National Library of Energy BETA

Sample records for affix mailing label

  1. Mailing List Subscription

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mail and Distribution Mail and Distribution The DOE Mail Center provides a variety of mail services for all official and other authorized mail for the Department of Energy and its employees. The services provided include the processing of all incoming postal mail, outgoing official mail, internal mail processing, accountable mail processing, pouch mail, a variety of overnight express mail services, directory services, and pick-up and delivery services. The Mail Management Memorandum (pdf)

  2. Electronic Mail Analysis Capability

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    2001-01-08

    Establishes the pilot program to test the Department of Energy (DOE) Electronic Mail Analysis Capability (EMAC), which will be used to monitor and analyze outgoing and incoming electronic mail (e-mail) from the National Nuclear Security Administration (NNSA) and DOE laboratories that are engaged in nuclear weapons design or work involving special nuclear material. No cancellation.

  3. Mail Services User's Manual

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    2000-07-12

    This Manual provides detailed information on using the Department of Energy (DOE) mail services. Canceled by DOE G 573.1-1.

  4. mail_paycheck_111609

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Updated:
11/16/09
 P.O Box 1663 Los Alamos, New Mexico 87544 MAIL PAYCHECK FORM TO: CRAFT PAYROLL DEPARTMENT - P238 FROM: (Please Print) Z# ORG CODE PLEASE MAIL MY PAYCHECK, TO THE ADDRESS ON FILE WITH PAYROLL, FOR THE PAY PERIOD BEGINNING: EMPLOYEE SIGNATURE Z# DATE SUPERVISOR SIGNATURE Z# DATE

  5. Request Repository Mailing List

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Policies User Surveys NERSC Users Group User Announcements Help Staff Blogs Request Repository Mailing List Operations for: Passwords & Off-Hours Status 1-800-66-NERSC, option 1 or 510-486-6821 Account Support https://nim.nersc.gov accounts@nersc.gov 1-800-66-NERSC, option 2 or 510-486-8612 Consulting http://help.nersc.gov consult@nersc.gov 1-800-66-NERSC, option 3 or 510-486-8611 Home » For Users » Request Repository Mailing List Request Repository Mailing List Use this form to request a

  6. Mail and Distribution | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Mail and Distribution Mail and Distribution The DOE Mail Center provides a variety of mail services for all official and other authorized mail for the Department of Energy and its employees. The services provided include the processing of all incoming postal mail, outgoing official mail, internal mail processing, accountable mail processing, pouch mail, a variety of overnight express mail services, directory services, and pick-up and delivery services. The Mail Management Memorandum (pdf)

  7. By Certified Mail May

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    By Certified Mail May 4,2012 Dorothy Riehle FOIA Office U.S. Department of Energy P. O. Box 550 Richland, WA 99352 Re: FOIA RequestLand Transfer Dear Ms. Riehle: Pursuant to the...

  8. By E-Mail

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    By E-Mail May 29, 2012 Dorothy Riehle FOIA Office U.S. Department of Energy P. O. Box 550 Richland, WA 99352 Re: FOIA RequestTank Inventories Dear Ms. Riehle: Pursuant to the...

  9. Mail Services | The Ames Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mail Management Memorandum, July 2, 2010 Mail Management Memorandum, July 2, 2010 Mail Management Memorandum prescribing policy and requirements for the effective, economical, and secure management of incoming, internal, and outgoing mail in Federal agencies. These requirements pertain to all DOE offices, and may also apply to national laboratories and other contractor facilities, depending on whether they qualify as Federal facilities as defined in the regulations. PDF icon Mail Management

  10. PDSF Mailing Lists

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mailing Lists PDSF Mailing Lists pdsf-status@nersc.gov This is voluntary. You have to subscribe to it. This list can be chatty, since major and minor problems are sent to this list. Also multiple status updates will be sent for extended outages. Subscribe: Send email to pdsf-status-request@nersc.gov with subscribe in the subject of the message. Unsubscribe: Send email to pdsf-status-request@nersc.gov with unsubscribe in the subject of the message. pdsf-users@nersc.gov Users are subscribed to

  11. Mail Services User's Guide

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    2005-10-03

    This Guide provides information on using Department of Energy (DOE) mail services in accordance with U.S. Postal Service, General Services Administration (GSA), and DOE regulations. Cancels DOE M 573.1-1. Canceled by DOE N 251.89.

  12. Mailing List Subscription

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mailing List Subscription Jefferson Lab Home Search Contact JLab Descriptions A - C autocad: No description available briefs: On-Target Briefs cctest-alert: No description available clas_drift_chambers: Hall B Drift Chambers Group clas_offline: Discussion group for CLAS RECSIS group clas_slow_control: CLAS slow control working group clas_strangep: Hall B Strange Particles using CLAS discussion group clas_tof: CLAS Time of Flight Collaboration credit-card: List of JLab Credit Card buyers csc_all:

  13. Printing and Mail Managers Exchange Forum Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    May 16, 2013 Mail discussion Joe Whitford opened the meeting by introducing Al Majors to talk about mail related items. 1) Update on the USPS mail name changes. If approved by the Postal Regulatory Commission the following name changes will go into effective July 28, 2013: a. Express Mail will be called Priority Mail Express b. Express Mail International will be Priority Mail International c. Express Mail Corporate Account will become USPS Express Corporate Account Only the names of these

  14. LLNL E-Mail Utilities

    Energy Science and Technology Software Center (OSTI)

    2005-10-31

    The LLNL E-mail Utilities software library is a Java API that simplifies the creation and delivery of email in Java business applications. It consists of a database-driven template engine, various strategies for composing, queuing, dispatching email and a Java Swing GUI for creating and editing email templates.

  15. Mail Management Memorandum, July 2, 2010 | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Mail Management Memorandum, July 2, 2010 Mail Management Memorandum, July 2, 2010 Mail Management Memorandum prescribing policy and requirements for the effective, economical, and ...

  16. Minutes from the Print and Mail Managers Exchange Forum Teleconference...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Minutes from the Print and Mail Managers Exchange Forum Teleconferences Minutes from the Print and Mail Managers Exchange Forum Teleconferences Minutes from the Print and Mail...

  17. Field Facilities Contacts for Printing and Mail

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Field Facilities Contacts for Printing and Mail Print and Mail Contacts Site Printing Contact Mail Contact NNSA, Albuquerque Deborah Miller (505) 845-6049 Thomas H. Clinkenbeard NNSA Service Center PO Box 5400 Albuquerque, NM 87185-5400 (505) 845-4602 tclinkenbeard@doeal.gov (mailto:tclinkenbeard@doeal.gov) Argonne National Laboratory Doreen Schoening Argonne National Laboratory U.S. Department of Energy 9700 South Cass Avenue Blvd 340 Lemonmt, IL 60439 (630) 840-6399 dschoening@anl.gov

  18. Printing and Mail Managers Exchange Forum Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    November 21, 2013 Mail Managers discussion Joe Whitford opened the meeting by introducing Tony Nellums to talk about mail related items. 1) Mr. Nellums introduced Derek Milner, Policy Advisor from the GSA Office of Government-wide policy. a. Mr. Milner stated that he is being replaced as primary policy contact by Linda Willoughby (Linda.Willoughby@gsa.gov) or (202) 219-1083. b. Initiatives discussed by Mr. Milner included: Upcoming mail reports. The SMART system is online and available now.

  19. Minutes from the January 10, 2013 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    January 10, 2013 Mail discussion Al Majors opened the meeting by discussing the Mail Management Report and latest update on status. One final report is yet to be submitted, after which close out will be accomplished. Copies will be provided to the Mail Managers once completed. Al introduced Derrick Miliner, Program Manager from the General Services Administration, Office of Government-wide Policy, and acknowledged Mr. Miliner's role in completing the Mail Management Report. Mail Security Plans A

  20. Field Facilities Contacts for Printing and Mail | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Field Facilities Contacts for Printing and Mail Field Facilities Contacts for Printing and Mail This is the list of DOE field facilities contacts for Printing and Mail as of April 27, 2011. Go to Mail Services Go to Printing Services PDF icon Field_Facilities_Contacts_Print-Mail.pdf More Documents & Publications Director's Perspective by George Miller Tenant Education and Training Fire Safety Committee Membership List

  1. Read Your E-mail | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Read Your E-mail All Argonne employees can read their e-mail through the web. Argonne E-Mail service is a robust, reliable electronic communication solution for supporting day-to-day business activities. Features include e-mail, calendar, task lists, and contact lists. While it is designed to work Microsoft Outlook, it also works with other POP- and IMAP-based clients. All employees can read their e-mail through the web. Use the login link at right to get started. Login to E-mail

  2. T-618: Debian update for exim4: Mail Transport Agent

    Broader source: Energy.gov [DOE]

    It was discovered that Exim, the default mail transport agent in Debian, uses DKIM data obtain from DNS directly in a format string, potentially allowing malicious mail senders to execute arbitrary code.

  3. Minutes from the January 19, 2011 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    January 2010 Printing and Mail Managers Exchange Forum Teleconference Twenty-one individuals participated in the Printing and Mail Managers Exchange Forum, which included Printing and Mail Managers and Contractors Comments/Additions to last Months Minutes No comments. Printing Agenda Items......... Update on the Department-wide FY-2010 Three-Year Plan Dallas Woodruff, Headquarters in formed the group that the Department-wide Printing and Publishing Activities is currently in the concurrence

  4. Minutes from the January 20, 2010 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    , 2010 Printing and Mail Managers Exchange Forum Teleconference Twenty-one individuals participated in the Printing and Mail Managers Exchange Forum, which included Printing and Mail Managers and Contractors. Comments/Additions to last Months Minutes Dallas Woodruff, Headquarters opened the meeting by thanking everyone for participating in the today's teleconference. Printing Agenda Items... Update on the Department-wide Printing and Publishing Activities Report Three-Year Plan. Dallas Woodruff,

  5. Minutes from the July 21, 2010 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    July 21, 2010 Printing and Mail Managers Exchange Forum Teleconference Twenty-one individuals participated in the Printing and Mail Managers Exchange Forum, which included Printing and Mail Managers and Contractors. Comments/Additions to last Months Minutes Dallas Woodruff, Headquarters opened the meeting by thanking everyone for participating in the today's teleconference. Printing Agenda Items... Update on the Government Printing Office revisions to the Standard Form one (SF!), Twenty-five

  6. Minutes from the June 28, 2012 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    June 28, 2012 Mail discussion Al Majors opened the meeting by introducing United Parcel Service (UPS) Representative Shelly Scott. Ms. Scott's contact information is: Shelly Scott shellyscott@ups.com 404 402-9827 (cell) Ms. Scott discussed issues relating to various UPS services available to the department. Next Al introduced Michael R. Sanders, President and Chief Executive Officer of Intra-Mail Network, an innovative, information Technology Company that improves the delivery of mail or email

  7. Minutes from the May 26, 2010 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    26, 2010 Printing and Mail Managers Exchange Forum Teleconference Seventeen individuals participated in the Printing and Mail Managers Exchange Forum, which included Printing and Mail Managers and Contractors. Comments/Additions to last Months Minutes Dallas Woodruff, Headquarters opened the meeting by thanking everyone for participating in the today's teleconference. Printing Agenda Items... Update on the FY 2010, Congressional Joint Committee on Printing Commercial Printing Report "JCP

  8. Minutes from the November 01, 2012 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    November 1, 2012 Mail discussion Al Majors opened the meeting by introducing Derrick Milner, Program Manager from the General Services Administration, Office of Government-wide Policy. Mr. Majors and Mr. Miliner discussed the pending Official Mail Management Report for the FY-2012. The question on where to put data relating to certified and registered mail was addressed. It should be placed under the others section or under first class, standard delivery. Mr. Majors also discussed the pending

  9. Minutes from the November 17, 2010 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    November 17, 2010 Printing and Mail Managers Exchange Forum Teleconference Twenty seven individuals participated in the Printing and Mail Managers Exchange Forum, which included Printing and Mail Managers and Contractors Comments/Additions to last Months Minutes No comments. Printing Agenda Items......... Update on the Department-wide "Three-Year Plan" Dallas Woodruff, Headquarters opened the meeting by thanking everyone for providing their sites Three-Year Plan data to Headquarters in

  10. Minutes from the September 15, 2010 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    September 15, 2010 Printing and Mail Managers Exchange Forum Teleconference Twenty-four individuals participated in the Printing and Mail Managers Exchange Forum, which included Printing and Mail Managers and Contractors. Comments/Additions to last Months Minutes Dallas Woodruff, Headquarters opened the meeting by thanking everyone for participating in the today's teleconference. Printing Agenda Items... Upcoming FY 2010 Department-wide Three-Year Plan Dallas Woodruff, Headquarters informed the

  11. Headquarters Program & Staff Office Mailing Addresses | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Headquarters Program & Staff Office Mailing Addresses Headquarters Program & Staff Office Mailing Addresses The following addresses are for delivery of regular mail and small packages: Delivery to the Headquarters buildings in Washington, DC: Name of Individual Title Routing Symbol/Forrestal Building U.S. Department of Energy 1000 Independence Ave., S.W. Washington, DC 20585 Name of Individual Title Routing Symbol/L'Enfant Plaza Building U.S. Department of Energy 1000

  12. Mail-Order Metal-Organic Frameworks (MOFs): Designing Isoreticular...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mail-Order Metal-Organic Frameworks (MOFs): Designing Isoreticular MOF-5 Analogues Comprising Commercially Available Organic Molecules Previous Next List R. L. Martin, L.-C. Lin,...

  13. Minutes from the Print and Mail Managers Exchange Forum Teleconferences

    Broader source: Energy.gov [DOE]

    Minutes from the Print and Mail Managers Exchange Forum Teleconferences.  Contact the Office of Administrative Management and Support at (202) 586-4318 with any questions.

  14. Minutes from the May 3, 2012 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    http:www.gsa.govmailpolicy (for training options) https:www.intra-mail.com ... discussion Brainstorming discussion on methodsapproaches to reduce printing expenses: ...

  15. Minutes from the October 26, 2011 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Woodruff also said the files are due back to Headquarters no later November 11, 2011, and the report is due to congress by February 10, 2012. Mail Agenda Items...... Fiscal ...

  16. The Future of Electric Vehicles and Arizona State University's MAIL

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Battery | Department of Energy The Future of Electric Vehicles and Arizona State University's MAIL Battery The Future of Electric Vehicles and Arizona State University's MAIL Battery August 11, 2010 - 4:26pm Addthis Cody Friesen and his team at Arizona State University | Photo Credit Arizona State University Cody Friesen and his team at Arizona State University | Photo Credit Arizona State University Andy Oare Andy Oare Former New Media Strategist, Office of Public Affairs What does this

  17. Minutes from the March 14, 2013 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    March 14, 2013 Mail discussion Al Majors is on leave today. Ellsworth Howell Jr. and Tony Nellums are sitting for Al. There are no agenda items for the Mail portion. A discussion period for questions, comments, or suggestions was opened without response Printing discussion Discussed suggestions for reducing printing expenses Presidential Executive Order 13589 and reducing hard copy printing in favor of electronic publishing Sec. 5. Printing. Agencies are encouraged to limit the publication and

  18. Mailing Addresses and Information Numbers for Operations, Field, and Site

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Offices | Department of Energy About Energy.gov » Mailing Addresses and Information Numbers for Operations, Field, and Site Offices Mailing Addresses and Information Numbers for Operations, Field, and Site Offices Name Telephone Number U.S. Department of Energy Ames Site Office 111 TASF, Iowa State University Ames, Iowa 50011 515-294-9557 U.S. Department of Energy Argonne Site Office 9800 S. Cass Avenue Argonne, IL 60439 630-252-2000 U.S. Department of Energy Berkeley Site Office Berkeley

  19. E-mail et Web : pour une navigation sans risque

    ScienceCinema (OSTI)

    None

    2011-10-06

    Présentation orale en français, support visuel en anglais. À travers des exemples concrets, vous consoliderez vos connaissances et pourrez ainsi réajuster vos habitudes concernant l?utilisation sécurisée de votre boîte e-mail et de votre navigateur Web.

  20. Navigation Labels and Approval

    Broader source: Energy.gov [DOE]

    EERE has commonly used and approved navigation labels. To maintain consistency in navigation across EERE, the EERE Template Coordinator reviews and approves requests for new navigation labels and...

  1. V-147: IBM Lotus Notes Mail Client Lets Remote Users Execute...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    7: IBM Lotus Notes Mail Client Lets Remote Users Execute Java Applets V-147: IBM Lotus Notes Mail Client Lets Remote Users Execute Java Applets May 2, 2013 - 6:00am Addthis...

  2. Mail-Order Metal-Organic Frameworks (MOFs) | Center for Gas

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    SeparationsRelevant to Clean Energy Technologies | Blandine Jerome Mail-Order Metal-Organic Frameworks (MOFs)

  3. Minutes from the February 23, 2012 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Minutes Printing and Mail Managers Exchange Forum Teleconference February 23, 2012 Participants: Headquarters (5) National Energy Technology Laboratory, PA National Security Complex Y-12 (2) Oak Ridge National Laboratory Y-12 Site Office (2) Hanford Site Office Oak Ridge Association University Oak Ridge Operations Office BWXT Pantex Site Office JanTec Corporation, Richland, Washington Los Alamos National Laboratory Chicago Office Bettis Atomic Power Laboratory National Security Technology C1,

  4. U.S. DEPARTMENT OF ENERGY RECEIPT FOR CONTROLLED MAIL PARCEL SERVICE

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    HQ F 1410.2 (06-93) U.S. DEPARTMENT OF ENERGY RECEIPT FOR CONTROLLED MAIL PARCEL SERVICE (Receipt No.) MAIL STATION: DATE: TO: NAME: ROUTING SYMBOL: FROM: DOE Mail Facility, Office of Administration Services 1. 2. 3. 4. 5. 6. 7. 8. 9. 10. 11. 12. 13. 14. 15. 16. 17. 18. ITEM NO. ITEM NO. ITEM NO. SIGN AND RETURN WITHIN 24 HOURS TO AVOID TRACER ACTION TO DOE MAIL FACILITY (Stamp Location) RECEIVED BY: DATE: Printed with soy ink on recycled paper

  5. U-157: Ruby Mail Gem Directory Traversal and Shell Command Injection Vulnerabilities

    Broader source: Energy.gov [DOE]

    Some vulnerabilities have been reported in the Mail gem for Ruby, which can be exploited by malicious people to manipulate certain data and compromise a vulnerable system.

  6. {open_quotes}Media-On-Demand{close_quotes} multimedia electronic mail: A tool for collaboration on the web

    SciTech Connect (OSTI)

    Tsoi, Kei Nam; Rahman, S.M.

    1996-12-31

    Undoubtedly, multimedia electronic mail has many advantages in exchanging information electronically in a collaborative work. The existing design of e-mail systems architecture is inefficient in exchanging multimedia message which has much larger volume, and requires more bandwidth and storage space than the text-only messages. This paper presents an innovative method for exchanging multimedia mail messages in a heterogeneous environment to support collaborative work over YAW on the Internet. We propose a {open_quotes}Parcel Collection{close_quotes} approach for exchanging multimedia electronic mail messages. This approach for exchanging multimedia electronic mail messages integrates the current WWW technologies with the existing electronic mail systems.

  7. Capacitive label reader

    DOE Patents [OSTI]

    Arlowe, H.D.

