robotic Contact Tasks Problem  

E-Print Network [OSTI]

1 1995 ACC On the Effect of Compliance in Robotic Contact Tasks Problem Shahram Payandeh, Assistant Professor Experimental Robotics Laboratory (ERL) School of Engineering Science Simon Fraser University control of the robotic manipulator during its phase transition from free to constrained motions. One

482

Media contact: FOR IMMEDIATE RELEASE Diana Hanford May 4, 2012  

E-Print Network [OSTI]

companies working in conjunction with the FAU College of Engineering and Computer Science, the FAU Charles EMedia contact: FOR IMMEDIATE RELEASE Diana Hanford May 4, 2012 Ambit Advertising and Public working on industry projects. Also included is a dedicated office for the annual FAU Business Plan

Fernandez, Eduardo

483

Media contact: FOR IMMEDIATE RELEASE Diana Hanford September 24, 2012  

E-Print Network [OSTI]

to 22 technology companies working in conjunction with the FAU College of Engineering and ComputerMedia contact: FOR IMMEDIATE RELEASE Diana Hanford September 24, 2012 Ambit Advertising and Public by FAU student-based teams working on industry projects. It also serves as a knowledge resource center

Belogay, Eugene A.

484

ENVS 404: Internship Syllabus Contact Information: Internship Coordinator  

E-Print Network [OSTI]

1 ENVS 404: Internship Syllabus Contact Information: Internship Coordinator Peg Boulay Environmental Leadership Program Co-Director, Internship Coordinator and Academic Adviser 242 Columbia Hall 541-346-5945 boulay@uoregon.edu Note: The Internship Coordinator position may also be filled by a Graduate Teaching

485

Simulations with Sliding and Intermittent Contact Matthew P. Kelly  

E-Print Network [OSTI]

.edu March 5, 2014 Abstract When simulating a system that has intermittent contact, it is necessary or uses those [4] · Examples from my book (wheel and pulley) · Page 6 of Chatterjee and Ruina board. 4 Bouncing Ball Briefly discuss the results of my Simulations of a bouncing ball. 4.1 Zeno

Ruina, Andy L.

486

An Energy-Based Approach for Contact Force Computation  

E-Print Network [OSTI]

An Energy-Based Approach for Contact Force Computation Fran¸cois Faure Francois.Faure@imag.fr, i. The subsequent iterations consist of global redistributions of energy through the solids in order to restrict widely addressed in computer graphics research. The dynamics equations are now well-known and used

Paris-Sud XI, Université de

487

Problems addressed in this course Teaching methodology, material, exams, contacts  

E-Print Network [OSTI]

. The first look at a genome - Sequence analysis Bioinformatics - Lecture 1 Louis Wehenkel Department. The first look at a genome - Sequence analysis Problems addressed in this course Teaching methodology, material, exams, contacts Chapter 1. The first look at a genome - Sequence analysis Introduction

Wehenkel, Louis

488

Michael A. Santoro Title and Address: Contact Information  

E-Print Network [OSTI]

of intellectual property, competitor information gathering, personal privacy law, and trade secrecy. ResearchMichael A. Santoro Title and Address: Contact Information: Professor Department of Management, Rutgers Flex Program MBA Program (2013) 2010 With Ronald J. Strauss, Best Paper in Ethics Award

Lin, Xiaodong

489

REALTIME MONITORING OF PIPELINES FOR THIRD-PARTY CONTACT  

SciTech Connect (OSTI)

Third-party contact with pipelines (typically caused by contact with a digging or drilling device) can result in mechanical damage to the pipe, in addition to coating damage that can initiate corrosion. Because this type of damage often goes unreported and can lead to eventual catastrophic failure of the pipe, a reliable, cost-effective method is needed for monitoring and reporting third-party contact events. The impressed alternating cycle current (IACC) pipeline monitoring method consists of impressing electrical signals on the pipe by generating a time-varying voltage between the pipe and the soil at periodic locations where pipeline access is available. The signal voltage between the pipe and ground is monitored continuously at receiving stations located some distance away. Third-party contact to the pipe that breaks through the coating changes the signal received at the receiving stations. In this project, the IACC monitoring method is being developed, tested, and demonstrated. Work performed to date includes (1) a technology assessment, (2) development of an IACC model to predict performance and assist with selection of signal operating parameters, (3) investigation of potential interactions with cathodic protection systems, and (4) experimental measurements on operating pipelines. Based on information recently found in published studies, it is believed that the operation of IACC on a pipeline will cause no interference with CP systems. Initial results on operating pipelines showed that IACC signals could be successfully propagated over a distance of 3.5 miles, and that simulated contact can be detected up to a distance of 1.4 miles, depending on the pipeline and soil conditions.

