National Library of Energy BETA

Sample records for agency doc number

  1. Property:NEPA LeadAgencyDocNumber | Open Energy Information

    Open Energy Info (EERE)

    LeadAgencyDocNumber Jump to: navigation, search Property Name NEPA LeadAgencyDocNumber Property Type String This is a property of type String. Pages using the property "NEPA...

  2. Property:NEPA FundingAgencyDocNumber | Open Energy Information

    Open Energy Info (EERE)

    + DOEEA-1676 + N NV-020-03-26 + DE-PS07-02ID14264 + O One Nevada + NA + S Sigurd Red Butte No2 + NA + Retrieved from "http:en.openei.orgwindex.php?titleProperty:NEPAF...

  3. Associate Research Physicist (Post Doc, Experimental Research...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Post Doc, Experimental Research, NSTX-U, Radio Frequency Waves) Department: Research Staff: RM1 Requisition Number: 1500421 The Princeton Plasma Physics Laboratory (PPPL) seeks to...

  4. Number

    Office of Legacy Management (LM)

    ' , /v-i 2 -i 3 -A, This dow'at consists ~f--~-_,_~~~p.~,::, Number -------of.-&--copies, 1 Series.,-a-,-. ! 1 THE UNIVERSITY OF ROCHESTER 1; r-.' L INTRAMURALCORRESPONDENCE i"ks' 3 2.. September 25, 1947 Memo.tor Dr. A. H, Dovdy . From: Dr. H. E, Stokinger Be: Trip Report - Mayvood Chemical Works A trip vas made Nednesday, August 24th vith Messrs. Robert W ilson and George Sprague to the Mayvood Chemical F!orks, Mayvood, New Jersey one of 2 plants in the U.S.A. engaged in the

  5. howtodesignandmarketenergyefficiencyprogramstospecificneighborhoods.doc |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy howtodesignandmarketenergyefficiencyprogramstospecificneighborhoods.doc howtodesignandmarketenergyefficiencyprogramstospecificneighborhoods.doc howtodesignandmarketenergyefficiencyprogramstospecificneighborhoods.doc Microsoft Office document icon howtodesignandmarketenergyefficiencyprogramstospecificneighborhoods.doc More Documents & Publications How to Design and Market Energy Efficiency Programs to Specific Neighborhoods Using Social Media to Engage the Community

  6. Weatherization Beyond the Numbers: Case Studies of Fifteen High-performing Weatherization Agencies - Conducted May 2011 through July 2012

    SciTech Connect (OSTI)

    Tonn, Bruce Edward; Rose, Erin M.; Hawkins, Beth A.

    2014-09-01

    The report presents fifteen individual case studies of high-performing and unique local weatherization agencies. This research was one component of the retrospective evaluation of the U.S. Department of Energy s Weatherization Assistance Program. The agencies were chosen to represent a range of contexts and approaches to weatherization. For example, the set of agencies includes a mix of urban and rural agencies, those that mainly use in-house crews to weatherize homes versus those that use contractor crews, and a mix of locations, from very cold climates to moderate to hot humid and dry climates. The case studies were mainly based on site visits to the agencies that encompassed interviews with program directors, weatherization crews, and recipients of weatherization. This information was supplemented by secondary materials. The cases document the diversity of contexts and challenges faced by the agencies and how they operate on a day-by-day basis. The cases also high common themes found throughout the agencies, such as their focus on mission and respect for their clients.

  7. Microsoft Word - S0130700_Mar 2008Rev June 2008.doc

    Office of Legacy Management (LM)

    Agency Notification Agreements This page intentionally left blank U.S. Department of Energy LTSP for the Falls City, Texas, Disposal Site March 2008 Doc. No. S0130700 Page E-3 LTSP for the Falls City, Texas, Disposal Site U.S. Department of Energy Doc. No. S0130700 March 2008 Page E-4 U.S. Department of Energy LTSP for the Falls City, Texas, Disposal Site March 2008 Doc. No. S0130700 Page E-5 LTSP for the Falls City, Texas, Disposal Site U.S. Department of Energy Doc. No. S0130700 March 2008

  8. finance_programs.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    financeprograms.doc financeprograms.doc financeprograms.doc Microsoft Office document icon financeprograms.doc More Documents & Publications Tools for Designing & Implementing ...

  9. Key Agency Targets Summary _FY 2012_.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    all projects in the capital work plan; and 3) At least 80% of Capital Allocation Board (CAB) approved "major capital investment" projectprogram elements of cost, schedule, and...

  10. Doc...~En.

    Office of Legacy Management (LM)

    ' : ,:#;: .' :.' . ,.:: :,; ..,' ... ..,,..,.... - .~~._ I&i3:scD .::-:, TO-340 .":: ..' . - ' - -. ' . .." ,.. .;.. Very traly yours;, -' .~X :, Doc...~En. ' Br.:Re&ng ';;a' : _, Div. Reading File ., ,, .~, ,.~-

  11. webinar_innovation_financing.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    financing.doc webinarinnovationfinancing.doc webinarinnovationfinancing.doc Microsoft Office document icon webinarinnovationfinancing.doc More Documents & Publications...

  12. webinar_innovation_planning_zoning.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    planningzoning.doc webinarinnovationplanningzoning.doc webinarinnovationplanningzoning.doc Microsoft Office document icon webinarinnovationplanningzoning.doc More...

  13. webinar_innovation_net_metering_interconnection.doc | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    netmeteringinterconnection.doc webinarinnovationnetmeteringinterconnection.doc webinarinnovationnetmeteringinterconnection.doc Microsoft Office document icon...

  14. webinar_innovation_organizing_strategizing.doc | Department of...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    organizingstrategizing.doc webinarinnovationorganizingstrategizing.doc webinarinnovationorganizingstrategizing.doc Microsoft Office document icon webinarinnovationorganizi...

  15. webinar_innovation_permitting_inspections.doc | Department of...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    permittinginspections.doc webinarinnovationpermittinginspections.doc webinarinnovationpermittinginspections.doc Microsoft Office document icon webinarinnovationpermitting...

  16. fed_finance_facilities_ee_upgrades_deployment.doc | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    fedfinancefacilitieseeupgradesdeployment.doc fedfinancefacilitieseeupgradesdeployment.doc fedfinancefacilitieseeupgradesdeployment.doc Microsoft Office document icon ...

  17. interiorlightingefficiencyformunicipalities.doc | Department of Energy

    Broader source: Energy.gov (indexed) [DOE]

    interiorlightingefficiencyformunicipalities.doc Microsoft Office document icon interiorlightingefficiencyformunicipalities.doc More Documents & Publications Interior Lighting Efficiency for Municipalities States & Emerging Energy Technologies stateandemergingtechnologies.doc

  18. Doc.~:Ru.

    Office of Legacy Management (LM)

    .' , .' c,j .c; Distriblition:~ ;. <; ~..,:L.D.i&%.ay,FiN-OR00 Doc.~:Ru. ,.,. 75. ' Br..Reading 'ire' ,lliv. Read&q File ,: '. ~ ,, .-' . ...: - SURNAME..

  19. Agency Sub-

    Office of Environmental Management (EM)

    Report as of March 2016 Agency Sub- agency Title Of Initiative/Rule or ICR RIN/OMB Control Number Summary of Initiative Status of Initiative -- New to this update, Ongoing, or Completed Target Completion Date (if completed, please add the publication date and cite in Federal Register for example) Does the Initiative include regulatory flexibilities such as pilot projects, safe harbor exemptions, sunset provisions, trigger provisions, streamlined requirements, state flexibilities, or other

  20. Agency Sub-

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    February 2015 Agency Sub- agency Title Of Initiative/Rule or ICR RIN/OMB Control Number Summary of Initiative Status of Initiative -- New to this update, Ongoing, or Completed Target Completion Date (if completed, please add the publication date and cite in Federal Register for example) Does the Initiative include regulatory flexibilities such as pilot projects, safe harbor exemptions, sunset provisions, trigger provisions, streamlined requirements, state flexibilities, or other similar

  1. Microsoft Word - BreakoutSummary.doc

    Office of Environmental Management (EM)

    H:/TECWG/January 2002/Breakout Worksheets.doc *The number appearing in brackets refer to the number of participants with the same comment. 1. On a scale of 1 (lowest) to 10 (highest), how would you rate TEC's effectiveness relative to other comparable organizations? Average score = 7.51 2. The TEC mission is to "serve as a mechanism to provide continuing and improved coordination between appropriate DOE elements, other levels of government, and outside organizations having a responsibility

  2. Microsoft Word - ContractManagementPlanningDRIVERS.doc | Department...

    Broader source: Energy.gov (indexed) [DOE]

    ContractManagementPlanningDRIVERS.doc More Documents & Publications Microsoft Word - ARRAAttachment2.doc Microsoft Word - ARRAModelWAS.doc Microsoft Word - ARRAMOModelMod.doc...

  3. transcript_pv_mapper.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    transcriptpvmapper.doc transcriptpvmapper.doc transcriptpvmapper.doc transcriptpvmapper.doc More Documents & Publications PVMapper: A Tool for Energy Siting...

  4. Microsoft Word - aser_rev0.doc

    Office of Legacy Management (LM)

    Weiss Associates Environmental Science, Engineering and Management ANNUAL SITE ENVIRONMENTAL REPORT CALENDAR YEAR 2007 for the LABORATORY FOR ENERGY-RELATED HEALTH RESEARCH UNIVERSITY OF CALIFORNIA, DAVIS Submitted to: S.M. Stoller Corporation 2597 B ¾ Road Grand Junction, Colorado 81503 Prepared by: Weiss Associates 5801 Christie Avenue, Suite 600 Emeryville, California 94608-1827 September 30, 2008 Rev. 0 J:\DOE_STOLLER\4110\137\ASER 2007\REV. 0\ASER_REV0.DOC WEISS ASSOCIATES Project Number:

  5. raising_investment_funds_for_clean_energy_programs.doc | Department...

    Broader source: Energy.gov (indexed) [DOE]

    raisinginvestmentfundsforcleanenergyprograms.doc raisinginvestmentfundsforcleanenergyprograms.doc More Documents & Publications Raising Investment Funds for Clean...

  6. spurring_local_economic_development_clean_energy_programs.doc...

    Broader source: Energy.gov (indexed) [DOE]

    spurringlocaleconomicdevelopmentcleanenergyprograms.doc spurringlocaleconomicdevelopmentcleanenergyprograms.doc More Documents & Publications Spurring Local Economic...

  7. Category:NEPA Doc | Open Energy Information

    Open Energy Info (EERE)

    NEPA Doc Jump to: navigation, search GEOTHERMAL ENERGYGeothermal Home Category: NEPA Documents Collections Add.png Add a new NEPA Document Collection Pages in category "NEPA Doc"...

  8. exploringpowerpurchaseagreementsthebasicspart1.doc | Department of Energy

    Broader source: Energy.gov (indexed) [DOE]

    exploringpowerpurchaseagreementsthebasicspart1.doc Microsoft Office document icon exploringpowerpurchaseagreementsthebasicspart1.doc More Documents & Publications Exploring Power Purchase Agreements - The Basics Part 1

  9. Microsoft Word - AL2006-02.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    2.doc Microsoft Word - AL2006-02.doc PDF icon Microsoft Word - AL2006-02.doc More Documents & Publications Microsoft Word - AL2006-03.doc Archived Financial Assistance Letters Microsoft Word - FAL2006-04.doc

  10. Microsoft Word - AL2008-06.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AL2008-06.doc Microsoft Word - AL2008-06.doc PDF icon Microsoft Word - AL2008-06.doc More Documents & Publications Chapter 9 - Contracting Qualifications Microsoft Word - PART 970.doc Microsoft Word - Matrixpart2.doc

  11. Microsoft Word - 98-11.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    8-11.doc Microsoft Word - 98-11.doc PDF icon Microsoft Word - 98-11.doc More Documents & Publications Microsoft Word - AL2006-08.doc Microsoft Word - AL2005-01.doc Microsoft Word -...

  12. Reporting Guidance for Federal Agency Annual Report on Energy...

    Broader source: Energy.gov (indexed) [DOE]

    factors for that period. It is only to be completed if an agency discovers an error in a previously reported annual data prior to FY 2008. 2015reportingrequirements.doc...

  13. Advanced Research Projects Agency - Energy Program Specific Recovery Plan

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    | Department of Energy Research Projects Agency - Energy Program Specific Recovery Plan Advanced Research Projects Agency - Energy Program Specific Recovery Plan PDF icon Microsoft Word - 44F1801D.doc More Documents & Publications Microsoft Word - PSRP Updates 6-25-10_v2 Advanced Research Projects Agency -EnergyDepartment Audit Report: OAS-RA-11-11

  14. Microsoft Word - Rev5functionalaccountabilityimplementationplan..doc |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy Rev5functionalaccountabilityimplementationplan..doc Microsoft Word - Rev5functionalaccountabilityimplementationplan..doc PDF icon Microsoft Word - Rev5functionalaccountabilityimplementationplan..doc More Documents & Publications Microsoft Word - AL2007-01.doc module 4 Chapter 71 - Review and Approval of Contract and Financial Assistance Actions

  15. deepenergyretrofitsandstateapplications.doc | Department of Energy

    Energy Savers [EERE]

    deepenergyretrofitsandstateapplications.doc deepenergyretrofitsandstateapplications.doc deepenergyretrofitsandstateapplications.doc Microsoft Office document icon deepenergyretrofitsandstateapplications.doc More Documents & Publications Deep Energy Retrofits & State Applications Sustainable Energy Resources for Consumers Webinar on Residential Geothermal Heat Pump Retrofit Transcript Interior Lighting Efficiency for Municipalities

  16. TentativeAgreement.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Iani, Region 10 Administrator U.S. Environmental Protection Agency CC: R. Jim, YN P. Sobotta, NPT K. Niles, Oregon Energy W. J. Taylor, ORP R. Gay, CTUIR J. H. Swailes, ORP L....

  17. Microsoft Word - SpecialTermsandConditions0506.doc | Department...

    Energy Savers [EERE]

    Microsoft Word - SpecialTermsandConditions0506.doc Microsoft Word - SpecialTermsandConditions0506.doc Microsoft Word - SpecialTermsandConditions0506.doc More Documents &...

  18. Microsoft Word - FY2005finaliparhandbook.doc | Department of...

    Energy Savers [EERE]

    Microsoft Word - FY2005finaliparhandbook.doc Microsoft Word - FY2005finaliparhandbook.doc Microsoft Word - FY2005finaliparhandbook.doc More Documents & Publications...

  19. Microsoft Word - ARRAAttachment2.doc | Department of Energy

    Office of Environmental Management (EM)

    ARRAAttachment2.doc Microsoft Word - ARRAAttachment2.doc More Documents & Publications Microsoft Word - ARRAAttachment12v1.doc Microsoft Word - ARRAAttachment3.rtf Microsoft Word -...

  20. Microsoft Word - ARRAMOModelMod.doc | Department of Energy

    Energy Savers [EERE]

    ARRAMOModelMod.doc Microsoft Word - ARRAMOModelMod.doc More Documents & Publications Microsoft Word - ARRAAttachment2.doc Microsoft Word - ARRAModelWAS...

  1. Microsoft Word - ARRAModelWAS.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ARRAModelWAS.doc Microsoft Word - ARRAModelWAS.doc More Documents & Publications Microsoft Word - ARRAAttachment2.doc Microsoft Word - ARRAMOModelMod...

  2. Microsoft Word - August06.doc | Department of Energy

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    August06.doc Microsoft Word - August06.doc PDF icon Microsoft Word - August06.doc More Documents & Publications Microsoft Word - April

  3. Microsoft Word - Flash2007-43.doc | Department of Energy

    Office of Environmental Management (EM)

    43.doc Microsoft Word - Flash2007-43.doc Microsoft Word - Flash2007-43.doc More Documents & Publications Microsoft Word - Policy Flash 2008-07.doc Microsoft Word - Policy Flash...

  4. Microsoft Word - AL2006-01.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    1.doc Microsoft Word - AL2006-01.doc PDF icon Microsoft Word - AL2006-01.doc More Documents & Publications Microsoft Word - al2005-06.doc Chapter 19 - Small Business Programs OPAM Policy Acquisition Guides

  5. Microsoft Word - AL2005-10.doc | Department of Energy

    Office of Environmental Management (EM)

    10.doc Microsoft Word - AL2005-10.doc PDF icon Microsoft Word - AL2005-10.doc More Documents & Publications Microsoft Word - AL2005-16.doc Audit Report: IG-0860 Microsoft Word - AL2006-08

  6. Microsoft Word - Matrixpart1.doc | Department of Energy

    Broader source: Energy.gov (indexed) [DOE]

    Matrixpart1.doc More Documents & Publications Part 1, Clauses Prescribed in FAR Part 52 Microsoft Word - Matrixpart2.doc...

  7. csep_transcript_arlington.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Office document icon cseptranscriptarlington.doc More Documents & Publications Tools for Designing & Implementing Better Finance Programs financeprograms.doc financeprograms

  8. Microsoft Word - AL2002-03.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    2-03.doc Microsoft Word - AL2002-03.doc PDF icon Microsoft Word - AL2002-03.doc More Documents & Publications Microsoft Word - AL2005-01.doc Microsoft Word - FAL2004-01.doc Microsoft Word - ARRAAttachment12v1.doc

  9. Microsoft Word - AL2005-14.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    4.doc Microsoft Word - AL2005-14.doc PDF icon Microsoft Word - AL2005-14.doc More Documents & Publications Microsoft Word - AL-Omnibus FY 2009 Apr 22 2009 all sections.doc Microsoft Word - AL-Consolidated Approps FY 2008 as of feb 21 2008 final.doc Microsoft Word - AL2006-08.doc

  10. Microsoft Word - AL2007-01.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AL2007-01.doc Microsoft Word - AL2007-01.doc PDF icon Microsoft Word - AL2007-01.doc More Documents & Publications Microsoft Word - Rev5functionalaccountabilityimplementationplan..doc Microsoft Word - Corp Impl 10-05-06.final.doc Microsoft Word - AL2006-11.doc

  11. csep_transcript_aspen.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    aspen.doc csep_transcript_aspen.doc csep_transcript_aspen.doc Microsoft Office document icon csep_transcript_aspen.doc More Documents & Publications highperformanceleasingstrategiesforstateandlocalgovernments.doc Using Social Media to Engage the Community in Energy Efficiency Projects.doc webinar_innovation_permitting_inspections

  12. csep_transcript_minneapolis.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    minneapolis.doc csep_transcript_minneapolis.doc csep_transcript_minneapolis.doc Microsoft Office document icon csep_transcript_minneapolis.doc More Documents & Publications newguideforcommunityenergystrategicplanning.doc csep_transcript_aspen.doc Marketing & Driving Demand: Social Media Tools & Strategies - January 16, 2011 (Text Version)

  13. Microsoft Word - FWP- Fact Sheet.doc | Department of Energy

    Office of Environmental Management (EM)

    FWP- Fact Sheet.doc Microsoft Word - FWP- Fact Sheet.doc PDF icon Microsoft Word - FWP- Fact Sheet.doc More Documents & Publications Microsoft Word - FOA cover sheet.doc Microsoft Word - Fact Sheet Energy Speech 082508 FINAL.doc Microsoft Word - ARRAAttachment12v1.doc

  14. titlepg.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    7 (Released October 8, 1997) Energy Information Administration DOE/EIA-0202(97/4Q) Distribution Category UC-950 Short-Term Energy Outlook Quarterly Projections Fourth Quarter 1997 Energy Information Administration Office of Energy Markets and End Use U.S. Department of Energy Washington, DC 20585 This report was prepared by the Energy Information Administration, the independent statistical and analytical agency within the Department of Energy. The information contained herein should not be

  15. Environmental Records.doc

    Office of Environmental Management (EM)

    LIST OF TERMS ALARA as low as reasonably achievable CAA Clean Air Act CEQ Council on Environmental Quality CERCLA Comprehensive Environmental Response, Compensation, and Liability Act CFR Code of Federal Regulations CX categorical exclusion DOE U.S. Department of Energy EA environmental assessment ECL environmental checklist EIS environmental impact statement EPA U.S. Environmental Protection Agency EPCRA Emergency Planning and Community Right-To-Know Act of 1986 FFA&CO Federal Facility

  16. Microsoft Word - ITSI award doc 06-D0008 conformed to P00001.doc |

    Office of Environmental Management (EM)

    Department of Energy ITSI award doc 06-D0008 conformed to P00001.doc Microsoft Word - ITSI award doc 06-D0008 conformed to P00001.doc More Documents & Publications Policy Flash 2015-02 Acquisition Letter No. AL 2015-01R - 06/01/2015 FOA 148 Amendment

  17. Ammendment 2.doc | Department of Energy

    Broader source: Energy.gov (indexed) [DOE]

    Ammendment 2.doc More Documents & Publications Attachment 6 Volume V Pricing Matrix for Optional Enhancements.xls&0; RFQ DE-RQ01-04ME90001.doc&0; Attachment 3-Past Performance...

  18. Microsoft Word - S06401_IC.doc

    Office of Legacy Management (LM)

    0 Doc. No. S06401 Page B-1 Annual Assessment of the Effectiveness of Site-Wide Institutional Controls U.S. Department of Energy Doc. No. S06401 June 2010 Page B-2 U.S. Department of Energy Annual Assessment of the Effectiveness of Site-Wide Institutional Controls June 2010 Doc. No. S06401 Page B-3 Annual Assessment of the Effectiveness of Site-Wide Institutional Controls U.S. Department of Energy Doc. No. S06401 June 2010

  19. Flash2007-33DomesticDeliveryParticipatingAgencies.doc

    Energy Savers [EERE]

    Securities and Exchange Commission 900,500.00 13 Department of TransportationFederal Motor Carrier Safety Administration 252,027.08 14 Pension Benefit Guaranty Corporation ...

  20. Microsoft Word - FOIA NOT AGENCY RECORD RESPONSE.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    April 11, 2013 CERTIFIED MAIL Mr. Ryan Henry Law Offices of Ryan Henry, P.L.L.C. 1380 Pantheon Way, Suite 215 San Antonio, Texas 78232 Dear Mr. Henry: FREEDOM OF INFORMATION ACT REQUEST (FOI 2013-00782) This letter is in response to your electronic Freedom of Information Act (FOIA) request that you sent to the Department of Energy (DOE), Richland Operations Office (RL) requesting documents relating to the jobs performed by Dritherm International, Inc., from January 1, 1995, to present, including

  1. Index2.doc | Department of Energy

    Energy Savers [EERE]

    Index2.doc Index2.doc PDF icon Index2.doc More Documents & Publications Sylvania Corporation, Hicksville, NY and Bayside, NY - Addendum to July 8, 2004 O:\HOMEPAGE\FOIA\report99.PDF&#0; U.S. Department of Energy 2004 Annual Report

  2. SubcontractingGuidelines.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    SubcontractingGuidelines.doc&#0; SubcontractingGuidelines.doc&#0; PDF icon SubcontractingGuidelines.doc&#0; More Documents & Publications Guidance of the Department of Energy Subcontracting Program Chapter 19 - Small Business Programs Business Opportunity Session Materials - December 14, 2011, Chicago

  3. SPDWRAP#1.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Please notify Aon Hewitt's Your Benefit Resources (YBR) in Appendix G to update your personal information, such as your home address and home telephone number. 2. Eligibility...

  4. Habadv-119.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    9 Subject: B Reactor Engineering Evaluation and Cost Analysis Adopted: June 8, 2001 Page 1 June 8, 2001 Keith Klein, Manager U.S. Department of Energy, Richland Operations P.O. Box 550 (A7-50) Richland, WA 99352 Chuck Findley, Acting Regional Administrator U.S. Environmental Protection Agency, Region 10 1200 Sixth Avenue Seattle, WA 98101 Tom Fitzsimmons, Director Washington Department of Ecology P.O. Box 47600 Olympia, WA 98504-7600 Re: B Reactor Engineering Evaluation and Cost Analysis Dear

  5. HABAdv#1671.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    6 Subject: U Plant Closure Plan Adopted: September 10, 2004 Page 1 September 10, 2004 Keith Klein, Manager U.S. Department of Energy, Richland Operations P.O. Box 550 (A7-50) Richland, WA 99352 Linda Hoffman, Director Washington State Department of Ecology P.O. Box 47600 Olympia, WA 98504-7600 Ron Kreizeneeck, Acting Regional Administrator U.S. Environmental Protection Agency, Region 10 1200 Sixth Avenue Seattle, WA 98101 Subject: U Plant Closure Plan Dear Mssrs. Klein, Kreizeneeck, and Ms.

  6. Fonsi.Leo.DOC

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AGENCY: U.S. Department of Energy ACTION: Finding of No Significant Impact SUMMARY: The U.S. Department of Energy (DOE) has prepared an Environmental Assessment (EA), DOE/EA-1319, to assess environmental impacts associated with the disposition of surplus Hanford Site uranium. DOE has identified 1,866 metric tons of uranium (MTU) on the Hanford Site as surplus. As of late calendar year 1999, the predominant amount of approximately 1,700 MTU [1,866 MTU minus 140 MTU (135 MTU of contaminated fuel

  7. AL2007-03.doc

    Broader source: Energy.gov (indexed) [DOE]

    from GAO and Inspector General (IG) reports of other federal agencies. Introduction The IA relationship involves two Federal agencies that enter into a relationship for the...