    1983-07-15

    A capacitive label reader includes an outer ring transmitting portion, an inner ring transmitting portion, and a plurality of insulated receiving portions. A label is the mirror-image of the reader except that identifying portions corresponding to the receiving portions are insulated from only one of two coupling elements. Positive and negative pulses applied, respectively, to the two transmitting rings biased a CMOS shift register positively to either a 1 or 0 condition. The output of the CMOS may be read as an indication of the label.

  8. Capacitive label reader

    DOE Patents [OSTI]

    Arlowe, H.D.

    1985-11-12

    A capacitive label reader includes an outer ring transmitting portion, an inner ring transmitting portion, and a plurality of insulated receiving portions. A label is the mirror-image of the reader except that identifying portions corresponding to the receiving portions are insulated from only one of two coupling elements. Positive and negative pulses applied, respectively, to the two transmitting rings biased a CMOS shift register positively to either a 1 or 0 condition. The output of the CMOS may be read as an indication of the label. 5 figs.

  9. Capacitive label reader

    DOE Patents [OSTI]

    Arlowe, H. Duane

    1985-01-01

    A capacitive label reader includes an outer ring transmitting portion, an inner ring transmitting portion, and a plurality of insulated receiving portions. A label is the mirror-image of the reader except that identifying portions corresponding to the receiving portions are insulated from only one of two coupling elements. Positive and negative pulses applied, respectively, to the two transmitting rings biased a CMOS shift register positively to either a 1 or 0 condition. The output of the CMOS may be read as an indication of the label.

  10. Data-Driven Mailing Helps Heat Up Untapped Seattle Market | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Data-Driven Mailing Helps Heat Up Untapped Seattle Market Abridged transcript of an interview with Community Power Works Project Manager Ruth Bell and ProgramSystem Analyst Vince ...

  11. Data-Driven Mailing Helps Heat Up Untapped Seattle Market | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Data-Driven Mailing Helps Heat Up Untapped Seattle Market Data-Driven Mailing Helps Heat Up Untapped Seattle Market Abridged transcript of an interview with Community Power Works Project Manager Ruth Bell and Program/System Analyst Vince Schueler of the Washington State University Energy Program. PDF icon Seattle Focus Series More Documents & Publications The Better Buildings Neighborhood View -- January 2013 howtodesignandmarketenergyefficiencyprogramstospecificneighborhoods.doc

  12. Sign Up for E-mail Updates | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    Sign Up for E-mail Updates Materials Sciences and Engineering (MSE) Division MSE Home About Staff What's New Research Areas Reports and Activities Science Highlights Principal Investigators' Meetings BES Home What's New Sign Up for E-mail Updates Print Text Size: A A A FeedbackShare Page The Division has a "Dear Colleague" email list, which is used to circulate general information such as funding opportunity announcements and administrative information such as position openings. To

  13. Legal and policy issues associated with monitoring employee E-mail

    SciTech Connect (OSTI)

    Segura, M.A.; Rither, A.C.

    1997-01-01

    This paper examines the legal issues involved with employer monitoring of employee e-mail. In addition to identifying pertinent legal issues, the paper provides guidelines that will help the Pacific Northwest National Laboratory (PNNL) establish a program for monitoring outgoing e-mail to insure compliance with company policies, particularly those regarding protection of trade secrets and proprietary information, and to comply with the Department of Energy`s (DOE) procedures for protecting Export Controlled Information (ECI). Electronic communication has allowed companies to enhance efficiency, responsiveness and effectiveness. E-mail allows employees to transmit all types of data to other individuals inside and outside of their companies. The ease with which information can be transmitted by e-mail has placed trade secrets, proprietary information, and other sensitive data at risk from inadvertent disclosure by employees. As employers attempt to protect their interests through measures such as monitoring e-mail, they may expose themselves to liability under federal and state laws for violating employee privacy. Business use of e-mail has proliferated so rapidly that the federal and state legal systems have not been able to adequately address the issues arising out of its use in the workplace.

  14. Map labeling and its generalizations

    SciTech Connect (OSTI)

    Doddi, S. |; Marathe, M.V.; Mirzaian, A.; Moret, B.M.E.; Zhu, B. |

    1997-01-01

    Map labeling is of fundamental importance in cartography and geographical information systems and is one of the areas targeted for research by the ACM Computational Geometry Impact Task Force. Previous work on map labeling has focused on the problem of placing maximal uniform, axis-aligned, disjoint rectangles on the plane so that each point feature to be labeled lies at the corner of one rectangle. Here, we consider a number of variants of the map labeling problem. We obtain three general types of results. First, we devise constant-factor polynomial-time-approximation algorithms for labeling point features by rectangular labels, where the feature may lie anywhere on the boundary of its label region and where labeling rectangles may be placed in any orientation. These results generalize to the case of elliptical labels. Secondly, we consider the problem of labeling a map consisting of disjoint rectilinear fine segments. We obtain constant-factor polynomial-time approximation algorithms for the general problem and an optimal algorithm for the special case where all segments are horizontal. Finally, we formulate a bicriteria version of the map-labeling problem and provide bicriteria polynomial- time approximation schemes for a number of such problems.

  15. Labeled Cocaine Analogs

    DOE Patents [OSTI]

    Goodman, Mark M.; Shi, Bing Zhi; Keil, Robert N.

    1999-03-30

    Novel methods for positron emission tomography or single photon emission spectroscopy using tracer compounds having the structure: ##STR1## where X in .beta. configuration is phenyl, naphthyl; 2,3 or 4-iodophenyl; 2,3 or 4-(trimethylsilyl)phenyl; 3,4,5 or 6-iodonaphthyl; 3,4,5 or 6-(trimethylsilyl)naphthyl; 2,3 or 4-(trialkylstannyl)phenyl; or 3,4,5 or 6-(trialkylstannyl)napthyl Y in .beta. configuration is 2-fluoroethoxy, 3-fluoropropoxy, 4-fluorobutoxy, 2-fluorocyclopropoxy, 2 or 3-fluorocyclobutoxy, R,S 1'-fluoroisopropoxy, R 1'-fluoroisopropoxy, S 1'-fluoroisopropoxy, 1',3'-difluoroisopropoxy, R,S 1'-fluoroisobutoxy, R 1'-fluoroisobutoxy, S 1'-fluoroisobutoxy, R,S 4'-fluoroisobutoxy, R 4'-fluoroisobutoxy, S 4'-fluoroisobutoxy, or 1',1'-di(fluoromethyl)isobutoxy, The compounds bind dopamine transporter protein and can be labeled with .sup.18 F or .sup.123 I for imaging.

  16. By E-Mail Daniel Cohen Assistant General Counsel for Legislation, Regulation, and Energy Efficiency

    Energy Savers [EERE]

    June 19, 2012 By E-Mail Daniel Cohen Assistant General Counsel for Legislation, Regulation, and Energy Efficiency U.S. Department of Energy Office of the General Counsel 1000 Independence Ave., SW Washington, D.C. 20585 Regulatory.Review@hq.doe.gov Re: Regulatory Burden RFI Dear Mr. Cohen: The Association of Home Appliance Manufacturers (AHAM) respectfully submits the following comments to the Department of Energy (DOE) on its Regulatory Burden RFI, 77 Fed. Reg. 28518 (May 15, 2012). AHAM

  17. Extremely High-Frequency Holographic Radar Imaging of Personnel and Mail

    SciTech Connect (OSTI)

    McMakin, Douglas L.; Sheen, David M.; Griffin, Jeffrey W.; Lechelt, Wayne M.

    2006-08-01

    The awareness of terrorists covertly transporting chemical warfare (CW) and biological warfare (BW) agents into government, military, and civilian facilities to harm the occupants has increased dramatically since the attacks of 9/11. Government and civilian security personnel have a need for innovative surveillance technology that can rapidly detect these lethal agents, even when they are hidden away in sealed containers and concealed either under clothing or in hand-carried items such as mailed packages or handbags. Sensor technology that detects BW and CW agents in mail or sealed containers carried under the clothing are under development. One promising sensor technology presently under development to defeat these threats is active millimeter-wave holographic radar imaging, which can readily image concealed items behind paper, cardboard, and clothing. Feasibility imaging studies at frequencies greater than 40 GHz have been conducted to determine whether simulated biological or chemical agents concealed in mail packages or under clothing could be detected using this extremely high-frequency imaging technique. The results of this imaging study will be presented in this paper.

  18. Synthesis Of Labeled Metabolites

    DOE Patents [OSTI]

    Martinez, Rodolfo A.; Silks, III, Louis A.; Unkefer, Clifford J.; Atcher, Robert

    2004-03-23

    The present invention is directed to labeled compounds, for example, isotopically enriched mustard gas metabolites including: [1,1',2,2'-.sup.13 C.sub.4 ]ethane, 1,1'-sulfonylbis[2-(methylthio); [1,1',2,2'-.sup.13 C.sub.4 ]ethane, 1-[[2-(methylsulfinyl)ethyl]sulfonyl]-2-(methylthio); [1,1',2,2'-.sup.13 C.sub.4 ]ethane, 1,1'-sulfonylbis[2-(methylsulfinyl)]; and, 2,2'-sulfinylbis([1,2-.sup.13 C.sub.2 ]ethanol of the general formula ##STR1## where Q.sup.1 is selected from the group consisting of sulfide (--S--), sulfone (--S(O)--), sulfoxide (--S(O.sub.2)--) and oxide (--O--), at least one C* is .sup.13 C, X is selected from the group consisting of hydrogen and deuterium, and Z is selected from the group consisting of hydroxide (--OH), and --Q.sup.2 --R where Q.sup.2 is selected from the group consisting of sulfide (--S--), sulfone(--S(O)--), sulfoxide (--S(O.sub.2)--) and oxide (--O--), and R is selected from the group consisting of hydrogen, a C.sub.1 to C.sub.4 lower alkyl, and amino acid moieties, with the proviso that when Z is a hydroxide and Q.sup.1 is a sulfide, then at least one X is deuterium.

  19. Labeled Cocaine Analogs

    DOE Patents [OSTI]

    Goodman, Mark M.; Shi, Bing Zhi; Keil, Robert N.

    1999-01-26

    Novel compounds having the structure: ##STR1## where X in .beta. configuration is phenyl, naphthyl; 2,3 or 4-iodophenyl; 2,3 or 4-(trimethylsilyl)phenyl; 3,4,5 or 6-iodonaphthyl; 3,4,5 or 6-(trimethylsilyl)naphthyl; 2,3 or 4-(trialkylstannyl)phenyl; or 3,4,5 or 6-(trialkylstannyl)naphthyl Y in .beta. configuration is Y.sub.1 or Y.sub.2, where Y.sub.1 is 2-fluoroethoxy, 3-fluoropropoxy, 4-fluorobutoxy, 2-fluorocyclopropoxy, 2 or 3-fluorocyclobutoxy, R,S 1'-fluoroisopropoxy, R 1'-fluoroisopropoxy, S 1'-fluoroisopropoxy, 1',3'-difluoroisopropoxy, R,S 1'-fluoroisobutoxy, R 1'-fluoroisobutoxy, S 1'-fluoroisobutoxy, R,S 4'-fluoroisobutoxy, R 4'-fluoroisobutoxy, S 4'-fluoroisobutoxy, or 1',1'-di(fluoromethyl)isobutoxy, and Y.sub.2 is 2-methanesulfonyloxy ethoxy, 3-methanesulfonyloxy propoxy, 4-methanesulfonyloxy butoxy, 2-methanesulfonyloxy cyclopropoxy, 2 or 3-methanesulfonyloxy cyclobutoxy, 1'methanesulfonyloxy isopropoxy, 1'-fluoro, 3'-methanesulfonyloxy isopropoxy, 1'-methanesulfonyloxy, 3'-fluoro isopropoxy, 1'-methanesulfonyloxy isobutoxy, or 4'-methanesulfonyloxy isobutoxy bind dopamine transporter protein and can be labeled with .sup.18 F or .sup.123 I for imaging.

  20. Positron emitter labeled enzyme inhibitors

    DOE Patents [OSTI]

    Fowler, J.S.; MacGregor, R.R.; Wolf, A.P.

    1987-05-22

    This invention involved a new strategy for imaging and mapping enzyme activity in the living human and animal body using positron emitter-labeled suicide enzyme inactivators or inhibitors which become covalently bound to the enzyme as a result of enzymatic catalysis. Two such suicide in activators for monoamine oxidase have been labeled with carbon-11 and used to map the enzyme subtypes in the living human and animal body using PET. By using positron emission tomography to image the distribution of radioactivity produced by the body penetrating radiation emitted by carbon-11, a map of functionally active monoamine oxidase activity is obtained. Clorgyline and L-deprenyl are suicide enzyme inhibitors and irreversibly inhibit monoamine oxidase. When these inhibitors are labeled with carbon-11 they provide selective probes for monoamine oxidase localization and reactivity in vivo using positron emission tomography. 2 figs.

  1. Positron emitter labeled enzyme inhibitors

    DOE Patents [OSTI]

    Fowler, Joanna S.; MacGregor, Robert R.; Wolf, Alfred P.; Langstrom, Bengt

    1990-01-01

    This invention involves a new strategy for imaging and mapping enzyme activity in the living human and animal body using positron emitter-labeled suicide enzyme inactivators or inhibitors which become covalently bound to the enzyme as a result of enzymatic catalysis. Two such suicide inactivators for monoamine oxidase have been labeled with carbon-11 and used to map the enzyme subtypes in the living human and animal body using PET. By using positron emission tomography to image the distribution of radioactivity produced by the body penetrating radiation emitted by carbon-11, a map of functionally active monoamine oxidase activity is obtained. Clorgyline and L-deprenyl are suicide enzyme inhibitors and irreversibly inhibit monoamine oxidase. When these inhibitors are labeled with carbon-11 they provide selective probes for monoamine oxidase localization and reactivity in vivo using positron emission tomography.

  2. Hemoglobin Labeled by Radioactive Lysine

    DOE R&D Accomplishments [OSTI]

    Bale, W. F.; Yuile, C. L.; DeLaVergne, L.; Miller, L. L.; Whipple, G. H.

    1949-12-08

    This paper reports on the utilization of tagged epsilon carbon of DL-lysine by a dog both anemic and hypoproteinemic due to repeated bleeding plus a diet low in protein. The experiment extended over period of 234 days, a time sufficient to indicate an erythrocyte life span of at least 115 days based upon the rate of replacement of labeled red cell proteins. The proteins of broken down red cells seem not to be used with any great preference for the synthesis of new hemoglobin.

  3. Overview of Existing Home Energy Labels

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Rating Review Process June 1, 2010 The attached spreadsheet contains to date gathered information on six domestic and international rating and/or labeling programs (summarized below), including: their rating; calculation methodology; the display of the scale; the display of additional information on the label; detailed information contained on the label's accompanying report; policy issues, training, and quality assurance; and data gathering, management, and analysis. The following provides some

  4. Internal Labeling Technique Tracks Nanoparticle Transport - Energy...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Biomass and Biofuels Biomass and Biofuels Find More Like This Return to Search Internal Labeling Technique Tracks Nanoparticle Transport Oak Ridge National Laboratory Contact ORNL ...

  5. CRAD, Equipment and Piping Labeling Assessment Plan

    Broader source: Energy.gov [DOE]

    This assessment provides a basis for evaluating the effectiveness of the contractor’s program for labeling equipment and piping and for establishing compliance with DOE requirements.

  6. Labeled nucleotide phosphate (NP) probes

    DOE Patents [OSTI]

    Korlach, Jonas; Webb, Watt W.; Levene, Michael; Turner, Stephen; Craighead, Harold G.; Foquet, Mathieu

    2009-02-03

    The present invention is directed to a method of sequencing a target nucleic acid molecule having a plurality of bases. In its principle, the temporal order of base additions during the polymerization reaction is measured on a molecule of nucleic acid, i.e. the activity of a nucleic acid polymerizing enzyme on the template nucleic acid molecule to be sequenced is followed in real time. The sequence is deduced by identifying which base is being incorporated into the growing complementary strand of the target nucleic acid by the catalytic activity of the nucleic acid polymerizing enzyme at each step in the sequence of base additions. A polymerase on the target nucleic acid molecule complex is provided in a position suitable to move along the target nucleic acid molecule and extend the oligonucleotide primer at an active site. A plurality of labelled types of nucleotide analogs are provided proximate to the active site, with each distinguishable type of nucleotide analog being complementary to a different nucleotide in the target nucleic acid sequence. The growing nucleic acid strand is extended by using the polymerase to add a nucleotide analog to the nucleic acid strand at the active site, where the nucleotide analog being added is complementary to the nucleotide of the target nucleic acid at the active site. The nucleotide analog added to the oligonucleotide primer as a result of the polymerizing step is identified. The steps of providing labelled nucleotide analogs, polymerizing the growing nucleic acid strand, and identifying the added nucleotide analog are repeated so that the nucleic acid strand is further extended and the sequence of the target nucleic acid is determined.

  7. Site Office Contracting Officer E-mail address Ames Site Office Jackie York Jacquelyn.york@ch.doe.gov

    National Nuclear Security Administration (NNSA)

    Site Office Contracting Officer E-mail address Ames Site Office Jackie York Jacquelyn.york@ch.doe.gov Argonne Site Office Jacquelyn York Jacquelyn.york@ch.doe.gov Brookhaven Site Office Evelyn Landini Jennifer Hartmann elandini@bnl.gov jhartmann@bnl.gov Idaho Site Office Paul Allen allenph@id.doe.gov Kansas City Site Office Ralph Tennant rtennant@kcp.gov Lawrence Livermore Site Office Homer Williamson homer.williamson@nnsa.doe.gov Los Alamos Site Office Barbara Romero Robert M. Poole

  8. Microsoft Word - WD Proposed Plan D5 R8 MASTER 10-29-14 _final with reply mail_ rev 1

    Energy Savers [EERE]

    WD-PLN-0034, Rev. 8 1 DOE/PPPO/03-0312&D5 Aerial photo of the Portsmouth Gaseous Diffusion Plant showing the three large process buildings (center of photo) and other support facilities, facing southwest PUBLIC COMMENT PERIOD NOVEMBER 12, 2014 TO JANUARY 10, 2015 HOW YOU CAN PARTICIPATE Read this Proposed Plan and review related documents in the Administrative Record. Comment on this Proposed Plan by mail, email, or fax to: Ms. Kristi Wiehle Department of Energy P.O. Box 370 Piketon, Ohio

  9. Nanomaterial Labels in Electrochemical Immunosensors and Immunoassays

    SciTech Connect (OSTI)

    Liu, Guodong; Lin, Yuehe

    2007-12-15

    This article reviews recent advances in nanomaterial labels in electrochemical immunosensors and immunoassays. Various nanomaterial labels are discussed, including colloidal gold/silver, semiconductor nanoparticles, and markers loaded nanocarriers (carbon nanotubes, apoferritin, silica nanoparticles, and liposome beads). The enormous signal enhancement associated with the use of nanomaterial labels and with the formation of nanomaterialantibody-antigen assemblies provides the basis for ultrasensitive electrochemical detection of disease-related protein biomarkers, biothreat agents, or infectious agents. In general, all endeavors cited here are geared to achieve one or more of the following goals: signal amplification by several orders of magnitude, lower detection limits, and detecting multiple targets.

  10. Label-invariant Mesh Quality Metrics. (Conference) | SciTech...

    Office of Scientific and Technical Information (OSTI)

    Label-invariant Mesh Quality Metrics. Citation Details In-Document Search Title: Label-invariant Mesh Quality Metrics. Abstract not provided. Authors: Knupp, Patrick Publication ...