Gary L. Burkhardt; Alfred E. Crouch

2005-10-01T23:59:59.000Z

490

correspondence n engl j med 362;16 nejm.org april 22, 2010 1547  

E-Print Network [OSTI]

care reform ini- tiatives in China, Mexico, Iran, and elsewhere. Musgrove criticizes our Perspective- port.3 At that time, we published a thorough re- buttal.4 The United States spends more on health carecorrespondence n engl j med 362;16 nejm.org april 22, 2010 1547 Musgrove P. Judging health systems

de Bakker, Paul

491

XU ET AL. VOL. 8 ' NO. 3 ' 26972703 ' 2014 www.acsnano.org  

E-Print Network [OSTI]

XU ET AL. VOL. 8 ' NO. 3 ' 2697­2703 ' 2014 www.acsnano.org 2697 February 05, 2014 C 2014 American, and # Department of Physics, Shahid Rajaee Teacher Training University, Lavizan, Tehran 16788, Iran D irect effects.2,3 Among the most effective supports for Pt NPs in electro- chemical catalysis are carbon

Thibado, Paul M.

492

http://arXiv.org/physics/0507088 Teaching About Nature's Nuclear Reactors  

E-Print Network [OSTI]

http://arXiv.org/physics/0507088 Teaching About Nature's Nuclear Reactors J. Marvin Herndon reactors existed in uranium deposits on Earth long before Enrico Fermi built the first man-made nuclear reactors. The subject of planetocentric nuclear fission reactors can be a jumping off point for stimulating

Learned, John

493

JOM January 201148 www.tms.org/jom.html OverviewOverviewNanomaterials for Renewable Energy  

E-Print Network [OSTI]

JOM · January 201148 www.tms.org/jom.html OverviewOverviewNanomaterials for Renewable Energy Global to fundamental advances in direct renewable energy and ener- gy storage and conversion which are needed to enable renewable energy and meet the general energy challenges and associated environmental effects. This paper

494

Renewable Energy Research Laboratory, UMass Amherst www.ceere.org/rerl  

E-Print Network [OSTI]

Renewable Energy Research Laboratory, UMass Amherst www.ceere.org/rerl Community-Scale Wind Energy Fellow, Renewable Energy Research Laboratory, University of Massachusetts Supported by the The US, Renewable Energy Research Laboratory, University of Massachusetts Supported by the The US Department

Massachusetts at Amherst, University of

495

Renewable Energy Research Laboratory, UMass Amherst www.ceere.org/rerl  

E-Print Network [OSTI]

Renewable Energy Research Laboratory, UMass Amherst www.ceere.org/rerl 1 Small Wind PowerSmall Wind Sally Wright, PE Staff Engineer Renewable Energy Research Laboratory University of Massachusetts, Amherst A Presentation to Co-op Power Sally Wright, PE Staff Engineer Renewable Energy Research Laboratory

Massachusetts at Amherst, University of

496

SEO ET AL. VOL. XXX ' NO. XX ' 000000 ' XXXX www.acsnano.org  

E-Print Network [OSTI]

SEO ET AL. VOL. XXX ' NO. XX ' 000000 ' XXXX www.acsnano.org A C XXXX American Chemical Society Si Microwire Solar Cells: Improved Efficiency with a Conformal SiO2 Layer Kwanyong Seo,, Young J. Yu, Peter

497

22th International Meeting on org. geochem. The fate of organic matter in mangrove sediments  

E-Print Network [OSTI]

22th International Meeting on org. geochem. The fate of organic matter in mangrove sediments and the unvegetated sediments, and various vascular plants specific to these swamps. An elemental, pyrolytic sediments characterised by great changes in the redox conditions. Several specific results have already been

Boyer, Edmond

498

INTERIOR LIGHTING CASE STUDY For more information, visit PARTNERSHIPDEMONSTRATIONS.ORG  

E-Print Network [OSTI]

INTERIOR LIGHTING CASE STUDY » For more information, visit PARTNERSHIPDEMONSTRATIONS.ORG In 2013 the SPEED team collaborated with UC San Francisco to demonstrate three lighting retrofits of fluorescent the feasibility of adaptive corridor lighting retrofits for sites with different budgets and financing

California at Davis, University of

499

EXTERIOR LIGHTING CASE STUDY For more information, visit PARTNERSHIPDEMONSTRATIONS.ORG  

E-Print Network [OSTI]

EXTERIOR LIGHTING CASE STUDY » For more information, visit PARTNERSHIPDEMONSTRATIONS.ORG In 2013, UC Santa Barbara partnered with the SPEED team to demonstrate network controlled LED lighting sensors. These lighting controls allowed all the units to be incorporated into an adaptive mesh network

California at Davis, University of

500

www.sciencemag.org SCIENCE VOL 337 10 AUGUST 2012 649 POLICYFORUM  

E-Print Network [OSTI]

in water governance (table S2) but lack coor- dination. At the central government level, the Ministrywww.sciencemag.org SCIENCE VOL 337 10 AUGUST 2012 649 POLICYFORUM A water crisis has prompted the Chi- nese government to develop an ambi- tious water conservancy plan. How- ever, the plan may