  8. U0083900.doc

    Office of Legacy Management (LM)

    GJO-2002-304-TAR MAC-GWTUB 11.11.2 Plan for Injection of Treated Ground Water at the Tuba City, Arizona, UMTRA Project Site March 2002 Prepared by U. S. Department of Energy Grand Junction Office Grand Junction, Colorado Project Number UGW-511-0023-17-000 Document Number U0083900 Work Performed Under DOE Contract No. DE-AC13-96GJ87335 Document Number U0083900 DOE/Grand Junction Office Plan for Injection of Treated Ground Water at the Tuba City UMTRA Site March 2002 Page 1 Introduction This plan

  9. N0057000.doc

    Office of Legacy Management (LM)

    000 GJO- 2002-380- TAC GJO-PIN 13.5.1-1 Pinellas Environmental Restoration Project Northeast Site Non-Aqueous Phase Liquids Interim Measures Progress Report July through September 2002 October 2002 Prepared by U.S. Department of Energy Grand Junction Office Grand Junction, Colorado Work Performed Under DOE Contract Number DE-AC13-02GJ79491 Task Order Number ST03-107 Document Number N0057000 Contents DOE/Grand Junction Office Northeast Site NAPL Interim Measures Progress Report October 2002 Page

  10. Utah Municipal Power Agency | Open Energy Information

    Open Energy Info (EERE)

    Municipal Power Agency Place: Utah Phone Number: (801) 798-7489 Website: www.umpa.cc Facebook: https:www.facebook.compagesUtah-Municipal-Power-Agency152219714819535 Outage...

  11. Microsoft Word - 1938.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    personal information is revealed in a LANS record: Education, salary, medical history, employment history, social security number, date and place of birth, or mother's maiden name. Form 1938 (3/14) Page 1 of 3 Form 1938 Universal Beneficiary Designation/Change Form Instructions: The information on this form will replace any prior beneficiary designation. You may name anyone or any entity as your beneficiary and you may change your beneficiary at any time by completing a new Universal Beneficiary

  12. U0174100.doc

    Office of Legacy Management (LM)

    4100 DOE/EA-1452 Environmental Assessment of Ground Water Compliance at the Durango, Colorado, UMTRA Project Site Final November 2002 Prepared by U.S. Department of Energy Grand Junction Office Grand Junctio n, Colorado Work Performed Under DOE Contract Number DE-AC13-02GJ79491 DOE Grand Junction Office EA of Ground Water Compliance at the Durango Site November 2002 Final Page iii Contents Page Acronyms and Abbreviations

  13. AcqGuide38pt1.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    8pt1.doc&#0; AcqGuide38pt1.doc&#0; PDF icon AcqGuide38pt1.doc&#0; More Documents & Publications Microsoft Word - AcqGuide38pt Nov 2010 Microsoft Word - AL2005-05Revised.doc AL2007-03.doc&#0;

  14. AcqGuide41pt1.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    1pt1.doc&#0; AcqGuide41pt1.doc&#0; PDF icon AcqGuide41pt1.doc&#0; More Documents & Publications Chapter 41 - Acquisition of Utility Services AcqGuide70pt28.doc&#0; AcqGuide9pt1.doc&#0;

  15. Microsoft Word - AL2000-05.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    .doc Microsoft Word - AL2000-05.doc PDF icon Microsoft Word - AL2000-05.doc More Documents & Publications al99-06.doc&#0; Microsoft Word - AL2000-05Attachment.doc AL2004-01r2.pdf

  16. Microsoft Word - AL2004-02.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    4-02.doc Microsoft Word - AL2004-02.doc PDF icon Microsoft Word - AL2004-02.doc More Documents & Publications Microsoft Word - AL2005-02.doc Microsoft Word - al2005-04.doc Microsoft Word - AL-Omnibus FY 2009 Apr 22 2009 all sections

  17. Microsoft Word - AL2005-02.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    5-02.doc Microsoft Word - AL2005-02.doc PDF icon Microsoft Word - AL2005-02.doc More Documents & Publications Microsoft Word - AL-Omnibus FY 2009 Apr 22 2009 all sections.doc Microsoft Word - AL2004-02.doc Microsoft Word - AL-Consolidated Approps FY 2008 as of feb 21 2008 final

  18. Microsoft Word - AL2005-03.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    3.doc Microsoft Word - AL2005-03.doc PDF icon Microsoft Word - AL2005-03.doc More Documents & Publications Microsoft Word - AL2005-01.doc Microsoft Word - AL2006-08.doc Microsoft Word - Chapter 10_2006_Jun

  19. Microsoft Word - FAL2004-01.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    1.doc Microsoft Word - FAL2004-01.doc PDF icon Microsoft Word - FAL2004-01.doc More Documents & Publications Microsoft Word - FAL2004-03.doc Microsoft Word - FAL2004-02.doc Microsoft Word - FAL2003-03R

  20. csep_transcript_transportation.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    transportation.doc csep_transcript_transportation.doc csep_transcript_transportation.doc Microsoft Office document icon csep_transcript_transportation.doc More Documents & Publications csep_transcript_minneapolis.doc Marketing & Driving Demand: Social Media Tools & Strategies - January 16, 2011 (Text Version) Transcript: Biomass Clean Cities Webinar - Workforce Development

  1. Engaging Financial Institution Partners Transcript.doc | Department of

    Office of Environmental Management (EM)

    Energy Engaging Financial Institution Partners Transcript.doc Engaging Financial Institution Partners Transcript.doc Engaging Financial Institution Partners Transcript.doc Microsoft Office document icon Engaging Financial Institution Partners Transcript.doc More Documents & Publications Engaging Financial Institution Partners Transcript.doc Engaging Financial Institution Partners Case Studies-Financing Energy Improvements on Utility Bills

  2. Microsoft Word - PeerReview_SAR.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    SAR.doc Microsoft Word - PeerReview_SAR.doc PDF icon Microsoft Word - PeerReview_SAR.doc More Documents & Publications Microsoft Word - PeerReview_CCSP.doc Microsoft Word - Cross Reference Matrix Introduction.doc Assessment of the Effects of Climate Change on Federal Hydropower

  3. AL2007-05.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    7-05.doc&#0; AL2007-05.doc&#0; PDF icon AL2007-05.doc&#0; More Documents & Publications Microsoft Word - AL2006-08.doc Department of Energy Microsoft Word - AL2006-10.doc

  4. Microsoft Word - AL2005-01.doc | Department of Energy

    Office of Environmental Management (EM)

    1.doc Microsoft Word - AL2005-01.doc PDF icon Microsoft Word - AL2005-01.doc More Documents & Publications Microsoft Word - AL2006-08.doc Acquisition Letter Archive listing AL2007-05.doc&#0;

  5. Microsoft Word - AL2006-08.doc | Department of Energy

    Office of Environmental Management (EM)

    6-08.doc Microsoft Word - AL2006-08.doc PDF icon Microsoft Word - AL2006-08.doc More Documents & Publications AL2007-05.doc&#0; Microsoft Word - AL2005-14.doc Microsoft Word - AL2006-03

  6. Microsoft Word - FAL2004-03.doc | Department of Energy

    Office of Environmental Management (EM)

    FAL2004-03.doc Microsoft Word - FAL2004-03.doc PDF icon Microsoft Word - FAL2004-03.doc More Documents & Publications Microsoft Word - FAL2004-01.doc Financial Assistance Letters No. FAL 2006-04 Microsoft Word - FAL2006-04.doc

  7. Microsoft Word - toc.doc

    Office of Legacy Management (LM)

    I Ground Water Management Policy for the MMTS and Adjacent Areas U n c o n t r o l l e d c o p y U.S. Department of Energy Long-Term Surveillance and Maintenance Plan for the Monticello NPL Sites Rev. 0 Doc. No. S0038700 Rev. Date: June 25, 2007 Page I-3 U n c o n t r o l l e d c o p y Long-Term Surveillance and Maintenance Plan for the Monticello NPL Sites U.S. Department of Energy Doc. No. S0038700 Rev. 0 Page I-4 Rev. Date: June 25, 2007 U n c o n t r o l l e d c o p y U.S. Department of

  8. Microsoft Word - Appendix F_OfficialContactList.doc

    Office of Legacy Management (LM)

    Official Contact List U.S. Department of Energy Weldon Spring Site LTS&M Plan July 2005 Doc. No. S0079000 Page F-3 Long-Term Surveillance and Maintenance Emergency Contact List Environmental Protection Agency Mr. Dan Wall Remedial Project Manager Superfund Division U.S. EPA Region 7 901 North 5 th Street Kansas City, Kansas 66101 (913) 551-7710 Missouri Department of Natural Resources Mr. Robert Geller Chief, Federal Facilities Section Missouri Department of Natural Resources 1738 East Elm

  9. Microsoft Word - toc.doc

    Office of Legacy Management (LM)

    J Ground Water Remedy Performance Evaluation Plan U n c o n t r o l l e d c o p y U.S. Department of Energy Long-Term Surveillance and Maintenance Plan for Monticello NPL Sites Rev. 0 Doc. No. S0038700 Rev. Date: June 25, 2007 Page iii Contents Page J1.0 Plan Objective..................................................................................................................J-1 J2.0 Monitored Natural Attenuation Performance Evaluation Method...................................J-1 J2.1

  10. 3010DLFinal.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    0 Core Status: new users must complete 2 trouble-free training sessions and pass a sample exchange exam to work independently during Core sessions. Flex Status: core users must complete 4 "trouble-free" sessions and pass a driving test to work independently during Flex sessions To reserve a 3010 session, go to www/ncem.lbl.gov, click on "Microscope Scheduling", use proposal number and password to log in. You may only sign up for 2 Core sessions and 1 Flex session at a time.

  11. Nov08.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    8 ANL/EVS/NL-08-11 Technical Contact: Brad W. Orr Phone: 630-252-8665 Email: brad.orr@anl.gov Editor: Donna J. Holdridge Contributor: Lynne Roeder Website: http://www.arm.gov ACRF Southern Great Plains Newsletter is published by Argonne National Laboratory, managed by UChicago Argonne, LLC, for the U.S. Department of Energy under contract number DE-AC02-06CH11357. Site Operations Centralized Through New Tracking System With more than 300 instrument systems operating at remote sites around the

  12. Dec08.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    8 ANL/EVS/NL-08-12 Technical Contact: Brad W. Orr Phone: 630-252-8665 Email: brad.orr@anl.gov Editor: Donna J. Holdridge Contributor: Lynne Roeder Website: http://www.arm.gov ACRF Southern Great Plains Newsletter is published by Argonne National Laboratory, managed by UChicago Argonne, LLC, for the U.S. Department of Energy under contract number DE-AC02-06CH11357. AMF2 Team Surveys Storm Peak Area The U.S. Department of Energy recently announced the initial deployment of the second ARM Mobile

  13. Feb09.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    9 ANL/EVS/NL-09-02 Technical Contact: Brad W. Orr Phone: 630-252-8665 Email: brad.orr@anl.gov Editor: Donna J. Holdridge Contributor: Lynne Roeder Website: http://www.arm.gov ACRF Southern Great Plains Newsletter is published by Argonne National Laboratory, managed by UChicago Argonne, LLC, for the U.S. Department of Energy under contract number DE-AC02-06CH11357. Radiometers Used to Close Gap in Climate Models In late January, scientists initiated a five-month field campaign involving routine

  14. Jan09.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    9 ANL/EVS/NL-09-01 Technical Contact: Brad W. Orr Phone: 630-252-8665 Email: brad.orr@anl.gov Editor: Donna J. Holdridge Contributor: Lynne Roeder Website: http://www.arm.gov ACRF Southern Great Plains Newsletter is published by Argonne National Laboratory, managed by UChicago Argonne, LLC, for the U.S. Department of Energy under contract number DE-AC02-06CH11357. Routine AVP Clouds with Low Optical Water Depths (CLOWD) Optical Radiative Observations (RACORO) Field Campaign Scheduled at SGP

  15. June08.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    8 ANL/EVS/NL-08-06 Technical Contact: Brad W. Orr Phone: 630-252-8665 Email: brad.orr@anl.gov Editor: Donna J. Holdridge Contributor: Lynne Roeder Website: http://www.arm.gov ACRF Southern Great Plains Newsletter is published by Argonne National Laboratory, managed by UChicago Argonne, LLC, for the U.S. Department of Energy under contract number DE-AC02-06CH11357. Interagency Effort Will Measure Carbon Dioxide Profiles Beginning in June, the ARM Climate Research Facility (ACRF) is supporting an

  16. May08.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    May 2008 ANL/EVS/NL-08-05 Technical Contact: Brad W. Orr Phone: 630-252-8665 Email: brad.orr@anl.gov Editor: Donna J. Holdridge Contributor: Lynne Roeder Website: http://www.arm.gov ACRF Southern Great Plains Newsletter is published by Argonne National Laboratory, managed by UChicago Argonne, LLC, for the U.S. Department of Energy under contract number DE-AC02-06CH11357. Cloud Radars at the Southern Great Plains Site The flip of a switch in February solved a dilemma in detection of cirrus clouds

  17. Edwin Parks (Doc) | Department of Energy

    Energy Savers [EERE]

    Edwin Parks (Doc) About Us Edwin Parks (Doc) Team Leader, Archives and Information Management Team Dr. Ed "Doc" Parks joined the Office of Legacy Management in September 2010, as a Program Analyst in the Records Management program. He provided ongoing analytical support for records and information programs, policies, procedures, plans, cost, and operational analyses. He now serves as LM's Program Records Official, the Authorizing Official and federal official accountable for the risk

  18. Property:NEPA TieredDoc | Open Energy Information

    Open Energy Info (EERE)

    TieredDoc Jump to: navigation, search Property Name NEPA TieredDoc Property Type Page This is a property of type Page. Pages using the property "NEPA TieredDoc" Showing 25 pages...

  19. Microsoft Word - AL2005-08.doc | Department of Energy

    Office of Environmental Management (EM)

    8.doc Microsoft Word - AL2005-08.doc Microsoft Word - AL2005-08.doc More Documents & Publications OPAM Policy Acquisition Guides Attachment FY2011-28 OPAM Microsoft Word -...

  20. Microsoft Word - FAC2005-19.doc | Department of Energy

    Office of Environmental Management (EM)

    FAC2005-19.doc Microsoft Word - FAC2005-19.doc Microsoft Word - FAC2005-19.doc More Documents & Publications Acquisitlon Letter No. AL 2008-06 AL2008-06.pdf fac2001-27.pdf...

  1. Microsoft Word - FAL2004-05.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Microsoft Word - FAL2004-05.doc Microsoft Word - FAL2004-05.doc Microsoft Word - FAL2004-05.doc More Documents & Publications Archived Financial Assistance Letters Microsoft Word -...

  2. Microsoft Word - FORM46002.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    2.doc Microsoft Word - FORM46002.doc Microsoft Word - FORM46002.doc More Documents & Publications DOE F 4600.2 ATTACHMENT FLASH 2011-46(6) Attachment FY2011-63 OPAM...

  3. Microsoft Word - AL2008-05.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Microsoft Word - AL2008-05.doc Microsoft Word - AL2008-05.doc Microsoft Word - AL2008-05.doc More Documents & Publications Microsoft Word - AL 2010-07 Acquistion Letters Remaining...

  4. Microsoft Word - AL2006-07.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    7.doc Microsoft Word - AL2006-07.doc PDF icon Microsoft Word - AL2006-07.doc More Documents & Publications OPAM Policy Acquisition Guides Personal Property Management Certification Brochure Microsoft Word - AL2005-07

  5. Microsoft Word - AL2008-05.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    8-05.doc Microsoft Word - AL2008-05.doc PDF icon Microsoft Word - AL2008-05.doc More Documents & Publications Department of Energy OPAM Policy Acquisition Guides Microsoft PowerPoint - Executive Order13423rbl

  6. Microsoft Word - May2009.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    May2009.doc Microsoft Word - May2009.doc PDF icon Microsoft Word - May2009.doc More Documents & Publications Special Resource Study/Environmental Assessment for Manhattan Project Sites, DOE/EA-1868 (September 2010) Microsoft Word - April06

  7. DOC-DOE Joint China Mission Statement | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Joint China Mission Statement DOC-DOE Joint China Mission Statement DOC-DOE Joint China Mission Statement PDF icon DOC-DOE Joint China Mission Statement More Documents &...

  8. Microsoft Word - al2006-12.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    al2006-12.doc Microsoft Word - al2006-12.doc PDF icon Microsoft Word - al2006-12.doc More Documents & Publications Department of Energy Special Report: DOE/IG-0934

  9. Microsoft Word - al95-06.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    06.doc Microsoft Word - al95-06.doc PDF icon Microsoft Word - al95-06.doc More Documents & Publications ppl970-1.pdf Audit Report: IG-0589 Inspection Report: INS-O-02-01

  10. Microsoft Word - CMPTemplate031307.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    CMPTemplate031307.doc Microsoft Word - CMPTemplate031307.doc PDF icon Microsoft Word - CMPTemplate031307.doc More Documents & Publications Chapter 42 - Contract Administration Chapter 71 - Review and Approval of Contract and Financial Assistance Actions Chapter 43 - Contract Modifications

  11. Operating Guidelines Appendix C D.DOC | Department of Energy

    Energy Savers [EERE]

    Operating Guidelines Appendix C D.DOC&0; Operating Guidelines Appendix C D.DOC&0; PDF icon Operating Guidelines Appendix C D.DOC&0; More Documents & Publications Operating...

  12. Microsoft Word - April06.doc | Department of Energy

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    April06.doc Microsoft Word - April06.doc PDF icon Microsoft Word - April06.doc More Documents & Publications Secretary Directs FPO to Prepare Strategic Plan Microsoft Word - August

  13. Microsoft Word - AL2006-11.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AL2006-11.doc Microsoft Word - AL2006-11.doc PDF icon Microsoft Word - AL2006-11.doc More Documents & Publications Subject: Cost and Price Analysis Subject: Cost and Price Analysis...

  14. Microsoft Word - GJPPGPracticesDraft.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    GJPPGPracticesDraft.doc Microsoft Word - GJPPGPracticesDraft.doc PDF icon Microsoft Word - GJPPGPracticesDraft.doc More Documents & Publications 1 DOE Purchase Card Policy Natural Oils - The Next Generation of Diesel Engine Lubricants?

  15. al99-06.doc | Department of Energy

    Broader source: Energy.gov (indexed) [DOE]

    .doc&#0; More Documents & Publications Microsoft Word - AL2000-05.doc AL2007-05.doc&#0; AL2004-01r2.pdf

  16. Microsoft Word - competitionincontractingguidev2.doc | Department of Energy

    Office of Environmental Management (EM)

    competitionincontractingguidev2.doc Microsoft Word - competitionincontractingguidev2.doc PDF icon Microsoft Word - competitionincontractingguidev2.doc More Documents & Publications AcqGuide 5.2-OPAM Microsoft Word - AG Chapter 6 1 Nov 2010 Competition Requirements

  17. Microsoft Word - ACQUISITION LETTER.doc | Department of Energy

    Office of Environmental Management (EM)

    ACQUISITION LETTER.doc Microsoft Word - ACQUISITION LETTER.doc PDF icon Microsoft Word - ACQUISITION LETTER.doc More Documents & Publications ACQUISITION LETTER DEAR Part 933 OPAM Policy Acquisition Guides Chapter 33 - Protests, Disputes and Appeals

  18. Microsoft Word - ARRAAttachment12v1.doc | Department of Energy

    Office of Environmental Management (EM)

    ARRAAttachment12v1.doc Microsoft Word - ARRAAttachment12v1.doc More Documents & Publications Microsoft Word - DRAFT CRB Interview Guidance.doc Microsoft Word - ARRAGuideAttachment10v1

  19. Microsoft Word - FORM46001.doc | Department of Energy

    Office of Environmental Management (EM)

    FORM46001.doc Microsoft Word - FORM46001.doc PDF icon Microsoft Word - FORM46001.doc More Documents & Publications DOE F 4600.1 Archived Financial Assistance Letters American Recovery and Reinvestment Act, Financial Assistance Award: 212 Degrees Consulting, LLC

  20. Operating Guidelines Appendix A B.DOC | Department of Energy

    Energy Savers [EERE]

    Operating Guidelines Appendix A B.DOC&#0; Operating Guidelines Appendix A B.DOC&#0; PDF icon Operating Guidelines Appendix A B.DOC&#0; More Documents & Publications Operating Guidelines Appendix C D.DOC&#0; 2 Jun 03 Roles and Responsibilities _CSO Highlighted_.doc&#0; DOE HR Guidebook 12_15_05.DOC&#0;

  1. Microsoft Word - PeerReview_SAR.doc | Department of Energy

    Energy Savers [EERE]

    & Publications Microsoft Word - PeerReviewCCSP.doc Microsoft Word - Cross Reference Matrix Introduction.doc Assessment of the Effects of Climate Change on Federal Hydropower...

  2. Microsoft Word - FOA cover sheet.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Microsoft Word - FOA cover sheet.doc Recovery Act, Office of the Biomass Program,Funding Opportunity Announcements Special Notice Microsoft Word - FOA cover sheet.doc...

  3. Experimental Evaluation of DOC Performance Using Secondary Fuel...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Evaluation of DOC Performance Using Secondary Fuel Injection Experimental Evaluation of DOC Performance Using Secondary Fuel Injection Poster presentation at the 2007 Diesel ...

  4. DOE EIR FM.doc | Department of Energy

    Office of Environmental Management (EM)

    EIR FM.doc PDF icon DOE EIR FM.doc More Documents & Publications Contractor Statement of Work (SOW) Template (for EIR) External Independent Review (EIR) Standard Operating...

  5. Design Potential of Metal Foil Substrates for Optimized DOC Performanc...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Potential of Metal Foil Substrates for Optimized DOC Performance Design Potential of Metal Foil Substrates for Optimized DOC Performance Poster presentation at the 2007 Diesel...

  6. RetTrendReport1205.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    PDF icon RetTrendReport1205.doc&0; More Documents & Publications Pension Plans for Contractor Workers April 1-10 comments.doc&0; POLICY GUIDANCE MEMORANDUM...