  11. ENERGY STAR Labeled Buildings and Plants | Open Energy Information

    Open Energy Info (EERE)

    STAR Labeled Buildings and Plants Jump to: navigation, search Name ENERGY STAR Labeled Buildings and Plants Data Format Excel Spreadsheet Geographic Scope United States TODO:...

  12. Radionuclide labeled lymphocytes for therapeutic use

    DOE Patents [OSTI]

    Srivastava, Suresh C.; Fawwaz, Rashid A.; Richards, Powell

    1985-01-01

    Lymphocytes labelled with .beta.-emitting radionuclides are therapeutically useful, particularly for lymphoid ablation. They are prepared by incubation of the lymphocytes with the selected radionuclide-oxine complex.

  13. Radionuclide labeled lymphocytes for therapeutic use

    DOE Patents [OSTI]

    Srivastava, S.C.; Fawwaz, R.A.; Richards, P.

    1983-05-03

    Lymphocytes labelled with ..beta..-emitting radionuclides are therapeutically useful, particularly for lymphoid ablation. They are prepared by incubation of the lymphocytes with the selected radionuclide-oxine complex.

  14. Lumens and the Lighting Facts Label

    Broader source: Energy.gov [DOE]

    When you're shopping for lightbulbs, compare lumens and use the Lighting Facts label to be sure you're getting the amount of light, or level of brightness, you want.

  15. Multiple tag labeling method for DNA sequencing

    DOE Patents [OSTI]

    Mathies, Richard A.; Huang, Xiaohua C.; Quesada, Mark A.

    1995-01-01

    A DNA sequencing method described which uses single lane or channel electrophoresis. Sequencing fragments are separated in said lane and detected using a laser-excited, confocal fluorescence scanner. Each set of DNA sequencing fragments is separated in the same lane and then distinguished using a binary coding scheme employing only two different fluorescent labels. Also described is a method of using radio-isotope labels.

  16. Multiple tag labeling method for DNA sequencing

    DOE Patents [OSTI]

    Mathies, R.A.; Huang, X.C.; Quesada, M.A.

    1995-07-25

    A DNA sequencing method is described which uses single lane or channel electrophoresis. Sequencing fragments are separated in the lane and detected using a laser-excited, confocal fluorescence scanner. Each set of DNA sequencing fragments is separated in the same lane and then distinguished using a binary coding scheme employing only two different fluorescent labels. Also described is a method of using radioisotope labels. 5 figs.

  17. Website Navigation Labels and Approval | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Website Navigation Labels and Approval Website Navigation Labels and Approval The Office of Energy Efficiency and Renewable Energy (EERE) has commonly used and approved navigation labels. To maintain consistency in navigation across EERE, the EERE Template Coordinator reviews and approves requests for new navigation labels and navigation changes. Commonly Used and Approved Navigation Labels [Office technology area or acronym] Home About the [office name] Key Activities Plans, Implementation,

  18. Overview of Existing Home Energy Labels | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Residential Buildings » Home Energy Score » Home Energy Score Publications » Overview of Existing Home Energy Labels Overview of Existing Home Energy Labels This analysis looks at home energy labeling programs around the world and highlights similarities and differences of various approaches. PDF icon existing_labels.pdf More Documents & Publications North America Energy Efficiency Standards and Labeling Lower Colorado River Authority Lower Colorado River Authority Buildings Home About

  19. Probes labelled with energy transfer coupled dyes

    DOE Patents [OSTI]

    Mathies, R.A.; Glazer, A.; Ju, J.

    1997-11-18

    Compositions are provided comprising sets of fluorescent labels carrying pairs of donor and acceptor dye molecules, designed for efficient excitation of the donors at a single wavelength and emission from the acceptor in each of the pairs at different wavelengths. The different molecules having different donor-acceptor pairs can be modified to have substantially the same mobility under separation conditions, by varying the distance between the donor and acceptor in a given pair. Particularly, the fluorescent compositions find use as labels in sequencing nucleic acids. 7 figs.

  20. 1999 EV America Technical Specifications

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ... Suppliers shall specify seating capacity (available seat belt positions) for their ... label denoting the location of the device should be affixed to the driver's sun visor. ...

  1. Microfluidic Radiometal Labeling Systems for Biomolecules

    SciTech Connect (OSTI)

    Reichert, D E; Kenis, P J. A.

    2011-12-29

    In a typical labeling procedure with radiometals, such as Cu-64 and Ga-68; a very large (~ 100-fold) excess of the non-radioactive reactant (precursor) is used to promote rapid and efficient incorporation of the radioisotope into the PET imaging agent. In order to achieve high specific activities, careful control of reaction conditions and extensive chromatographic purifications are required in order to separate the labeled compounds from the cold precursors. Here we propose a microfluidic approach to overcome these problems, and achieve high specific activities in a more convenient, semi-automated fashion and faster time frame. Microfluidic reactors, consisting of a network of micron-sized channels (typical dimensions in the range 10 â?? 300 ?¼m), filters, separation columns, electrodes and reaction loops/chambers etched onto a solid substrate, are now emerging as an extremely useful technology for the intensification and miniaturization of chemical processes. The ability to manipulate, process and analyze reagent concentrations and reaction interfaces in both space and time within the channel network of a microreactor provides the fine level of reaction control that is desirable in PET radiochemistry practice. These factors can bring radiometal labeling, specifically the preparation of radio-labeled biomolecules such as antibodies, much closer to their theoretical maximum specific activities.

  2. Tc-99m Labeled carrier for imaging

    DOE Patents [OSTI]

    Henze, Eberhard

    1984-01-01

    Novel radionuclide imaging agents, having particular application for lymphangiography are provided by non-covalently binding Tc-99m to a pharmaceutically acceptable cross-linked polysaccharide. Upon injection of the Tc-99m labeled polysaccharide into the blood stream, optimum contrast can be obtained within one hour.

  3. 99M-technetium labeled macroaggregated human serum albumin pharmaceutical

    DOE Patents [OSTI]

    Winchell, Harry S.; Barak, Morton; Van Fleet, III, Parmer

    1977-05-17

    A reagent comprising macroaggregated human serum albumin having dispersed therein particles of stannous tin and a method for instantly making a labeled pharmaceutical therefrom, are disclosed. The labeled pharmaceutical is utilized in organ imaging.

  4. California Homebuyers Find More Value in Energy-Efficient Labeled...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Labeled Homes A photo of a house. During a time when many homeowners have seen their ... these sales for four years and certified homes have outsold non-labeled homes each time. ...

  5. An introduction to the National Tritium Labeling Facility

    SciTech Connect (OSTI)

    Dorsky, A.M.; Morimoto, H.; Saljoughian, M.; Williams, P.G.; Rapoport, H.

    1988-06-01

    The facilities and projects of the National Tritium Labeling Facility are described. 5 refs., 1 fig., 1 tab.

  6. DOE Challenge Home Label Methodology | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Label Methodology DOE Challenge Home Label Methodology A document of the U.S. Department of Energy's Zero Energy Ready Home (formerly Challenge Home) program. PDF icon ch_label_methodology_1012.pdf More Documents & Publications DOE Zero Energy Ready Home Partner Resources Indoor airPLUS Construction Specifications Indoor airPLUS Construction Specifications Version 1 (Rev. 02)

  7. Colloid labelled with radionuclide and method

    DOE Patents [OSTI]

    Atcher, Robert W.; Hines, John J.

    1990-01-01

    A ferric hydroxide colloid having an alpha-emitting radionuclide essentially on the outer surfaces and a method of forming same. The method includes oxidizing a ferrous hydroxide to ferric hydroxide in the presence of a preselected radionuclide to form a colloid having the radionuclide on the outer surface thereof, and thereafter washing the colloid, and suspending the washed colloid in a suitable solution. The labelled colloid is useful in cancer therapy and for the treatment of inflamed joints.

  8. Colloid labelled with radionuclide and method

    DOE Patents [OSTI]

    Atcher, R.W.; Hines, J.J.

    1990-11-13

    A ferric hydroxide colloid having an alpha-emitting radionuclide essentially on the outer surfaces and a method of forming same. The method includes oxidizing a ferrous hydroxide to ferric hydroxide in the presence of a preselected radionuclide to form a colloid having the radionuclide on the outer surface thereof, and thereafter washing the colloid, and suspending the washed colloid in a suitable solution. The labelled colloid is useful in cancer therapy and for the treatment of inflamed joints. No Drawings

  9. Method of making colloid labeled with radionuclide

    DOE Patents [OSTI]

    Atcher, Robert W.; Hines, John J.

    1991-01-01

    A ferric hydroxide colloid having an alpha-emitting radionuclide essentially on the outer surfaces and a method of forming same. The method includes oxidizing a ferrous hydroxide to ferric hydroxide in the presence of a preselected radionuclide to form a colloid having the radionuclide on the outer surface thereof, and thereafter washing the colloid, and suspending the washed colloid in a suitable solution. The labelled colloid is useful in cancer therapy and for the treatment of inflamed joints.

  10. MailedForm.pptx

    National Nuclear Security Administration (NNSA)

    Businesses using high-activity radioactive sources (Cesium-137, Cobalt-60, Americium-241, ... to: Kristina Hatcher, U.S. Department of Energy, 1000 Independence Ave., S.W., ...

  11. Energy-efficient appliance labeling in China: Lessons for successful labeling programs in varied markets

    SciTech Connect (OSTI)

    Lin, Jiang; Townend, Jeanne; Fridley, David; McNeil, Gary; Silva, Tony; Clark, Robin

    2002-08-20

    Appliance ownership and production has increased dramatically in China in the past two decades. From extremely low levels in 1980, China's appliance industry has become one of the largest in the world, with sales topping U.S. $14.4 billion in 2000. In 1981, less than 1 percent of urban Chinese households owned a refrigerator; by 1998, that number had increased to over 75 percent. This dramatic increase in sales and ownership leads to an excellent opportunity to impact energy consumption in China by affecting the energy efficiency of appliances being bought and sold. In general, Chinese consumers value energy efficiency and are knowledgeable about the operating costs of major appliances. However, the Chinese marketplace does not provide information that consumers trust about the energy consumption of specific products. Thus, several interdependent organizations have emerged in China to provide information and market supports for energy efficiency. This paper describes the appliance market in China and the evolution of its standards and labeling programs and the agencies that implement them. It discusses the authors' work with these organizations in developing energy efficiency criteria and supporting an energy efficiency endorsement labeling program in China. It describes how the authors have used their experience with ENERGY STAR{reg_sign} and other programs in the U.S. to work with China to develop a successful program specific to Chinese conditions, with a particular emphasis on refrigerators. It then gives the author's market assessment of the Chinese refrigerator market and recommendations for a successful labeling program and transferable lessons for developing energy efficiency labeling programs in varied markets. This paper is based on the authors' market research, their support in setting energy efficiency criteria in China, interviews with Chinese manufacturers, retailers, and sales staff, and the development and implementation of labeling strategies and promotion in China.

  12. North America Energy Efficiency Standards and Labeling | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy North America Energy Efficiency Standards and Labeling North America Energy Efficiency Standards and Labeling This document reflects a joint perspective of the national energy departments of Canada, Mexico, and the Unites States. PDF icon naewg_report.pdf More Documents & Publications Overview of Existing Home Energy Labels CANADA-UNITED STATES REGULATORY COOPERATION COUNCIL Webinar: Work Plan Development - 2016/17; April 12, 2016 2014-12-30 Issuance: Energy Conservation Standard

  13. Energy Efficiency Labeling System & its Development in China | Department

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    of Energy Labeling System & its Development in China Energy Efficiency Labeling System & its Development in China Information about the regulations, formats, objectives, and implementation of energy efficiency labeling in China. PDF icon session_1_buildings_track_cheng_jianhong_en.pdf PDF icon session_1_buildings_track_cheng_jianhong_cn.pdf More Documents & Publications Status Prospects of Green Data Center 4th U.S.-China Energy Efficiency Forum Documents Non-ferrous Metals

  14. CD Label and Package Templates | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Publications, Exhibits, & Logos » Templates » CD Label and Package Templates CD Label and Package Templates The Office of Energy Efficiency and Renewable Energy (EERE) has developed templates for CD labels and CD packages. These can be used for all EERE products. Both templates are available as EPS files, which can be downloaded and edited in a graphics package like Adobe Illustrator. You are not required to use these templates for your EERE products. These templates were designed to allow

  15. Beryllium-7 labeled carbon particles and method of making

    DOE Patents [OSTI]

    Richards, Powell; Mausner, Leonard F.; Prach, Thomas F.

    1987-01-01

    Beryllium-7 labeled carbon particles made from the proton irradiation of carbon materials, preferably from dry carbon black are disclosed. Such particles are useful as gamma emitting radiotracers.

  16. Beryllium-7 labeled carbon particles and method of making

    DOE Patents [OSTI]

    Richards, P.; Mausner, L.F.; Prach, T.F.

    1987-11-17

    Beryllium-7 labeled carbon particles made from the proton irradiation of carbon materials, preferably from dry carbon black are disclosed. Such particles are useful as gamma emitting radiotracers.

  17. Beryllium-7 labeled carbon particles and method of making

    DOE Patents [OSTI]

    Richards, P.; Mausner, L.F.; Prach, T.F.

    1985-04-29

    Beryllium-7 labeled carbon particles made from the proton irradiation of carbon materials, preferably from dry carbon black are disclosed. Such particles are useful as gamma emitting radiotracers.

  18. Widget:LabelMandatoryFields | Open Energy Information

    Open Energy Info (EERE)

    Jump to: navigation, search This widget labels any mandatory form fields with a red asterik. Matches on css selectors formtable and mandatoryField. Retrieved from "http:...

  19. Enhancing the Sensitivity of Label-free Silicon Photonic Biosensors...

    Office of Scientific and Technical Information (OSTI)

    Enhancing the Sensitivity of Label-free Silicon Photonic Biosensors through Increased Probe Molecule Density Citation Details In-Document Search Title: Enhancing the Sensitivity of ...

  20. Holographic Labeling And Reading Machine For Authentication And Security Appications

    DOE Patents [OSTI]

    Weber, David C.; Trolinger, James D.

    1999-07-06

    A holographic security label and automated reading machine for marking and subsequently authenticating any object such as an identification badge, a pass, a ticket, a manufactured part, or a package is described. The security label is extremely difficult to copy or even to read by unauthorized persons. The system comprises a holographic security label that has been created with a coded reference wave, whose specification can be kept secret. The label contains information that can be extracted only with the coded reference wave, which is derived from a holographic key, which restricts access of the information to only the possessor of the key. A reading machine accesses the information contained in the label and compares it with data stored in the machine through the application of a joint transform correlator, which is also equipped with a reference hologram that adds additional security to the procedure.

  1. Synthesis of labeled oxalic acid derivatives

    DOE Patents [OSTI]

    Martinez, Rodolfo A.; Unkefer, Clifford J.; Alvarez, Marc A.

    2004-06-22

    The present invention is directed to labeled compounds, specifically ##STR1## where each C* is selected from the group consisting of a carbon-12, i.e., .sup.12 C, or a carbon-13, i.e., .sup.13 C and at least one C* is .sup.13 C, R.sup.1 is selected from the group of C.sub.1 -C.sub.4 lower alkyl and aryl, and X is selected from the group of --NR.sup.2 R.sup.3 where R.sup.2 and R.sup.3 are each independently selected from the group of C.sub.1 -C.sub.4 lower alkyl, alkoxy and aryl, --SR.sup.4 where R.sup.4 is selected from the group of C.sub.1 -C.sub.4 lower alkyl, alkoxy and aryl, and --OR.sup.5 where R.sup.5 is selected from the group of C.sub.1 -C.sub.4 lower alkyl, alkoxy and aryl with the proviso that when R.sup.1 is methyl then R.sup.5 is other than methyl, when R.sup.1 is ethyl then R.sup.5 is other than ethyl, and when R.sup.1 is benzyl then R.sup.5 is other than benzyl.

  2. 99M-Technetium labeled tin colloid radiopharmaceuticals

    DOE Patents [OSTI]

    Winchell, Harry S.; Barak, Morton; Van Fleet, III, Parmer

    1976-07-06

    An improved 99m-technetium labeled tin(II) colloid, size-stabilized for reticuloendothelial organ imaging without the use of macromolecular stabilizers and a packaged tin base reagent and an improved method for making it are disclosed.

  3. Template:LabelValuePair | Open Energy Information

    Open Energy Info (EERE)

    is typically used to display the results of an ask or sparql query in a simple label: value format. It is used by many pages, including the sub pages for country profiles, and is...

  4. Data-Parallel Mesh Connected Components Labeling and Analysis

    SciTech Connect (OSTI)

    Harrison, Cyrus; Childs, Hank; Gaither, Kelly

    2011-04-10

    We present a data-parallel algorithm for identifying and labeling the connected sub-meshes within a domain-decomposed 3D mesh. The identification task is challenging in a distributed-memory parallel setting because connectivity is transitive and the cells composing each sub-mesh may span many or all processors. Our algorithm employs a multi-stage application of the Union-find algorithm and a spatial partitioning scheme to efficiently merge information across processors and produce a global labeling of connected sub-meshes. Marking each vertex with its corresponding sub-mesh label allows us to isolate mesh features based on topology, enabling new analysis capabilities. We briefly discuss two specific applications of the algorithm and present results from a weak scaling study. We demonstrate the algorithm at concurrency levels up to 2197 cores and analyze meshes containing up to 68 billion cells.

  5. Understanding the Environmental Impacts of Electricity: Product Labeling and Certification

    SciTech Connect (OSTI)

    Bird, L.

    2003-01-01

    Electricity consumers are increasingly gaining the ability to choose among power options from either their current electric utilities or from alternative power providers. In order to help consumers make informed decisions about their electricity purchases and to compare alternatives, many states are requiring electricity providers to disclose information regarding the fuel sources used to generate electricity and the associated environmental impacts. Like nutrition labels, environmental disclosure labels present the content or sources of electricity and are typically included with electricity bills and in product offers. These labels allow consumers to compare the environmental impacts of standard and cleaner power options, which are typically available. This paper discusses clean, green power options available to power purchasers and the tools and information that can be used to make more sustainable power purchase decisions.

  6. Simple, rapid method for the preparation of isotopically labeled formaldehyde

    DOE Patents [OSTI]

    Hooker, Jacob Matthew; Schonberger, Matthias; Schieferstein, Hanno; Fowler, Joanna S.

    2011-10-04

    Isotopically labeled formaldehyde (*C.sup..sctn.H.sub.2O) is prepared from labeled methyl iodide (*C.sup..sctn.H.sub.3I) by reaction with an oxygen nucleophile having a pendant leaving group. The mild and efficient reaction conditions result in good yields of *C.sup..sctn.H.sub.2O with little or no *C isotopic dilution. The simple, efficient production of .sup.11CH.sub.2O is described. The use of the .sup.11CH.sub.2O for the formation of positron emission tomography tracer compounds is described. The reaction can be incorporated into automated equipment available to radiochemistry laboratories. The isotopically labeled formaldehyde can be used in a variety of reactions to provide radiotracer compounds for imaging studies as well as for scintillation counting and autoradiography.