  7. Project Summary-TES-SNL.doc. (Conference) | SciTech Connect

    Office of Scientific and Technical Information (OSTI)

    Project Summary-TES-SNL.doc. Citation Details In-Document Search Title: Project Summary-TES-SNL.doc. Abstract not provided. Authors: Siegel, Nathan Phillip Publication Date: 2009-02-01 OSTI Identifier: 1142774 Report Number(s): SAND2009-0912C 508394 DOE Contract Number: DE-AC04-94AL85000 Resource Type: Conference Resource Relation: Conference: Doe peer review held March 9-10, 2009 in denver, CO.; Related Information: Proposed for presentation at the doe peer review held March

  8. Microsoft Word - toc.doc

    Office of Legacy Management (LM)

    Appendix A Monticello LTS&M Project Organization and Key Personnel U n c o n t r o l l e d c o p y U.S. Department of Energy Long-Term Surveillance and Maintenance Plan for the Monticello NPL Sites Rev. 0 Doc. No. S0038700 Rev. Date: June 25, 2007 Page A-3 Utah Department of Transportation City of Monticello Monticello LM Representativ e Contractor General Manager Monticello LM Task Order Manager DOE Office of Legacy Managem ent Director U.S. EPA Region VIII Utah Departm ent of Environm

  9. Microsoft Word - toc.doc

    Office of Legacy Management (LM)

    B Document Control and Records Management Procedures U n c o n t r o l l e d c o p y U.S. Department of Energy Long-Term Surveillance and Maintenance Plan for the Monticello NPL Sites Rev. 0 Doc. No. S0038700 Rev. Date: June 25, 2007 Page B-3 B1.0 Document Control and Records Management Procedures Administrative procedures have been developed to define responsibilities, establish documentation and change control requirements, and employ standard work processes in implementing the monitoring,

  10. Microsoft Word - toc.doc

    Office of Legacy Management (LM)

    F Radiological Survey Procedures U n c o n t r o l l e d c o p y U.S. Department of Energy Long-Term Surveillance and Maintenance Plan for the Monticello NPL Sites Rev. 0 Doc. No. S0038700 Rev. Date: June 25, 2007 Page F-3 F.1 Radiological Survey Procedures This section describes the actions and method used by the Monticello Legacy Management (LM) Representative when conducting radiological surveys for the purpose of identifying radiologically contaminated material and determining the Radium-226

  11. Microsoft Word - toc.doc

    Office of Legacy Management (LM)

    G Uranium Scanning Procedure U n c o n t r o l l e d c o p y U.S. Department of Energy Long-Term Surveillance and Maintenance Plan for the Monticello NPL Sites Rev. 0 Doc. No. S0038700 Rev. Date: June 25, 2007 Page G-3 Uranium Scanning Procedure for Property MP-00211 1. Select a Ludlum Model 12 ratemeter with a 44-9 pancake Geiger-Mueller beta-gamma detector or equivalent instrument capable of meeting detection limit criteria. 2. Check that the ratemeter and the detector have calibration

  12. Microsoft Word - toc.doc

    Office of Legacy Management (LM)

    Appendix H Procedures for the Transportation of Radioactive Materials U n c o n t r o l l e d c o p y U.S. Department of Energy Long-Term Surveillance and Maintenance Plan for the Monticello NPL Sites Rev. 0 Doc. No. S0038700 Rev. Date: June 25, 2007 Page H-3 H1.0 Purpose The purpose of this procedure is to ensure that radioactive material is transported (1) using best management practices, (2) in compliance with U.S. Department of Transportation (DOT) requirements, and (3) with minimal risk to

  13. Microsoft Word - Appendix N_Historical.doc

    Office of Legacy Management (LM)

    N Example Historical Marker and Plaque U.S. Department of Energy Weldon Spring Site LTS&M Plan July 2005 Doc. No. S0079000 Page N-3 Weldon Spring Site LTS&M Plan U.S. Department of Energy Doc. No. S0079000 July 2005 Page N-4

  14. Microsoft Word - ICMP2005Rev2.doc

    National Nuclear Security Administration (NNSA)

    49-REV2 INTEGRATED CLOSURE AND MONITORING PLAN for the Area 3 and Area 5 Radioactive Waste Management Sites at the Nevada Test Site Prepared for U.S. Department of Energy National Nuclear Security Administration Nevada Site Office under Contract Number DE-AC08-96NV11718 June 2005 DISCLAIMER NOTICE This report was prepared as an account of work sponsored by an agency of the U.S. Government. Neither the U.S. Government nor any agency thereof, nor any of their employees, nor any of their

  15. Microsoft Word - AL2000-01.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AL2000-01.doc Microsoft Word - AL2000-01.doc PDF icon Microsoft Word - AL2000-01.doc More Documents & Publications AL/FAL 99-01 Department of Energy No Microsoft Word - al2005-04.doc

  16. Microsoft Word - AL2005-11.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    11.doc Microsoft Word - AL2005-11.doc PDF icon Microsoft Word - AL2005-11.doc More Documents & Publications Audit Report: OAS-L-13-08 Microsoft Word - AL2005-12.doc CHAPTER 7 FINANCIAL MANAGEMENT

  17. AcqGuide42pt3.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    2pt3.doc&#0; AcqGuide42pt3.doc&#0; PDF icon AcqGuide42pt3.doc&#0; More Documents & Publications Chapter 42 - Contract Administration AcqGuide9pt2.doc&#0; Chapter 9 - Contracting Qualifications

  18. AcqGuide47pt1.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    7pt1.doc&#0; AcqGuide47pt1.doc&#0; PDF icon AcqGuide47pt1.doc&#0; More Documents & Publications Chapter 47 - Transportation TEC Working Group Topic Groups Manual Review Key Documents AcqGuide3pt1.doc&#0;

  19. AcqGuide9pt1.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    pt1.doc&#0; AcqGuide9pt1.doc&#0; PDF icon AcqGuide9pt1.doc&#0; More Documents & Publications Chapter 9 - Contracting Qualifications AcqGuide3pt1.doc&#0; OPAM Policy Acquisition Guides

  20. AcqGuide9pt2.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    pt2.doc&#0; AcqGuide9pt2.doc&#0; PDF icon AcqGuide9pt2.doc&#0; More Documents & Publications Chapter 9 - Contracting Qualifications Audit Report: IG-0432 AcqGuide42pt3.doc&#0;

  1. Microsoft Word - al2005-04.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    al2005-04.doc Microsoft Word - al2005-04.doc PDF icon Microsoft Word - al2005-04.doc More Documents & Publications AL2005-04ClassDeviation.pdf Microsoft Word - Matrixpart2.doc 2014-02 Acquistion Letter 2014-01: Management and Operating Contractors' Audit Coverage of Cost-Reimbursement Subcontracts

  2. Microsoft Word - al2005-06.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    al2005-06.doc Microsoft Word - al2005-06.doc PDF icon Microsoft Word - al2005-06.doc More Documents & Publications Microsoft Word - AL2006-01.doc OPAM Policy Acquisition Guides Acquisition Letter: AL2005-08

  3. Microsoft Word - 99-04.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    9-04.doc Microsoft Word - 99-04.doc PDF icon Microsoft Word - 99-04.doc More Documents & Publications Policy Flash 2014-18 Complex-Wide Strategic Sourcing Microsoft Word - AL2000-01.doc Microsoft Word - AL2005-1

  4. Microsoft Word - AL2005-16.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    6.doc Microsoft Word - AL2005-16.doc PDF icon Microsoft Word - AL2005-16.doc More Documents & Publications Microsoft Word - AL2005-10.doc Policy Flash 2013-33 Department of Energy Order 206.2 Identity, Credential and Access Managment (ICAM) Audit Report: IG-0860

  5. Microsoft Word - AL2006-03.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    3.doc Microsoft Word - AL2006-03.doc PDF icon Microsoft Word - AL2006-03.doc More Documents & Publications Microsoft Word - AL2006-02.doc Archived Financial Assistance Letters Financial Assistance Letters No. FAL 2006-04

  6. Microsoft Word - AL2006-09.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    9.doc Microsoft Word - AL2006-09.doc PDF icon Microsoft Word - AL2006-09.doc More Documents & Publications Microsoft PowerPoint - Executive Order13423rbl Sample Contract Language for Construction Using Energy-Efficient Products AL2007-05.doc&#0;

  7. AcqGuide39pt1.doc | Department of Energy

    Energy Savers [EERE]

    9pt1.doc&#0; AcqGuide39pt1.doc&#0; PDF icon AcqGuide39pt1.doc&#0; More Documents & Publications Chapter 39 - Acquisition of Information Technology AcqGuide38pt1.doc&#0; Microsoft Word - AcqGuide16pt1 Nov 2010

  8. Microsoft Word - AL2005-12.doc | Department of Energy

    Energy Savers [EERE]

    2.doc Microsoft Word - AL2005-12.doc PDF icon Microsoft Word - AL2005-12.doc More Documents & Publications Acquisition Letter No. AL 2012-05 Microsoft Word - AL2005-11.doc OPAM Policy Acquisition Guides

  9. Microsoft Word - FAL2006-03.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    FAL2006-03.doc Microsoft Word - FAL2006-03.doc PDF icon Microsoft Word - FAL2006-03.doc More Documents & Publications Financial Assistance Letter No. FAL 2006-03 Microsoft Word - FAL2006-03.doc For-Profit Audit Guidance (FY 2010)

  10. Microsoft Word - PART 970.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    PART 970.doc Microsoft Word - PART 970.doc PDF icon Microsoft Word - PART 970.doc More Documents & Publications Searchable Electronic Department of Energy Acquisition Regulation Microsoft Word - Matrixpart2.doc AcqGuide70.52Matrixpart2Redo-OPAM

  11. Microsoft Word - PeerReview_CCSP.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    CCSP.doc Microsoft Word - PeerReview_CCSP.doc PDF icon Microsoft Word - PeerReview_CCSP.doc More Documents & Publications Microsoft Word - PeerReview_SAR.doc EIS-0402: Advance Notice of Intent to Prepare an Environmental Impact Statement URTAC Meeting - January 2008

  12. Microsoft Word - al2007-11.doc | Department of Energy

    Office of Environmental Management (EM)

    al2007-11.doc Microsoft Word - al2007-11.doc PDF icon Microsoft Word - al2007-11.doc More Documents & Publications Acquisition Letter: AL2005-08 Microsoft Word - al2004-03.doc OPAM Policy Acquisition Guides

  13. Microsoft Word - AL2003-04.doc | Department of Energy

    Office of Environmental Management (EM)

    3-04.doc Microsoft Word - AL2003-04.doc PDF icon Microsoft Word - AL2003-04.doc More Documents & Publications Microsoft Word - AL2006-08.doc AL2004-01r2.pdf City of Tulare Renewable Biogas Fuel Cell Project

  14. Microsoft Word - AL2005-07.doc | Department of Energy

    Office of Environmental Management (EM)

    07.doc Microsoft Word - AL2005-07.doc PDF icon Microsoft Word - AL2005-07.doc More Documents & Publications Microsoft Word - AL2006-07.doc OPAM Policy Acquisition Guides Microsoft Word - 1_2011_CEG_Update_v2

  15. Microsoft Word - CERFDOE Final Report - 071204.doc | Department of Energy

    Office of Environmental Management (EM)

    CERFDOE Final Report - 071204.doc Microsoft Word - CERFDOE Final Report - 071204.doc PDF icon Microsoft Word - CERFDOE Final Report - 071204.doc More Documents & Publications Integrated Project Team RM DOE EIR FM.doc Independent Oversight Activity Report, Hanford Sludge Treatment Project - September 2013

  16. Microsoft Word - DOETTQuestions.doc | Department of Energy

    Office of Environmental Management (EM)

    DOETTQuestions.doc Microsoft Word - DOETTQuestions.doc PDF icon Microsoft Word - DOETTQuestions.doc More Documents & Publications Microsoft Word - 73FR72036_UC signed 1&#0; Microsoft Word - SRNL Fed Register Response.doc Subcontractor Rights Under CRADAs and WFO Agreements

  17. Microsoft Word - FAL2006-04.doc | Department of Energy

    Office of Environmental Management (EM)

    FAL2006-04.doc Microsoft Word - FAL2006-04.doc PDF icon Microsoft Word - FAL2006-04.doc More Documents & Publications Financial Assistance Letters No. FAL 2006-04 Microsoft Word - AL2006-03.doc Microsoft Word - FAL2004-01

  18. Microsoft Word - Federal Register Response _Jan09_.doc | Department of

    Office of Environmental Management (EM)

    Energy Federal Register Response _Jan09_.doc Microsoft Word - Federal Register Response _Jan09_.doc PDF icon Microsoft Word - Federal Register Response _Jan09_.doc More Documents & Publications Microsoft Word - Document2 Microsoft Word - Intellectual Property Provisions _NRD-1003_.doc Microsoft Word - SRNL Fed Register Response

  19. Microsoft Word - Final Sample Participant Profile November 2008.doc |

    Office of Environmental Management (EM)

    Department of Energy Final Sample Participant Profile November 2008.doc Microsoft Word - Final Sample Participant Profile November 2008.doc More Documents & Publications Microsoft Word - ARRAAttachment12v1.doc Microsoft Word - Fact Sheet Energy Speech 082508 FINAL.doc Microsoft Word - DRAFT CRB Interview Guidance

  20. AcqGuide70pt31.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    pt31.doc&#0; AcqGuide70pt31.doc&#0; PDF icon AcqGuide70pt31.doc&#0; More Documents & Publications Microsoft Word - AcqGuide70pt31A.doc Policy Flash 2014-26 Acquisition Guide Chapter 70.31A - Costs Associated with Whistleblower Actions Microsoft Word - AcqGuide70pt31B.doc

  1. leveraging_partnerships_with_faith-based_organizations.doc | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy leveraging_partnerships_with_faith-based_organizations.doc leveraging_partnerships_with_faith-based_organizations.doc leveraging_partnerships_with_faith-based_organizations.doc Microsoft Office document icon leveraging_partnerships_with_faith-based_organizations.doc More Documents & Publications Leveraging Partnerships with Faith-Based Organizations Outreach to Faith--Based Organizations Using Social Media to Engage the Community in Energy Efficiency Projects.doc

  2. Microsoft Word - figure_03.doc

    U.S. Energy Information Administration (EIA) Indexed Site

    Oil and Gas Reserves"; PointLogic Energy; Ventyx; and the Bureau of Safety and Environmental Enforcement, and predecessor agencies. IN OH TN WV VA KY MD PA NY VT NH MA CT ME...

  3. Microsoft Word - secondqmetric.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    and the CAPT group Lawrence Livermore National Laboratory Livermore, California UCRL-TR-219973 This document was prepared as an account of work sponsored by an agency of the...

  4. Microsoft Word - table_26.doc

    U.S. Energy Information Administration (EIA) Indexed Site

    Fueled Vehicles"; state agencies; Form EIA-23, "Annual Survey of Domestic Oil and Gas Reserves"; PointLogic Energy; DI; Ventyz; and EIA estimates based on historical data. Table 27...

  5. Microsoft Word - Chapter 01.doc

    National Nuclear Security Administration (NNSA)

    INTRODUCTION AND PURPOSE AND NEED FOR AGENCY ACTION 1-1 1.0 INTRODUCTION AND PURPOSE AND NEED FOR AGENCY ACTION 1.1 Introduction This Site-Wide Environmental Impact Statement for the Continued Operation of the Department of Energy/National Nuclear Security Administration Nevada National Security Site and Off-Site Locations in the State of Nevada (NNSS SWEIS) analyzes potential environmental impacts of continued management and operation of the Nevada National Security Site (NNSS) (formerly known

  6. Microsoft Word - Summary.doc

    National Nuclear Security Administration (NNSA)

    The alternative fuel demonstration project was transferred to the U.S. Department of Energy's Golden Field Office. The Nevada Desert Free Air Carbon Dioxide Enrichment Facility was built. S.3.1.5 Work-for-Others Programs The Weapons of Mass Destruction First Responder Training Program was transferred to the Federal Emergency Management Agency. The Defense Threat Reduction Agency Hard Target Defeat Program is inactive other than tests of small air-dropped munitions against tunnel targets. The

  7. Microsoft Word - Clay Memo PMC Coburn Obama 11_9_06.doc | Department...

    Office of Environmental Management (EM)

    Clay Memo PMC Coburn Obama 11906.doc Microsoft Word - Clay Memo PMC Coburn Obama 11906.doc Microsoft Word - Clay Memo PMC Coburn Obama 11906.doc More Documents & Publications...

  8. Microsoft Word - TSLCC 2007_5_05_08 rev 1.doc | Department of...

    Office of Environmental Management (EM)

    TSLCC 200750508 rev 1.doc Microsoft Word - TSLCC 200750508 rev 1.doc Microsoft Word - TSLCC 200750508 rev 1.doc More Documents & Publications FY 2007 Total System Life...

  9. Form:NEPA Doc | Open Energy Information

    Open Energy Info (EERE)

    NEPA Doc Jump to: navigation, search Input the name of a NEPA Document below. If the document already exists, you will be able to edit its information. AddEdit a NEPA Document...

  10. [Agency Name]

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    2 1. Introduction The Department of Energy sees the implementation of the Plain Writing Act as an important initiative that helps the Department share relevant information in a way that is clear, concise, and informative. The areas referenced in this report are only a few of the successes we have encountered as we continue to implement the Act. 1. Departmental Plain Writing Officials 2. Ingrid Kolb, Director of the Office of Management, Senior Agency Official Responsible for Plain Writing 3.

  11. Microsoft Word - fonsi-1.doc

    Office of Legacy Management (LM)

    Finding of No Significant Impact Ground Water Compliance at the Shiprock Uranium Mill Tailings Site Agency: U.S. Department of Energy Action: Finding of No Significant Impact (FONSI) Summary: The U.S. Department of Energy (DOE) proposes to conduct ground water remediation at the former Shiprock, New Mexico, uranium mill tailings site. The purpose of the proposed action is to meet U.S. Environmental Protection Agency ground water standards as defined in Title 40 Part 192 of the Code of Federal

  12. Placer County Water Agency | Open Energy Information

    Open Energy Info (EERE)

    Placer County Water Agency Jump to: navigation, search Name: Placer County Water Agency Place: California Phone Number: (530) 823-4850 Website: www.pcwa.net Twitter: @PlacerWater...

  13. Texas Municipal Power Agency | Open Energy Information

    Open Energy Info (EERE)

    Texas Municipal Power Agency Jump to: navigation, search Name: Texas Municipal Power Agency Place: Texas Sector: Wind energy Phone Number: (936) 873-1100 Website: www.texasmpa.org...

  14. Municipal Energy Agency of MS | Open Energy Information

    Open Energy Info (EERE)

    Name: Municipal Energy Agency of MS Place: Mississippi Phone Number: (601) 362-2252 Facebook: https:www.facebook.compagesMunicipal-Energy-Agency-of-Mississippi Outage...

  15. Central Minnesota Municipal Power Agency | Open Energy Information

    Open Energy Info (EERE)

    Power Agency Place: Minnesota Phone Number: 507-526-2193 Website: www.cmmpa.org Facebook: https:www.facebook.compagesCentral-Minnesota-Municipal-Power-Agency-CMMPA...

  16. Microsoft Word - Flash2008-09Attachment.doc | Department of Energy

    Broader source: Energy.gov (indexed) [DOE]

    9Attachment.doc More Documents & Publications Flash2007-02Attachment.doc&0; Microsoft Word - AL2000-05Attachment.doc Flash2007-03Attachment.doc&0;...

  17. Microsoft Word - Policy Flash 2008-04.doc | Department of Energy

    Office of Environmental Management (EM)

    4.doc Microsoft Word - Policy Flash 2008-04.doc More Documents & Publications Microsoft Word - Policy Flash 2008-07.doc Microsoft Word - Policy Flash 2008-10.doc Microsoft Word -...

  18. Microsoft Word - Policy Flash 2008-06.doc | Department of Energy

    Office of Environmental Management (EM)

    6.doc Microsoft Word - Policy Flash 2008-06.doc More Documents & Publications Microsoft Word - Policy Flash 2008-07.doc Microsoft Word - Policy Flash 2008-10.doc Microsoft Word -...

  19. Microsoft Word - DRAFT CRB Interview Guidance.doc | Department of Energy

    Office of Environmental Management (EM)

    DRAFT CRB Interview Guidance.doc Microsoft Word - DRAFT CRB Interview Guidance.doc More Documents & Publications Microsoft Word - ARRAAttachment12v1.doc Microsoft Word - ARRAGuideAttachment10v1.doc Microsoft Word - Document2

  20. [Agency Name

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    of open government and Plain Language in a number of ways, including: 3. Energy.gov blog. This blog highlights timely content featuring the many exciting innovations across ...

  1. [Agency Name

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    of open government and Plain Language in a number of ways, including: 3. Energy.gov blog. This blog features timely content highlighting many exciting innovations from the ...

  2. Microsoft Word - Policy Flash 2008-07.doc | Department of Energy

    Office of Environmental Management (EM)

    07.doc Microsoft Word - Policy Flash 2008-07.doc More Documents & Publications Microsoft Word - Policy Flash 2008-10...

  3. Microsoft Word - Policy Flash 2008-10.doc | Department of Energy

    Office of Environmental Management (EM)

    10.doc Microsoft Word - Policy Flash 2008-10.doc More Documents & Publications Microsoft Word - Policy Flash 2008-07...

  4. Microsoft Word - AMS Report v6.doc

    Office of Scientific and Technical Information (OSTI)

    ADVANCED MICROTURBINE SYSTEMS Final Report for Tasks 1 Through 4 and Task 6 T. Rosfjord, Program Manager W. Tredway, Deputy Program Manager A. Chen, J. Mulugeta, and T. Bhatia United Technologies Research Center East Hartford, CT 06118 March 26, 2007 Prepared for The U.S. Department of Energy, Office of Distributed Energy Award No. DE-FC26-00CH11060 Report Number DOE/CH/11060-1 DISCLAIMER This report was prepared as an account of work sponsored by an agency of the United States Government.

  5. Microsoft Word - n0045000.doc

    Office of Legacy Management (LM)

    Pinellas STAR Center Building 100 Area Remediation Technology Screening Report August 2001 Prepared by U.S. Department of Energy Grand Junction Office Grand Junction, Colorado Project Number PIN-041-0004-04-000 Document Number N0045000 Work Performed Under DOE Contract Number DE-AC13-96GJ87335 Task Order Number MAC01-10 This page intentionally left blank Document Number N0045000 Contents DOE/Grand Junction Office Building 100 Area Remediation Technology Screening Report August 2001 Page iii

  6. Q1 1998 STEO Docs

    Gasoline and Diesel Fuel Update (EIA)

    8 (Released January 12, 1998) Energy Information Administration DOE/EIA-0202(98/1Q) Distribution Category UC-950 Short-Term Energy Outlook Quarterly Projections First Quarter 1998 Energy Information Administration Office of Energy Markets and End Use U.S. Department of Energy Washington, DC 20585 This report was prepared by the Energy Information Administration, the independent statistical and analytical agency within the U.S. Department of Energy. The information contained herein should be

  7. Microsoft Word - fourthqmetric 2.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    comparison of model short-range forecasts and the ARM Microbase data. September 19, 2006 J. Hnilo Lawrence Livermore National Laboratory Livermore, California UCRL-TR-224648 This document was prepared as an account of work sponsored by an agency of the United States Government. Neither the United States Government nor the University of California nor any of their employees, makes any warranty, express or implied, or assumes any legal liability or responsibility for the accuracy, completeness, or

  8. Microsoft Word - Chapter 06.doc

    National Nuclear Security Administration (NNSA)

    6 CUMULATIVE IMPACTS 6-1 6.0 CUMULATIVE IMPACTS Council on Environmental Quality (CEQ) National Environmental Policy Act (NEPA) regulations (42 United States Code [U.S.C.] 4321 et seq.) define a cumulative impact as the "impact on the environment which results from the incremental impact of the action when added to past, present, and reasonably foreseeable future actions regardless of what agency (Federal or non-Federal) or person undertakes such other actions. Cumulative impacts can result

  9. Microsoft Word - Chapter 10.doc

    National Nuclear Security Administration (NNSA)

    0 CONSULTATION AND COORDINATION 10-1 10.0 CONSULTATION AND COORDINATION Chapter 10 presents an overview of the National Nuclear Security Administration's (NNSA's) consultation and coordination efforts with other Federal, state, and local government agencies and American Indian groups during the development of this Site-Wide Environmental Impact Statement for the Continued Operation of the Department of Energy/National Nuclear Security Administration Nevada National Security Site and Off-Site

  10. fleetappforms04f1298.doc | Department of Energy

    Broader source: Energy.gov (indexed) [DOE]

    fleetappforms04f1298.doc&#0; More Documents & Publications pocforms06a0399.doc&#0; Inspection Report: INS-O-09-04 Inspection Report: INS-O-06-01

  11. transcript_jedi_model.doc | Department of Energy

    Broader source: Energy.gov (indexed) [DOE]

    transcript_jedi_model.doc Microsoft Office document icon transcript_jedi_model.doc More Documents & Publications TAP Webcast Transcript July-29, 2009 Scenario Jedi Tools for Designing & Implementing Better Finance Programs

  12. expanding_chp_in_your_state.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    expanding_chp_in_your_state.doc expanding_chp_in_your_state.doc expanding_chp_in_your_state.doc Microsoft Office document icon expanding_chp_in_your_state.doc More Documents & Publications Combined Heat and Power: Expanding CHP in Your State Sustainable Energy Resources for Consumers (SERC) - Solar Hot Water Sustainable Energy Resources for Consumers (SERC) - Geothermal/Ground-Source Heat Pumps

  13. DOCS System Configuration Management Plan | Department of Energy

    Office of Environmental Management (EM)

    DOCS System Configuration Management Plan DOCS System Configuration Management Plan The DOCS Systems Configuration Management Plan (SCMP), from an actual DOE systems engineering project, can be used as a template to facilitate the creation of the CMP for your particular project. PDF icon DOCS System Configuration Management Plan More Documents & Publications OPC Security Whitepaper #3Hardening Guidelines for OPC Hosts NMMSS Software Quality Assurance Plan ABB SCADA/EMS System INEEL Baseline

  14. 20130226_sunshot_transcript_lbnl.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    transcript_lbnl.doc 20130226_sunshot_transcript_lbnl.doc 20130226_sunshot_transcript_lbnl.doc Microsoft Office document icon 20130226_sunshot_transcript_lbnl.doc More Documents & Publications Why Are Resiential PV Prices in Germany So Much Lower Than in the United States? text_alternative_stat_webinar_2012_7_25.docx An Analysis of Residential PV System Price Differences between the United States and Germany

  15. Microsoft Word - S06401_IC.doc

    Office of Legacy Management (LM)

    Photos of T Building Rooms with Special ICs This page intentionally left blank U.S. Department of Energy Annual Assessment of the Effectiveness of Site-Wide Institutional Controls June 2010 Doc. No. S06401 Page D-1 Figure D-1. T Building Rooms with Special ICs Annual Assessment of the Effectiveness of Site-Wide Institutional Controls U.S. Department of Energy Doc. No. S06401 June 2010 Page D-2 Figure D-2. T Bldg. Room 16 View A Figure D-3. T Bldg. Room 16 View B Figure D-4. T Bldg. Room 16 View

  16. Residential Retrofit Program Design Guide Overview Transcript.doc |

    Broader source: Energy.gov (indexed) [DOE]

    Department of Energy Residential Retrofit Program Design Guide Overview Transcript.doc Microsoft Office document icon Residential Retrofit Program Design Guide Overview Transcript.doc More Documents & Publications Residential Retrofit Program Design Guide Overview Transcript.doc Residential Retrofit Design Guide Overview Sustainable Energy Resources for Consumers Webinar on Residential Geothermal Heat Pump Retrofit Transcript

  17. Microsoft Word - FAL2004-05.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    FAL2004-05.doc Microsoft Word - FAL2004-05.doc PDF icon Microsoft Word - FAL2004-05.doc More Documents & Publications Archived Financial Assistance Letters Microsoft Word - Section 311 AL FAL Feb 17 2010 Financial Assistance Letter No. FAL 2006-03

  18. Microsoft Word - al2004-03.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    al2004-03.doc Microsoft Word - al2004-03.doc PDF icon Microsoft Word - al2004-03.doc More Documents & Publications Acquisition Letter: AL2005-08 OPAM Policy Acquisition Guides Presentations, Women-Owned Small Business Forum (May 2013)

  19. Microsoft Word - meritrev.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    meritrev.doc Microsoft Word - meritrev.doc PDF icon Microsoft Word - meritrev.doc More Documents & Publications Policy Flash 2013-38 Revised Merit Review Guide For Financial Assistance Application Content and Evaluation Criteria/Process Application Content and Evaluation Criteria/Process

  20. AcqGuide37pt1.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    7pt1.doc&#0; AcqGuide37pt1.doc&#0; PDF icon AcqGuide37pt1.doc&#0; More Documents & Publications Chapter 37 - Service Contracting Microsoft Word - AcqGuide37pt1 binney Nov 2010 Special Review: OAS-M-15-05

  1. AcqGuide4pt1.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    pt1.doc&#0; AcqGuide4pt1.doc&#0; PDF icon AcqGuide4pt1.doc&#0; More Documents & Publications Source Selection Guide Source Selection Guide Policy Flash 2013-46 Awardee in STRIPES