  7. Semiconductor Quantum Rods as Single Molecule FluorescentBiological Labels

    SciTech Connect (OSTI)

    Fu, Aihua; Gu, Weiwei; Boussert, Benjamine; Koski, Kristie; Gerion, Daniele; Manna, Liberato; Le Gros, Mark; Larabell, Carolyn; Alivisatos, A. Paul

    2006-05-29

    In recent years, semiconductor quantum dots have beenapplied with great advantage in a wide range of biological imagingapplications. The continuing developments in the synthesis of nanoscalematerials and specifically in the area of colloidal semiconductornanocrystals have created an opportunity to generate a next generation ofbiological labels with complementary or in some cases enhanced propertiescompared to colloidal quantum dots. In this paper, we report thedevelopment of rod shaped semiconductor nanocrystals (quantum rods) asnew fluorescent biological labels. We have engineered biocompatiblequantum rods by surface silanization and have applied them fornon-specific cell tracking as well as specific cellular targeting. Theproperties of quantum rods as demonstrated here are enhanced sensitivityand greater resistance for degradation as compared to quantum dots.Quantum rods have many potential applications as biological labels insituations where their properties offer advantages over quantumdots.

  8. Volume-labeled nanoparticles and methods of preparation

    DOE Patents [OSTI]

    Wang, Wei; Gu, Baohua; Retterer, Scott T; Doktycz, Mitchel J

    2015-04-21

    Compositions comprising nanosized objects (i.e., nanoparticles) in which at least one observable marker, such as a radioisotope or fluorophore, is incorporated within the nanosized object. The nanosized objects include, for example, metal or semi-metal oxide (e.g., silica), quantum dot, noble metal, magnetic metal oxide, organic polymer, metal salt, and core-shell nanoparticles, wherein the label is incorporated within the nanoparticle or selectively in a metal oxide shell of a core-shell nanoparticle. Methods of preparing the volume-labeled nanoparticles are also described.

  9. Isonitrile radionuclide complexes for labelling and imaging agents

    DOE Patents [OSTI]

    Jones, Alun G.; Davison, Alan; Abrams, Michael J.

    1984-06-04

    A coordination complex of an isonitrile ligand and radionuclide such as Tc, Ru, Co, Pt, Fe, Os, Ir, W, Re, Cr, Mo, Mn, Ni, Rh, Pd, Nb and Ta, is useful as a diagnostic agent for labelling liposomes or vesicles, and selected living cells containing lipid membranes, such as blood clots, myocardial tissue, gall bladder tissue, etc.

  10. Palladium-109 labeled anti-melanoma monoclonal antibodies

    DOE Patents [OSTI]

    Srivastava, S.C.; Fawwaz, R.A.; Ferrone, S.

    1984-04-30

    The invention consists of new monoclonal antibodies labelled with Palladium 109, a beta-emitting radionuclide, the method of preparing this material, and its use in the radiotherapy of melanoma. The antibodies are chelate-conjugated and demonstrate a high uptake in melanomas. (ACR)

  11. Calendar Year 2008 Program Benefits for ENERGY STAR Labeled Products

    SciTech Connect (OSTI)

    Homan, GregoryK; Sanchez, Marla; Brown, RichardE; Lai, Judy

    2010-08-24

    This paper presents current and projected savings for ENERGY STAR labeled products, and details the status of the model as implemented in the September 2009 spreadsheets. ENERGY STAR is a voluntary energy efficiency labeling program operated jointly by the Environmental Protection Agency (US EPA) and the U.S. Department of Energy (US DOE), designed to identify and promote energy-efficient products, buildings and practices. Since the program inception in 1992, ENERGY STAR has become a leading international brand for energy efficient products, and currently labels more than thirty products, spanning office equipment, heating, cooling and ventilation equipment, commercial and residential lighting, home electronics, and major appliances. ENERGY STAR's central role in the development of regional, national and international energy programs necessitates an open process whereby its program achievements to date as well as projected future savings are shared with stakeholders. This report presents savings estimates for ENERGY STAR labeled products. We present estimates of energy, dollar, and carbon savings achieved by the program in the year 2008, annual forecasts for 2009 and 2010, and cumulative savings estimates for the period 1993 through 2008 and cumulative forecasts for the period 2009 through 2015. Through 2008 the program saved 8.8 Quads of primary energy and avoided the equivalent of 158 metric tones carbon (MtC). The forecast for the period 2009-2015 is 18.1 Quads or primary energy saved and 316 MtC emissions avoided. The sensitivity analysis bounds the best estimate of carbon avoided between 104 MtC and 213 MtC (1993 to 2008) and between 206 MtC and 444 MtC (2009 to 2015). In this report we address the following questions for ENERGY STAR labeled products: (1) How are ENERGY STAR impacts quantified; (2) What are the ENERGY STAR achievements; and (3) What are the limitations to our method?

  12. Efficient and selective isotopic labeling of hemes to facilitate the study

    Office of Scientific and Technical Information (OSTI)

    of multiheme proteins (Journal Article) | SciTech Connect Efficient and selective isotopic labeling of hemes to facilitate the study of multiheme proteins Citation Details In-Document Search Title: Efficient and selective isotopic labeling of hemes to facilitate the study of multiheme proteins Specific isotopic labeling of hemes provides a unique opportunity to characterize the structure and function of heme-proteins. Unfortunately, present day methods do not allow efficient labeling in high

  13. Methods to radiolabel natural organic matter by reduction with hydrogen labeled reducing agents

    DOE Patents [OSTI]

    Tinnacher, Ruth M.; Honeyman, Bruce D.

    2011-10-18

    Methods to radiolabel natural organic matter by reduction with a hydrogen labeled reducing agent, and compositions, are provided.

  14. The Practice and Thinking of Building Energy Efficiency Evaluation & Labeling in Shanghai

    Broader source: Energy.gov [DOE]

    Information about the development of Building Energy Efficiency Evaluation and Labeling in Shanghai with project examples and theory.

  15. Single step signal group-imidazole labeling of organic phosphate groups under aqueous conditions

    DOE Patents [OSTI]

    Giese, R.W.; Wang, P.

    1996-04-30

    Compounds and methods for single step, covalent labeling of the phosphate group of an organic substance under aqueous conditions are described. The labeling compound includes any kind of detectable signal group covalently bound to an imidazole moiety, which can be imidazole or a substituted imidazole. A preferred labeling compound has the formula shown in the accompanying diagram. 4 figs.

  16. Single step signal group-imidazole labeling of organic phosphate groups under aqueous conditions

    DOE Patents [OSTI]

    Giese, Roger W.; Wang, Poguang

    1996-01-01

    Compounds and methods for single step, covalent labeling of the phosphate group of an organic substance under aqueous conditions are described. The labeling compound includes any kind of detectable signal group covalently bound to an imidazole moiety, which can be imidazole or a substituted imidazole. A preferred labeling compound has the formula ##STR1##

  17. Microfabricated capillary electrophoresis chip and method for simultaneously detecting multiple redox labels

    DOE Patents [OSTI]

    Mathies, Richard A.; Singhal, Pankaj; Xie, Jin; Glazer, Alexander N.

    2002-01-01

    This invention relates to a microfabricated capillary electrophoresis chip for detecting multiple redox-active labels simultaneously using a matrix coding scheme and to a method of selectively labeling analytes for simultaneous electrochemical detection of multiple label-analyte conjugates after electrophoretic or chromatographic separation.

  18. Assay for vitamin B12 absorption and method of making labeled vitamin B12

    DOE Patents [OSTI]

    Anderson, Peter J.; Dueker, Stephen; Miller, Joshua; Green, Ralph; Roth, John; Carkeet, Colleen; Buchholz,; Bruce A.

    2012-06-19

    The invention provides methods for labeling vitamin B12 with .sup.14C, .sup.13C, tritium, and deuterium. When radioisotopes are used, the invention provides for methods of labeling B12 with high specific activity. The invention also provides labeled vitamin B12 compositions made in accordance with the invention.

  19. Global Potential of Energy Efficiency Standards and Labeling Programs

    SciTech Connect (OSTI)

    McNeil, Michael A; McNeil, Michael A.; Letschert, Virginie; de la Rue du Can, Stephane

    2008-06-15

    This report estimates the global potential reductions in greenhouse gas emissions by 2030 for energy efficiency improvements associated with equipment (appliances, lighting, and HVAC) in buildings by means of energy efficiency standards and labels (EES&L). A consensus has emerged among the world's scientists and many corporate and political leaders regarding the need to address the threat of climate change through emissions mitigation and adaptation. A further consensus has emerged that a central component of these strategies must be focused around energy, which is the primary generator of greenhouse gas emissions. Two important questions result from this consensus: 'what kinds of policies encourage the appropriate transformation to energy efficiency' and 'how much impact can these policies have'? This report aims to contribute to the dialogue surrounding these issues by considering the potential impacts of a single policy type, applied on a global scale. The policy addressed in this report is Energy Efficient Standards and Labeling (EES&L) for energy-consuming equipment, which has now been implemented in over 60 countries. Mandatory energy performance standards are important because they contribute positively to a nation's economy and provide relative certainty about the outcome (both timing and magnitudes). Labels also contribute positively to a nation's economy and importantly increase the awareness of the energy-consuming public. Other policies not analyzed here (utility incentives, tax credits) are complimentary to standards and labels and also contribute in significant ways to reducing greenhouse gas emissions. We believe the analysis reported here to be the first systematic attempt to evaluate the potential of savings from EES&L for all countries and for such a large set of products. The goal of the analysis is to provide an assessment that is sufficiently well-quantified and accurate to allow comparison and integration with other strategies under consideration.

  20. Labeled ALPHA4BETA2 ligands and methods therefor

    DOE Patents [OSTI]

    Mukherjee, Jogeshwar; Pichika, Ramaiah; Potkin, Steven; Leslie, Frances; Chattopadhyay, Sankha

    2013-02-19

    Contemplated compositions and methods are employed to bind in vitro and in vivo to an .alpha.4.beta.2 nicotinic acetylcholine receptor in a highly selective manner. Where such compounds are labeled, compositions and methods employing such compounds can be used for PET and SPECT analysis. Alternatively, and/or additionally contemplated compounds can be used as antagonists, partial agonists or agonists in the treatment of diseases or conditions associated with .alpha.4.beta..beta.2 dysfunction.

  1. Calendar Year 2009 Program Benefits for ENERGY STAR Labeled Products

    SciTech Connect (OSTI)

    Homan, Gregory K; Sanchez, Marla C.; Brown, Richard E.

    2010-11-15

    ENERGY STAR is a voluntary energy efficiency labeling program operated jointly by the Environmental Protection Agency (US EPA) and the U.S. Department of Energy (US DOE), designed to identify and promote energy-efficient products, buildings and practices. Since the program inception in 1992, ENERGY STAR has become a leading international brand for energy efficient products, and currently labels more than thirty products, spanning office equipment, heating, cooling and ventilation equipment, commercial and residential lighting, home electronics, and major appliances. ENERGY STAR's central role in the development of regional, national and international energy programs necessitates an open process whereby its program achievements to date as well as projected future savings are shared with stakeholders. This report presents savings estimates from the use ENERGY STAR labeled products. We present estimates of energy, dollar, and carbon savings achieved by the program in the year 2009, annual forecasts for 2010 and 2011, and cumulative savings estimates for the period 1993 through 2009 and cumulative forecasts for the period 2010 through 2015. Through 2009 the program saved 9.5 Quads of primary energy and avoided the equivalent of 170 million metric tons carbon (MMTC). The forecast for the period 2009-2015 is 11.5 Quads or primary energy saved and 202 MMTC emissions avoided. The sensitivity analysis bounds the best estimate of carbon avoided between 110 MMTC and 231 MMTC (1993 to 2009) and between 130 MMTC and 285 MMTC (2010 to 2015).

  2. Microfluidic devices, systems, and methods for quantifying particles...

    Office of Scientific and Technical Information (OSTI)

    Signals may be detected from label moieties affixed to the cells. Authors: Schaff, Ulrich Y. ; Sommer, Gregory J. ; Singh, Anup K. Publication Date: 2015-11-17 OSTI Identifier: ...

  3. Microfluidic devices, systems, and methods for quantifying particles...

    Office of Scientific and Technical Information (OSTI)

    Signals may be detected from label moieties affixed to the cells. Inventors: Schaff, Ulrich Y. ; Sommer, Gregory J. ; Singh, Anup K. Issue Date: 2015-11-17 OSTI Identifier: 1226547 ...

  4. Method for producing labeled single-stranded nucleic acid probes

    DOE Patents [OSTI]

    Dunn, John J.; Quesada, Mark A.; Randesi, Matthew

    1999-10-19

    Disclosed is a method for the introduction of unidirectional deletions in a cloned DNA segment. More specifically, the method comprises providing a recombinant DNA construct comprising a DNA segment of interest inserted in a cloning vector, the cloning vector having an f1 endonuclease recognition sequence adjacent to the insertion site of the DNA segment of interest. The recombinant DNA construct is then contacted with the protein pII encoded by gene II of phage f1 thereby generating a single-stranded nick. The nicked DNA is then contacted with E. coli Exonuclease III thereby expanding the single-stranded nick into a single-stranded gap. The single-stranded gapped DNA is then contacted with a single-strand-specific endonuclease thereby producing a linearized DNA molecule containing a double-stranded deletion corresponding in size to the single-stranded gap. The DNA treated in this manner is then incubated with DNA ligase under conditions appropriate for ligation. Also disclosed is a method for producing single-stranded DNA probes. In this embodiment, single-stranded gapped DNA, produced as described above, is contacted with a DNA polymerase in the presence of labeled nucleotides to fill in the gap. This DNA is then linearized by digestion with a restriction enzyme which cuts outside the DNA segment of interest. The product of this digestion is then denatured to produce a labeled single-stranded nucleic acid probe.

  5. A European Sustainable Tourism Labels proposal using a composite indicator

    SciTech Connect (OSTI)

    Blancas, Francisco Javier; Lozano-Oyola, Macarena; González, Mercedes

    2015-09-15

    The tourism sector in Europe faces important challenges which it must deal with to promote its future development. In this context, the European Commission considers that two key issues must be addressed. On the one hand, a better base of socio-economic knowledge about tourism and its relationship with the environment is needed, and, on the other hand, it is necessary to improve the image of European areas as quality sustainable tourism destinations. In this paper we present analytical tools that cover these needs. Specifically, we define a system of sustainable tourism indicators and we obtain a composite indicator incorporating weights quantified using a panel of experts. Employing the values of this global indicator as a basis, we define a Sustainable Tourism Country-Brand Ranking which assesses the perception of each country-brand depending on its degree of sustainability, and a system of sustainable tourism labels which reward the management carried out. - Highlights: • We define a system of indicators to improve the knowledge about sustainable tourism. • We obtain composite indicators based on expert knowledge. • The Sustainable Tourism Country-Brand Ranking would improve the image of destinations. • We define a Sustainable Tourism Labels System to assess country-brands. • The conclusions of the empirical analysis can be extrapolated to other tourist areas.

  6. International Experience in Standards and Labeling Programs for Rice Cookers

    SciTech Connect (OSTI)

    Zhou, Nan; Zheng, Nina

    2008-05-01

    China has had an active program on energy efficiency standards for household appliances since the mid-1990s. Rice cooker is among the first to be subject to such mandatory regulation, since it is one of the most prevalent electric appliances in Chinese households. Since first introduced in 1989, the minimum energy efficiency standard for rice cookers has not been revised. Therefore, the potential for energy saving is considerable. Initial analysis from CNIS indicates that potential carbon savings is likely to reach 7.6 million tons of CO2 by the 10th year of the standard implementation. Since September 2007, CNIS has been working with various groups to develop the new standard for rice cookers. With The Energy Foundation's support, LBNL has assisted CNIS in the revision of the minimum energy efficiency standard for rice cookers that is expected to be effective in 2009. Specifically, work has been in the following areas: assistance in developing consumer survey on usage pattern of rice cookers, review of international standards, review of international test procedures, comparison of the international standards and test procedures, and assessment of technical options of reducing energy use. This report particularly summarizes the findings of reviewing international standards and technical options of reducing energy consumption. The report consists of an overview of rice cooker standards and labeling programs and testing procedures in Hong Kong, South Korea, Japan and Thailand, and Japan's case study in developing energy efficiency rice cooker technologies and rice cooker efficiency programs. The results from the analysis can be summarized as the follows: Hong Kong has a Voluntary Energy Efficiency Labeling scheme for electric rice cookers initiated in 2001, with revision implemented in 2007; South Korea has both MEPS and Mandatory Energy Efficiency Label targeting the same category of rice cookers as Hong Kong; Thailand's voluntary endorsement labeling program is similar to Hong Kong in program design but has 5 efficiency grades; Japan's program is distinct in its adoption of the 'Top Runner' approach, in which, the future efficiency standards is set based on the efficiency levels of the most efficient product in the current domestic market. Although the standards are voluntary, penalties can still be evoked if the average efficiency target is not met. Both Hong Kong and South Korea's tests involve pouring water into the inner pot equal to 80% of its rated volume; however, white rice is used as a load for its tests in Hong Kong whereas no rice is used for tests in South Korea. In Japan's case, water level specified by the manufactures is used and milled rice is used as a load only partially in the tests. Moreover, Japan does not conduct heat efficiency test but its energy consumption measurements tests are much more complex, with 4 different tests are conducted to determine the annual average energy consumption. Hong Kong and Thailand both set Minimum Allowable Heat Efficiency for different rated wattages. The energy efficiency requirements are identical except that the minimum heat efficiency in Thailand is 1 percentage point higher for all rated power categories. In South Korea, MEPS and label's energy efficiency grades are determined by the rice cooker's Rated Energy Efficiency for induction, non-induction, pressure, nonpressure rice cookers. Japan's target standard values are set for electromagnetic induction heating products and non-electromagnetic induction heating products by different size of rice cookers. Specific formulas are used by type and size depending on the mass of water evaporation of the rice cookers. Japan has been the leading country in technology development of various types of rice cookers, and developed concrete energy efficiency standards for rice cookers. However, as consumers in Japan emphasize the deliciousness of cooked rice over other factors, many types of models were developed to improve the taste of cooked rice. Nonetheless, the efficiency of electromagnetic induction heating (IH) rice cook

  7. Preparation of 13C/15N-labeled oligomers using the polymerase chain reaction

    DOE Patents [OSTI]

    Chen, Xian; Gupta, Goutam; Bradbury, E. Morton

    2001-01-01

    Preparation of .sup.13 C/.sup.15 N-labeled DNA oligomers using the polymerase chain reaction (PCR). A PCR based method for uniform (.sup.13 C/.sup.15 N)-labeling of DNA duplexes is described. Multiple copies of a blunt-ended duplex are cloned into a plasmid, each copy containing the sequence of interest and restriction Hinc II sequences at both the 5' and 3' ends. PCR using bi-directional primers and uniformly .sup.13 C/.sup.15 N-labeled dNTP precursors generates labeled DNA duplexes containing multiple copies of the sequence of interest. Twenty-four cycles of PCR, followed by restriction and purification, gave the uniformly .sup.13 C/.sup.15 N-labeled duplex sequence with a 30% yield. Such labeled duplexes find significant applications in multinuclear magnetic resonance spectroscopy.

  8. Slow light Mach-Zehnder interferometer as label-free biosensor with

    Office of Scientific and Technical Information (OSTI)

    scalable sensitivity (Journal Article) | SciTech Connect Slow light Mach-Zehnder interferometer as label-free biosensor with scalable sensitivity Citation Details In-Document Search This content will become publicly available on February 5, 2017 Title: Slow light Mach-Zehnder interferometer as label-free biosensor with scalable sensitivity Our design, fabrication, and characterization of a label-free Mach-Zehnder interferometer (MZI) optical biosensor that incorporates a highly dispersive

  9. Document clustering methods, document cluster label disambiguation methods, document clustering apparatuses, and articles of manufacture

    DOE Patents [OSTI]

    Sanfilippo, Antonio; Calapristi, Augustin J.; Crow, Vernon L.; Hetzler, Elizabeth G.; Turner, Alan E.

    2009-12-22

    Document clustering methods, document cluster label disambiguation methods, document clustering apparatuses, and articles of manufacture are described. In one aspect, a document clustering method includes providing a document set comprising a plurality of documents, providing a cluster comprising a subset of the documents of the document set, using a plurality of terms of the documents, providing a cluster label indicative of subject matter content of the documents of the cluster, wherein the cluster label comprises a plurality of word senses, and selecting one of the word senses of the cluster label.

  10. Automatic Labeling for Entity Extraction in Cyber Security

    SciTech Connect (OSTI)

    Bridges, Robert A; Jones, Corinne L; Iannacone, Michael D; Testa, Kelly M; Goodall, John R

    2014-01-01

    Timely analysis of cyber-security information necessitates automated information extraction from unstructured text. While state-of-the-art extraction methods produce extremely accurate results, they require ample training data, which is generally unavailable for specialized applications, such as detecting security related entities; moreover, manual annotation of corpora is very costly and often not a viable solution. In response, we develop a very precise method to automatically label text from several data sources by leveraging related, domain-specific, structured data and provide public access to a corpus annotated with cyber-security entities. Next, we implement a Maximum Entropy Model trained with the average perceptron on a portion of our corpus (~750,000 words) and achieve near perfect precision, recall, and accuracy, with training times under 17 seconds.

  11. Nucleic acid analysis using terminal-phosphate-labeled nucleotides

    DOE Patents [OSTI]

    Korlach, Jonas; Webb, Watt W.; Levene, Michael; Turner, Stephen; Craighead, Harold G.; Foquet, Mathieu

    2008-04-22

    The present invention is directed to a method of sequencing a target nucleic acid molecule having a plurality of bases. In its principle, the temporal order of base additions during the polymerization reaction is measured on a molecule of nucleic acid, i.e. the activity of a nucleic acid polymerizing enzyme on the template nucleic acid molecule to be sequenced is followed in real time. The sequence is deduced by identifying which base is being incorporated into the growing complementary strand of the target nucleic acid by the catalytic activity of the nucleic acid polymerizing enzyme at each step in the sequence of base additions. A polymerase on the target nucleic acid molecule complex is provided in a position suitable to move along the target nucleic acid molecule and extend the oligonucleotide primer at an active site. A plurality of labelled types of nucleotide analogs are provided proximate to the active site, with each distinguishable type of nucleotide analog being complementary to a different nucleotide in the target nucleic acid sequence. The growing nucleic acid strand is extended by using the polymerase to add a nucleotide analog to the nucleic acid strand at the active site, where the nucleotide analog being added is complementary to the nucleotide of the target nucleic acid at the active site. The nucleotide analog added to the oligonucleotide primer as a result of the polymerizing step is identified. The steps of providing labelled nucleotide analogs, polymerizing the growing nucleic acid strand, and identifying the added nucleotide analog are repeated so that the nucleic acid strand is further extended and the sequence of the target nucleic acid is determined.

  12. Compliance and Verification of Standards and Labeling Programs in China: Lessons Learned

    SciTech Connect (OSTI)

    Saheb, Yamina; Zhou, Nan; Fridley, David; Pierrot, Andre

    2010-08-01

    After implementing several energy efficiency standards and labels (30 products covered by MEPS, 50 products covered by voluntary labels and 19 products by mandatory labels), the China National Institute of Standardization (CNIS) is now implementing verification and compliance mechanism to ensure that the energy information of labeled products comply with the requirements of their labels. CNIS is doing so by organizing check testing on a random basis for room air-conditioners, refrigerators, motors, heaters, computer displays, ovens, and self -ballasted lamps. The purpose of the check testing is to understand the implementation of the Chinese labeling scheme and help local authorities establishing effective compliance mechanisms. In addition, to ensure robustness and consistency of testing results, CNIS has coordinated a round robin testing for room air conditioners. Eight laboratories (Chinese (6), Australian (1) and Japanese (1)) have been involved in the round robin testing and tests were performed on four sets of samples selected from manufacturer's production line. This paper describes the methodology used in undertaking both check and round robin testing, provides analysis of testing results and reports on the findings. The analysis of both check and round robin testing demonstrated the benefits of a regularized verification and monitoring system for both laboratories and products such as (i) identifying the possible deviations between laboratories to correct them, (ii) improving the quality of testing facilities, (iii) ensuring the accuracy and reliability of energy label information in order to strength the social credibility of the labeling program and the enforcement mechanism in place.

  13. Compliance and Verification of Standards and Labelling Programs in China: Lessons Learned

    SciTech Connect (OSTI)

    Saheb, Yamina; Zhou, Nan; Fridley, David; Pierrot, Andr

    2010-06-11

    After implementing several energy efficiency standards and labels (30 products covered by MEPS, 50 products covered by voluntary labels and 19 products by mandatory labels), the China National Institute of Standardization (CNIS) is now implementing verification and compliance mechanism to ensure that the energy information of labeled products comply with the requirements of their labels. CNIS is doing so by organizing check testing on a random basis for room air-conditioners, refrigerators, motors, heaters, computer displays, ovens, and self -ballasted lamps. The purpose of the check testing is to understand the implementation of the Chinese labeling scheme and help local authorities establishing effective compliance mechanisms. In addition, to ensure robustness and consistency of testing results, CNIS has coordinated a round robin testing for room air conditioners. Eight laboratories (Chinese (6), Australian (1) and Japanese (1)) have been involved in the round robin testing and tests were performed on four sets of samples selected from manufacturer?s production line. This paper describes the methodology used in undertaking both check and round robin testing, provides analysis of testing results and reports on the findings. The analysis of both check and round robin testing demonstrated the benefits of a regularized verification and monitoring system for both laboratories and products such as (i) identifying the possible deviations between laboratories to correct them, (ii) improving the quality of testing facilities, (iii) ensuring the accuracy and reliability of energy label information in order to strength the social credibility of the labeling program and the enforcement mechanism in place.

  14. Label-free functional nucleic acid sensors for detecting target agents

    SciTech Connect (OSTI)

    Lu, Yi; Xiang, Yu

    2015-01-13

    A general methodology to design label-free fluorescent functional nucleic acid sensors using a vacant site approach and an abasic site approach is described. In one example, a method for designing label-free fluorescent functional nucleic acid sensors (e.g., those that include a DNAzyme, aptamer or aptazyme) that have a tunable dynamic range through the introduction of an abasic site (e.g., dSpacer) or a vacant site into the functional nucleic acids. Also provided is a general method for designing label-free fluorescent aptamer sensors based on the regulation of malachite green (MG) fluorescence. A general method for designing label-free fluorescent catalytic and molecular beacons (CAMBs) is also provided. The methods demonstrated here can be used to design many other label-free fluorescent sensors to detect a wide range of analytes. Sensors and methods of using the disclosed sensors are also provided.

  15. Enhanced detection of fluorescence quenching in labeled cells

    DOE Patents [OSTI]

    Crissman, H.A.; Steinkamp, J.A.

    1987-11-30

    A method is provided for quantifying BrdU labeled DNA in cells. The BrdU is substituted onto the DNA and the DNA is stained with a first fluorochrome having a fluorescence which is quenchable by BrdU. The first fluorochrome is preferably a thymidine base halogen analogue, such as a Hoechst fluorochrome. The DNA is then stained with a second fluorochrome having a fluorescence which is substantially uneffected by BrdU. The second fluorochrome may be selected from the group consisting of mithramycin, chromomycin A3, olivomycin, propidium iodide and ethidium bromine. The fluorescence from the first and second fluorochromes is then measured to obtain first and second output signals, respectively. The first output signal is subtracted from the second output signal to obtain a difference signal which is functionally related to the quantity of BrdU incorporated into DNA. The technique is particularly useful for quantifying the synthesis of DNA during the S-phase of the cell cycle. 2 figs.

  16. Enhanced detection of fluorescence quenching in labeled cells

    DOE Patents [OSTI]

    Crissman, Harry A.; Steinkamp, John A.

    1992-01-01

    A method is provided for quantifying BrdU labeled DNA in cells. The BrdU is incorporated into the DNA and the DNA is stained with a first fluorochrome having a fluorescence which is quenchable by BrdU. The first fluorochrome is preferably a thymidine base halogen analogue, such as a Hoechst fluorochrome. The DNA is then stained with a second fluorochrome having a fluorescence that is substantially uneffected by BrdU. The second fluorochrome may be selected from the group consisting of mithramycin, chromomycin A3, olivomycin, propidium iodide and ethidium bromine. The fluorescence from the first and second fluorochromes is then measured to obtain first and second output signals, respectively. The first output signal is substracted from the second output signal to obtain a difference signal which is functionally related to the quantity of BrdU incorporated into DNA. The technique is particularly useful for quantifying the synthesis of DNA during the S-phase of the cell cycle.

  17. Calendar Year 2007 Program Benefits for ENERGY STAR Labeled Products

    SciTech Connect (OSTI)

    Sanchez, Marla Christine; Homan, Gregory; Brown, Richard

    2008-10-31

    ENERGY STAR is a voluntary energy efficiency-labeling program operated jointly by the United States Department of Energy and the United States Environmental Protection Agency (US EPA). Since the program inception in 1992, ENERGY STAR has become a leading international brand for energy efficient products. ENERGY STAR's central role in the development of regional, national, and international energy programs necessitates an open process whereby its program achievements to date as well as projected future savings are shared with committed stakeholders. Through 2007, the program saved 7.1 Quads of primary energy and avoided 128 MtC equivalent. The forecast shows that the program is expected to save 21.2 Quads of primary energy and avoid 375 MtC equivalent over the period 2008-2015. The sensitivity analysis bounds the best estimate of carbon avoided between 84 MtC and 172 MtC (1993 to 2007) and between 243 MtC and 519 MtC (2008 to 2015).

  18. Synthesis and preliminary biological evaluations of fluorescent or 149Promethium labeled Trastuzumab-polyethylenimine

    DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

    Fitzsimmons, Jonathan; Nayak, Tapan; Cutler, Cathy; Atcher, Robert

    2015-12-30

    Radioimmunotherapy utilize a targeting antibody coupled to a therapeutic isotope to target and treat a tumor or disease. In this study we examine the synthesis and cell binding of a polymer scaffold containing a radiotherapeutic isotope and a targeting antibody. Methods: The multistep synthesis of a fluorescent or 149Promethium-labeled Trastuzumab-polyethyleneimine (PEI), Trastuzumab, or PEI is described. In vitro uptake, internalization and/or the binding affinity to the Her2/neu expressing human breast adenocarcinoma SKBr3 cells was investigated with the labeled compounds. Fluorescent-labeled Trastuzumab-PEI was internalized more into cells at 2 and 18 h than fluorescent-labeled Trastuzumab or PEI. The fluorescent-labeled Trastuzumab wasmore » concentrated on the cell surface at 2 and 18 h and the labeled PEI had minimal uptake. DOTA-PEI was prepared and contained an average of 16 chelates per PEI; the compound was radio-labeled with 149Promethium and conjugated to Trastuzumab. The purified 149Pm-DOTA-PEI-Trastuzumab had a radiochemical purity of 96.7% and a specific activity of 0.118 TBq/g. The compound demonstrated a dissociation constant for the Her2/neu receptor of 20.30 ± 6.91 nM. In conclusion, the results indicate the DOTA-PEI-Trastuzumab compound has potential as a targeted therapeutic carrier, and future in vivo studies should be performed.« less

  19. A New Generation of Labels for a New Generation of Cars | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy A New Generation of Labels for a New Generation of Cars A New Generation of Labels for a New Generation of Cars May 25, 2011 - 5:42pm Addthis A New Generation of Labels for a New Generation of Cars John Schueler John Schueler Former New Media Specialist, Office of Public Affairs What does this mean for me? An improved car buying experience Clear cut cost comparisons of vehicles If you've ever gone through the process of shopping for a new car, you know just how difficult it can be to

  20. Department of Energy to Take Steps to Remove ENERGY STAR Label...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    As a result, effective January 2, 2010, certain LG French-door refrigerators are no longer eligible to carry the ENERGY STAR label. ENERGY STAR is a voluntary program sponsored ...

  1. New Lighting Facts Label: Takes the Guess Work Out of Shopping...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    New Lighting Facts Label: Takes the Guess Work Out of Shopping for Light Bulbs January 25, 2012 - 5:52am Addthis Chris Stewart Senior Communicator at DOE's National Renewable ...

  2. OPS 9.18 Equipment and Piping Labeling 8/24/98

    Broader source: Energy.gov [DOE]

    The objective of this surveillance is to verify that facility equipment and piping are labeled in a manner such that facility personnel are able to positively identify equipment they operate.  This...

  3. DOE Withdraws the Energy Star Label from 34 Compact Fluorescent Light Bulbs

    Broader source: Energy.gov [DOE]

    Washington, DC - On January 25th, the General Counsel notified 25 manufacturers that the Department of Energy has withdrawn their right to use the Energy Star label on 34 different models of...

  4. Energy Department Sets Tougher Standards for Clothes Washers to Qualify for the ENERGY STAR® Label

    Broader source: Energy.gov [DOE]

    WASHINGTON, DC - The U.S. Department of Energy (DOE) today announced tougher standards for clothes washers to qualify for the ENERGY STAR® label, which lets American families identify which clothes...

  5. Look at the label and indicate the type of unit for which you...

    U.S. Energy Information Administration (EIA) Indexed Site

    Case Label Here STEP 1 STEP 2 Please provide the following information for the person who completed this form. (Use each box for individual letters, numbers, characters, or spaces. ...

  6. Look at the label and indicate the type of unit for which you...

    U.S. Energy Information Administration (EIA) Indexed Site

    Department of Energy Washington, DC 20585 Case Label Here STEP 1 STEP 2 Please provide ... C O M STEP 3 Reporting format: Report the requested information on this form, or in a ...

  7. California Homebuyers Find More Value in Energy-Efficient Labeled Homes |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy California Homebuyers Find More Value in Energy-Efficient Labeled Homes California Homebuyers Find More Value in Energy-Efficient Labeled Homes A photo of a house. During a time when many homeowners have seen their homes' values decrease, some encouraging data shows how investing in efficiency will boost resale value. Aside from the increased comfort and reduced utility bills that stem from home energy efficiency upgrades, homeowners who invest in energy-efficient

  8. Enhancing the Sensitivity of Label-free Silicon Photonic Biosensors through

    Office of Scientific and Technical Information (OSTI)

    Increased Probe Molecule Density (Journal Article) | SciTech Connect Enhancing the Sensitivity of Label-free Silicon Photonic Biosensors through Increased Probe Molecule Density Citation Details In-Document Search Title: Enhancing the Sensitivity of Label-free Silicon Photonic Biosensors through Increased Probe Molecule Density Authors: Hu, Shuren [1] ; Quin, K. [1] ; Retterer, Scott T [2] ; Kravchenko, Ivan I [2] ; Weiss, Sharon [1] + Show Author Affiliations Vanderbilt University,

  9. Cyanine dyes with high-absorbance cross section as donor chromophores in energy transfer labels

    DOE Patents [OSTI]

    Glazer, Alexander N.; Mathies, Richard A.; Hung, Su-Chun; Ju, Jingyue

    1998-01-01

    Cyanine dyes are used as the donor fluorophore in energy transfer labels in which light energy is absorbed by a donor fluorophore and transferred to an acceptor fluorophore which responds to the transfer by emitting fluorescent light for detection. The cyanine dyes impart an unusually high sensitivity to the labels thereby improving their usefulness in a wide variety of biochemical procedures, particularly nucleic acid sequencing, nucleic acid fragment sizing, and related procedures.

  10. Methods of sequencing and detection using energy transfer labels with cyanine dyes as donor chromophores

    DOE Patents [OSTI]

    Glazer, Alexander N.; Mathies, Richard A.; Hung, Su-Chun; Ju, Jingyue

    2000-01-01

    Cyanine dyes are used as the donor fluorophore in energy transfer labels in which light energy is absorbed by a donor fluorophore and transferred to an acceptor fluorophore which responds to the transfer by emitting fluorescent light for detection. The cyanine dyes impart an unusually high sensitivity to the labels thereby improving their usefulness in a wide variety of biochemical procedures, particularly nucleic acid sequencing, nucleic acid fragment sizing, and related procedures.

  11. Cyanine dyes with high-absorbance cross section as donor chromophores in energy transfer labels

    DOE Patents [OSTI]

    Glazer, A.N.; Mathies, R.A.; Hung, S.C.; Ju, J.

    1998-12-29

    Cyanine dyes are used as the donor fluorophore in energy transfer labels in which light energy is absorbed by a donor fluorophore and transferred to an acceptor fluorophore which responds to the transfer by emitting fluorescent light for detection. The cyanine dyes impart an unusually high sensitivity to the labels thereby improving their usefulness in a wide variety of biochemical procedures, particularly nucleic acid sequencing, nucleic acid fragment sizing, and related procedures. 22 figs.

  12. Method for rapid base sequencing in DNA and RNA with two base labeling

    DOE Patents [OSTI]

    Jett, J.H.; Keller, R.A.; Martin, J.C.; Posner, R.G.; Marrone, B.L.; Hammond, M.L.; Simpson, D.J.

    1995-04-11

    A method is described for rapid-base sequencing in DNA and RNA with two-base labeling and employing fluorescent detection of single molecules at two wavelengths. Bases modified to accept fluorescent labels are used to replicate a single DNA or RNA strand to be sequenced. The bases are then sequentially cleaved from the replicated strand, excited with a chosen spectrum of electromagnetic radiation, and the fluorescence from individual, tagged bases detected in the order of cleavage from the strand. 4 figures.

  13. Microsoft Word - Smart Grid Certification and Labeling Program 09-11-2009 _3_.docx

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    NETL Modern Grid Strategy Powering our 21st-Century Economy SMART GRID CERTIFICATION AND LABELING Conducted by National Energy Technology Laboratory for the U.S. Department of Energy Office of Electricity Delivery and Energy Reliability September 2009 Office of Electricity Delivery and Energy Reliability Smart Grid Certification and Labeling 1 DISCLAIMER This report was prepared as an account of work sponsored by an agency of the United States Government. Neither the United States Government nor

  14. Biosensor for label-free DNA quantification based on functionalized LPGs

    Office of Scientific and Technical Information (OSTI)

    (Journal Article) | DOE PAGES Publisher's Accepted Manuscript: Biosensor for label-free DNA quantification based on functionalized LPGs This content will become publicly available on December 31, 2017 « Prev Next » Title: Biosensor for label-free DNA quantification based on functionalized LPGs Authors: Gonçalves, Helena M. R. ; Moreira, Luis ; Pereira, Leonor ; Jorge, Pedro ; Gouveia, Carlos ; Martins-Lopes, Paula ; Fernandes, José R. A. Publication Date: 2016-10-01 OSTI Identifier:

  15. Synthesis of isotopically labeled R- or S-[.sup.13C, .sup.2H] glycerols

    DOE Patents [OSTI]

    Martinez, Rodolfo A.; Unkefer, Clifford J.; Alvarez, Marc A.