  2. AcqGuide70pt5.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    pt5.doc&#0; AcqGuide70pt5.doc&#0; PDF icon AcqGuide70pt5.doc&#0; More Documents & Publications Chapter 70 - DOE Management and Operating Contracts CHAPTER 3 Policy Flash 2013-62 Acquisition Letter 09 - Revision of Department of Energy (DOE) Order 350.1 and Special H Clause

  3. Microsoft Word - al96-09.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    6-09.doc Microsoft Word - al96-09.doc PDF icon Microsoft Word - al96-09.doc More Documents & Publications Subject: Cost and Price Analysis Subject: Cost and Price Analysis Policy Flash 2013-30 Acquisition Letter on Acquisition Planning Considerations for Management and Operating Contracts

  4. Microsoft Word - AL2005-15.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    5.doc Microsoft Word - AL2005-15.doc PDF icon Microsoft Word - AL2005-15.doc More Documents & Publications Appendix A. Notice of Inquiry: Preparation of Report to Congress on Price-Anderson Act. 62 Federal Register 68,272 (December 31, 1997) Public comment re Price-Anderson Act Public Comment on Price Anderson Act from the University of Chicago

  5. Microsoft Word - AL2006-10.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    0.doc Microsoft Word - AL2006-10.doc PDF icon AL2006-10 More Documents & Publications Microsoft Word - Matrixpart2.doc Microsoft Word - AcqGuide70pt52Matrixpart2Redo AcqGuide70.52Matrixpart2Redo-OPAM

  6. Microsoft Word - FOA cover sheet.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    cover sheet.doc Microsoft Word - FOA cover sheet.doc PDF icon Microsoft Word - FOA cover sheet.doc More Documents & Publications Recovery Act: Wind Energy Consortia between Institutions of Higher Learning and Industry Microsoft Word - kDE-FOA-0000090.rtf DISCLAIMER:

  7. AcqGuide3pt1.doc | Department of Energy

    Energy Savers [EERE]

    pt1.doc&#0; AcqGuide3pt1.doc&#0; PDF icon AcqGuide3pt1.doc&#0; More Documents & Publications POLICY FLASH 2016-04 Procurement Integrity PI Brief 6 15 07 final2&#0;

  8. Microsoft Word - Cross Reference Matrix Introduction.doc | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Cross Reference Matrix Introduction.doc Microsoft Word - Cross Reference Matrix Introduction.doc PDF icon Microsoft Word - Cross Reference Matrix Introduction.doc More Documents & Publications Quality Assurance Requirements USA RS Basic Contract - Contract No.: DE-RW0000005 Office of Civilian Radioactive Waste Management-Quality Assurance Requirements and Description

  9. Microsoft Word - Matrixpart2.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Matrixpart2.doc Microsoft Word - Matrixpart2.doc PDF icon Microsoft Word - Matrixpart2.doc More Documents & Publications AcqGuide70.52Matrixpart2Redo-OPAM Microsoft Word - AcqGuide70pt52Matrixpart2Redo Part 2, Clauses Prescribed in DEAR Parts 952 and 970

  10. CompleteProject List.doc | Department of Energy

    Office of Environmental Management (EM)

    CompleteProject List.doc&#0; CompleteProject List.doc&#0; PDF icon CompleteProject List.doc&#0; More Documents & Publications Tribal Energy Program February 2012 Award Project Descriptions CX-008525: Categorical Exclusion Determination 2010 Program Review Meeting

  11. al99-06attachment.doc | Department of Energy

    Broader source: Energy.gov (indexed) [DOE]

    attachment.doc&#0; More Documents & Publications Microsoft Word - AL2000-05Attachment.doc Microsoft Word - NSRC precompetitive User Agreement amended 1-18-07.doc EXHIBIT A: CRADA, WFO, PUA and NPUA Comparison Table, with suggested changes

  12. Microsoft Word - Political Activity and the Federal Employee.doc |

    Office of Environmental Management (EM)

    Department of Energy Political Activity and the Federal Employee.doc Microsoft Word - Political Activity and the Federal Employee.doc PDF icon Microsoft Word - Political Activity and the Federal Employee.doc More Documents & Publications Audit Report: IG-0473 PROCESSING INVITATIONS FOR A PRESIDENTIAL APPOINTEE EIS-0307: Withdrawal of Notice of Intent to Prepare an Environmental Impact Statement

  13. Microsoft Word - al95-14.doc | Department of Energy

    Office of Environmental Management (EM)

    al95-14.doc Microsoft Word - al95-14.doc PDF icon Microsoft Word - al95-14.doc More Documents & Publications Cooperation with the New Independent States of the Former Soviet Union CDLB-1003.PDF&#0; 10 CFR 600.325 - Intellectual Property Provisions (GDLB-1003) Grant

  14. Microsoft Word - fal2004-04.doc | Department of Energy

    Office of Environmental Management (EM)

    fal2004-04.doc Microsoft Word - fal2004-04.doc PDF icon Microsoft Word - fal2004-04.doc More Documents & Publications Financial Assistance Guide (2013) For Profit Audits - Information Related to 12/21/11 Federal Register Notice Policy Flash Search Listing (2001-2014)

  15. Microsoft Word - CSATCourseCatalog_02.doc | Department of Energy

    Office of Environmental Management (EM)

    CSATCourseCatalog_02.doc Microsoft Word - CSATCourseCatalog_02.doc classroom-1008856_960_720.jpg PDF icon Microsoft Word - CSATCourseCatalog_02.doc More Documents & Publications CSAT Course Catalog Headquarters Facilities Master Security Plan - Chapter 17, Headquarters Security Officer Program Headquarters Facilities Master Security Plan - Chapter 8, Operations Security Program

  16. Microsoft Word - FAC2005-27.doc | Department of Energy

    Office of Environmental Management (EM)

    FAC2005-27.doc Microsoft Word - FAC2005-27.doc PDF icon Microsoft Word - FAC2005-27.doc More Documents & Publications Policy Flash 2015-07 - FAC 2005-78 Policy Flash Search Listing (2001-2014) POLICY FLASH 2015-32 - FAC 2005-83

  17. Microsoft Word - FOA cover sheet.doc | Department of Energy

    Office of Environmental Management (EM)

    cover sheet.doc Microsoft Word - FOA cover sheet.doc PDF icon Microsoft Word - FOA cover sheet.doc More Documents & Publications Vehicle Technologies Office Merit Review 2014: Moving North Texas Forward by Addressing Alternative Fuel Barriers Clean Cities Regional Support & Petroleum Displacement Awards Clean Cities 2009 Petroleum Displacement Awards

  18. Microsoft Word - LibraryofPriorRulemakings.doc | Department of Energy

    Office of Environmental Management (EM)

    LibraryofPriorRulemakings.doc Microsoft Word - LibraryofPriorRulemakings.doc PDF icon Microsoft Word - LibraryofPriorRulemakings.doc More Documents & Publications Solar Background Document 1 Natural Gas Imports and Exports First Quarter Report 2014 Natural Gas Imports and Exports Second Quarter Report 2014

  19. Microsoft Word - EODchecklist1.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    New Employee Orientation FORMS CHECKLIST EOD Date: Employee Name: Organization: HR Specialist: Phone Number: Admin Contact: Phone Number: New Employee Orientation Forms to be issued and collected by HR Orientation Team: FORM COMPLETE & SIGNED FORM NAME AND NUMBER Yes No Comments 1. Photo ID 2. Passport, Birth Certificate, or U.S. Citizenship Documents Bring on 1 st Day 3. Employment & Benefits forms listed below 1. Employee Information Form 2. Statement of Prior Federal Service - SF-144

  20. Microsoft Word - figure_03.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    2014 10 U.S. Energy Information Administration | Natural Gas Annual Figure 3. Marketed production of natural gas in the United States and the Gulf of Mexico, 2014 (million cubic feet) None 1-15,000 15,001-100,000 100,001-200,000 200,001-500,000 500,001 and over Sources: Energy Information Administration (EIA), Form EIA-895, "Annual Quantity and Value of Natural Gas Report"; Form EIA-914, "Monthly Natural Gas Production Report"; state agencies; Form EIA-23, "Annual Survey

  1. Habadv#165 RCBRA.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    5 Subject: River Corridor Baseline Risk Assessment (RCBRA) Adopted: September 10, 2004 Page 1 September 10, 2004 Keith Klein, Manager U.S. Department of Energy, Richland Operations P.O. Box 550 (A7-50) Richland, WA 99352 Ron Kreizeneeck, Regional Administrator U.S. Environmental Protection Agency, Region 10 1200 Sixth Avenue Seattle, WA 98101 Linda Hoffman, Director Washington State Department of Ecology P.O. Box 47600 Olympia, WA 98504-7600 Subject: Risk Assessment Work Plan for the 100 Area

  2. Microsoft Word - toc.doc

    Office of Legacy Management (LM)

    K MMTS and MVP Site Inspection Checklists U n c o n t r o l l e d c o p y MMTS Annual Inspection Checklist U n c o n t r o l l e d c o p y MMTS Annual Inspection Checklist Page 1 of 38 I. MMTS Site Information Site name: Monticello Mill Tailings (USDOE) Site; Operable Units I, II, and III Date of inspection: Site Location: Monticello, Utah: EPA Region 8 EPA ID: UT 3890090035 Lead Agency: U.S. Department of Energy Office of Legacy Management (DOE-LM) PCOR Date: September 2004 Operational and

  3. Microsoft Word - S0171500.doc

    Office of Legacy Management (LM)

    DOE-LM/GJ850-2005 ESL-RPT-2005-03 Alternatives for Mending a Permeable Reactive Barrier at a Former Uranium Milling Site: Monticello, Utah April 2005 Prepared for U. S. Environmental Protection Agency Region 8, Denver, Colorado Under Interagency Agreement DW89953767018 By U. S. Department of Energy Grand Junction, Colorado Work Performed by S.M. Stoller Corporation under DOE Contract No. DE-AC01-02GJ79491 for the U.S. Department of Energy Office of Legacy Management, Grand Junction, Colorado

  4. Change Number

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    E KEY INDIVIDUALS U.S. Environmental Protection Agency Region 10 Washington State Department of Ecology U.S. Department of Energy, Richland Operations Executive Managers Program Manager for the Hanford Project Office (509) 376-6865 Program Manager for the Nuclear Waste Program (509) 372-7950 Assistant Manager for the Central Plateau (509) 373-9971 Assistant Manager for the Office of River Protection, Waste Treatment and Immobilization Plant (509) 372-3864 Assistant Manager for the Office of

  5. Microsoft Word - cover.doc

    Office of Legacy Management (LM)

    1999-90-TAR MAC-GWGRJ 1.9 Ground Water Compliance Action Plan for the Grand Junction, Colorado, UMTRA Project Site May 2001 GJO-1999-90-TAR MAC-GWGRJ 1.9 Ground Water Compliance Action Plan for the Grand Junction, Colorado, UMTRA Project Site May 2001 Prepared by U.S. Department of Energy Grand Junction Office Grand Junction, Colorado Project Number UGW-511-0008-09-000 Document Number U0050100 Work Performed under DOE Contract No. DE-AC13-96GJ87335 Document Number U0050100 Contents DOE/Grand

  6. n0053200-sitewide.doc

    Office of Legacy Management (LM)

    3200 GJO-PIN 11.6.2 Pinellas Environmental Restoration Project Sitewide Environmental Monitoring Quarterly Progress Report for the Young-Rainey STAR Center April through June 2002 July 2002 Prepared by U.S. Department of Energy Grand Junction Office Grand Junction, Colorado Work Performed Under DOE Contract Number DE-AC13-02GJ79491 Task Order Number ST02-107 Document Number N0053200 Contents DOE/Grand Junction Office Pinellas Environmental Restoration Project July 2002 Page iii Contents Page

  7. Microsoft Word - N0049800.doc

    Office of Legacy Management (LM)

    49800 GJO-2002-306-TAR MAC-PIN 14.5.2 Pinellas Environmental Restoration Project at the Young-Rainey STAR Center Building 100 Area Plume Control Technology Selection Report February 2002 Prepared by U.S. Department of Energy Grand Junction Office Grand Junction, Colorado Work Performed Under DOE Contract Number DE-AC13-96GJ87335 Task Order Number MAC02-10 This page intentionally left blank Document Number N0049800 Contents DOE/Grand Junction Office Building 100 Area Plume Control Technology

  8. Microsoft Word - S06692_VMR.doc

    Office of Legacy Management (LM)

    Gunnison, Colorado, Processing Site September 2010 LMS/GUP/S06692 This page intentionally left blank LMS/GUP/S06692 2010 Verification Monitoring Report for the Gunnison, Colorado, Processing Site September 2010 This page intentionally left blank U.S. Department of Energy 2010 Verification Monitoring Report-Gunnison, Colorado, Processing Site September 2010 Doc. No. S06692 Page i Contents

  9. Microsoft Word - Appendix A_Background.doc

    Office of Legacy Management (LM)

    Background Information, Remedial Action Histories, Present Site Conditions U.S. Department of Energy Weldon Spring Site LTS&M Plan July 2005 Doc. No. S0079000 Page A-iii Contents A1.1 Location and Property Ownership ................................................................................1 A1.2 Physiography and Topography.....................................................................................4 A1.3 Hydrogeology

  10. LATEST_m_93.DOC

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    3 AM Change Number M-93-01-02 Federal Facility Agreement and Consent Order Change Control Form Do not use blue ink. Type or print using black ink. Date 123101 Originator Phone H....

  11. Microsoft Word - M084.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of Offers is extended, is not...

  12. Microsoft Word - expcaruso.doc

    U.S. Energy Information Administration (EIA) Indexed Site

    4.9 percent drop in overall U.S. natural gas consumption in ... SR4. The deteriorating financial condition of a number of ... to the 2000-2001 energy crisis in that region, resulted ...

  13. Microsoft Word - U0127400.doc

    Office of Legacy Management (LM)

    12-TAR MAC-GWMON 1.8 Chemistry of Phase I Phytoremediation Soils: Work Plan for the Monument Valley, Arizona, UMTRA Project Site September 2001 This page intentionally left blank UMTRA Ground Water Project Chemistry of Phase I Phytoremediation Soils: Work Plan for the Monument Valley, Arizona, UMTRA Project Site September 2001 Prepared for U.S. Department of Energy Grand Junction Office Grand Junction, Colorado Project Number UGW-511-0015-37-000 Document Number U0127400 Work Performed Under DOE

  14. Microsoft Word - Nevada map cover page.doc

    National Nuclear Security Administration (NNSA)

    MAP OF SOLAR ENERGY STUDY AREAS FOR IN-DEPTH STUDY IN NEVADA The U.S. Department of Energy (DOE) and the Bureau of Land Management (BLM (the Agencies) are preparing a draft Programmatic Environmental Impact Statement (PEIS) pursuant to the National Environmental Policy Act to evaluate utility-scale solar energy development in six Western states: Arizona, California, Colorado, Nevada, New Mexico, and Utah. In the course of the PEIS analyses, the Agencies have identified a number of tracts of

  15. Microsoft Word - table_21.doc

    Gasoline and Diesel Fuel Update (EIA)

    9 Table 21. Number of natural gas commercial consumers by type of service and state, 2013-2014 R Revised data. Note: Totals may not equal sum of components due to independent rounding. Source: Energy Information Administration (EIA), Form EIA-176, "Annual Report of Natural and Supplemental Gas Supply and Disposition." Please see the cautionary note regarding the number of residential and commercial customers located on the second page of Appendix A of this report. Alabama 67,006 130

  16. Microsoft Word - U0186500.doc

    Office of Legacy Management (LM)

    500 GJO-2003-487-TAC GJO-GWSHP 11.7 UMTRA Ground Water Project Wildlife Management Plan for the Evaporation Pond at the Shiprock, New Mexico, UMTRA Site September 2003 Prepared by U.S. Department of Energy Grand Junction Office Grand Junction, Colorado Work Performed Under DOE Contract Number DE-AC-13-02GJ79491 Document Number U0186500 DOE/Grand Junction Office Wildlife Management PlanShiprock Evaporation Pond September 2003 Page 1 1.0 Introduction The Proposed Action in the Environmental

  17. Microsoft Word - Chapter 12.doc

    National Nuclear Security Administration (NNSA)

    2 GLOSSARY 12-1 12.0 GLOSSARY absorbed dose-The energy imparted by ionizing radiation per unit mass of the irradiated material (e.g., biological tissue). The units of absorbed dose are the rad and the gray (Gy). (See gray, quality factor, rad, rem, and sievert.) accident-An unplanned sequence of events that usually results in undesirable consequences. actinides-A series of heavy radioactive metallic elements of increasing atomic number (Z number) beginning with actinium (89) and continuing

  18. Microsoft Word - n0021500.doc

    Office of Legacy Management (LM)

    PIN 16.2 Environmental Restoration Program Wastewater Neutralization Area/Building 200 Area Corrective Measures Implementation Plan Addendum January 2000 Environmental Restoration Program Wastewater Neutralization Area/Building 200 Area Corrective Measures Implementation Plan Addendum January 2000 Prepared for U.S. Department of Energy Albuquerque Operations Office Grand Junction Office Prepared by MACTEC Environmental Restoration Services, LLC Grand Junction, Colorado Project Number

  19. Request Number:

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    3023307 Name: Madeleine Brown Organization: nJa Address: --- -------- -------- -- Country: Phone Number: United States Fax Number: n/a E-mail: --- -------- --------_._------ --- Reasonably Describe Records Description: Please send me a copy of the emails and records relating to the decision to allow the underage son of Bill Gates to tour Hanford in June 2010. Please also send the emails and records that justify the Department of Energy to prevent other minors from visiting B Reactor. Optional

  20. Request Number:

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    1074438 Name: Gayle Cooper Organization: nla Address: _ Country: United States Phone Number: Fax Number: nla E-mail: . ~===--------- Reasonably Describe Records Description: Information pertaining to the Department of Energy's cost estimate for reinstating pension benefit service years to the Enterprise Company (ENCO) employees who are active plan participants in the Hanford Site Pension Plan. This cost estimate was an outcome of the DOE's Worker Town Hall Meetings held on September 17-18, 2009.

  1. AL2007-05.doc

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AL 2007-05 Acquisition Regulation Date 03/29/2007 ACQUISITION LETTER This Acquisition Letter is issued under the authority of the DOE and NNSA Procurement Executives. Acquisition Letters (AL) that remain in effect are identified below. All other previously issued ALs have been superseded by a formal rule-making, incorporated into other guidance, and/or canceled. * * * * * * * * * * * * * * * * ACQUISITION LETTERS REMAINING IN EFFECT NUMBER DATE SUBJECT 93-4 04/07/93 Displaced Workers Benefits

  2. Microsoft Word - P450.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Understanding the Role of Thiolate Ligation in Nature's Hydroxylating Heme Enzymes Michael T. Green, 1 John H. Dawson, 2 Harry B. Gray 3 1 Department of Chemistry, The Pennsylvania State University, PA 16802 2 Department of Chemistry and Biochemistry, The University of South Carolina, SC 29208 3 Beckman Institute, California Institute of Technology, Pasadena, CA 91125 Cytochromes P450 are thiolate-ligated heme enzymes that play critical roles in a number of important physiological processes.

  3. Microsoft Word - U01866.doc

    Office of Legacy Management (LM)

    186600 GJO-2003-489-TAC GJO-GWDUR 2.0 UMTRA Ground Water Project Verification Monitoring Report for the Durango, Colorado, UMTRA Project Site September 2003 Prepared by U.S. Department of Energy Grand Junction Office Grand Junction, Colorado Work Performed Under DOE Contract No. DE-AC13-02GJ79491 Document Number U0186600 Contents DOE/Grand Junction Office Verification Monitoring Report-Durango, Colorado September 2003 Page iii Contents 1.0

  4. Microsoft Word - e0399102.doc

    Office of Legacy Management (LM)

    UNCONTROLLED IF PRINTED E0399101 GJO-2003-493-TAC MNT 015.20 REV. 06 Copy No. ______ Draft-Final Monticello Site Management Plan October 2003 UNCONTROLLED IF PRINTED Prepared by U.S. Department of Energy Grand Junction, Colorado Work Performed Under DOE Contract Number DE-AC13-02GJ79491 UNCONTROLLED IF PRINTED Contents October 2003 Site Management Plan Page iii Contents Acronyms and Abbreviations

  5. Microsoft Word - April06.doc

    Office of Environmental Management (EM)

    April 2006 Volume 2, Number 1 In This Issue * DOE and ACHP Heritage Tourism Partnership * Nau Applauds DOE Executive Order Report * Want to Receive Partners in Preservation? * Atomic Testing Museum to Host Museum and Visitor Center Conference * $2 Million in FY06 Budget for Manhattan Project Preservation * Manhattan Project Web Site & Reprint * National Park Service Manhattan Project Study * 2006 DOE Cultural Resources Forum: Oak Ridge, Tennessee * Idaho to Hold Cultural Resources

  6. Microsoft Word - August06.doc

    Office of Environmental Management (EM)

    August 2006 Office of History and Heritage Resources Volume 2, Number 2 In This Issue * B-Reactor Study for Deputy Secretary * Museum and Visitor Center Conference * National Park Service Manhattan Project Resource Study * DOE Headquarters Museum/Visitor Center * Want to Receive Partners in Preservation? * 2007 DOE Cultural Resources Forum: Hanford, Washington * 2006 DOE Cultural Resources Forum: Oak Ridge, Tennessee * K-25 Racetrack? * FPO Funds Field Office Preservation * Pantex Donates Cold

  7. Microsoft Word - May2009.doc

    Office of Environmental Management (EM)

    009 Volume 4, Number 1 IN THIS ISSUE  DOE Wins ACHP Chairman's Award  Oak Ridge Hosts Energy Communities Alliance for Meeting and Secret Cities Festival  Hanford's B Reactor Named National Historic Landmark  National Trust Awards National Preservation Award for V-Site Restoration  Want to Receive Partners in Preservation?  Public Tours at Savannah River  Remember the ACHP  Status of National Park Service Manhattan Project Study  Touring the B Reactor at Hanford 

  8. Microsoft Word - Fact Sheet Energy Speech 082508 FINAL.doc | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Energy Speech 082508 FINAL.doc Microsoft Word - Fact Sheet Energy Speech 082508 FINAL.doc More Documents & Publications Microsoft Word - Press Release RECOMP 2-8-08 REV FINAL.doc Microsoft Word - ARRAAttachment12v1.doc Microsoft Word - Final Sample Participant Profile November 2008.doc

  9. Microsoft Word - ADR-Provisions-FederalAcquisitionReg.doc | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy ADR-Provisions-FederalAcquisitionReg.doc Microsoft Word - ADR-Provisions-FederalAcquisitionReg.doc PDF icon Microsoft Word - ADR-Provisions-FederalAcquisitionReg.doc More Documents & Publications ADR Provisions in Federal Acquisition Regulation (FAR) Microsoft Word - ACQUISITION LETTER.doc Microsoft Word - ADR Revised Policy82508Reformatted.doc

  10. Microsoft Word - AL2000-05Attachment.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Attachment.doc Microsoft Word - AL2000-05Attachment.doc PDF icon Microsoft Word - AL2000-05Attachment.doc More Documents & Publications al99-06attachment.doc&#0; EXHIBIT A: CRADA, WFO, PUA and NPUA Comparison Table, with suggested changes Microsoft Word - NSRC precompetitive User Agreement amended 1-18-07.doc

  11. Microsoft Word - AL2005-05Revised.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AL2005-05Revised.doc Microsoft Word - AL2005-05Revised.doc PDF icon Microsoft Word - AL2005-05Revised.doc More Documents & Publications AL2007-03.doc&#0; 2011-31 Attachment Aquisition Letter AcqGuide38pt1.doc&#0;

  12. Microsoft Word - S05428_VMR.doc

    Office of Legacy Management (LM)

    2008 and 2009 Update July 2010 LMS/SRE-SRW/S05428 This page intentionally left blank LMS/SRE-SRW/S05428 Verification Monitoring Report for the Slick Rock, Colorado, Processing Sites 2008 and 2009 Update July 2010 This page intentionally left blank U.S. Department of Energy Verification Monitoring Report-Slick Rock, Colorado, 2008 and 2009 Update July 2010 Doc. No. S05428 Page i Contents

  13. Microsoft Word - S05527_VMR 2009.DOC

    Office of Legacy Management (LM)

    Report for the Gunnison, Colorado, Processing Site August 2009 LMS/GUP/S05527 This page intentionally left blank LMS/GUP/S05527 2009 Verification Monitoring Report for the Gunnison, Colorado, Processing Site August 2009 This page intentionally left blank U.S. Department of Energy 2009 Verification Monitoring Report-Gunnison, Colorado, Processing Site August 2009 Doc. No. S05527 Page i Contents

  14. Microsoft Word - S06371_VMR_060210.doc

    Office of Legacy Management (LM)

    Naturita, Colorado, Processing Site May 2010 LMS/NAP/S06371 This page intentionally left blank LMS/NAP/S06371 Office of Legacy Management Verification Monitoring Report for the Naturita, Colorado, Processing Site May 2010 This page intentionally left blank U.S. Department of Energy Verification Monitoring Report⎯Naturita, Colorado May 2010 Doc. No. S06371 Page i Contents 1.0 Introduction

  15. Microsoft Word - S07050_WM.doc

    Office of Legacy Management (LM)