    2008-01-22

    The present invention is directed to asymmetric chiral labeled glycerols including at least one chiral atom, from one to two .sup.13C atoms and from zero to four deuterium atoms bonded directly to a carbon atom, e.g., (2S) [1,2-.sup.13C.sub.2]glycerol and (2R) [1,2-.sup.13C.sub.2]glycerol, and to the use of such chiral glycerols in the preparation of labeled amino acids.

  16. Method for rapid base sequencing in DNA and RNA with two base labeling

    DOE Patents [OSTI]

    Jett, James H.; Keller, Richard A.; Martin, John C.; Posner, Richard G.; Marrone, Babetta L.; Hammond, Mark L.; Simpson, Daniel J.

    1995-01-01

    Method for rapid-base sequencing in DNA and RNA with two-base labeling and employing fluorescent detection of single molecules at two wavelengths. Bases modified to accept fluorescent labels are used to replicate a single DNA or RNA strand to be sequenced. The bases are then sequentially cleaved from the replicated strand, excited with a chosen spectrum of electromagnetic radiation, and the fluorescence from individual, tagged bases detected in the order of cleavage from the strand.

  17. Methods for labeling .beta.-amyloid plaques and neurofibrillary tangles

    DOE Patents [OSTI]

    Barrio, Jorge R.; Petric, Andrej; Satyamurthy, Nagichettiar; Small, Gary W.; Cole, Gregory M.; Huang, Sung-Cheng

    2001-01-01

    A method for labeling .beta.-amyloid plaques and neurofibrillary tangles in vivo and in vitro, comprises contacting a compound of formula (I): ##STR1## with mammalian tissue. In formula (I), R.sub.1 is selected from the group consisting of --C(O)-alkyl, --C(O)-alkylenyl-R.sub.4, --C(O)O-alkyl, --C(O)O-alkylenyl-R.sub.4, --C.dbd.C(CN).sub.2 -alkyl, --C.dbd.C(CN).sub.2 -alkylenyl-R.sub.4 , ##STR2## R.sub.4 is a radical selected from the group consisting of alkyl, substituted alkyl, aryl and substituted aryl; R.sub.5, is a radical selected from the group consisting of --NH.sub.2, --OH, --SH, --NH-alkyl, --NHR.sub.4, --NH-alkylenyl-R.sub.4, --O-alkyl, --O-alkylenyl-R.sub.4, --S-alkyl, and --S-alkylenyl-R.sub.4 ; R.sub.6 is a radical selected from the group consisting of --CN, --COOH, --C(O)O-alkyl, --C(O)O-alkylenyl-R.sub.4, --C(O)-alkyl, --C(O)-alkylenyl-R.sub.4, --C(O)-halogen, --C(O)NH , --C(O)NH-alkyl, --C(O)NH-alkylenyl-R.sub.4 ; R.sub.7 is a radical selected from the group consisting of O, NH, and S; and R.sub.8 is N, O or S. R.sub.2 and R.sub.3 are each independently selected from the group consisting of alkyl and alkylenyl-R.sub.10, wherein R.sub.10 is selected from the group consisting of --OH, --OTs, halogen, spiperone, spiperone ketal and spiperone-3-yl. Alternatively, R.sub.2 and R.sub.3 together form a heterocyclic ring, optionally substituted with at least one radical selected from the group consisting of alkyl, alkoxy, OH, OTs, halogen, alkylenyl-R.sub.10, carbonyl, spiperone, spiperone ketal and spiperone-3-yl. In the compounds of formula (I), one or more of the hydrogen, halogen or carbon atoms can, optionally, be replaced with a radiolabel.

  18. Methods for labeling .beta.-amyloid plaques and neurofibrillary tangles

    DOE Patents [OSTI]

    Barrio, Jorge R.; Petric, Andrej; Satyamurthy, Nagichettiar; Small, Gary W.; Cole, Gregory M.; Huang, Sung-Cheng

    2003-12-09

    A method for labeling .beta.-amyloid plaques and neurofibrillary tangles in vivo and in vitro, comprises contacting a compound of formula (I): ##STR1## with mammalian tissue. In formula (I), R.sub.1 is selected from the group consisting of --C(O)-alkyl, --C(O)-alkylenyl-R.sub.4, --C(O)O-alkyl, --C(O)O-alkylenyl-R.sub.4, --C.dbd.C(CN).sub.2 -alkyl, --C.dbd.C(CN).sub.2 -alkylenyl-R.sub.4, ##STR2## R.sub.4 is a radical selected from the group consisting of alkyl, substituted alkyl, aryl and substituted aryl; R.sub.5 is a radical selected from the group consisting of --NH.sub.2, --OH, --SH, --NH-alkyl, --NHR.sub.4, --NH-alkylenyl-R.sub.4, --O-alkyl, --O-alkylenyl-R.sub.4, --S-alkyl, and --S-alkylenyl-R.sub.4 ; R.sub.6 is a radical selected from the group consisting of --CN, --COOH, --C(O)O-alkyl, --C(O)O-alkylenyl-R.sub.4, --C(O)-alkyl, --C(O)-alkylenyl-R.sub.4, --C(O)-halogen, --C(O)NH, --C(O)NH-alkyl, --C(O)NH-alkylenyl-R.sub.4 ; R.sub.7 is a radical selected from the group consisting of O, NH, and S; and R.sub.8 is N, O or S. R.sub.2 and R.sub.3 are each independently selected from the group consisting of alkyl and alkylenyl-R.sub.10, wherein R.sub.10 is selected from the group consisting of --OH, --OTs, halogen, spiperone, spiperone ketal and spiperone-3-yl. Alternatively, R.sub.2 and R.sub.3 together form a heterocyclic ring, optionally substituted with at least one radical selected from the group consisting of alkyl, alkoxy, OH, OTs, halogen, alkylenyl-R.sub.10, carbonyl, spiperone, spiperone ketal and spiperone-3-yl. In the compounds of formula (I), one or more of the hydrogen, halogen or carbon atoms can, optionally, be replaced with a radiolabel.

  19. Compositions for labeling .beta.-amyloid plaques and neurofibrillary tangles

    DOE Patents [OSTI]

    Barrio, Jorge R.; Petric, Andrej; Satyamurthy, Nagichettiar; Small, Gary W.; Cole, Gregory M.; Huang, Sung-Cheng

    2008-03-11

    Compositions useful for labeling .beta.-amyloid plaques and neurofibrillary tangles are provided. The compositions comprises compounds of formula (I): ##STR00001## wherein R.sub.1 is selected from the group consisting of --C(O)-alkyl, --C(O)-alkylenyl-R.sub.4, --C(O)O-alkyl, --C(O)O-alkylenyl-R.sub.4, --C.dbd.C(CN).sub.2-alkyl, --C.dbd.C(CN).sub.2-alkylenyl-R.sub.4, ##STR00002## wherein R.sub.4 is a radical selected from the group consisting of alkyl, substituted alkyl, aryl and substituted aryl; R.sub.5 is a radical selected from the group consisting of --NH.sub.2, --OH, --SH, --NH-alkyl, --NHR.sub.4, --NH-alkylenyl-R.sub.4, --O-alkyl, --O-alkylenyl-R.sub.4, --S-alkyl, and --S-alkylenyl-R.sub.4; R.sub.6 is a radical selected from the group consisting of --CN, --COOH, --C(O)O-alkyl, --C(O)O-alkylenyl-R.sub.4, --C(O)-alkyl, --C(O)-alkylenyl-R.sub.4, --C(O)-halogen, --C(O)NH-alkyl, --C(O)NH-alkylenyl-R.sub.4 and --C(O)NH.sub.2; R.sub.7 is a radical selected from the group consisting of O, NH, and S; and R.sub.8 is N, O or S; and R.sub.2 is selected from the group consisting of alkyl and alkylenyl-R.sub.10 and R.sub.3 is alkylenyl-R.sub.10, wherein R.sub.10 is selected from the group consisting of --OH, --OTs, halogen, spiperone, spiperone ketal, and spiperone-3-yl, or R.sub.2 and R.sub.3 together form a heterocyclic ring, optionally substituted with at least one radical selected from the group consisting of alkyl, alkoxy, OH, OTs, halogen, alkyl-R.sub.10, carbonyl, spiperone, spiperone ketal and spiperone-3-yl, and further wherein one or more of the hydrogen, halogen or carbon atoms are optionally replaced with a radiolabel.

  20. Comparison of doubly labeled water with respirometry at low- and high-activity levels

    SciTech Connect (OSTI)

    Westerterp, K.R.; Brouns, F.; Saris, W.H.; ten Hoor, F.

    1988-07-01

    In previous studies the doubly labeled water method for measuring energy expenditure in free-living humans has been validated against respirometry under sedentary conditions. In the present investigation, energy expenditure is measured simultaneously with doubly labeled water and respirometry at low- and high-activity levels. Over 6 days, five subjects were measured doing mainly sedentary activities like desk work; their average daily metabolic rate was 1.40 +/- 0.09 (SD) times sleeping metabolic rate. Four subjects were measured twice over 3.5 days, including 2 days with heavy bicycle ergometer work, resulting in an average daily metabolic rate of 2.61 +/- 0.25 (SD) times sleeping metabolic rate. At the low-activity level, energy expenditures from the doubly labeled water method were on the average 1.4 +/- 3.9% (SD) larger than those from respirometry. At the high-activity level, the doubly labeled water method yielded values that were 1.0 +/- 7.0% (SD) lower than those from respirometry. Results demonstrate the utility of the doubly labeled water method for the determination of energy expenditure in the range of activity levels in daily life.

  1. New Lighting Facts Label: Takes the Guess Work Out of Shopping for Light

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Bulbs | Department of Energy Lighting Facts Label: Takes the Guess Work Out of Shopping for Light Bulbs New Lighting Facts Label: Takes the Guess Work Out of Shopping for Light Bulbs January 25, 2012 - 5:52am Addthis Chris Stewart Senior Communicator at DOE's National Renewable Energy Laboratory If you're like me, it sometimes feels overwhelming standing at the store and staring at a big wall of light bulbs, trying to understand all the lighting choices. With new lighting standards taking

  2. Department of Energy to Take Steps to Remove ENERGY STAR Label on Certain

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    LG Refrigerator-Freezer Models | Department of Energy to Take Steps to Remove ENERGY STAR Label on Certain LG Refrigerator-Freezer Models Department of Energy to Take Steps to Remove ENERGY STAR Label on Certain LG Refrigerator-Freezer Models December 7, 2009 - 12:00am Addthis Washington, DC - The Department of Energy announced today that as part of the expanded enforcement efforts under the ENERGY STAR® program, effective January 2, 2010, certain LG French-door refrigerator-freezers are

  3. Energy-efficiency labels and standards: A guidebook for appliances, equipment and lighting

    SciTech Connect (OSTI)

    McMahon, James E.; Wiel, Stephen

    2001-02-16

    Energy-performance improvements in consumer products are an essential element in any government's portfolio of energy-efficiency and climate change mitigation programs. Governments need to develop balanced programs, both voluntary and regulatory, that remove cost-ineffective, energy-wasting products from the marketplace and stimulate the development of cost-effective, energy-efficient technology. Energy-efficiency labels and standards for appliances, equipment, and lighting products deserve to be among the first policy tools considered by a country's energy policy makers. The U.S. Agency for International Development (USAID) and the United Nations Foundation (UNF) recognize the need to support policy makers in their efforts to implement energy-efficiency standards and labeling programs and have developed this guidebook, together with the Collaborative Labeling and Appliance Standards Program (CLASP), as a primary reference. This guidebook was prepared over the course of the past year with significant contribution from the authors and reviewers mentioned previously. Their diligent participation has made this the international guidance tool it was intended to be. The lead authors would also like to thank the following individuals for their support in the development, production, and distribution of the guidebook: Marcy Beck, Elisa Derby, Diana Dhunke, Ted Gartner, and Julie Osborn of Lawrence Berkeley National Laboratory as well as Anthony Ma of Bevilacqua-Knight, Inc. This guidebook is designed as a manual for government officials and others around the world responsible for developing, implementing, enforcing, monitoring, and maintaining labeling and standards-setting programs. It discusses the pros and cons of adopting energy-efficiency labels and standards and describes the data, facilities, and institutional and human resources needed for these programs. It provides guidance on the design, development, implementation, maintenance, and evaluation of the programs and on the design of the labels and standards themselves. In addition, it directs the reader to references and other resources likely to be useful in conducting the activities described and includes a chapter on energy policies and programs that complement appliance efficiency labels and standards. This guidebook attempts to reflect the essential framework of labeling and standards programs. It is the intent of the authors and sponsors to distribute copies of this book worldwide at no charge for the general public benefit. The guidebook is also available on the web at www.CLASPonline.org and can be downloaded to be used intact or piecemeal for whatever beneficial purposes readers may conceive.

  4. Expedited Synthesis of Fluorine-18 Labeled Phenols. A Missing Link in PET Radiochemistry

    SciTech Connect (OSTI)

    Katzenellenbogen, John A.; Zhou, Dong

    2015-03-26

    Fluorine-18 (F-18) is arguably the most valuable radionuclide for positron emission tomographic (PET) imaging. However, while there are many methods for labeling small molecules with F-18 at aliphatic positions and on electron-deficient aromatic rings, there are essentially no reliable and practical methods to label electron-rich aromatic rings such as phenols, with F-18 at high specific activity. This is disappointing because fluorine-labeled phenols are found in many drugs; there are also many interesting plant metabolites and hormones that contain either phenols or other electron-rich aromatic systems such as indoles whose metabolism, transport, and distribution would be interesting to study if they could readily be labeled with F-18. Most approaches to label phenols with F-18 involve the labeling of electron-poor precursor arenes by nucleophilic aromatic substitution, followed by subsequent conversion to phenols by oxidation or other multi-step sequences that are often inefficient and time consuming. Thus, the lack of good methods for labeling phenols and other electron-rich aromatics with F-18 at high specific activity represents a significant methodological gap in F-18 radiochemistry that can be considered a “Missing Link in PET Radiochemistry”. The objective of this research project was to develop and optimize a series of unusual synthetic transformations that will enable phenols (and other electron-rich aromatic systems) to be labeled with F-18 at high specific activity, rapidly, reliably, and conveniently, thereby bridging this gap. Through the studies conducted with support of this project, we have substantially advanced synthetic methodology for the preparation of fluorophenols. Our progress is presented in detail in the sections below, and much has been published or presented publication; other components are being prepared for publication. In essence, we have developed a completely new method to prepare o-fluorophenols from non-aromatic precursors (diazocyclohexenones) by a novel reaction sequence that uses fluoride ion as a precursor and various activating electrophiles, and we have improved methods for the preparation of heterodiaryl iodonium salts. Both methods have been used to prepare interesting potential radiotracers. Other advances have been made in labeling dendrimeric nanoparticle structures of increasing interest for multimodal imaging and in advancing labeling through fluorosilane bonds. Thus, the progress we have made substantially fills the significant gap in PET radiochemistry that we originally identified, and it provides for the field new methodology that can be applied to a number of current challenges, including the preparation of several molecules of interest as radiotracers, such as 2-[18F]Fluoroestradiol (2-FES) and m-fluorotyrosine, which we have illustrated. These methods can be used by any skilled radiochemist interesting in preparing these agents or similar fluorine-18 labeled electron-rich arene systems of interested for PET biological imaging in the most general sense.

  5. NAME ORGANIZATION E-MAIL PHONE

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    (865) 574-2105 (Alternate) Miller, Ruth Oak Ridge Nat'l Laboratory ... Ashley, Tom CWI, Idaho Cleanup Project thomas.ashley@icp.doe.gov (208) 360-3552 McGary, ...

  6. Mail Management Memorandum, July 2, 2010

    Energy Savers [EERE]

  7. Printing and Mail Managers Exchange Forum Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    New reporting due date will be October 31 of each year starting in FY-2014. On-line ... Change to Schedule 5-1. Requirement is to now enter numbers rounded to the nearest dollar ...

  8. Widget:MailChimp | Open Energy Information

    Open Energy Info (EERE)

    source History View New Pages Recent Changes All Special Pages Semantic SearchQuerying Get Involved Help Apps Datasets Community Login | Sign Up Search Widget Edit History...

  9. Kit for the selective labeling of red blood cells in whole blood with [sup 99]Tc

    DOE Patents [OSTI]

    Srivastava, S.C.; Babich, J.W.; Straub, R.; Richards, P.

    1992-05-26

    Disclosed herein are a method and kit for the preparation of [sup 99m]Tc labeled red blood cells using whole blood in a closed sterile system containing stannous tin in a form such that it will enter the red blood cells and be available therein for reduction of technetium. No Drawings

  10. New method for the selective labeling of erythrocytes in whole blood with Tc-99m

    DOE Patents [OSTI]

    Srivastava, S.C.; Babich, J.W.; Straub, R.; Richards, P.

    1984-01-27

    Method and kit are described for the preparation of /sup 99m/Tc labeled red blood cells using whole blood in a closed sterile system containing stannous tin in a form such that it will enter the red blood cells and be available therein for the reduction of technetium.

  11. Kit for the selective labeling of red blood cells in whole blood with .sup.9 TC

    DOE Patents [OSTI]

    Srivastava, Suresh C.; Babich, John W.; Straub, Rita; Richards, Powell

    1992-01-01

    Disclosed herein are a method and kit for the preparation of .sup.99m Tc labeled red blood cells using whole blood in a closed sterile system containing stannous tin in a form such that it will enter the red blood cells and be available therein for reduction of technetium.

  12. Feasibility of an appliance energy testing and labeling program for Sri Lanka

    SciTech Connect (OSTI)

    Biermayer, Peter; Busch, John; Hakim, Sajid; Turiel, Issac; du Pont, Peter; Stone, Chris

    2000-04-01

    A feasibility study evaluated the costs and benefits of establishing a program for testing, labeling and setting minimum efficiency standards for appliances and lighting in Sri Lanka. The feasibility study included: refrigerators, air-conditioners, flourescent lighting (ballasts & CFls), ceiling fans, motors, and televisions.

  13. Using phylogenetic probes for quantification of stable isotope labeling and microbial community analysis

    DOE Patents [OSTI]

    Brodie, Eoin L; DeSantis, Todd Z; Karaoz, Ulas; Andersen, Gary L

    2014-12-09

    Herein is described methods for a high-sensitivity means to measure the incorporation of stable isotope labeled substrates into RNA following stable isotope probing experiments (SIP). RNA is hybridized to a set of probes such as phylogenetic microarrays and isotope incorporation is quantified such as by secondary ion mass spectrometer imaging (NanoSIMS).

  14. High-resolution x-ray diffraction microscopy of specifically labeled yeast cells

    SciTech Connect (OSTI)

    Nelson, Johanna; Huang, Xiaojing; Steinbrener, Jan; Shapiro, David; Kirz, Janos; Marchesini, Stephano; Neiman, Aaron M.; Turner, Joshua J.; Jacobsen, Chris

    2010-04-20

    X-ray diffraction microscopy complements other x-ray microscopy methods by being free of lens-imposed radiation dose and resolution limits, and it allows for high-resolution imaging of biological specimens too thick to be viewed by electron microscopy. We report here the highest resolution (11-13 nm) x-ray diffraction micrograph of biological specimens, and a demonstration of molecular-specific gold labeling at different depths within cells via through-focus propagation of the reconstructed wavefield. The lectin concanavalin A conjugated to colloidal gold particles was used to label the ?-mannan sugar in the cell wall of the yeast Saccharomyces cerevisiae. Cells were plunge-frozen in liquid ethane and freeze-dried, after which they were imaged whole using x-ray diffraction microscopy at 750 eV photon energy.