    Monitoring Report for Wetland Area near the Naturita, Colorado, Processing Site September 2010 LMS/NAP/S07050 This page intentionally left blank LMS/NAP/S07050 Monitoring Report for Wetland Area near the Naturita, Colorado, Processing Site September 2010 This page intentionally left blank U.S. Department of Energy Naturita-Monitoring Report for Wetland Area September 2010 Doc. No. S07050 Page i Contents 1.0 Introduction

  16. Microsoft Word - S03736_ FMP010609.doc

    Office of Legacy Management (LM)

    Fluid Management Plan Central Nevada Test Area Corrective Action Unit 443 January 2009 LMS/CNT/S03736 This page intentionally left blank LMS/CNT/S03736 Fluid Management Plan Central Nevada Test Area Corrective Action Unit 443 January 2009 This page intentionally left blank U.S. Department of Energy Fluid Management Plan For CAU 443: CNTA, Subsurface, Nevada January 2009 Doc. No. S0373600 Page i Contents Acronyms and Abbreviations

  17. Microsoft Word - S04019_GSB.doc

    Office of Legacy Management (LM)

    Long-Term Hydrologic Monitoring Program Evaluation Report June 2009 LMS/GSB/S04019 This page intentionally left blank LMS/GSB/S04019 Gasbuggy, New Mexico Long-Term Hydrologic Monitoring Program Evaluation Report June 2009 This page intentionally left blank U.S. Department of Energy Gasbuggy, New Mexico Long-Term Hydrologic Monitoring Program Evaluation Report June 2009, Rev. 3 Doc. No. S04019 Page i Contents Abbreviations

  18. Microsoft Word - S05094_VMR.doc

    Office of Legacy Management (LM)

    08 May 2009 LMS/RVT/S05094 This page intentionally left blank LMS/RVT/S05094 Verification Monitoring Report for the Riverton, Wyoming, Processing Site Update for 2008 May 2009 This page intentionally left blank U.S. Department of Energy Riverton, Wyoming, Verification Monitoring Report May 2009 Doc. No. S05094 Page i Contents 1.0 Introduction ........................................................................................................................1-1 2.0 Site Conditions

  19. Microsoft Word - S05575_AP.doc

    Office of Legacy Management (LM)

    8 through March 2009 for the Shiprock, New Mexico, Site December 2009 LMS/SHP/S05575 This page intentionally left blank LMS/SHP/S05575 Annual Performance Report April 2008 through March 2009 for the Shiprock, New Mexico, Site December 2009 This page intentionally left blank U.S. Department of Energy Annual Performance Report, Shiprock, New Mexico December 2009 Doc. No. S05575 Page i Contents

  20. Microsoft Word - S05949_IR.doc

    Office of Legacy Management (LM)

    Annual Inspection of the Monticello Mill Tailings (USDOE) and Monticello Radioactively Contaminated Properties Sites December 2009 LMS/MNT/S05949 This page intentionally left blank LMS/MNT/S05949 2009 Annual Inspection of the Monticello Mill Tailings (USDOE) and Monticello Radioactively Contaminated Properties Sites December 2009 This page intentionally left blank U.S. Department of Energy 2009 Annual Inspection-Monticello, Utah December 2009 Doc. No. S05949 Page i Contents Executive

  1. Microsoft Word - S06093_VMR.doc

    Office of Legacy Management (LM)

    09 April 2010 LMS/RVT/S06093 This page intentionally left blank LMS/RVT/S06093 Verification Monitoring Report for the Riverton, Wyoming, Processing Site Update for 2009 April 2010 This page intentionally left blank U.S. Department of Energy Riverton, Wyoming, Verification Monitoring Report April 2010 Doc. No. S06093 Page i Contents 1.0 Introduction ........................................................................................................................1-1 2.0 Site Conditions

  2. Microsoft Word - S06178_MP.doc

    Office of Legacy Management (LM)

    Rulison Monitoring Plan July 2010 Approved for public release; further dissemination unlimited LMS/RUL/S06178 This page intentionally left blank LMS/RUL/S06178 Rulison Monitoring Plan July 2010 Approved for public release; further dissemination unlimited This page intentionally left blank U.S. Department of Energy Rulison Monitoring Plan July 2010 Doc. No. S06178 Page i Contents 1.0

  3. Microsoft Word - S06182_GCAP.doc

    Office of Legacy Management (LM)

    Groundwater Compliance Action Plan for the Lakeview, Oregon, Processing Site June 2010 LMS/LKP/S06182 This page intentionally left blank LMS/LKP/S06182 Groundwater Compliance Action Plan for the Lakeview, Oregon, Processing Site June 2010 This page intentionally left blank U.S. Department of Energy Groundwater Compliance Action Plan for the Lakeview, Oregon, Processing Site June 2010 Doc. No.S06182 Page i Contents

  4. Microsoft Word - S06596_GW.doc

    Office of Legacy Management (LM)

    Annual Groundwater Report May 2009 through April 2010 September 2010 LMS/MNT/S06596 This page intentionally left blank LMS/MNT/S06596 Monticello Mill Tailings Site Operable Unit III Annual Groundwater Report May 2009 through April 2010 September 2010 This page intentionally left blank U.S. Department of Energy Monticello Mill Tailings Site OU III Annual Groundwater Report May 2009-April 2010 September 2010 Doc. No. S06596 Page i Contents

  5. Microsoft Word - S06654_ESL.doc

    Office of Environmental Management (EM)

    and Geochemical Modeling of Vanadium Contamination in Groundwater New Rifle Processing Site, Colorado July 2010 LMS/RFN/S06654 ESL-RPT-2010-01 This page intentionally left blank LMS/RFN/S06654 ESL-RPT-2010-01 Analysis and Geochemical Modeling of Vanadium Contamination in Groundwater New Rifle Processing Site, Colorado July 2010 This page intentionally left blank U.S. Department of Energy Analysis and Geochemical Modeling of Vanadium Contamination in Groundwater, Rifle, Colorado July 2010 Doc.

  6. Microsoft Word - Appendix A.doc

    Office of Legacy Management (LM)

    Background Information, Remedial Action Histories, Final Site Conditions U.S. Department of Energy Weldon Spring Site LTS&M Plan February 2005 Second Draft Final Doc. No. S00790AG Page A-iii Contents A1.0 Weldon Spring Site Description and History................................................................... A-1 A1.1 Location and Property Ownership .......................................................................... A-1 A1.2 Physiography and

  7. Microsoft Word - Appendix B.doc

    Office of Legacy Management (LM)

    Risk Assessment Information U.S. Department of Energy Weldon Spring Site LTS&M Plan February 2005 Second Draft Final Doc. No. S00790AG Page B-3 Summary of Post-Remediation Risk Status at the Weldon Spring Site Baseline risk assessments addressing both human health and ecological risks were performed as part of the remedial investigation phase of the remedial investigation/feasibility study processes conducted. A limited assessment was performed for the Quarry Bulk Waste Operable Unit (OU)

  8. Microsoft Word - S01382_September2004.doc

    Office of Legacy Management (LM)

    S0138200 Verification Monitoring Report for the Gunnison, Colorado, UMTRCA Title I Processing Site September 2004 Work Performed by S.M. Stoller Corporation under DOE Contract No. DE-AC01-02GJ79491 for the U.S. Department of Energy Office of Legacy Management, Grand Junction, Colorado U.S. Department of Energy Verification Monitoring Report-Gunnison, Colorado September 2004 Doc. No. S0138200 Page iii Contents Acronyms and Abbreviations

  9. Microsoft Word - S06350_EA.doc

    Office of Legacy Management (LM)

    Draft Environmental Assessment Photovoltaic Solar Project at the Durango, Colorado, Site August 2010 LMS/DUD/S06350 DOE/EA 1770 This page intentionally left blank LMS/DUD/S06350 DOE/EA 1770 Draft Environmental Assessment Photovoltaic Solar Project at the Durango, Colorado, Disposal Site August 2010 This page intentionally left blank U.S. Department of Energy Photovoltaic Solar Project at the Durango, Colorado, Site August 2010 Doc. No. S06350 Page i Contents Summary

  10. Microsoft Word - DOE RFI.doc

    Office of Environmental Management (EM)

    Ms. Patricia Hoffman Assistant Secretary United States Department of Energy 1000 Independence Avenue, SW, Room 8H033 Washington, DC 20585 RE: Smart Grid RFI Dear Assistant Secretary Hoffman, Thank you for the opportunity to provide information to the Department of Energy Federal Register Doc. 2010-23251 filed September 16, 2010. With our recent acquisition of Ventyx, ABB is one of the few companies in the smart grid space that can approach the entire smart grid value chain, from distributed

  11. CM300DLFinal.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    CM300 Core Status: new users must complete 2 trouble-free training sessions, pass the Core driver's test and execute a sample exchange exam to to work independently during Core sessions. Flex Status: core users must complete 5 trouble-free sessions and pass the FLEX driver's test to work during Flex sessions. To reserve a CM300 session, go to www/ncem.lbl.gov, click on "Microscope Scheduling", use proposal number and password to log in. You may only sign up for 2 sessions per month,

  12. word2pdf43408.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    YOUR BENEFIT PLAN LOS ALAMOS NATIONAL SECURITY, LLC Retiree Voluntary Accidental Death and Dismemberment Plan (ADD) Questions about Your Coverage In the event You have questions regarding any aspect of Your coverage, You should contact Your Employee Benefits Manager or You may write to us at: The Hartford Group Benefits Division, Customer Service P.O. Box 2999 Hartford, CT 06104-2999 Or call Us at: 1-800-523-2233 When calling, please give Us the following information: 1) the policy number; and

  13. Microsoft Word - Technetium.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Investigations to Identify the Soluble, Non-pertechnetate Species in the High-level Nuclear Waste at the Hanford Site Wayne W. Lukens 1 , David K. Shuh 1 , Norman C. Schroeder 2 , Kenneth R. Ashley 3 1 Lawrence Berkeley National Laboratory, Berkeley, CA 2 Los Alamos National Laboratory, Los Alamos, NM 3 Texas A&M University-Commerce, Commerce, TX Technetium ( 99 Tc) is an abundant fission product that presents a number of challenges for the safe, long-term disposal of high-level nuclear

  14. Microsoft Word - U01804.doc

    Office of Legacy Management (LM)

    0400 GJO-2003-422-TAC GJO-GWTUB 30.13.2-2 UMTRA Ground Water Project Tuba City UMTRA Project Site Semi-Annual Performance Evaluation through August 2002 May 2003 Prepared by U.S. Department of Energy Grand Junction Office Grand Junction, Colorado Work Performed Under DOE Contract No. DE-AC13-02GJ79491 This page intentionally left blank Document Number U0180400 Contents DOE/Grand Junction Office Tuba City UMTRA Project Site Semi-Annual Performance Evaluation May 2003 Page iii Contents 1.0

  15. Microsoft Word - U0195900.doc

    Office of Legacy Management (LM)

    Diffusion Multilayer Sampling of Ground Water in Five Wells at the Tuba City, Arizona, Site February 2004 GJO-2004-589-TAC ESL-RPT-2004-02 ESL-RPT-2004-02 U0195900 Office of Legacy Management Diffusion Multilayer Sampling of Ground Water in Five Wells at the Tuba City, Arizona, Site February 2004 Work Performed by S.M. Stoller Corporation under DOE Contract No. DE-AC01-02GJ79491 for the U.S. Department of Energy, Grand Junction, Colorado Document Number U0195900 Contents DOE/Office of Legacy

  16. Microsoft Word - U0197300.doc

    Office of Legacy Management (LM)

    MSE Cores Tuba City, Arizona, Site March 2004 GJO-2004-591-TAC ESL-RPT-2004-03 ESL-RPT-2004-03 U0197300 Office of Legacy Management Analysis of MSE Cores Tuba City, Arizona, Site March 2004 Work Performed by S.M. Stoller Corporation under DOE Contract No. DE-AC01-02GJ79491 for the U.S. Department of Energy Office of Legacy Management, Grand Junction, Colorado Signature Page Document Number U0197300 Analysis of MSE Cores DOE/Office of Legacy Management Page iv March 2004 End of current text

  17. Microsoft Word - U0197800.doc

    Office of Legacy Management (LM)

    Contaminant Rebound in Ground Water in Extraction Wells at the Tuba City, Arizona, Site April 2004 DOE-LM/GJ625-2004 ESL-RPT-2004-04 ESL-RPT-2004-04 U0197800 Analysis of Contaminant Rebound in Ground Water in Extraction Wells at the Tuba City, Arizona, Site April 2004 Work Performed by S.M. Stoller Corporation under DOE Contract No. DE-AC01-02GJ79491 for the U.S. Department of Energy Office of Legacy Management, Grand Junction, Colorado Signature Page Document Number U0197800 Analysis of

  18. Microsoft Word - Factsheet.doc

    National Nuclear Security Administration (NNSA)

    NEVADA DIVISION OF ENVIRONMENTAL PROTECTION FACT SHEET (Pursuant to NAC 445A.236) Permittee Name: United States Air Force (USAF) 99 th CES/CEV 4349 Duffer Drive, Suite 1601 Nellis AFB, NV 89191-7007 Permit Number: NEV20001 Location: Tonopah Test Range (TTR) Wastewater Treatment Facility (WWTF) WWTF is located 32 miles SE of Tonopah, Nye County, Nevada Latitude: 37° 52' 20" N, Longitude: 116° 47' 12" W Township 1S, Range 46E, Section 11 NW ¼ Wellhead Protection Area: The TTR WWTF is

  19. AL2007-02.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    2.doc&#0; AL2007-02.doc&#0; PDF icon AL2007-02.doc&#0; More Documents & Publications Attached is Policy Flash 2013-34 Department of Energy Acquisition Letter 2013-04 on Executive Compensation Acquisition Letter No. AL 2014-07 Policy Flash 2014-29 Acquisition Letter 2014-07 - Benchmark Compensation Amount for Individual Executive Salary Actions

  20. AcqGuide70pt4.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    pt4.doc&#0; AcqGuide70pt4.doc&#0; PDF icon AcqGuide70pt4.doc&#0; More Documents & Publications Chapter 70 - DOE Management and Operating Contracts 2014-02 Acquistion Letter 2014-01: Management and Operating Contractors' Audit Coverage of Cost-Reimbursement Subcontracts Acquisition Letter No. AL 2014-01

  1. Microsoft Word - AL2005-13.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    3.doc Microsoft Word - AL2005-13.doc PDF icon Microsoft Word - AL2005-13.doc More Documents & Publications PBA2007 Presentation-short-6-19-07DOE&#0; Accident Investigation of the February 7, 2013, Scissor Lift Accident in the West Hackberry Brine Tank-14 Resulting in Injury, Strategic Petroleum Reserve West Hackberry, LA Microsoft Word - AcqGuide37pt1 binney Nov 2010

  2. Using Other Agencies' Contracts

    Broader source: Energy.gov [DOE]

    The Department of Energy's (DOE) use of other agencies contracts has increased in recent years. Other agency contracts include Economy Act interagency agreements, Franchise Fund Organizations,...

  3. Agency Improvement Plan For Fiscal Year 2006 and Fiscal Year 2007 |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy Agency Improvement Plan For Fiscal Year 2006 and Fiscal Year 2007 Agency Improvement Plan For Fiscal Year 2006 and Fiscal Year 2007 Department of Energy Report and Agency Improvement Plan,For Fiscal Year 2006 and Fiscal Year 2007 PDF icon Agency Improvement Plan For Fiscal Year 2006 and Fiscal Year 2007 More Documents & Publications Office of Information Resources (MA-90) Microsoft Word - DOE E-Government Act Report 11.16.06 Final.doc DOE Chief FOIA Officer Report

  4. Microsoft Word - table_20.doc

    Gasoline and Diesel Fuel Update (EIA)

    8 Table 20. Number of natural gas residential consumers by type of service and state, 2013-2014 Alabama 765,957 0 765,957 769,418 0 769,418 Alaska 124,411 0 124,411 126,416 0 126,416 Arizona 1,171,997 6 1,172,003 1,186,788 6 1,186,794 Arkansas R 549,764 0 R 549,764 549,034 0 549,034 California 10,471,814 283,094 10,754,908 10,372,973 408,747 10,781,720 Colorado 1,672,307 5 1,672,312 1,690,576 5 1,690,581 Connecticut 512,110 1,382 513,492 521,460 1,198 522,658 Delaware 155,627 0 155,627 158,502 0

  5. Microsoft Word - table_22.doc

    Gasoline and Diesel Fuel Update (EIA)

    0 Table 22. Number of natural gas industrial consumers by type of service and state, 2013-2014 Alabama 2,876 267 3,143 2,973 271 3,244 Alaska 2 1 3 1 0 1 Arizona 257 126 383 256 130 386 Arkansas 513 507 1,020 531 478 1,009 California 32,662 5,334 37,996 32,266 5,282 37,548 Colorado 946 6,347 7,293 986 6,837 7,823 Connecticut 3,360 1,094 4,454 3,340 877 4,217 Delaware 28 110 138 28 113 141 Florida 166 362 528 165 355 520 Georgia 984 1,258 2,242 887 1,594 2,481 Hawaii 22 0 22 23 0 23 Idaho 109 R

  6. Enter the Post-Doc: The Untapped Sourcing Pipeline

    SciTech Connect (OSTI)

    Boscow, Ryan B.

    2011-07-30

    This article addresses the potential formulation and utilization of an industry-based Post-Doc program in order to create workforce candidate pipelines with targeted universities.

  7. Microsoft Word - DOE_Staffing_Study_Cover.doc | Department of...

    Office of Environmental Management (EM)

    Word - DOEStaffingStudyCover.doc More Documents & Publications 2010 DOE Strategic Sustainability Performance Plan - Report to the White House Council on Environmental...

  8. Doc Cambell's Post Greenhouse Low Temperature Geothermal Facility...

    Open Energy Info (EERE)

    Low Temperature Geothermal Facility Facility Doc Cambell's Post Sector Geothermal energy Type Greenhouse Location Las Cruces, New Mexico Coordinates 32.3123157,...

  9. DOC-DOE China Mission Announcement Press Release | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Press Release More Documents & Publications DOC-DOE Joint China Mission Statement China 2015 Business Development Mission Marketing Flyer DOE-LPOEmail-Update001Through11

  10. pocforms06a0399.doc | Department of Energy

    Broader source: Energy.gov (indexed) [DOE]

    More Documents & Publications fleetappforms04f1298.doc&0; OPC Security Whitepaper 3Hardening Guidelines for OPC Hosts Critical Decision 2 (CD-2) Approval Template...

  11. Microsoft Word - S05767_PostClosureInspRpt.doc

    Office of Legacy Management (LM)

    09 Doc. No. S05767 Page A-1 Post-Closure Inspection & Monitoring Report for CAU 417 U.S. Department of Energy Doc. No. S05767 October 2009 Page A-2 U.S. Department of Energy Post-Closure Inspection & Monitoring Report for CAU 417 October 2009 Doc. No. S05767 Page A-3 Post-Closure Inspection & Monitoring Report for CAU 417 U.S. Department of Energy Doc. No. S05767 October 2009 Page A-4 U.S. Department of Energy Post-Closure Inspection & Monitoring Report for CAU 417 October 2009

  12. Microsoft Word - S05827_WCR_Final.doc

    Office of Legacy Management (LM)

    Response to Comments This page intentionally left blank U.S. Department of Energy Well Completion Report for CAU 443 CNTA December 2009 Doc. No. S05827 Page G-1 Well Completion Report for CAU 443 CNTA U.S. Department of Energy Doc. No. S05827 December 2009 Page G-2 U.S. Department of Energy Well Completion Report for CAU 443 CNTA December 2009 Doc. No. S05827 Page G-3 Well Completion Report for CAU 443 CNTA U.S. Department of Energy Doc. No. S05827 December 2009 Page G-4

  13. Microsoft Word - S0130700_Mar 2008Rev June 2008.doc

    Office of Legacy Management (LM)

    NRC Concurrence with Completion of Remedial Action This page intentionally left blank U.S. Department of Energy LTSP for the Falls City, Texas, Disposal Site March 2008 Doc. No. S0130700 Page A-3 LTSP for the Falls City, Texas, Disposal Site U.S. Department of Energy Doc. No. S0130700 March 2008 Page A-4 U.S. Department of Energy LTSP for the Falls City, Texas, Disposal Site March 2008 Doc. No. S0130700 Page A-5 LTSP for the Falls City, Texas, Disposal Site U.S. Department of Energy Doc. No.

  14. Microsoft Word - S0130700_Mar 2008Rev June 2008.doc

    Office of Legacy Management (LM)

    Real Estate Documentation This page intentionally left blank U.S. Department of Energy LTSP for the Falls City, Texas, Disposal Site March 2008 Doc. No. S0130700 Page B-3 LTSP for the Falls City, Texas, Disposal Site U.S. Department of Energy Doc. No. S0130700 March 2008 Page B-4 U.S. Department of Energy LTSP for the Falls City, Texas, Disposal Site March 2008 Doc. No. S0130700 Page B-5 LTSP for the Falls City, Texas, Disposal Site U.S. Department of Energy Doc. No. S0130700 March 2008 Page B-6

  15. Microsoft Word - S0130700_Mar 2008Rev June 2008.doc

    Office of Legacy Management (LM)

    NRC Technical Evaluation Report on Revised LTSP This page intentionally left blank U.S. Department of Energy LTSP for the Falls City, Texas, Disposal Site March 2008 Doc. No. S0130700 Page D-3 LTSP for the Falls City, Texas, Disposal Site U.S. Department of Energy Doc. No. S0130700 March 2008 Page D-4 U.S. Department of Energy LTSP for the Falls City, Texas, Disposal Site March 2008 Doc. No. S0130700 Page D-5 LTSP for the Falls City, Texas, Disposal Site U.S. Department of Energy Doc. No.

  16. Microsoft Word - FFATA Memo 30 March 2007.doc | Department of...

    Broader source: Energy.gov (indexed) [DOE]

    FFATA Memo 30 March 2007.doc More Documents & Publications Policy Flash 2014-35 Rescission of American Recovery and Reinvestment Act Reporting Requirements. Flash2008-44attachment....

  17. Microsoft Word - AL-ARRAGAODeviation 6.12.09.doc | Department...

    Energy Savers [EERE]

    ARRAGAODeviation 6.12.09.doc Microsoft Word - AL-ARRAGAODeviation 6.12.09.doc Microsoft Word - AL-ARRAGAODeviation 6.12.09.doc More Documents & Publications Microsoft Word -...

  18. Microsoft Word - Flash2009dashxxFAC34.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Flash2009dashxxFAC34.doc Microsoft Word - Flash2009dashxxFAC34.doc Microsoft Word - Flash2009dashxxFAC34.doc More Documents & Publications Federal Acquisition Regulation; Federal...

  19. Microsoft Word - Flash2008-08attachmentFAC22.doc | Department...

    Energy Savers [EERE]

    Flash2008-08attachmentFAC22.doc Microsoft Word - Flash2008-08attachmentFAC22.doc Microsoft Word - Flash2008-08attachmentFAC22.doc More Documents & Publications Policy Flash 2013-75...

  20. Microsoft Word - Flash2007-61FACAttachment.doc | Department of...

    Energy Savers [EERE]

    Flash2007-61FACAttachment.doc Microsoft Word - Flash2007-61FACAttachment.doc Microsoft Word - Flash2007-61FACAttachment.doc More Documents & Publications Microsoft Word -...

  1. Microsoft Word - PolicyFlash2007-10Attch2.doc | Department of...

    Energy Savers [EERE]

    PolicyFlash2007-10Attch2.doc Microsoft Word - PolicyFlash2007-10Attch2.doc Microsoft Word - PolicyFlash2007-10Attch2.doc More Documents & Publications Policy Flash 2013-37 Federal...

  2. Microsoft Word - Policy Flash 2008-02.doc | Department of Energy

    Energy Savers [EERE]

    Microsoft Word - Policy Flash 2008-02.doc Microsoft Word - Policy Flash 2008-02.doc More Documents & Publications Microsoft Word - Policy Flash 2008-07.doc Microsoft Word - Policy...

  3. Microsoft Word - Policy Flash 2008-03.doc | Department of Energy

    Energy Savers [EERE]

    Microsoft Word - Policy Flash 2008-03.doc Microsoft Word - Policy Flash 2008-03.doc More Documents & Publications Microsoft Word - Policy Flash 2008-07.doc Microsoft Word - Policy...

  4. Microsoft Word - ARRAGuideAttachment10v1.doc | Department of Energy

    Office of Environmental Management (EM)

    ARRAGuideAttachment10v1.doc Microsoft Word - ARRAGuideAttachment10v1.doc More Documents & Publications Microsoft Word - ARRAAttachment12v1.doc Microsoft Word - DRAFT CRB Interview Guidance

  5. Microsoft Word - table_05.doc

    Gasoline and Diesel Fuel Update (EIA)

    3 Table 5. Number of producing gas wells by state and the Gulf of Mexico, December 31, 2010-2014 Alabama 7,026 7,063 6,327 R 6,165 6,118 Alaska 269 277 185 R 159 170 Arizona 5 5 5 5 5 Arkansas 7,397 8,388 8,538 R 9,843 10,150 California 1,580 1,308 1,423 R 1,335 1,118 Colorado 28,813 30,101 32,000 R 32,468 38,346 Gulf of Mexico 1,852 1,559 1,474 R 1,146 1,400 Illinois 50 40 40 R 34 36 Indiana 620 914 819 R 921 895 Kansas 22,145 25,758 24,697 R 23,792 24,354 Kentucky 17,670 14,632 17,936 R 19,494

  6. DOE HR Guidebook 12_15_05.DOC | Department of Energy

    Office of Environmental Management (EM)

    DOE HR Guidebook 12_15_05.DOC&#0; DOE HR Guidebook 12_15_05.DOC&#0; PDF icon DOE HR Guidebook 12_15_05.DOC&#0; More Documents & Publications Operating Guidelines Appendix A B.DOC&#0; 2 Jun 03 Roles and Responsibilities _CSO Highlighted_.doc&#0; Operating Guidelines Appendix C D.DOC&#0;

  7. Cooperating Agencies | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Cooperating Agencies Cooperating Agencies Selected documents on the topic of Cooperating Agencies under NEPA. December 23, 2004 Reporting Cooperating Agencies in Implementing the...