  15. High-resolution x-ray diffraction microscopy of specifically labeled yeast cells

    DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

    Nelson, Johanna; Huang, Xiaojing; Steinbrener, Jan; Shapiro, David; Kirz, Janos; Marchesini, Stephano; Neiman, Aaron M.; Turner, Joshua J.; Jacobsen, Chris

    2010-04-20

    X-ray diffraction microscopy complements other x-ray microscopy methods by being free of lens-imposed radiation dose and resolution limits, and it allows for high-resolution imaging of biological specimens too thick to be viewed by electron microscopy. We report here the highest resolution (11-13 nm) x-ray diffraction micrograph of biological specimens, and a demonstration of molecular-specific gold labeling at different depths within cells via through-focus propagation of the reconstructed wavefield. The lectin concanavalin A conjugated to colloidal gold particles was used to label the α-mannan sugar in the cell wall of the yeast Saccharomyces cerevisiae. Cells were plunge-frozen in liquid ethane andmore » freeze-dried, after which they were imaged whole using x-ray diffraction microscopy at 750 eV photon energy.« less

  16. Method for preparing radionuclide-labeled chelating agent-ligand complexes

    DOE Patents [OSTI]

    Meares, Claude F.; Li, Min; DeNardo, Sally J.

    1999-01-01

    Radionuclide-labeled chelating agent-ligand complexes that are useful in medical diagnosis or therapy are prepared by reacting a radionuclide, such as .sup.90 Y or .sup.111 In, with a polyfunctional chelating agent to form a radionuclide chelate that is electrically neutral; purifying the chelate by anion exchange chromatography; and reacting the purified chelate with a targeting molecule, such as a monoclonal antibody, to form the complex.

  17. Systematic Method for the Kinetic Modeling of Temporally Resolved Hyperspectral Microscope Images of Fluorescently Labeled Cells

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    accelerated paper Systematic Method for the Kinetic Modeling of Temporally Resolved Hyperspectral Microscope Images of Fluorescently Labeled Cells PATRICK J. CUTLER, DAVID M. HAALAND, and PAUL J. GEMPERLINE* Department of Chemistry, East Carolina University, Greenville, North Carolina 27858 (P.J.C., P.J.G.); and Sandia National Laboratories, Albuquerque, New Mexico 87185-0895 (D.M.H.) In this paper we report the application of a novel method for fitting kinetic models to temporally resolved

  18. Alexa Fluor-labeled Fluorescent Cellulose Nanocrystals for Bioimaging Solid Cellulose in Spatially Structured Microenvironments

    SciTech Connect (OSTI)

    Grate, Jay W.; Mo, Kai-For; Shin, Yongsoon; Vasdekis, Andreas; Warner, Marvin G.; Kelly, Ryan T.; Orr, Galya; Hu, Dehong; Dehoff, Karl J.; Brockman, Fred J.; Wilkins, Michael J.

    2015-03-18

    Cellulose nanocrystal materials have been labeled with modern Alexa Fluor dyes in a process that first links the dye to a cyanuric chloride molecule. Subsequent reaction with cellulose nanocrystals provides dyed solid microcrystalline cellulose material that can be used for bioimaging and suitable for deposition in films and spatially structured microenvironments. It is demonstrated with single molecular fluorescence microscopy that these films are subject to hydrolysis by cellulose enzymes.

  19. Labeling of Cp-105,191. Unusual findings on triphenyltin hydride reduction of an aryl iodide

    SciTech Connect (OSTI)

    McCarthy, P.A.; Diaz, C.L.; Zawistoski, M.P.

    1995-12-01

    CP-105,191 (1) is a potent, selective and systemically-available inhibitor of acyl-coenzyme A:cholesterol acyl transferase. We needed to make tritium-labeled 1 in order to facilitate the preclinical evaluation of the pharmacokinetics and systemic anti-atherosclerosis effects of 1. Desiring to introduce the tritium as the last step in the synthesis, we opted for introduction of the tritium into the quinoline nucleus via reduction of an 8-iodo species (8, synthesis to be described). To our surprise, treatment of 8 with distilled triphenyltin deuteride and catalytic AIBN in diglyme at reflux for 2 hours gave 67-72% yield of 1 with no deuterium incorporation. Consideration of these results and others to be presented suggests that the solvent is participating in radical chain propagation and that this reaction was unsuitable for tritium labeling. After these results, we found that reduction of 8 with atmospheric pressure of deuterium catalyzed by palladium on carbon in ethanol and triethylamine gave 75-95% yield of 1 with complete deuterium incorporation at C8 of the quinoline ring. The same reaction using 4 Ci of tritium gas gave 1.8 Ci of tritium-labeled 1 with specific activity of 20 Ci/mmole and 97% radiochemical purity.

  20. Apparatus and method for reading two-dimensional electrophoretograms containing .beta.-ray-emitting labeled compounds

    DOE Patents [OSTI]

    Anderson, Herbert L.; Kinnison, W. Wayne; Lillberg, John W.

    1987-01-01

    Apparatus and method for electronically reading planar two dimensional .beta.-ray emitter-labeled gel electrophoretograms. A single, flat rectangular multiwire proportional chamber is placed in close proximity to the gel and the assembly placed in an intense uniform magnetic field disposed in a perpendicular manner to the rectangular face of the proportional chamber. Beta rays emitted in the direction of the proportional chamber are caused to execute helical motions which substantially preserve knowledge of the coordinates of their origin in the gel. Perpendicularly oriented, parallel wire, parallel plane cathodes electronically sense the location of the .beta.-rays from ionization generated thereby in a detection gas coupled with an electron avalanche effect resulting from the action of a parallel wire anode located therebetween. A scintillator permits the present apparatus to be rendered insensitive when signals are generated from cosmic rays incident on the proportional chamber. Resolution for concentrations of radioactive compounds in the gel exceeds 700 .mu.m. The apparatus and method of the present invention represent a significant improvement over conventional autoradiographic techniques in dynamic range, linearity and sensitivity of data collection. A concentration and position map for gel electrophoretograms having significant concentrations of labeled compounds and/or highly radioactive labeling nuclides can generally be obtained in less than one hour.

  1. Apparatus for reading two-dimensional electrophoretograms containing. beta. -ray-emitting labeled compounds

    DOE Patents [OSTI]

    Anderson, H.L.; Kinnison, W.W.; Lillberg, J.W.

    1985-04-30

    An apparatus and method for electronically reading planar two-dimensional ..beta..-ray emitter-labeled gel electrophoretograms. A single, flat rectangular multiwire proportional chamber is placed in close proximity to the gel and the assembly placed in an intense uniform magnetic field disposed in a perpendicular manner to the rectangular face of the proportional chamber. Beta rays emitted in the direction of the proportional chamber are caused to execute helical motions which substantially preserve knowledge the coordinates of their origin in the gel. Perpendicularly oriented, parallel wire, parallel plane cathodes electronically sense the location of the ..beta..-rays from ionization generated thereby in a detection gas coupled with an electron avalanche effect resulting from the action of a parallel wire anode located therebetween. A scintillator permits the present apparatus to be rendered insensitive when signals are generated from cosmic rays incident on the proportional chamber. Resolution for concentrations of radioactive compounds in the gel exceeds 700-..mu..m. The apparatus and method of the present invention represent a significant improvement over conventional autoradiographic techniques in dynamic range, linearity and sensitivity of data collection. A concentration and position map for gel electrophoretograms having significant concentrations of labeled compounds and/or highly radioactive labeling nuclides can generally be obtained in less than one hour.

  2. Calendar Year 2007 Program Benefits for U.S. EPA Energy Star Labeled Products: Expanded Methodology

    SciTech Connect (OSTI)

    Sanchez, Marla; Homan, Gregory; Lai, Judy; Brown, Richard

    2009-09-24

    This report provides a top-level summary of national savings achieved by the Energy Star voluntary product labeling program. To best quantify and analyze savings for all products, we developed a bottom-up product-based model. Each Energy Star product type is characterized by product-specific inputs that result in a product savings estimate. Our results show that through 2007, U.S. EPA Energy Star labeled products saved 5.5 Quads of primary energy and avoided 100 MtC of emissions. Although Energy Star-labeled products encompass over forty product types, only five of those product types accounted for 65percent of all Energy Star carbon reductions achieved to date, including (listed in order of savings magnitude)monitors, printers, residential light fixtures, televisions, and furnaces. The forecast shows that U.S. EPA?s program is expected to save 12.2 Quads of primary energy and avoid 215 MtC of emissions over the period of 2008?2015.

  3. 2006 Status Report Savings Estimates for the ENERGY STAR(R)Voluntary Labeling Program

    SciTech Connect (OSTI)

    Webber, Carrie A.; Brown, Richard E.; Sanchez, Marla; Homan,Gregory K.

    2006-03-07

    ENERGY STAR(R) is a voluntary labeling program designed toidentify and promote energy-efficient products, buildings and practices.Operated jointly by the Environmental Protection Agency (EPA) and theU.S. Department of Energy (DOE), ENERGY STAR labels exist for more thanthirty products, spanning office equipment, residential heating andcooling equipment, commercial and residential lighting, home electronics,and major appliances. This report presents savings estimates for a subsetof ENERGY STAR labeled products. We present estimates of the energy,dollar and carbon savings achieved by the program in the year 2005, whatwe expect in 2006, and provide savings forecasts for two marketpenetration scenarios for the periods 2006 to 2015 and 2006 to 2025. Thetarget market penetration forecast represents our best estimate of futureENERGY STAR savings. It is based on realistic market penetration goalsfor each of the products. We also provide a forecast under the assumptionof 100 percent market penetration; that is, we assume that all purchasersbuy ENERGY STAR-compliant products instead of standard efficiencyproducts throughout the analysis period.

  4. International Review of the Development and Implementation of Energy Efficiency Standards and Labeling Programs

    SciTech Connect (OSTI)

    Zhou, Nan; Zheng, Nina; Fridley, David

    2012-02-28

    Appliance energy efficiency standards and labeling (S&L) programs have been important policy tools for regulating the efficiency of energy-using products for over 40 years and continue to expand in terms of geographic and product coverage. The most common S&L programs include mandatory minimum energy performance standards (MEPS) that seek to push the market for efficient products, and energy information and endorsement labels that seek to pull the market. This study seeks to review and compare some of the earliest and most well-developed S&L programs in three countries and one region: the U.S. MEPS and ENERGY STAR, Australia MEPS and Energy Label, European Union MEPS and Ecodesign requirements and Energy Label and Japanese Top Runner programs. For each program, key elements of S&L programs are evaluated and comparative analyses across the programs undertaken to identify best practice examples of individual elements as well as cross-cutting factors for success and lessons learned in international S&L program development and implementation. The international review and comparative analysis identified several overarching themes and highlighted some common factors behind successful program elements. First, standard-setting and programmatic implementation can benefit significantly from a legal framework that stipulates a specific timeline or schedule for standard-setting and revision, product coverage and legal sanctions for non-compliance. Second, the different MEPS programs revealed similarities in targeting efficiency gains that are technically feasible and economically justified as the principle for choosing a standard level, in many cases at a level that no product on the current market could reach. Third, detailed survey data such as the U.S. Residential Energy Consumption Survey (RECS) and rigorous analyses provide a strong foundation for standard-setting while incorporating the participation of different groups of stakeholders further strengthen the process. Fourth, sufficient program resources for program implementation and evaluation are critical to the effectiveness of standards and labeling programs and cost-sharing between national and local governments can help ensure adequate resources and uniform implementation. Lastly, check-testing and punitive measures are important forms of enforcement while the cancellation of registration or product sales-based fines have also proven effective in reducing non-compliance. The international comparative analysis also revealed the differing degree to which the level of government decentralization has influenced S&L programs and while no single country has best practices in all elements of standards and labeling development and implementation, national examples of best practices for specific elements do exist. For example, the U.S. has exemplified the use of rigorous analyses for standard-setting and robust data source with the RECS database while Japan�s Top Runner standard-setting principle has motivated manufacturers to exceed targets. In terms of standards implementation and enforcement, Australia has demonstrated success with enforcement given its long history of check-testing and enforcement initiatives while mandatory information-sharing between EU jurisdictions on compliance results is another important enforcement mechanism. These examples show that it is important to evaluate not only the drivers of different paths of standards and labeling development, but also the country-specific context for best practice examples in order to understand how and why certain elements of specific S&L programs have been effective.

  5. Alternative Fuels Data Center

    Alternative Fuels and Advanced Vehicles Data Center [Office of Energy Efficiency and Renewable Energy (EERE)]

    Ethanol Blend Labeling Requirements Pumps that dispense ethanol-blended gasoline available for purchase must be labeled with the registered brand name and the volume percentage, or blend level, of the ethanol (10% or less, 10-15%, 15-85% or 85%). The labels must be affixed to the front panel of the pump in a position that is clearly visible to the vehicle driver. Graphics requirements apply. (Reference North Carolina Administrative Code Title 2, Chapter 42, Subchapter .0401; and North Carolina

  6. This form may be submitted to the EIA by mail, fax, e-mail, or...

    U.S. Energy Information Administration (EIA) Indexed Site

    business on the web.) To use this service, we recommend the use of Microsoft Internet Explorer 5.5 or later or Netscape 4.77 or later. Send your surveys using this secure...

  7. This form may be submitted to the EIA by mail, fax, e-mail, or...

    U.S. Energy Information Administration (EIA) Indexed Site

    over the web using secure, encrypted processes. (It is the same method that commercial companies communicate with customers when transacting business on the web.) To use this ...

  8. This form may be submitted to the EIA by mail, fax, e-mail, or...

    U.S. Energy Information Administration (EIA) Indexed Site

    over the web using secure, encrypted processes. (It is the same method that commercial companies use to communicate with customers when transacting business on the web.) To use ...

  9. This form may be submitted to the EIA by mail, fax, e-mail, or...

    U.S. Energy Information Administration (EIA) Indexed Site

    month." " since the last report, enter an ""X"" in the block:" " ",,,..."Mo",,,"Yea... "If this is a resubmission, enter an ""X"" in the block:",,,...

  10. This form may be submitted to the EIA by mail, fax, e-mail, or...

    U.S. Energy Information Administration (EIA) Indexed Site

    ,,," Version No: 2014.001" "ANNUAL REPORT OF THE ORIGIN OF NATURAL GAS LIQUIDS PRODUCTION" "FORM EIA-64A" "REPORT YEAR 2014" "This report is...

  11. This form may be submitted to the EIA by mail, fax, e-mail, or...

    U.S. Energy Information Administration (EIA) Indexed Site

    ...www.eia.govsurveyformeia782alist782a.pdf" "Phone No.:",,,..."Ex... you are reporting:" "Type of Report (Check One):" ,,"Original",,,..."Mo",,,"Da...

  12. This form may be submitted to the EIA by mail, fax, e-mail, or...

    U.S. Energy Information Administration (EIA) Indexed Site

    under the Federal Energy Administration Act of 1974 (Public Law 93-275). Failure to comply may result in criminal fines, civil penalties and other sanctions as provided by law. ...

  13. This form may be submitted to the EIA by mail, fax, e-mail, or...

    U.S. Energy Information Administration (EIA) Indexed Site

    Failure to comply may result in criminal fines, civil penalties and other sanctions as provided by law. Title 18 USC 1001 makes it a criminal offense for any person knowingly and ...

  14. This form may be submitted to the EIA by mail, fax, e-mail, or...

    U.S. Energy Information Administration (EIA) Indexed Site

    "REPORT YEAR 2011" "This report is mandatory under Public Law 93-275. Failure to comply may result in criminal fines, civil penalties and other sanctions as provided by law. ...

  15. Optimization of preparation of Rh-105 labeled (B72.3) MOAB using an amine oxime ligand and comparison of its biodistribution with I-131 labeled B72.3 MOAB

    SciTech Connect (OSTI)

    Venkatesh, M.; Kilcoin, T.T.; Schlemper, E.O.

    1994-05-01

    Propyleneamineoxime ligands with the four N donor atoms form stable complexes with Rh(III). The p-aminobenzylpropyleneamineoxime ligand (L) was made to act as a bifunctional chelating agent to label proteins with Rh-105. This study encompasses the optimization of formation of the Rh-105 complex of L, its purification, activation with thiophosgene, conjugation the B72.3 MOAB, purification by gel filtration, determination of its stability in physiological buffers and in human serum and comparison of the biodistribution Rh-105 labeled antibody with I-131 labeled antibody in normal healthy mice. Rh-105 was complexed with the ligand L by refluxing at pH 5-6 for 45 min. CuCl, was added to form a charged complex and the neutral activated Rh-105 complex extracted into chloroform. Following evaporation of CHC1{sub 3}, the complex was dissolved in 20 {mu}1 of DMF and reconstituted with 0.5 ml of saline. This was then reacted with the B72.3 MOAB in 0.05 M bicarbonate buffer at pH 9 and incubated for 3 h at 37{degrees}C. The complexation yields were generally 95% and the conjugation yields {approximately}60%. The Rh-105 conjugate was stable at room temperature in phosphate buffer saline (pH 7.4), bicarbonate buffer saline (pH 8.5) and human serum at 37{degrees}C for 4 days. >95% of the conjugate remained immunoreactive using mucin-bound to sepharose as the antigen. I-131 labeled antibody was prepared by using iodogen as the oxidizing agent. The two labeled antibodies were co-injected into healthy mice and the biodistribution studied at different time intervals. The biodistribution studies show good correlation between I-131 and Rh-105 labeled B72.3 MOAB preparations over 20 h demonstrating good in vivo stability. This ligand may be useful as a bifunctional chelating agent for Rh-105 labeled antibody.

  16. F-18 Labeled Diabody-Luciferase Fusion Proteins for Optical-ImmunoPET

    SciTech Connect (OSTI)

    Wu, Anna M

    2013-01-18

    The goal of the proposed work is to develop novel dual-labeled molecular imaging probes for multimodality imaging. Based on small, engineered antibodies called â??diabodiesâ?, these probes will be radioactively tagged with Fluorine-18 for PET imaging, and fused to luciferases for optical (bioluminescence) detection. Performance will be evaluated and validated using a prototype integrated optical-PET imaging system, OPET. Multimodality probes for optical-PET imaging will be based on diabodies that are dually labeled with 18F for PET detection and fused to luciferases for optical imaging. 1) Two sets of fusion proteins will be built, targeting the cell surface markers CEA or HER2. Coelenterazine-based luciferases and variant forms will be evaluated in combination with native substrate and analogs, in order to obtain two distinct probes recognizing different targets with different spectral signatures. 2) Diabody-luciferase fusion proteins will be labeled with 18F using amine reactive [18F]-SFB produced using a novel microwave-assisted, one-pot method. 3) Sitespecific, chemoselective radiolabeling methods will be devised, to reduce the chance that radiolabeling will inactivate either the target-binding properties or the bioluminescence properties of the diabody-luciferase fusion proteins. 4) Combined optical and PET imaging of these dual modality probes will be evaluated and validated in vitro and in vivo using a prototype integrated optical-PET imaging system, OPET. Each imaging modality has its strengths and weaknesses. Development and use of dual modality probes allows optical imaging to benefit from the localization and quantitation offered by the PET mode, and enhances the PET imaging by enabling simultaneous detection of more than one probe.