  8. Microsoft Word - US_Japan_REE_agenda_ver7.doc | Department of...

    Office of Environmental Management (EM)

    Microsoft Word - USJapanREEagendaver7.doc Microsoft Word - USJapanREEagendaver7.doc U.S. - Japan Roundtable on Rare Earth Elements Research PDF icon Microsoft Word -...

  9. OP-PR-0015.001.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    OP-PR-0015.001.doc Begin Shutdown Date: 2000/12/08 To eliminate the possibility of going into a state of operations when people may be working on ladders or in the ring, the following SOP's are required of every shutdown. A shutdown is defined as a period wherein there are no accelerator operations. This procedure is in effect for all scheduled shutdowns and for non-scheduled shutdowns lasting more than 24 hours. 1. The accelerator staff must inform the CAMD staff of a shutdown via e-mail. In

  10. Microsoft Word - S0131700_NOV04.doc

    Office of Legacy Management (LM)

    S0131700 DOE-LM/GJ757-2004 Office of Legacy Management Monument Valley Ground Water Remediation: Pilot Study Work Plan November 2004 Work Performed by S.M. Stoller Corporation under DOE Contract No. DE-AC01-02GJ79491 for the U.S. Department of Energy, Office of Legacy Management, Grand Junction, Colorado This page intentionally left blank U.S. Department of Energy Monument Valley GW Remediation Pilot Study Work Plan November 2004 Doc. No. S0131700 Page 3 Signature Page Authors: J. Waugh, S.

  11. Microsoft Word - S03273_Rev1.doc

    Office of Legacy Management (LM)

    Surface, Hot Creek Valley, Nevada, for Calendar Year 2007 September 2008 Rev. 1 DOE-LM/1558-2007 This page intentionally left blank DOE-LM/1558-2008 Post-Closure Inspection and Monitoring Report for Corrective Action Unit 417: Central Nevada Test Area Surface, Hot Creek Valley, Nevada for Calendar Year 2007 September 2008 Rev. 1 This page intentionally left blank U.S. Department of Energy CY 2007 Post-Closure Inspection & Monitoring Report for CAU 417 September 2008, Rev. 1 Doc. No. S0327300

  12. Microsoft Word - S05069_ROD.doc

    Office of Legacy Management (LM)

    Record of Decision for DOE Areas at the Laboratory for Energy-Related Health Research University of California, Davis September 2009 LMS/LEH/S05069 This page intentionally left blank LMS/LEH/S05069 Record of Decision for DOE Areas at the Laboratory for Energy-Related Health Research University of California, Davis September 2009 This page intentionally left blank U.S. Department of Energy ROD for DOE Areas for LEHR September 2009 Doc. No. S05069, Rev. 0 Page i Contents Acronyms and Abbreviations

  13. Microsoft Word - S06713_SER.doc

    Office of Legacy Management (LM)

    09 August 2010 LMS/WEL/S06713 LMS/WEL/S06713 ENERGY Legacy Management U.S. DEPARTMENT OF U.S. Department of Energy Office of Legacy Management This page intentionally left blank LMS/WEL/S06713 U.S. Department of Energy Office of Legacy Management Weldon Spring Site Environmental Report for Calendar Year 2009 August 2010 This page intentionally left blank U.S. Department of Energy Weldon Spring Site Environmental Report for Calendar Year 2009 August 2010 Doc. No. S06713 Page i Contents

  14. Microsoft Word - U0194500July2005.doc

    Office of Legacy Management (LM)

    4500 GJO-2004-579-TAC Office of Legacy Management Refinement of Conceptual Model and Recommendations for Improving Remediation Efficiency at the Shiprock, New Mexico, Site July 2005 Work Performed by S.M. Stoller Corporation under DOE Contract No. DE-AC01-02GJ79491 for the U.S. Department of Energy Office of Legacy Management, Grand Junction, Colorado This page intentionally left blank U.S. Department of Energy Conceptual Model Refinement and Efficiency Recommendations July 2005 Doc. No.

  15. Microsoft Word - S06401_IC.doc

    Office of Legacy Management (LM)

    Annual Assessment Checklists For Parcels D, H, 4, and 3 and Phase I Land Parcel (Physical Walkover Conducted on April 14, 2009) This page intentionally left blank CHECKLIST WORKSHEET - COMBINED - ALL PARCELS Review of Effectiveness of Institutional Controls U.S. Department of Energy Annual Assessment of the Effectiveness of Site-Wide Institutional Controls June 2010 Doc. No. S06401 Page A-1 Parcels reviewed: D, H, 3, 4, 6, 7, 8, and Phase I (A, B, and C) Preliminary inspections performed on:

  16. Microsoft Word - S06401_IC.doc

    Office of Legacy Management (LM)

    Effectiveness of Site-Wide Institutional Controls Applied to the Former DOE Mound Site Property June 2010 LMS/MND/S06401 This page intentionally left blank LMS/MND/S06401 Annual Assessment of the Effectiveness of Site-Wide Institutional Controls Applied to the Former DOE Mound Site Property June 2010 This page intentionally left blank U.S. Department of Energy Annual Assessment of the Effectiveness of Site-Wide Institutional Controls June 2010 Doc. No. S06401 Page i Contents

  17. energyefficiencyink12schoolsandstateapplications.doc | Department of Energy

    Broader source: Energy.gov (indexed) [DOE]

    energyefficiencyink12schoolsandstateapplications.doc Microsoft Office document icon energyefficiencyink12schoolsandstateapplications.doc More Documents & Publications Energy Efficiency in K-12 Schools & State Applications CERTIFICATE OF AUTHENTICITY Successful Partnerships and Lessons from the Field, Part 1, Webinar Transcript

  18. Microsoft Word - Grant Rating Sheet.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    No Proposed project supports agency education objectives-increasing understanding, awareness and appreciation of the Columbia River system and its many uses? Does it enhance the...

  19. M-90-03-02.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    of Hanford Federal Facility Agreement and Consent Order (HFFACO) requirements M-90-10 and M-90- 11 to accelerate joint agency decisions and schedule establishment...

  20. AcqGuide38pt1.doc

    Broader source: Energy.gov (indexed) [DOE]

    the competitive nature of the purchase. Must agencies conduct Procurement Planning and Market Research before using an FSS contract? Not necessarily. As a general rule, obtaining...

  1. AcqGuide3pt1.doc

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ... General Law at Headquarters, or the local ethics official in the field, can provide ... to your supervisor and your agency ethics official, and F Either reject the ...

  2. Microsoft Word - Renew the Parks.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    cost of PV systems was the biggest concern. To overcome this barrier, the National Park Service will have to form partnerships with other agencies and groups. Potential...

  3. Microsoft Word - ayers_jk.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    and Space Agency Langley Atmospheric Radiation Measurement Project Cloud Products and ... from the surface at various Atmospheric Radiation Measurement (ARM) Program sites, the ARM ...

  4. Federal Agency NEPA Procedures

    Broader source: Energy.gov [DOE]

    Each Federal agency is required to develop NEPA procedures that supplement the CEQ Regulations. Developed in consultation with CEQ, Federal agency NEPA procedures must meet the standards in the CEQ...

  5. Microsoft Word - TSLCC 2007_5_05_08 rev 1.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    TSLCC 2007_5_05_08 rev 1.doc Microsoft Word - TSLCC 2007_5_05_08 rev 1.doc PDF icon Microsoft Word - TSLCC 2007_5_05_08 rev 1.doc More Documents & Publications FY 2007 Total System Life Cycle Cost, Pub 2008 Microsoft Word - TSLCC 2007_5_05_08 rev 1.doc FY 2007 Fee Adequacy, Pub 2008

  6. AcqGuideChapter39pt2.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AcqGuideChapter39pt2.doc&#0; AcqGuideChapter39pt2.doc&#0; PDF icon AcqGuideChapter39pt2.doc&#0; More Documents & Publications Chapter 39 - Acquisition of Information Technology Department of Energy (DOE) Acquisition Guide Microsoft Word - AL2006-08.doc

  7. Microsoft Word - ALonEO13423Last.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ALonEO13423Last.doc Microsoft Word - ALonEO13423Last.doc PDF icon Microsoft Word - ALonEO13423Last.doc More Documents & Publications Microsoft Word - AL2008-05.doc Tri-Party Agreement for Energy Savings Performance Contracts Photovoltaics at DOE's National Renewable Energy Laboratory License

  8. Microsoft Word - FAL2003-03R.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    3-03R.doc Microsoft Word - FAL2003-03R.doc PDF icon Microsoft Word - FAL2003-03R.doc More Documents & Publications Microsoft Word - FAL2003-03Rattach.doc FAL2003-03Attachment.pdf FAL2003-03.pdf

  9. Microsoft Word - FY08AnnualReport.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    FY08AnnualReport.doc Microsoft Word - FY08AnnualReport.doc PDF icon Microsoft Word - FY08AnnualReport.doc More Documents & Publications Microsoft Word - FY09AnnualReportv1.doc Audit Report: IG-0857 Audit Report: OAS-M-13-07

  10. Energy Savings Performance Contracting-Savings Measurement and Verification Transcript 2-24-2011.doc

    Broader source: Energy.gov [DOE]

    Energy Savings Performance Contracting-Savings Measurement and Verification Transcript 2-24-2011.doc

  11. Community Development Finance Institutions-Opportunities for Partnerships with Energy Efficiency Programs Transcript.doc

    Office of Energy Efficiency and Renewable Energy (EERE)

    Community Development Finance Institutions-Opportunities for Partnerships with Energy Efficiency Programs Transcript.doc

  12. Microsoft Word - PPL 970-Materials and Inventory 5-9-05.doc | Department of

    Office of Environmental Management (EM)

    Energy PPL 970-Materials and Inventory 5-9-05.doc Microsoft Word - PPL 970-Materials and Inventory 5-9-05.doc PDF icon Microsoft Word - PPL 970-Materials and Inventory 5-9-05.doc More Documents & Publications Microsoft Word - al95-06.doc DOE-HDBK-1139-2006 ppl970-3.pdf

  13. Microsoft Word - 1_2011_CEG_Update_v2.doc | Department of Energy

    Office of Environmental Management (EM)

    1_2011_CEG_Update_v2.doc Microsoft Word - 1_2011_CEG_Update_v2.doc PDF icon Microsoft Word - 1_2011_CEG_Update_v2.doc More Documents & Publications OPAM Policy Acquisition Guides Microsoft Word - AL2006-07.doc IT Project Management Profile

  14. Microsoft Word - GC Mediation Evaluation _2-06-09_.doc | Department of

    Office of Environmental Management (EM)

    Energy GC Mediation Evaluation _2-06-09_.doc Microsoft Word - GC Mediation Evaluation _2-06-09_.doc PDF icon Microsoft Word - GC Mediation Evaluation _2-06-09_.doc More Documents & Publications Mediation Survey Form Microsoft Word - ARRAAttachment12v1.doc Microsoft Word - DRAFT CRB Interview Guidance

  15. Microsoft Word - S05767_PostClosureInspRpt.doc

    Office of Legacy Management (LM)

    NDEP Correspondence and Record of Review This page intentionally left blank U.S. Department of Energy Post-Closure Inspection & Monitoring Report for CAU 417 October 2009 Doc. No. S05767 Page D-1 Post-Closure Inspection & Monitoring Report for CAU 417 U.S. Department of Energy Doc. No. S05767 October 2009 Page D-2 U.S. Department of Energy Post-Closure Inspection & Monitoring Report for CAU 417 October 2009 Doc. No. S05767 Page D-3 Due Date 12-23-09 Review No. 1 Project Offsites -

  16. Microsoft Word - Appendix M_ContingencyTrees.doc

    Office of Legacy Management (LM)

    M Groundwater Operable Unit Contingency Trees U.S. Department of Energy Weldon Spring Site LTS&M Plan July 2005 Doc. No. S0079000 Page M-3 Figure M-1. Validation and Statistical Evaluation Scheme Weldon Spring Site LTS&M Plan U.S. Department of Energy Doc. No. S0079000 July 2005 Page M-4 Figure M-2. Decision Tree for Objective 1 Data U.S. Department of Energy Weldon Spring Site LTS&M Plan July 2005 Doc. No. S0079000 Page M-5 Figure M-3. Decision Tree for Objective 2 Data Weldon

  17. Microsoft Word - RAP_Central_Plateau_Milestones_Draft_Advice.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    TPA Proposed Changes to Hanford Central Plateau Cleanup Work and Schedule Authors: Cimon, Niles, Catrell, Bouchey, Garnant, Vanni, Mattson, Engstrom, Serres, Leckband Originating Committee: River and Plateau Version #1 :Color: __pink__yellow__green__salmon__purple_X_blue Background (paragraphs numbered to aid review) 1. The Hanford Advisory Board (Board) provides the Tri-Party Agreement (TPA) agencies with policy advice that reflects the Board's core values related to Hanford cleanup. These

  18. Microsoft Word - AcqGuide70pt31A.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AcqGuide70pt31A.doc Microsoft Word - AcqGuide70pt31A.doc PDF icon Microsoft Word - AcqGuide70pt31A.doc More Documents & Publications AcqGuide70pt31.doc&#0; Policy Flash 2014-26 Acquisition Guide Chapter 70.31A - Costs Associated with Whistleblower Actions Microsoft Word - AcqGuide70pt31B.doc

  19. Microsoft Word - NationalPolicyAssurancesAwardTermsFinal81804.doc |

    Office of Environmental Management (EM)

    Department of Energy NationalPolicyAssurancesAwardTermsFinal81804.doc Microsoft Word - NationalPolicyAssurancesAwardTermsFinal81804.doc PDF icon Microsoft Word - NationalPolicyAssurancesAwardTermsFinal81804.doc More Documents & Publications Microsoft Word - National Policy AssurancesAwardTermsREVJuly2005.doc National Policy Assurances to be Incorporated as Award Terms Microsoft Word - NationalPolicyAssurances5-06.doc

  20. Flash2007-02Attachment.doc

    Broader source: Energy.gov (indexed) [DOE]

    April 11, 2005 and April 17, 2006, requiring agencies to publish on the Government-wide point of entry (GPE) or e-Buy the documentation required by the FAR to support the use of...

  1. Microsoft Word - FAC2005-27.doc

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    the Act contain the definitions of minority institution and Hispanic-serving institution. ... and comply with 8.405 and 16.505 in a report to the agency senior procurement ...

  2. Microsoft Word - TR01-18.doc

    Office of Legacy Management (LM)

    Inspection Report for the Weldon Spring, Missouri, Site January 2011 LMS/WEL/S07299 ENERGY Legacy Management U.S. DEPARTMENT OF This report was prepared as an account of work sponsored by an agency of the United States Government. Neither the United States Government nor any agency thereof, nor any of their employees, makes any warranty, express or implied, or assumes any legal liability or responsibility for the accuracy, completeness, or usefulness of any information, apparatus, product, or

  3. Microsoft Word - S08266_App_A-3.doc

    Office of Legacy Management (LM)

    Score 0 Fernald Preserve, Ohio, Wetland Mitigation Monitoring Report U.S. Department of Energy Doc. No. S08266 Appendix A-3, 2011 Amphibian Index of Biotic Integrity Data...

  4. Microsoft Word - ex15-ITER-sept10.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    - ITER UT-B Contracts Div Sept 2010 Page 1 of 1 ex15-ITER-sept10.doc Exhibit 15-ITER Ref: FAR 52.227-17 RIGHTS IN DATA SPECIAL WORKS ITER (Sept 2010) (a) Definitions. (1)...

  5. Petascale Post-Doc Project a Supercomputing Success Story

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Petascale Post-Doc Project a Supercomputing Success Story Petascale Post-Doc Project a Supercomputing Success Story ARRA-funded program takes petascale computing researchers to the next level March 24, 2014 Contact: Kathy Kincade, +1 510 495 2124, kkincade@lbl.gov petascalepostdocs.jpg From left: Jihan Kim, Filipe Maia, Alice Koniges, Robert Preissl, Brian Austin, Wangyi (Bobby) Liu , Kirsten Fagnan and Praveen Narayanan. The first post-doctoral research project centered at the Department of

  6. Experimental Evaluation of DOC Performance Using Secondary Fuel Injection |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy Evaluation of DOC Performance Using Secondary Fuel Injection Experimental Evaluation of DOC Performance Using Secondary Fuel Injection Poster presentation at the 2007 Diesel Engine-Efficiency & Emissions Research Conference (DEER 2007). 13-16 August, 2007, Detroit, Michigan. Sponsored by the U.S. Department of Energy's (DOE) Office of FreedomCAR and Vehicle Technologies (OFCVT). PDF icon deer07_Yetkin.pdf More Documents & Publications Engine Tests of an Active PM

  7. Design Potential of Metal Foil Substrates for Optimized DOC Performance |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy Potential of Metal Foil Substrates for Optimized DOC Performance Design Potential of Metal Foil Substrates for Optimized DOC Performance Poster presentation at the 2007 Diesel Engine-Efficiency & Emissions Research Conference (DEER 2007). 13-16 August, 2007, Detroit, Michigan. Sponsored by the U.S. Department of Energy's (DOE) Office of FreedomCAR and Vehicle Technologies (OFCVT). PDF icon deer07_rice.pdf More Documents & Publications Components for Optimized SCR

  8. Notices ENVIRONMENTAL PROTECTION AGENCY

    Energy Savers [EERE]

    076 Federal Register / Vol. 77, No. 250 / Monday, December 31, 2012 / Notices ENVIRONMENTAL PROTECTION AGENCY [ER-FRL-9006-8] Notice of Intent: Designation of an Expanded Ocean Dredged Material Disposal Site (ODMDS) off Charleston, South Carolina AGENCY: U.S. Environmental Protection Agency (EPA) Region 4. ACTION: Notice of Intent to prepare an Environmental Assessment (EA) for the designation of an expanded ODMDS off Charleston, South Carolina. Purpose: EPA has the authority to designate ODMDSs

  9. Microsoft Word - Vol II_FM.doc

    National Nuclear Security Administration (NNSA)

    2006 EPA/600/R-05/144bF Air Quality Criteria for Lead Volume II of II EPA/600/R-05/144bF October 2006 Air Quality Criteria for Lead Volume II National Center for Environmental Assessment-RTP Division Office of Research and Development U.S. Environmental Protection Agency Research Triangle Park, NC PREFACE National Ambient Air Quality Standards (NAAQS) are promulgated by the United States Environmental Protection Agency (EPA) to meet requirements set forth in Sections 108 and 109 of the U.S.

  10. Microsoft Word - frm-1901rev1.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Form FRM-1901 ASBESTIFORM SHIPMENT NOTIFICATION Fax to (702) 295-1153 02/14/08 Rev. 01 Page 1 of 1 The generator signed below shall submit this notification to NNSA/NSO at least seven days in advance of arrival of shipment of Asbestiform low-level waste to the Area 5 Radioactive Waste Management Site (RWMS). Generator: Generator Address: Generator Telephone Number: Fax Number: Transporter Name: Transporter Address: Transporter Telephone Number: Fax Number: Waste Stream Identification Number:

  11. NVN-088208 | Open Energy Information

    Open Energy Info (EERE)

    6 months earlier; BLM NOI was just a formality Relevant Numbers Lead Agency Doc Number Serial Number NVN-088208 Lease Numbers NVN-074249 NVN-074250 NVN-074253 NVN-074254 Tiered Doc...

  12. NVN-091276 | Open Energy Information

    Open Energy Info (EERE)

    Type NOI Decision Document Date 20121025 Relevant Numbers Lead Agency Doc Number Serial Number NVN-091276 Lease Numbers NVN-083928 NVN-085708 Tiered Doc DOI-NV-W010-2012-0061...

  13. Microsoft Word - 46ED31B8-1E53-08CF52.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    46ED31B8-1E53-08CF52.doc Microsoft Word - 46ED31B8-1E53-08CF52.doc PDF icon Microsoft Word - 46ED31B8-1E53-08CF52.doc More Documents & Publications Microsoft Word - ARRAAttachment12v1.doc Microsoft Word - DRAFT CRB Interview Guidance.doc Microsoft Word - ARRAGuideAttachment10v1.doc

  14. Microsoft Word - 48D7DF19-707E-28B27A.doc | Department of Energy

    Office of Environmental Management (EM)

    48D7DF19-707E-28B27A.doc Microsoft Word - 48D7DF19-707E-28B27A.doc PDF icon Microsoft Word - 48D7DF19-707E-28B27A.doc More Documents & Publications Microsoft Word - ARRAAttachment12v1.doc Microsoft Word - Fact Sheet Energy Speech 082508 FINAL.doc Microsoft Word - GSP_Charter.doc

  15. NVN-086287 | Open Energy Information

    Open Energy Info (EERE)

    Type NOI Decision Document Date 20081203 Relevant Numbers Lead Agency Doc Number Serial Number NVN-086287 Lease Numbers NVN-074855 Proposed Action Installation and sampling...

  16. NVN-087930 | Open Energy Information

    Open Energy Info (EERE)

    Decision Document Date 20090916 Relevant Numbers Lead Agency Doc Number NVN-087930 Serial Number NVN-087930 Lease Numbers NVN-018423 NVN-076291 NVN-083928 NVN-085708 NVN-085709...

  17. NVN-087809 | Open Energy Information

    Open Energy Info (EERE)

    Decision Document Date 20090612 Relevant Numbers Lead Agency Doc Number NV-087809 Serial Number NV-087809 Lease Numbers NVN-085710 NVN-085711 Proposed Action A Gravity...

  18. NVN-086761 | Open Energy Information

    Open Energy Info (EERE)

    Type NOI Decision Document Date 20090224 Relevant Numbers Lead Agency Doc Number Serial Number NVN-086761 Lease Numbers NVN-079305 NVN-079306 NVN-079307 Proposed Action...

  19. NVN-086286 | Open Energy Information

    Open Energy Info (EERE)

    NOI, POO Decision Document Date 20081201 Relevant Numbers Lead Agency Doc Number Serial Number NVN-086286 Lease Numbers NVN-085722 NVN-085723 NVN-085724 Proposed Action The...

  20. NVN-087791 | Open Energy Information

    Open Energy Info (EERE)

    Type NOI Decision Document Date 20090721 Relevant Numbers Lead Agency Doc Number Serial Number NVN-087791 Lease Numbers NVN-074854 NVN-076298 NVN-076299 NVN-076300 NVN-076301...

  1. NVN-086285 | Open Energy Information

    Open Energy Info (EERE)

    Type NOI Decision Document Date 20081201 Relevant Numbers Lead Agency Doc Number Serial Number NVN-086285 Lease Numbers NVN-083928 NVN-085708 NVN-085709 Proposed Action The...

  2. NVN-088259 | Open Energy Information

    Open Energy Info (EERE)

    Type NOI Decision Document Date 20100317 Relevant Numbers Lead Agency Doc Number Serial Number NVN-088259 Lease Numbers NVN-074308 NVN-074309 Proposed Action Closely spaced...

  3. NVN-087812 | Open Energy Information

    Open Energy Info (EERE)

    Type NOI Decision Document Date 20090721 Relevant Numbers Lead Agency Doc Number Serial Number NVN-087812 Lease Numbers NVN-074854 NVN-076298 NVN-076299 NVN-076300 NVN-076301...

  4. NVN-89274 | Open Energy Information

    Open Energy Info (EERE)

    Type NOI Decision Document Date 20101202 Relevant Numbers Lead Agency Doc Number Serial Number NVN-89274 Lease Numbers NVN-085716 NVN-086893 NVN-088920 Proposed Action...

  5. NVN-087811 | Open Energy Information

    Open Energy Info (EERE)

    Type NOI Decision Document Date 20090721 Relevant Numbers Lead Agency Doc Number Serial Number NVN-087811 Lease Numbers NVN-074854 NVN-076298 NVN-076299 NVN-076300 NVN-076301...

  6. NVN-89534 | Open Energy Information

    Open Energy Info (EERE)

    Date 20110302 Application Document Type NOI Relevant Numbers Lead Agency Doc Number Serial Number NVN-089534 Lease Numbers NVN-083928 NVN-077668 Proposed Action Two thermal...

  7. NVN-89292 | Open Energy Information

    Open Energy Info (EERE)

    Type NOI Decision Document Date 20101202 Relevant Numbers Lead Agency Doc Number Serial Number NVN-089292 Lease Numbers NVN-088435 NVN-088436 NVN-088437 Proposed Action...

  8. United States Environmental Protection Agency

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    t United States Environmental Protection Agency knwronmenrar iwonrrormg Systems Laboratory P.O. 80x 93478 Las Vegas NV 89193-3478 kt'h/ D\)ci/ 4-t i / b I, DOE/DP/DD539/058 May 1987 Research and Development Off-Site Environmental Monitoring Report: 191 qbO Radiation Monitoring Around United States Nuclear Test Areas, Calendar Year 1986 prepared for the United States Department of Energy under Interagency Agreement Number DE-AI08-76DP00539 EPA-600/4-87-017 DOE/DP/00539-058 May 1987 OFF-SITE

  9. Microsoft Word - FAL2004-02.doc

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Subject: Implementation of Fiscal Year (FY) 2004 Legislative Provisions What is the Purpose of this Financial Assistance Letter (FAL)? This FAL provides Contracting Officers and grants personnel guidance for the implementation of certain provisions contained in the Energy and Water Development Appropriations Act, 2004 (Energy & Water Act), Pub. L. 108-137, enacted December 1, 2003 and the Department of Interior and Related Agencies Appropriations Act, 2004 (Interior Act), Pub. L. 108-108,

  10. Microsoft Word - Norwich Final EA.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    36 FINAL ENVIRONMENTAL ASSESSMENT FOR THE NORWICH COGENERATION INITIATIVE, NORWICH, CONNECTICUT U.S. Department of Energy National Energy Technology Laboratory Morgantown, West Virginia March 2011 DOE/EA-1836 FINAL ENVIRONMENTAL ASSESSMENT FOR THE NORWICH COGENERATION INITIATIVE, NORWICH, CONNECTICUT U.S. Department of Energy National Energy Technology Laboratory Morgantown, West Virginia March 2011 DOE/EA-1836 iii March 2011 COVER SHEET Responsible Agency: U.S. Department of Energy (DOE or the

  11. Microsoft Word - 03NESHAP-FINAL.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Standards Hazardous Air Pollutants DOE/NV/11718--929 June 2004 Calendar Year 2003 Prepared by: Bechtel Nevada Post Office Box 98521 Las Vegas, NV 89193-8521 for DISCLAIMER Reference herein to any specific commercial product, process, or service by trade name, trademark, manufacturer, or otherwise, does not necessarily constitute or imply its endorsement, recommendation, or favoring by the U.S. Government or any agency thereof or its contractors or subcontractors. This report has been reproduced

  12. Microsoft Word - 2007_Final.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    402 ECOLOGICAL MONITORING AND COMPLIANCE PROGRAM 2007 REPORT March 2008 Prepared by National Security Technologies, LLC Ecological Services P.O. Box 98521 Las Vegas, NV 89193-8521 DISCLAIMER Reference herein to any specific commercial product, process, or service by trade name, trademark, manufacturer, or otherwise, does not necessarily constitute or imply its endorsement, recommendation, or favoring by the United States Government or any agency thereof or its contractors or subcontractors.

  13. Microsoft Word - NEPA Fact Sheet 082814.doc

    National Nuclear Security Administration (NNSA)

    National Environmental Policy Act The National Environmental Policy Act (NEPA) of 1969 was enacted by Congress to ensure that federal agencies consider the potential environmental impacts of their proposed actions and alternatives before deciding on a course of action. NEPA requires the preparation of an environmental impact statement (EIS) for major federal actions that may significantly affect the quality of the environment. Under NEPA, the term "environment" encompasses both the

  14. Microsoft Word - 01a - Cover.doc

    National Nuclear Security Administration (NNSA)

    Environmental Assessment for Increased Depleted Uranium Use on Target 63-10, Nevada Test and Training Range Prepared for Headquarters Air Combat Command and Nellis Air Force Base, NV September 2006 ACRONYMS AND ABBREVIATIONS AFB Air Force Base AFI Air Force Instruction AFIOH Air Force Institute for Operational Health Air Force United States Air Force API Armor-Piercing Incendiary ATSDR Agency for Toxic Substances and Disease Registry BRAC Base Realignment and Closure CAA Clean Air Act CAF Combat

  15. Microsoft Word - TOC - ALL.doc

    National Nuclear Security Administration (NNSA)

    E E COVER SHEET RESPONSIBLE AGENCY: U.S. Department of Energy, National Nuclear Security Administration TITLE: Final Complex Transformation Supplemental Programmatic Environmental Impact Statement (Complex Transformation SPEIS, DOE/EIS-0236-S4) CONTACTS: For further information on this SPEIS, For general information on the DOE write or call: National Environmental Policy Act (NEPA) process, write or call: Theodore A. Wyka Carol Borgstrom, Director Complex Transformation Office of NEPA Policy

  16. Microsoft Word - TOC - ALL.doc

    National Nuclear Security Administration (NNSA)

    C C CO O OM MP PL LE EXtransfo o or r rm m mat on COVER SHEET RESPONSIBLE AGENCY: U.S. Department of Energy, National Nuclear Security Administration TITLE: Final Complex Transformation Supplemental Programmatic Environmental Impact Statement (Complex Transformation SPEIS, DOE/EIS-0236-S4) CONTACTS: For further information on this SPEIS, For general information on the DOE write or call: National Environmental Policy Act (NEPA) process, write or call: Theodore A. Wyka Carol Borgstrom, Director

  17. Microsoft Word - 0-PEP-6-14-07.doc | Department of Energy

    Energy Savers [EERE]

    Word - 0-PEP-6-14-07.doc Microsoft Word - 0-PEP-6-14-07.doc PSF.pdf More Documents & Publications Sample Project Execution Plan Project Execution Plan Review Module (RM) Microsoft...

  18. Microsoft Word - g413.3-10Final5-6-08.doc | Department of Energy

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    g413.3-10Final5-6-08.doc Microsoft Word - g413.3-10Final5-6-08.doc DOEEVMSGoldCardSep2011.pdf More Documents & Publications EVMS and Project Analysis Standard Operating...

  19. Microsoft Word - FY07AnnualReport.doc | Department of Energy

    Broader source: Energy.gov (indexed) [DOE]

    FY07AnnualReport.doc More Documents & Publications Microsoft Word - FY08AnnualReport.doc Audit Report: IG-0857 Attachment 5 Volume II Pricing Matrix.xls...

  20. Agency-Wide Screening

    Broader source: Energy.gov [DOE]

    Federal agencies face energy-related requirements on new construction projects and major renovations. These Federal requirements range from reductions in fossil-fuel use to specifying the use of...

  1. State Agency Loan Program

    Broader source: Energy.gov [DOE]

    Just over half of all SALP loans are directed to Energy Performance Contracts (EPCs) that the Maryland Department of General Services coordinates with the State’s agencies. These EPCs are typical...

  2. FEMP Best Practices and Lessons Learned for Federal Agency ESPC Projects: Preliminary Assessment

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    5. PRELIMINARY ASSESSMENT (PA) 5.1 To get a useful PA from the ESCO, the agency should provide the ESCO with all relevant current information about the facilities, including energy consumption and previous audits. 5.2 The PA should be only as long as necessary to convey the viability of a project. An example/template of a PA can be found at: http://www1.eere.energy.gov/femp/docs/10_patemplate.docx . 5.3 Set deadlines for PA submission and for agency completion of PA review and response to the

  3. Broad Agency Announcements

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Broad Agency Announcements Broad Agency Announcements World-class experts and capabilities countering all aspects of explosive threats, and aiming predominantly at enhanced detection capabilities. LACED can respond to BAAs, so long as the BAA solicitations satisfies FOA criteria noted in "When LACED can Participate" under the FOAs section. When a BAA is relevant to LACED's unique capabilities and its Department of Energy mission, LACED in general may respond to the BAA on its own.

  4. Microsoft Word - National Policy AssurancesAwardTermsREVJuly2005.doc |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy National Policy AssurancesAwardTermsREVJuly2005.doc Microsoft Word - National Policy AssurancesAwardTermsREVJuly2005.doc PDF icon Microsoft Word - National Policy AssurancesAwardTermsREVJuly2005.doc More Documents & Publications Microsoft Word - NationalPolicyAssurancesAwardTermsFinal81804.doc National Policy Assurances to be Incorporated as Award Terms Microsoft Word - NationalPolicyAssurances5-06

  5. Microsoft Word - Press Release RECOMP 2-8-08 REV FINAL.doc | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Press Release RECOMP 2-8-08 REV FINAL.doc Microsoft Word - Press Release RECOMP 2-8-08 REV FINAL.doc PDF icon Microsoft Word - Press Release RECOMP 2-8-08 REV FINAL.doc More Documents & Publications Microsoft Word - Fact Sheet Energy Speech 082508 FINAL.doc USA RS Basic Contract - Contract No.: DE-RW0000005 Microsoft Word - AL-Consolidated Approps FY 2008 as of feb 21 2008 final

  6. RFQ DE-RQ01-04ME90001.doc | Department of Energy

    Energy Savers [EERE]

    RFQ DE-RQ01-04ME90001.doc&#0; RFQ DE-RQ01-04ME90001.doc&#0; PDF icon RFQ DE-RQ01-04ME90001.doc&#0; More Documents & Publications Ammendment 2.doc Attachment 6 Volume V Pricing Matrix for Optional Enhancements.xls&#0; Operating Guidelines Appendix A B

  7. Microsoft Word - DP_cover_and_front matter_FINAL1.DOC | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy FINAL1.DOC Microsoft Word - DP_cover_and_front matter_FINAL1.DOC PDF icon Microsoft Word - DP_cover_and_front matter_FINAL1.DOC More Documents & Publications Microsoft Word - DP_cover_and_front matter_R1_Draft_3.DOC EA-1552: Final Environmental Assessment Probabilistic Modeling and Phase 2 Decision Making at the West Valley Demonstration Project and the Western New York Nuclear Service Center

  8. advanced_biofuels_pathways_webinar_alt_text.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    advanced_biofuels_pathways_webinar_alt_text.doc advanced_biofuels_pathways_webinar_alt_text.doc advanced_biofuels_pathways_webinar_alt_text.doc Microsoft Office document icon advanced_biofuels_pathways_webinar_alt_text.doc More Documents & Publications Sustainability for the Global Biofuels Industry: Minimizing Risks and Maximizing Opportunities Webinar Transcript "The Promise and Challenge of Algae as Renewable Sources of Biofuels" 9-8-2010 - Transcript NABC Webinar

  9. First NESAP Post-doc Takes on BoxLib

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    First NESAP Post-doc Takes on BoxLib First NESAP Post-doc Takes on BoxLib Brian Friesen to Work with Ann Almgren's Group in CCSE June 22, 2015 brianfriesenphoto Brian Friesen, PhD The first of eight post-doctoral researchers participating in the NERSC Exascale Science Applications Program (NESAP) is now working full time at NERSC. Brian Friesen, a graduate student in computational astrophysics at the University of Oklahoma, joined the NESAP team May 18. He's been assigned to Ann Almgren's group

  10. Microsoft Word - AL-PO-0001-0007.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Authorized List Doc. ID: OP-AL-0001-007.doc Off-Hours Shift Operator Date: 2001/11/20 This policy is effective 11/20/2001 and denotes those individuals who have been authorized for Off-Hours Shift Operation. 1. Alderman, Steven 2. Aigeldinger, Georg 3. Baethke, Niko 4. Bauer, Benjamin 5. Brendebach, Boris 6. Day, Lorraine 7. Desta, Yohannes 8. Doomes, Edward 9. Dust, Reinhard 10. Farquar, George 11. Fluegge, Michael 12. Goettert, Jost 13. Koch, Kevin 14. Kong, Jong Ren 15. Lian, Kun 16. Ling,

  11. Microsoft Word - Appendix D_LegalDescription.doc

    Office of Legacy Management (LM)

    Legal Descriptions and Ownership Information of Institutional Control Areas U.S. Department of Energy Weldon Spring Site LTS&M Plan July 2005 Doc. No. S0079000 Page D-3 Figure D-1. DOE Property Boundary for the Chemical Plant Area Weldon Spring Site LTS&M Plan U.S. Department of Energy Doc. No. S0079000 July 2005 Page D-4 Legal Description for the Chemical Plant Area All that parcel of land lying within St. Charles County, Missouri, comprising the Federal facility identified as the

  12. Microsoft Word - AcqGuide71pt1.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    1pt1.doc Microsoft Word - AcqGuide71pt1.doc PDF icon Microsoft Word - AcqGuide71pt1.doc More Documents & Publications Chapter 71 - Review and Approval of Contract and Financial Assistance Actions SEB Secretariat and Knowledge Manager Policy Flash 2015-09

  13. Microsoft Word - AcqGuide7pt1.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    pt1.doc Microsoft Word - AcqGuide7pt1.doc ACQUISITION PLANNING PDF icon Microsoft Word - AcqGuide7pt1.doc More Documents & Publications Policy Flash 2013-09 ACQUISITION PLANNING Policy Flash 2015-13

  14. Microsoft Word - Brochure_Senior Officials.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Brochure_Senior Officials.doc Microsoft Word - Brochure_Senior Officials.doc PDF icon Microsoft Word - Brochure_Senior Officials.doc More Documents & Publications Preservation of Department of Energy Federal Records Records Management Exit Procedures Procedures for Departing Employees

  15. Microsoft Word - FEMP-State MOU pdf version.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    FEMP-State MOU pdf version.doc Microsoft Word - FEMP-State MOU pdf version.doc PDF icon Microsoft Word - FEMP-State MOU pdf version.doc More Documents & Publications FEMP Peer Review 2001 FEMP Customer Survey Report (Appendices) Federal Utility Partnership Working Group Meeting: Washington Update

  16. Microsoft Word - Fact Sheet Environment 100808 FINAL.doc | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Environment 100808 FINAL.doc Microsoft Word - Fact Sheet Environment 100808 FINAL.doc PDF icon Microsoft Word - Fact Sheet Environment 100808 FINAL.doc More Documents & Publications Major Communications Report May 5, 2009 Major Communications Report April 30, 2009 Major Communications Report April 28, 2009

  17. Microsoft Word - NationalPolicyAssurances5-06.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    NationalPolicyAssurances5-06.doc Microsoft Word - NationalPolicyAssurances5-06.doc PDF icon Microsoft Word - NationalPolicyAssurances5-06.doc More Documents & Publications Microsoft Word - NationalPolicyAssurances907.rtf

  18. Effectiveness of a Diesel Oxidation Catalyst (DOC) to control CO and

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    hydrocarbon emissions from Reactivity Controlled Compression Ignition (RCCI) combustion | Department of Energy Effectiveness of a Diesel Oxidation Catalyst (DOC) to control CO and hydrocarbon emissions from Reactivity Controlled Compression Ignition (RCCI) combustion Effectiveness of a Diesel Oxidation Catalyst (DOC) to control CO and hydrocarbon emissions from Reactivity Controlled Compression Ignition (RCCI) combustion Performance of two commercially available DOCs with different precious

  19. Fact Sheet -- Climate VISION 02-12-031.doc | Department of Energy

    Office of Environmental Management (EM)

    Sheet -- Climate VISION 02-12-031.doc&#0; Fact Sheet -- Climate VISION 02-12-031.doc&#0; PDF icon Fact Sheet -- Climate VISION 02-12-031.doc&#0; More Documents & Publications Meeting President Bush's Climate Change Challenge to Business and Industry Climate Vision Progress Report 2007 Climate VISION Progress Report 2007

  20. Microsoft Word - 2005 FOIA ANNUAL REPORT.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    2005 FOIA ANNUAL REPORT.doc Microsoft Word - 2005 FOIA ANNUAL REPORT.doc report2005.pdf PDF icon Microsoft Word - 2005 FOIA ANNUAL REPORT.doc More Documents & Publications U.S. Department of Energy 2008 Annual FOIA Report Office of Information Resources (MA-90) ANNUAL FOIA REPORT FOR 2009

  1. Microsoft Word - va_Final3a_06-04-032.doc | Department of Energy

    Office of Environmental Management (EM)

    va_Final3a_06-04-032.doc Microsoft Word - va_Final3a_06-04-032.doc PDF icon Microsoft Word - va_Final3a_06-04-032.doc More Documents & Publications DOE F 473.2 Headquarters Facilities Master Security Plan - Chapter 1, Physical Security DOE F 473.2

  2. NDIA_PMSC_SurveillanceGuide_Oct2004.doc | Department of Energy

    Office of Environmental Management (EM)

    NDIA_PMSC_SurveillanceGuide_Oct2004.doc NDIA_PMSC_SurveillanceGuide_Oct2004.doc PDF icon NDIA_PMSC_SurveillanceGuide_Oct2004.doc More Documents & Publications EVMS Surveillance Standard Operating Procedure (ESSOP) NDIA_PMSC_EVMS_IntentGuide_Nov_2006.pdf Enhancing Earned Value (EV) Analysis Using Project Assessment & Reporting System (PARS II) - Road Show Presentation

  3. Microsoft Word - ADR Revised Policy82508Reformatted.doc | Department of

    Office of Environmental Management (EM)

    Energy ADR Revised Policy82508Reformatted.doc Microsoft Word - ADR Revised Policy82508Reformatted.doc PDF icon Microsoft Word - ADR Revised Policy82508Reformatted.doc More Documents & Publications ADR Revised Policy ADR Policy Federal Register Document

  4. Microsoft Word - CHAP02ESH _REVISED1_3.doc | Department of Energy

    Office of Environmental Management (EM)

    CHAP02ESH _REVISED1_3.doc Microsoft Word - CHAP02ESH _REVISED1_3.doc PDF icon Microsoft Word - CHAP02ESH _REVISED1_3.doc More Documents & Publications Chapter 70 - DOE Management and Operating Contracts Regulatory Aspects of ISM COMMENTS&#0;

  5. AcqGuide35pt1rev2.doc | Department of Energy

    Energy Savers [EERE]

    AcqGuide35pt1rev2.doc&0; AcqGuide35pt1rev2.doc&0; AcqGuide35pt1rev2.doc&0; More Documents & Publications Attachment FY2011-58 OPAM Chapter 35 - Research and Development...

  6. Microsoft Word - NONPHMC_CoC.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    CERTIFICATE OF CONFORMANCE Container Identification Number:_________________________________________________ Section 1. Vent The vent that has been installed on this waste container and the waste packaging meet the requirements of HNF-EP-0063, Section 2.11.4. The vent is an approved vent listed in Appendix H of HNF-EP-0063 or has been approved for use. ~ N/A - Vent Not Required Per HNF-EP-0063 ~ Yes - Vent Model Number: Vent Serial Number: Section 2. Certification Signature of this Certificate

  7. Microsoft Word - Attachment A3.doc

    Office of Environmental Management (EM)

    A3 DRAWING NUMBER 51-W-214-W UNDERGROUND FACILITIES TYPICAL DISPOSAL PANEL Waste Isolation Pilot Plant Hazardous Waste Permit November 30, 2010 (This page intentionally blank)...

  8. Microsoft Word - 20050821_Appendix_A.doc

    U.S. Energy Information Administration (EIA) Indexed Site

    0. U.S. Number of Vehicles, Vehicle-Kilometers, Motor Fuel Consumption and Expenditures, 2001 ENERGY INFORMATION ADMINISTRATION HOUSEHOLD VEHICLES ENERGY USE: LATEST A N D TRENDS...

  9. Microsoft Word - AspenMEAReport.doc

    Office of Scientific and Technical Information (OSTI)

    NETL-2002/1182 ASPEN Plus Simulation of CO 2 Recovery Process Final Report Prepared for: National Energy Technology Laboratory P.O. Box 10940, 626 Cochrans Mill Road Pittsburgh, PA 15236-0940 Prepared by: Charles W. White, III EG&G Technical Services, Inc. 3604 Collins Ferry Road Suite 200 Morgantown, West Virginia 26505 September, 2002 ii DISCLAIMER This report was prepared as an account of work sponsored by an agency of the United States Government. Neither the United States Government nor

  10. Microsoft Word - DOE_EA-1454.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    54 Rev. 0 Environmental Assessment Reactivation and Use of Three Former Borrow Sites in the 100-F, 100-H, and 100-N Areas U.S. Department of Energy Richland Operations Office Richland, Washington 99352 March 2003 DOE/EA-1454 Rev. 0 EA for Reactivation and Use of Three Former Borrow Sites in the 100-F, 100-H, and 100-N Areas March 2003 i TABLE OF CONTENTS 1.0 PURPOSE AND NEED FOR AGENCY ACTION ................................................... 1-1 2.0 BACKGROUND

  11. Microsoft Word - HAB adv #147.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    7 Subject: Hanford Budget Process Adopted: April 4, 2003 Page 1 April 4, 2003 Keith Klein, Manager U.S. Department of Energy, Richland Operations P.O. Box 550 (A7-50) Richland, WA 99352 Roy Schepens, Manager U. S Department of Energy, Office of River Protection P.O. Box 450 Richland, WA 99352 John Iani, Regional Administrator U. S. Environmental Protection Agency, Region 10 1200 Sixth Avenue Seattle, WA 98101 Tom Fitzsimmons, Director Washington State Department of Ecology P.O. Box 47600

  12. Microsoft Word - HAB adv #148.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    8 Subject: Hanford Solid Waste EIS Adopted: June 6, 2003 Page 1 June 6, 2003 Keith Klein, Manager U.S. Department of Energy, Richland Operations P.O. Box 550 (A7-50) Richland, WA 99352 Tom Fitzsimmons, Director Washington State Department of Ecology P.O. Box 47600 Olympia, WA 98504-7600 John Iani, Regional Administrator U.S. Environmental Protection Agency, Region 10 1200 Sixth Avenue Seattle, WA 98101 Re: Revised Draft Hanford Solid Waste Environmental Impact Statement Dear Mssrs. Klein,

  13. Microsoft Word - HABAdv#219 ERDF.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    19 Subject: ERDF Expansion - Record of Decision Amendment Adopted: June 5, 2009 Page 1 June 5, 2009 Dave Brockman, Manager U.S. Department of Energy, Richland Operations P.O. Box 550 (A7-50) Richland, WA 99352 Dennis Faulk, Program Manager U.S. Environmental Protection Agency, Region 10 309 Bradley Blvd, Suite 115 (B1-46) Richland, WA 99352 Re: Environmental Restoration Disposal Facility (ERDF) Expansion - Record of Decision (ROD) Dear Messrs. Brockman and Faulk, Background ERDF plays a key role

  14. Microsoft Word - HABAdv#237EECA.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    7 Subject: EE/CA for 105-KE Reactor Decommissioning Adopted: Nov. 5, 2010 Page 1 November 5, 2010 Dave Brockman, Manager U.S. Department of Energy, Office of River Protection P.O. Box 450 (H6-60) Richland, WA 99352 Matt McCormick, Manager U.S. Department of Energy, Richland Operations P.O. Box 550 (A7-50) Richland, WA 99352 Dennis Faulk, Manager U.S. Environmental Protection Agency, Region 10 309 Bradley Blvd,, Suite 115 Richland WA 99352 Jane Hedges, Program Manager Washington State Department

  15. Microsoft Word - HABAdv#251PIP.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    1 Subject: Hanford Public Involvement Plan Adopted: November 4, 2011 Page 1 November 4, 2011 Scott Samuelson, Manager U.S. Department of Energy, Office of River Protection P.O. Box 450 (H6-60) Richland, WA 99352 Matt McCormick, Manager U.S. Department of Energy, Richland Operations P.O. Box 550 (A7-50) Richland, WA 99352 Dennis Faulk, Manager U.S. Environmental Protection Agency, Region 10 309 Bradley Blvd,, Suite 115 Richland WA 99352 Jane Hedges, Program Manager Washington State Department of

  16. Microsoft Word - HABAdv#252LSSC.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    2 Subject: Hanford's 2011 Lifecycle Scope, Schedule, and Cost Report Adopted: November 4, 2011 Page 1 November 4, 2011 Scott Samuelson, Manager U.S. Department of Energy, Office of River Protection P.O. Box 450 (H6-60) Richland, WA 99352 Matt McCormick, Manager U.S. Department of Energy, Richland Operations P.O. Box 550 (A7-50) Richland, WA 99352 Dennis Faulk, Manager U.S. Environmental Protection Agency, Region 10 309 Bradley Blvd,, Suite 115 Richland WA 99352 Jane Hedges, Program Manager

  17. Microsoft Word - NEPA18_Final.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    6415 Rev. 18 Hanford Site National Environmental Policy Act (NEPA) Characterization J. P. Duncan, Editor K. W. Burk M. A. Chamness R. A. Fowler B. G. Fritz P. L. Hendrickson E. P. Kennedy G. V. Last T. M. Poston M. R. Sackschewsky M. J. Scott S. F. Snyder M. D. Sweeney P. D. Thorne September 2007 Prepared for the U.S. Department of Energy under Contract DE-AC05-76RL01830 DISCLAIMER This report was prepared as an account of work sponsored by an agency of the United States Government. Neither the

  18. Microsoft Word - 2012O-01.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    1 Subject: PW 1,3,6 and CW-5 February 10, 2012 Page 1 February 10, 2012 Matt McCormick, Manager U.S. Department of Energy, Richland Operations P.O. Box 550 (A7-50) Richland, WA 99352 Dennis Faulk, Manager U.S. Environmental Protection Agency, Region 10 309 Bradley Blvd,, Suite 115 Richland WA 99352 Jane Hedges, Program Manager Washington State Department of Ecology 3100 Port of Benton Blvd. Richland, WA 99354 Re: PW 1,3,6 and CW-5 Record of Decision Dear Messrs. McCormick, Faulk and Ms. Hedges,

  19. Microsoft Word - Cooper_Tritium.final.doc

    Office of Legacy Management (LM)

    PROCEEDINGS, TOUGH Symposium 2006 Lawrence Berkeley National Laboratory, Berkeley, California, May 15-17, 2006 - 1 - TRITIUM TRANSPORT THROUGH A LOW-PERMEABILITY NATURAL GAS RESERVOIR Clay A. Cooper 1 , Ming Ye 2 , and Jenny Chapman 2 Desert Research Institute 1 2215 Raggio Pkwy Reno, Nevada, 89512, USA E-mail: clay@dri.edu 2 755 E. Flamingo Road Las Vegas, NV 89119, USA ABSTRACT The U.S. Department of Energy and its predecessor agencies conducted a program in the 1960s and 1970s to evaluate

  20. Microsoft Word - Appendix B cover.doc

    National Nuclear Security Administration (NNSA)

    B FEDERAL REGISTER NOTICES 36691 Federal Register / Vol. 74, No. 141 / Friday, July 24, 2009 / Notices Each meeting is scheduled for 6-8 p.m. with an open-house format, during which attendees are invited to speak one-on-one with agency and Project representatives. Project presentations will be given at 6:15 and 7:30 p.m. Attendees are welcome to come and go at their convenience throughout the meeting. The purpose of the scoping meetings is to provide information about the proposed Project,

  1. Microsoft Word - 090713HanfordARRAupdate.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Backgrounder Contacts: July 13, 2009 Geoff Tyree, DOE (509) 376-4171, Geoff_Tyree@rl.gov Cameron Hardy, DOE (509) 376-5365, Cameron_M_Hardy@rl.gov Update on Hiring and Recovery Act Funding at the Hanford Site, Richland Operations Office Projects Total Number of Jobs Saved/Created The total number of jobs saved to date with Recovery Act funding for DOE Richland Operations Office projects is approximately 300. The total number of jobs created to date is approximately 900. New Hires in June

  2. Microsoft Word - VI_12_Degrees Awarded 2015.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    4 - March 31, 2015 Name Year Thesis Title Advisor Present Position Hua Zheng 2014 Density and temperature in quantum nuclear systems A. Bonasera Post Doc. at INFN - Laboratori Nazionali del Sud, Catania, Italy STUDENTS WHO RECEIVED GRADUATE DEGREES FROM NON-THESIS April 1, 2014 - March 31, 2015 Name Year Advisor Present Position Issac Sarver 2014 R. Rapp

  3. Notices ENVIRONMENTAL PROTECTION AGENCY

    Energy Savers [EERE]

    41 Federal Register / Vol. 80, No. 243 / Friday, December 18, 2015 / Notices ENVIRONMENTAL PROTECTION AGENCY [ER-FRL-9024-5] Environmental Impact Statements; Notice of Availability Responsible Agency: Office of Federal Activities, General Information (202) 564-7146 or http://www2.epa.gov/nepa. Weekly receipt of Environmental Impact Statements Filed 12/07/2015 Through 12/11/2015 Pursuant to 40 CFR 1506.9. Notice Section 309(a) of the Clean Air Act requires that EPA make public its comments on

  4. M_16_01_05.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    0, 2402,11:26 AM Change Number M-16-01-05 Federal Facility Agreement and Consent Order Change Control Form Do not use blue ink. Type or print using black ink. Date 12312001...

  5. M_016_01_06.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    5 AM Change Number M-016-01-06 Federal Facility Agreement and Consent Order Change Control Form Do not use blue ink. Type or print using black ink. Date 123101 Originator Phone...

  6. Microsoft Word - A112, Funding.DOC

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of Offers is extended, is not...

  7. Microsoft Word - A100 Funding.DOC

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of Offers is extended, is not...

  8. Microsoft Word - M088.SF30.DOC

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of Offers is extended, is not...

  9. Microsoft Word - M093.SF30.DOC

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of Offers is extended, is not...

  10. Microsoft Word - SF30 A062.DOC

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of offers is extended, is not...

  11. Microsoft Word - M117 Melter.DOC

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of Offers is extended, is not...

  12. Microsoft Word - A113 Funding.DOC

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of Offers is extended, is not...

  13. Microsoft Word - SF30 A056.DOC

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of offers is extended, is not...

  14. Microsoft Word - SF30 A064.DOC

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of offers is extended, is not...

  15. Microsoft Word - SF30 A061.DOC

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of offers is extended, is not...

  16. Microsoft Word - M092.SF30.DOC

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of Offers is extended, is not...

  17. Microsoft Word - A109 Funding.DOC

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of Offers is extended, is not...

  18. Microsoft Word - SF30 A070.DOC

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of offers is extended, is not...

  19. Microsoft Word - SF30 A072.DOC

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of offers is extended, is not...

  20. Microsoft Word - A094_SF30.DOC

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of Offers is extended, is not...

  1. Microsoft Word - M128 Word _2_.DOC

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of Offers is extended, is not...

  2. Microsoft Word - Final A139.DOC

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of Offers is extended, is not...

  3. Microsoft Word - SF30 A060.DOC

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of offers is extended, is not...

  4. Microsoft Word - M068 SF 30.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of offers is extended, is not...

  5. Microsoft Word - A111 Funding.DOC

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of Offers is extended, is not...

  6. Microsoft Word - M071 SF 30.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of offers is extended, is not...

  7. Microsoft Word - M069 SF 30.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of offers is extended, is not...

  8. Microsoft Word - A119 Funding.DOC

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of Offers is extended, is not...

  9. Microsoft Word - SF30 A058.DOC

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of offers is extended, is not...

  10. Microsoft Word - SF30 A059.DOC

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of offers is extended, is not...

  11. Microsoft Word - Final M135.DOC

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of Offers is extended, is not...

  12. Microsoft Word - SF30 A074.DOC

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of offers is extended, is not...

  13. Microsoft Word - Draft A142 _2_.DOC

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of Offers is extended, is not...

  14. Microsoft Word - M134 Word.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of Offers is extended, is not...

  15. Microsoft Word - A105 Funding.DOC

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of Offers is extended, is not...

  16. Microsoft Word - A138- Draft.DOC

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of Offers is extended, is not...

  17. Microsoft Word - A116 Funding.DOC

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of Offers is extended, is not...

  18. Microsoft Word - M090.SF30.DOC

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of Offers is extended, is not...

  19. Microsoft Word - M091.SF30.DOC

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of Offers is extended, is not...

  20. Microsoft Word - A089 Funding.DOC

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of Offers is extended, is not...

  1. Microsoft Word - M066 SF 30.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of offers is extended, is not...

  2. Microsoft Word - fellows_nomination_reworked.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    the National Nuclear Security Administration of the U.S. Department of Energy To be completed for each individual nomination Candidate Last Name: First Name: Middle Initial: Z Number: Organization: Phone: Mail Stop: Email Address: Nominator Last Name: First Name: Middle Initial: Z Number: Organization: Phone: Mail Stop: Email Address: Package Includes (please check all that apply): 1) Table of Contents ____ 2) Letter of Nomination ____ 3) Letters of Endorsement ____ 4) CV/Resume ____ 5)

  3. NVN-91276 | Open Energy Information

    Open Energy Info (EERE)

    Mineral Manager none provided Selected Dates Relevant Numbers Lead Agency Doc Number Serial Number NVN-091276 Data Completion Notes No documents from which to populate page. 9...

  4. NVN-89276 | Open Energy Information

    Open Energy Info (EERE)

    Type NOI Decision Document Date 20101202 Relevant Numbers Lead Agency Doc Number Serial Number NVN-89276 Proposed Action Geochemical survey Documents Serial Register Page:...

  5. NVN-89275 | Open Energy Information

    Open Energy Info (EERE)

    Type NOI Decision Document Date 20101202 Relevant Numbers Lead Agency Doc Number Serial Number NVN-89275 Proposed Action Geophysical surveys. Documents Serial Register Page:...

  6. NVN-89278 | Open Energy Information

    Open Energy Info (EERE)

    Type NOI Decision Document Date 20101202 Relevant Numbers Lead Agency Doc Number Serial Number NVN-89278 Proposed Action Geophysical survey. Documents Serial Register Page:...

  7. NVN-091277 | Open Energy Information

    Open Energy Info (EERE)

    Relevant Numbers Lead Agency Doc Number Serial Number NVN-091277 Proposed Action Conduct water sampling, archaeological surveys, and shallow temperature surveys. Data Completion...

  8. DOE/ID-Number

    Office of Scientific and Technical Information (OSTI)

    M. J. Robinson Pacific Northwest National Laboratory September 2012 FCRD-SWF-2012-000214 DISCLAIMER This information was prepared as an account of work sponsored by an agency of...

  9. Microsoft Word - Annual DOERPT2003.doc

    Office of Scientific and Technical Information (OSTI)

    Title: Integrating P-Wave and S-Wave Seismic Data to Improve Characterization of Oil Reservoirs Type of Report: Annually Reporting Period: September 1, 2002 to August 31, 2003 Author: Innocent J. Aluka Date of Report: January 12, 2004 Grant Number: DE-FG26-00NT40832 Institution: Prairie View A&M University Address: P.O. Box 2516, Prairie View, TX 77446 Telephone: 936-857-4510 Fax Number: 936-857-4148 E-Mail Address: innocent_aluka@pvamu.edu Subcontractor: Bureau of Economic Geology, Austin,

  10. Microsoft Word - S00790AG.doc

    Office of Legacy Management (LM)

    Website: http://www.lm.doe.gov/land/sites/mo/weldon/weldon.htm DOE office in Grand Junction 24-hour toll free security telephone number: (877) 695-5322 DOE-WSS local telephone number: (636) 300-0012 S00790AG DOE-LM/GJ688-2004 Long-Term Surveillance and Maintenance Plan for the U.S Department of Energy Weldon Spring, Missouri, Site February 2005 Work Performed by S.M. Stoller Corporation under DOE Contract No. DE-AC01-02GJ79491 for the U.S. Department of Energy Office of Legacy Management, Grand

  11. Microsoft Word - Append E waterlevels.doc

    Office of Legacy Management (LM)

    Groundwater Level Data Since 2000 This page intentionally left blank Groundwater Levels a ______________________________________________________________________________________________________ a Numbers in parentheses indicate elevation of bottom of well for dry measurements. ______________________________________________________________________________________________________ Well Id Collect Depth to Water Well Id Collect Depth to Water Date Water Elevation Date Water Elevation

  12. Microsoft Word - Attachment A3.doc

    Office of Environmental Management (EM)

    A3 DRAWING NUMBER 51-W-214-W UNDERGROUND FACILITIES TYPICAL DISPOSAL PANEL Waste Isolation Pilot Plant Hazardous Waste Permit November 30, 2010 (This page intentionally blank) Waste Isolation Pilot Plant Hazardous Waste Permit November 30, 2010 PERMIT ATTACHMENT A3 Page A3-1 of 1 Drawing 51-W-214-W Underground Facilities Typical Disposal Panel 1

  13. International Energy Agency

    Broader source: Energy.gov [DOE]

    DOE's market transformation efforts have reached to European and other countries who are part of the international distributed and decentralized energy community. Through its partnership with DOE, the combined heat and power (CHP) program of the International Energy Agency (IEA) conducts research and analysis of CHP markets and deployment efforts around the world and has used lessons learned from U.S. research, development, and deployment efforts to recommend market transformation activities and policies that will lead to new CHP installations worldwide.

  14. Microsoft Word - AAFS_Proposal_VB.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    PROPOSAL FACT SHEET PAC cycle: _ ________ _______ (Do not complete) Date: _ ________ _______ Assigned Experiment Number Title: Experiment Spokesperson and Alternate: Telephone and e-mail: ** Please list all additional Participants and their home institute on a separate sheet or on the proposal itself. Targets: Beams: Energies (MeV): Intensities (pnA): Beam Stop Material: Additional Beam Requirements: Beam Sweeper Yes:___ Period:_______________ Rebuncher/Debuncher Yes:___ Max. Width: __________ps

  15. Microsoft Word - Final Report.doc

    Office of Scientific and Technical Information (OSTI)

    New Cyclotron Targetry to Enhance F-18 Clinical Position Emission Tomography Covering Period: Aug 15, 2004 - Aug 14, 2008 Date of Report: December 19, 2008 Recipient: North Carolina State University, Raleigh NC 27695-7909 Award Number: DE-FG07-04ID14593 Subcontractors: -------- Other Partners: -------- Contact(s): J. Michael Doster, 919-515-3658, doster@eos.ncsu.edu Project Team: Nancy Elizondo, US DOE, Idaho Operations Office Project Objective: This project proposes to develop cyclotron targets

  16. Microsoft Word - FIA-12-0063.doc

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    the Native Hawaiian Legal ) Corporation. ) ) Filing Date: October 12, 2012 ) Case No.: FIA-12-0063 ) ) Issued: October 31, 2012 _______________ Decision and Order _______________ On October 12, 2012, the Native Hawaiian Legal Corporation ("Appellant") filed an Appeal from a determination issued to it on September 11, 2012, by the Golden Field Office (GFO) of the United States Department of Energy (DOE) (FOIA Request Number GO-12-296). In its determination, the GFO responded to the

  17. Microsoft Word - ISDAC_orientation_pkt.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    ORIENTATION PACKAGE ISDAC Field Campaign March 29 - May 2 Fairbanks, Alaska 1 Welcome to Alaska! This information package is to help you become familiar with the area and answer some questions you might have as you arrive. If you have any questions please feel free to contact Debbie at 509.392.1854. Contents Cell Phone Numbers Fairbanks * Campaign Info Site Locations in Fairbanks Badging and Access Mission Schedule Safety Network and Communications Office Equipment * Local Information * Map Cell

  18. Microsoft Word - Actinin_Safinya.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    3 Structure of Actin Cross-linked with α-Actinin: A Network of Bundles Olivier Pelletier, Elena Pokidysheva, Linda S. Hirst, Nate Bouxsein, Youli Li and Cyrus R. Safinya Materials and Physics Departments, Biomolecular Science & Engineering Program, Materials Research Laboratory, University of California, Santa Barbara, California 93106 With the emerging proteomics era, the biosciences community is now challenged to elucidate the structures and functions of a large number of interacting

  19. Microsoft Word - Q00336-Sept- 2004.doc

    Office of Legacy Management (LM)

    652 U.S. Department of Energy Remedial Action Report for the Interim Remedial Action Record of Decision Operable Unit III, Surface Water and Ground Water Monticello Mill Tailings (USDOE) Site, Monticello, Utah EPA CERCLIS Identification Number UT 3890090035 September 2004 Work Performed Under DOE Contract No. for the U.S. Department of Energy Office of Legacy Management. DE-AC01-02GJ79491 Approved for public release; distribution is unlimited. Office of Legacy Management Office of Legacy

  20. Microsoft Word - UPDATE 4 - Unit 4.doc

    Office of Environmental Management (EM)

    4 to: A Dispersion Modeling Analysis of Downwash from Mirant's Potomac River Power Plant Modeling Unit 4 Emissions at Maximum and Minimum Loads ENSR Corporation December 23, 2005 Document Number 10350-002-410 (Update 4) December, 2005 1-1 1.0 INTRODUCTION This report describes dispersion modeling performed for Unit 4 at Mirant's Potomac River Generating Station. The modeling was performed according to the Protocol approved by the Virginia Department of Environmental Quality. The purpose of the

  1. Microsoft Word - FIA-12-0061.doc

    Office of Environmental Management (EM)

    matter of John P. Newton ) ) Filing Date: October 9, 2012 ) Case No.: FIA-12-0061 ) ) Issued: October 31, 2012 _______________ Decision and Order _______________ On October 9, 2012, John P. Newton ("Appellant") filed an Appeal from determinations issued to him on September 6, 2012, and September 12, 2012, by the Office of Information Resources (OIR) of the Department of Energy (DOE) (FOIA Request Numbers HQ-2012-01768-F & HQ-2012-01835-F). In those determinations, OIR responded to

  2. Microsoft Word - PA MP FY02.doc

    National Nuclear Security Administration (NNSA)

    91-Rev. 1 Maintenance Plan for the Performance Assessments and Composite Analyses for the Area 3 and Area 5 Radioactive Waste Management Sites at the Nevada Test Site Prepared by Prepared for U.S. Department of Energy National Nuclear Security Administration Nevada Operations Office under Contract Number DE-AC08-96NV11718 September 2002 DISCLAIMER NOTICE Reference herein to any specific commercial product, process, or service by trade name, trade mark, manufacturer, or otherwise does not

  3. Number | Open Energy Information

    Open Energy Info (EERE)

    Property:NumOfPlants Property:NumProdWells Property:NumRepWells Property:Number of Color Cameras Property:Number of Devices Deployed Property:Number of Plants included in...

  4. 2009 Federal Register, 74 FR 50239; Centralized Library: U.S. Fish and Wildlife Service - FR Doc E9-23556

    National Nuclear Security Administration (NNSA)

    0239 Federal Register / Vol. 74, No. 188 / Wednesday, September 30, 2009 / Notices Dated: July 13, 2009. Cynthia K. Dohner, Acting Regional Director. [FR Doc. E9-23559 Filed 9-29-09; 8:45 am] BILLING CODE 4310-55-P DEPARTMENT OF THE INTERIOR Fish and Wildlife Service [FWS-R8-ES-2009-N141; 80221-1112- 0000-F2] Amendment of the Clark County Multiple Species Habitat Conservation Plan and Issuance of an Amended Incidental Take Permit, Clark County, NV AGENCY: Fish and Wildlife Service, Interior.

  5. Microsoft Word - AppendixH_CommentResponse.doc

    Office of Legacy Management (LM)

    NFSS Vicinity Property Report October 2010 Doc. No. S06246 Page H-1 Responsiveness Summary The U.S. Department of Energy (DOE) released the Formerly Utilized Sites Remedial Action Program Niagara Falls Storage Site Vicinity Properties, New York: Review of Radiological Conditions at Six Vicinity Properties and Two Drainage Ditches on April 23, 2010, for public comment. Report availability was announced through a message to stakeholders sent on behalf of DOE by USACE. The announcement provided a

  6. Microsoft Word - S04674_2008VMR.doc

    Office of Legacy Management (LM)

    for the Durango, Colorado, Processing Site September 2008 LMS/DUP/S04674 This page intentionally left blank LMS/DUP/S04674 Office of Legacy Management Verification Monitoring Report for the Durango, Colorado, Processing Site September 2008 This page intentionally left blank U.S. Department of Energy Verification Monitoring Report-Durango, Colorado, Processing Site September 2008 Doc. No. S0467400 Page iii Contents Acronyms and Abbreviations

  7. Microsoft Word - S05767_PostClosureInspRpt.doc

    Office of Legacy Management (LM)

    2009 Revegetation Success Monitoring This page intentionally left blank 2009 Revegetation Success Monitoring Central Nevada Test Area Corrective Action Unit 417 UC-1 Central Mud Pit This page intentionally left blank U.S. Department of Energy Post-Closure Inspection & Monitoring Report for CAU 417 October 2009 Doc No. S05767 Page C-i Contents 1.0 Introduction and Purpose ..................................................................................................C-1 2.0 Monitoring

  8. Microsoft Word - S05775_2009 VMR.doc

    Office of Legacy Management (LM)

    Report for the Old and New Rifle, Colorado, Processing Sites September 2009 LMS/RFO/RFN/S05775 This page intentionally left blank LMS/RFO/RFN/S05775 2009 Verification Monitoring Report for the Old and New Rifle, Colorado, Processing Sites September 2009 This page intentionally left blank U.S. Department of Energy 2009 Verification Monitoring Report for the Old and New Rifle, Colorado, Processing Sites September 2009 Doc. No. S05775 Page i Contents

  9. Microsoft Word - S07012_RFL_2010_VMR_LEC.doc

    Office of Legacy Management (LM)

    Old and New Rifle, Colorado, Processing Sites September 2010 LMS/RFO/RFN/S07012 This page intentionally left blank LMS/RFO/RFN/S07012 2010 Verification Monitoring Report for the Old and New Rifle, Colorado, Processing Sites September 2010 This page intentionally left blank U.S. Department of Energy 2010 Verification Monitoring Report for the Old and New Rifle, Colorado, Processing Sites September 2010 Doc. No. S07012 Page i Contents

  10. Microsoft Word - S07033_2nd qtr 2010.doc

    Office of Legacy Management (LM)

    Second Quarter Calendar Year 2010 October 2010 LMS/RFS/S07033 This page intentionally left blank LMS/RFS/S07033 U.S. Department of Energy Office of Legacy Management Rocky Flats Site Quarterly Report of Site Surveillance and Maintenance Activities Second Quarter Calendar Year 2010 October 2010 This page intentionally left blank U.S. Department of Energy Quarterly Report of Site Surveillance and Maintenance Activities-2nd Quarter CY 2010 October 2010 Doc. No. S07033 Page i Contents

  11. Microsoft Word - NO1113_Dewatering report.doc

    Office of Legacy Management (LM)

    Hydrologic Assessment of Dewatering for Installation of the Belcher Road Water Transmission Line This page intentionally left blank U.S. Department of Energy Dewatering Evaluation Report for Road Const. & Water Line Replacement June 2008 Doc. No. N0111300 Page C-3 The rate of pumping resulting from aquifer dewatering for installation of the planned water transmission line beneath Belcher Road is expected be larger than any of the discharge rates associated with drainage infrastructure

  12. Microsoft Word - S04801_Avian2008 _2_ revised.doc

    Office of Legacy Management (LM)

    Final Report Avian Wetland Surveys at Monticello Mill Tailings Site, 2008 November 2008 LMS/MNT/S04801 This page intentionally left blank LMS/MNT/S04801 Final Report Avian Wetland Surveys at Monticello Mill Tailing Site, 2008 November 2008 This page intentionally left blank U.S. Department of Energy Avian Wetland Surveys at Monticello Mill Tailing Site, 2008 November 2008 Doc. No. S0480100 Page i Contents 1.0 Summary

  13. Microsoft Word - S04816_InvestigationPlan.doc

    Office of Legacy Management (LM)

    New Brunswick, New Jersey, Site Investigation Plan to Identify Potential Radiological Contamination in a Sanitary Sewer December 2008 LMS/NBL/S04816 This page intentionally left blank New Brunswick, New Jersey, Site Investigation Plan to Identify Potential Radiological Contamination in a Sanitary Sewer December 2008 This page intentionally left blank U.S. Department of Energy Investigation Plan to Identify Contamination in a Sanitary Sewer December 2008 Doc. No. S0481600 Page i Contents 1.0

  14. Microsoft Word - S04877_AnnInspRpt2008.doc

    Office of Legacy Management (LM)

    Annual Inspection of the Monticello Mill Tailings (USDOE) and Monticello Radioactively Contaminated Properties Sites December 2008 LMS/MNT/S04877 This page intentionally left blank LMS/MNT/S04877 2008 Annual Inspection of the Monticello Mill Tailings (USDOE) and Monticello Radioactively Contaminated Properties Sites December 2008 This page intentionally left blank U.S. Department of Energy 2008 Annual Inspection-Monticello, Utah December 2008 Doc. No. S487700 Page i Contents Executive

  15. Microsoft Word - S04929_GW_Mon_NDEP_Final.doc

    Office of Legacy Management (LM)

    Groundwater Monitoring Report Central Nevada Test Area, Corrective Action Unit 443 March 2009 Rev. 1 LMS/CNT/S04929 This page intentionally left blank LMS/CNT/S04929 2008 Groundwater Monitoring Report Central Nevada Test Area, Corrective Action Unit 443 March 2009 Rev. 1 This page intentionally left blank U.S. Department of Energy 2008 Groundwater Monitoring Report-CNTA, CAU 443 March 2009 Doc. No. S04929 Rev. 1 Page i Contents 1.0

  16. Microsoft Word - S04932 History final.doc

    Office of Legacy Management (LM)

    FUSRAP History of the Chupadera Mesa, NM, Site December 2008 Doc. No. S0493200 (FUSRAP NM.04-5) Page 1 of 9 FUSRAP History of the Chupadera Mesa, NM, Site The following historical summary is provided to document the inclusion of the Chupadera Mesa, NM, Site into the Formerly Utilized Sites Remedial Action Program (FUSRAP). Although no remedial action was required, the site met eligibility criterion and was included under FUSRAP, under which the final radiological surveys were performed.

  17. Microsoft Word - S05072_WaterQualityComplStrategy.doc

    Office of Legacy Management (LM)

    Water Quality Compliance Strategy December 2009 LMS/MNT/S05072 This page intentionally left blank LMS/MNT/S05072 Monticello Mill Tailings Site Operable Unit III Water Quality Compliance Strategy December 2009 This page intentionally left blank U.S. Department of Energy MMTS Water Quality Compliance Strategy December 2009 Doc. No. S05072 Page i Contents 1.0 Introduction......................................................................................................................... 1 1.1

  18. Microsoft Word - S05378_2009 GW Rpt.doc

    Office of Legacy Management (LM)

    08 through April 2009 October 2009 LMS/MNT/S05378 This page intentionally left blank LMS/MNT/S05378 Monticello Mill Tailings Site Operable Unit III Annual Groundwater Report May 2008 through April 2009 October 2009 This page intentionally left blank U.S. Department of Energy Monticello Mill Tailings Site OU III Annual Groundwater Report May 2008-April 2009 October 2009 Doc. No. S05378 Page i Contents

  19. Microsoft Word - S05551_1stqtr report.doc

    Office of Legacy Management (LM)

    09 July 2009 LMS/RFS/S05551 This page intentionally left blank LMS/RFS/S05551 U.S. Department of Energy Office of Legacy Management Rocky Flats Site Quarterly Report of Site Surveillance and Maintenance Activities First Quarter Calendar Year 2009 July 2009 This page intentionally left blank U.S. Department of Energy Quarterly Report of Site Surveillance and Maintenance Activities-1st Quarter CY 2009 July 2009 Doc. No. S05551 Page i Contents

  20. Microsoft Word - S05837_FFA 4th qtr 09.doc

    Office of Legacy Management (LM)

    July 1-September 30, 2009 October 2009 Doc. No. S05837 Page 1 Monticello National Priorities List Sites Federal Facilities Agreement (FFA) Quarterly Report: July 1-September 30, 2009 This report summarizes project status and activities implemented July through September 2009, and provides a schedule of near-term activities for the Monticello Mill Tailings Site (MMTS) and the Monticello Vicinity Properties (MVP) sites. This report also includes disposal cell and Pond 4 leachate collection data,