  17. .sup.123m Te-Labeled biochemicals and method of preparation

    DOE Patents [OSTI]

    Knapp, Jr., Furn F.

    1980-01-01

    A novel class of .sup.123m Te-labeled steroids and amino acids is provided by the method of reacting a .sup.123m Te symmetric diorgano ditelluride with a hydride reducing agent and a source of alkali metal ions to form an alkali metal organo telluride. The alkali metal organo telluride is reacted with a primary halogenated steroidal side chain, amino acid, or amino acid precursor such as hydantoin. The novel compounds are useful as biological tracers and as organal imaging agents.

  18. Label-free three-dimensional imaging of cell nucleus using third-harmonic generation microscopy

    SciTech Connect (OSTI)

    Lin, Jian; Zheng, Wei; Wang, Zi; Huang, Zhiwei

    2014-09-08

    We report the implementation of the combined third-harmonic generation (THG) and two-photon excited fluorescence (TPEF) microscopy for label-free three-dimensional (3-D) imaging of cell nucleus morphological changes in liver tissue. THG imaging shows regular spherical shapes of normal hepatocytes nuclei with inner chromatin structures while revealing the condensation of chromatins and nuclear fragmentations in hepatocytes of diseased liver tissue. Colocalized THG and TPEF imaging provides complementary information of cell nuclei and cytoplasm in tissue. This work suggests that 3-D THG microscopy has the potential for quantitative analysis of nuclear morphology in cells at a submicron-resolution without the need for DNA staining.

  19. Metabolomics relative quantitation with mass spectrometry using chemical derivatization and isotope labeling

    DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

    O'Maille, Grace; Go, Eden P.; Hoang, Linh; Want, Elizabeth J.; Smith, Colin; O'Maille, Paul; NordstrÖm, Anders; Morita, Hirotoshi; Qin, Chuan; Uritboonthai, Wilasinee; et al

    2008-01-01

    Comprehensive detection and quantitation of metabolites from a biological source constitute the major challenges of current metabolomics research. Two chemical derivatization methodologies, butylation and amination, were applied to human serum for ionization enhancement of a broad spectrum of metabolite classes, including steroids and amino acids. LC-ESI-MS analysis of the derivatized serum samples provided a significant signal elevation across the total ion chromatogram to over a 100-fold increase in ionization efficiency. It was also demonstrated that derivatization combined with isotopically labeled reagents facilitated the relative quantitation of derivatized metabolites from individual as well as pooled samples.

  20. Peptide affinity labels for thrombin and other trypsin-like proteases

    DOE Patents [OSTI]

    Shaw, E.N.; Kettner, C.A.

    1982-03-09

    A peptide affinity label is disclosed of the formula (I): as given in the patent wherein X is a radical capable of acting as a leaving group in a nucleophilic substitution reaction; A is an aromatic amino acid residue; B is H, or a C[sub 1]--C[sub 4] alkyl group, or aryl; Y is selected from the group consisting of hydrogen, aroyl, C[sub 1]--C[sub 6] acyl, and Q--(A)--[sub n], wherein Q = hydrogen, aroyl, or C[sub 1]--C[sub 6] acyl, n = 1--10, A is an amino acid residue selected from the aliphatic, hydroxy-containing, carboxylic acid group, and amide-thereofcontaining, aromatic, sulfur-containing and imino-containing amino acids; and wherein J is selected from the group consisting of --CH[sub 2]--, --CH[sub 2]--CH[sub 2]--, --CH[sub 2]--CH[sub 2]--CH[sub 2]--, --CH[double bond]CH-- and --CH(OH)--CH[sub 2]. The affinity label is useful for irreversibly inactivating thrombin and trypsin-like enzymes and may be used as a potential anticlotting agent. 2 figs.

  1. Made with Renewable Energy: How and Why Companies are Labeling Consumer Products

    SciTech Connect (OSTI)

    Baker Brannan, D.; Heeter, J.; Bird, L.

    2012-03-01

    Green marketing--a marketing strategy highlighting the environmental attributes of a product, often through the use of labels or logos--dates back to the 1970s. It did not proliferate until the 1990s, however, when extensive market research identified a rapidly growing group of consumers with a heightened concern for the environment. This group expressed not only a preference for green products but also a willingness to pay a premium for such products. The response was a surge in green marketing that lasted through the early 1990s. This report discusses the experience of companies that communicate to consumers that their products are 'made with renewable energy.' For this report, representatives from 20 companies were interviewed and asked to discuss their experiences marketing products produced using renewable energy. The first half of this report provides an overview of the type of companies that have labeled products or advertised them as being made with renewable energy. It also highlights the avenues companies use to describe their use of renewable energy. The second half of the report focuses on the motivations for making on-product claims about the use of renewable energy and the challenges in doing so.

  2. Peptide affinity labels for thrombin and other trypsin-like proteases

    DOE Patents [OSTI]

    Shaw, Elliott N.; Kettner, Charles A.

    1982-03-09

    A peptide affinity label of the formula (I): ##STR1## wherein X is a radical capable of acting as a leaving group in a nucleophilic substitution reaction; A is an aromatic amino acid residue; B is H, or a C.sub.1 -C.sub.4 alkyl group, or aryl; Y is selected from the group consisting of hydrogen, aroyl, C.sub.1 -C.sub.6 acyl, and Q--(A)--.sub.n, wherein Q=hydrogen, aroyl, or C.sub.1 -C.sub.6 acyl, n=1-10, A is an amino acid residue selected from the aliphatic, hydroxy-containing, carboxylic acid group, and amide-thereof-containing, aromatic, sulfur-containing and imino-containing amino acids; and wherein J is selected from the group consisting of --CH.sub.2 --, --CH.sub.2 --CH.sub.2 --,--CH.sub.2 --CH.sub.2 --CH.sub.2 --, --CH.dbd.CH-- and --CH(OH)--CH.sub.2. The affinity label is useful for irreversibly inactivating thrombin and trypsin-like enzymes and may be used as a potential anticlotting agent.

  3. Energy-Efficiency Labels and Standards: A Guidebook forAppliances, Equipment, and Lighting - 2nd Edition

    SciTech Connect (OSTI)

    Wiel, Stephen; McMahon, James E.

    2005-04-28

    Energy-performance improvements in consumer products are an essential element in any government's portfolio of energy-efficiency and climate change mitigation programs. Governments need to develop balanced programs, both voluntary and regulatory, that remove cost-ineffective, energy-wasting products from the marketplace and stimulate the development of cost-effective, energy-efficient technology. Energy-efficiency labels and standards for appliances, equipment, and lighting products deserve to be among the first policy tools considered by a country's energy policy makers. The U.S. Agency for International Development (USAID) and several other organizations identified on the cover of this guidebook recognize the need to support policy makers in their efforts to implement energy-efficiency standards and labeling programs and have developed this guidebook, together with the Collaborative Labeling and Appliance Standards Program (CLASP), as a primary reference. This second edition of the guidebook was prepared over the course of the past year, four years after the preparation of the first edition, with a significant contribution from the authors and reviewers mentioned previously. Their diligent participation helps maintain this book as the international guidance tool it has become. The lead authors would like to thank the members of the Communications Office of the Environmental Energy Technologies Division, Lawrence Berkeley National Laboratory for their support in the development, production, and distribution of the guidebook. This guidebook is designed as a manual for government officials and others around the world responsible for developing, implementing, enforcing, monitoring, and maintaining labeling and standards setting programs. It discusses the pros and cons of adopting energy-efficiency labels and standards and describes the data, facilities, and institutional and human resources needed for these programs. It provides guidance on the design, development, implementation, maintenance, and evaluation of the programs and on the design of the labels and standards themselves. In addition, it directs the reader to references and other resources likely to be useful in conducting the activities described and includes a chapter on energy policies and programs that complement appliance efficiency labels and standards. This guidebook attempts to reflect the essential framework of labeling and standards programs. It is the intent of the authors and sponsor to distribute copies of this book worldwide, at no charge, for the general public benefit. The guidebook is also available on the web at www.clasponline.org and may be downloaded to be used intact or piecemeal for whatever beneficial purposes readers may conceive.

  4. Method to detect the end-point for PCR DNA amplification using an ionically labeled probe and measuring impedance change

    DOE Patents [OSTI]

    Miles, Robin R.; Belgrader, Phillip; Fuller, Christopher D.

    2007-01-02

    Impedance measurements are used to detect the end-point for PCR DNA amplification. A pair of spaced electrodes are located on a surface of a microfluidic channel and an AC or DC voltage is applied across the electrodes to produce an electric field. An ionically labeled probe will attach to a complementary DNA segment, and a polymerase enzyme will release the ionic label. This causes the conductivity of the solution in the area of the electrode to change. This change in conductivity is measured as a change in the impedance been the two electrodes.

  5. Tin-117m-labeled stannic (Sn.sup.4+) chelates

    DOE Patents [OSTI]

    Srivastava, Suresh C.; Meinken, George E.; Richards, Powell

    1985-01-01

    The radiopharmaceutical reagents of this invention and the class of Tin-117m radiopharmaceuticals are therapeutic and diagnostic agents that incorporate gamma-emitting nuclides that localize in bone after intravenous injection in mammals (mice, rats, dogs, and rabbits). Images reflecting bone structure or function can then be obtained by a scintillation camera that detects the distribution of ionizing radiation emitted by the radioactive agent. Tin-117m-labeled chelates of stannic tin localize almost exclusively in cortical bone. Upon intravenous injection of the reagent, the preferred chelates are phosphonate compounds, preferable, PYP, MDP, EHDP, and DTPA. This class of reagents is therapeutically and diagnostically useful in skeletal scintigraphy and for the radiotherapy of bone tumors and other disorders.

  6. Portable microfluidic raman system for rapid, label-free early disease signature detection

    SciTech Connect (OSTI)

    Wu, Meiye; Davis, Ryan Wesley; Hatch, Anson

    2015-09-01

    In the early stages of infection, patients develop non-specific or no symptoms at all. While waiting for identification of the infectious agent, precious window of opportunity for early intervention is lost. The standard diagnostics require affinity reagents and sufficient pathogen titers to reach the limit of detection. In the event of a disease outbreak, triaging the at-risk population rapidly and reliably for quarantine and countermeasure is more important than the identification of the pathogen by name. To expand Sandia's portfolio of Biological threat management capabilities, we will utilize Raman spectrometry to analyze immune subsets in whole blood to rapidly distinguish infected from non-infected, and bacterial from viral infection, for the purpose of triage during an emergency outbreak. The goal of this one year LDRD is to determine whether Raman spectroscopy can provide label-free detection of early disease signatures, and define a miniaturized Raman detection system meeting requirements for low- resource settings.

  7. Metal-isonitrile adducts for preparing radionuclide complexes for labelling and imaging agents

    DOE Patents [OSTI]

    Jones, Alun G.; Davison, Alan; Abrams, Michael J.

    1987-01-01

    A method for preparing a coordination complex of an isonitrile ligand and radionuclide such as Tc, Ru, Co, Pt, Fe, Os, Ir, W, Re, Cr, Mo, Mn, Ni, Rh, Pd, Nb and Ta is disclosed. The method comprises preparing a soluble metal adduct of said isonitrile ligand by admixing said ligand with a salt of a displaceable metal having a complete d-electron shell selected from the group consisting of Zn, Ga, Cd, In, Sn, Hg, Tl, Pb and Bi to form a soluble metal-isonitrile salt, and admixing said metal isonitrile salt with a salt comprising said radioactive metal in a suitable solvent to displace said displaceable metal with the radioactive metal thereby forming said coordination. The complex is useful as a diagnostic agent for labelling liposomes or vesicles, and selected living cells containing lipid membranes, such as blood clots, myocardial tissue, gall bladder tissue, etc.

  8. Slow light Mach-Zehnder interferometer as label-free biosensor with scalable sensitivity

    DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

    Qin, Kun; Hu, Shuren; Retterer, Scott T.; Kravchenko, Ivan I.; Weiss, Sharon M.

    2016-02-05

    Our design, fabrication, and characterization of a label-free Mach–Zehnder interferometer (MZI) optical biosensor that incorporates a highly dispersive one-dimensional (1D) photonic crystal in one arm are presented. The sensitivity of this slow light MZI-based sensor scales with the length of the slow light photonic crystal region. The numerically simulated sensitivity of a MZI sensor with a 16 μm long slow light region is 115,000 rad/RIU-cm, which is sevenfold higher than traditional MZI biosensors with millimeter-length sensing regions. Moreover, the experimental bulk refractive index detection sensitivity of 84,000 rad/RIU-cm is realized and nucleic acid detection is also demonstrated.

  9. Rational Conversion of Affinity Reagents into Label-Free Sensors for Peptide Motifs by Designed Allostery

    SciTech Connect (OSTI)

    Huang, Jin; Koide, Shohei

    2010-05-25

    Optical biosensors for short peptide motifs, an important class of biomarkers, have been developed based on 'affinity clamps', a new class of recombinant affinity reagents. Affinity clamps are engineered by linking a peptide-binding domain and an antibody mimic domain based on the fibronectin type III scaffold, followed by optimization of the interface between the two. This two-domain architecture allows for the design of allosteric coupling of peptide binding to fluorescence energy transfer between two fluorescent proteins attached to the affinity clamp. Coupled with high affinity and specificity of the underlying affinity clamps and rationally designed mutants with different sensitivity, peptide concentrations in crude cell lysate were determined with a low nanomolar detection limit and over 3 orders of magnitude. Because diverse affinity clamps can be engineered, our strategy provides a general platform to generate a repertoire of genetically encoded, label-free sensors for peptide motifs.

  10. CFL Labeling Harmonization in the United States, China, Brazil andELI Member Countries: Specifications, Testing, and MutualRecognition

    SciTech Connect (OSTI)

    Fridley, David; Lin, Jiang; Denver, Andrea; Biermayer, Peter; Dillavou, Tyler

    2005-07-20

    This report examines critical differences among energy-efficient labeling programs for CFLs in Brazil, China, the United States, and the seven members of the international Efficient Lighting Initiative (ELI) in terms of technical specifications and test procedures, and review issues related to international harmonization of these standards.

  11. Method and kit for the selective labeling of red blood cells in whole blood with TC-99M

    DOE Patents [OSTI]

    Srivastava, Suresh C.; Babich, John W.; Straub, Rita; Richards, Powell

    1988-01-01

    Disclosed herein are a method and kit for the preparation of .sup.99m Tc labeled red blood cells using whole blood in a closed sterile system containing stannous tin in a form such that it will enter the red blood cells and be available therein for the reduction of technetium.

  12. Method and kit for the selective labeling of red blood cells in whole blood with Tc-99m

    DOE Patents [OSTI]

    Srivastava, S.C.; Babich, J.W.; Straub, R.; Richards, P.

    1988-07-05

    Disclosed herein are a method and kit for the preparation of [sup 99m]Tc labeled red blood cells using whole blood in a closed sterile system containing stannous tin in a form such that it will enter the red blood cells and be available for the reduction of technetium. No Drawings

  13. Fluorescence energy transfer efficiency in labeled yeast cytochrome c: a rapid screen for ion biocompatibility in aqueous ionic liquids

    SciTech Connect (OSTI)

    Baker, Sheila N; Zhao, Hua; Pandey, Siddharth; Heller, William T; Bright, Frank; Baker, Gary A

    2011-01-01

    A fluorescence energy transfer de-quenching assay was implemented to follow the equilibrium unfolding behaviour of site-specific tetramethylrhodamine-labelled yeast cytochrome c in aqueous ionic liquid solutions; additionally, this approach offers the prospect of naked eye screening for biocompatible ion combinations in hydrated ionic liquids.

  14. Comparison of Test Procedures and Energy Efficiency Criteria in Selected International Standards and Labeling Programs for Clothes Washers, Water Dispensers, Vending Machines and CFLs

    SciTech Connect (OSTI)

    Fridley, David; Zheng, Nina; Zhou, Nan

    2010-06-01

    Since the late 1970s, energy labeling programs and mandatory energy performance standards have been used in many different countries to improve the efficiency levels of major residential and commercial equipment. As more countries and regions launch programs covering a greater range of products that are traded worldwide, greater attention has been given to harmonizing the specific efficiency criteria in these programs and the test methods for measurements. For example, an international compact fluorescent light (CFL) harmonization initiative was launched in 2006 to focus on collaboration between Australia, China, Europe and North America. Given the long history of standards and labeling programs, most major energy-consuming residential appliances and commercial equipment are already covered under minimum energy performance standards (MEPS) and/or energy labels. For these products, such as clothes washers and CFLs, harmonization may still be possible when national MEPS or labeling thresholds are revised. Greater opportunity for harmonization exists in newer energy-consuming products that are not commonly regulated but are under consideration for new standards and labeling programs. This may include commercial products such as water dispensers and vending machines, which are only covered by MEPS or energy labels in a few countries or regions. As China continues to expand its appliance standards and labeling programs and revise existing standards and labels, it is important to learn from recent international experiences with efficiency criteria and test procedures for the same products. Specifically, various types of standards and labeling programs already exist in North America, Europe and throughout Asia for products in China's 2010 standards and labeling programs, namely clothes washers, water dispensers, vending machines and CFLs. This report thus examines similarities and critical differences in energy efficiency values, test procedure specifications and other technical performance requirements in existing international programs in order to shed light on where Chinese programs currently stands and considerations for their 2010 programs.

  15. Acting Globally: Potential Carbon Emissions Mitigation Impacts from an International Standards and Labelling Program

    SciTech Connect (OSTI)

    McNeil, Michael A; Letschert, Virginie E.; de la Rue du Can, Stephane; Egan, Christine

    2009-05-29

    This paper presents an analysis of the potential impacts of an international initiative designed to support and promote the development and implementation of appliances standards and labelling programs throughout the world. As part of previous research efforts, LBNL developed the Bottom Up Energy Analysis System (BUENAS), an analysis framework that estimates impact potentials of energy efficiency policies on a global scale. In this paper, we apply this framework to an initiative that would result in the successful implementation of programs focused on high priority regions and product types, thus evaluating the potential impacts of such an initiative in terms of electricity savings and carbon mitigation in 2030. In order to model the likely parameters of such a program, we limit impacts to a five year period starting in 2009, but assume that the first 5 years of a program will result in implementation of 'best practice' minimum efficiency performance standards by 2014. The 'high priority' regions considered are: Brazil, China, the European Union,India, Mexico and the United States. The products considered are: refrigerators, air conditioners, lighting (both fluorescent and incandescent), standby power (for consumer electronics) and televisions in the residential sector, and air conditioning and lighting in commercial buildings. In 2020, these regions and enduses account for about 37percent of global residential electricity and 29percent of electricity in commercial buildings. We find that 850Mt of CO2 could be saved in buildings by 2030 compared to the baseline forecast.

  16. Nanoparticle-based immunosensor with apoferritin templated metallic phosphate label for quantification of phosphorylated acetylcholinesterase

    SciTech Connect (OSTI)

    Du, Dan; Chen, Aiqiong; Xie, Yunying; Zhang, Aidong; Lin, Yuehe

    2011-05-15

    A new sandwich-like electrochemical immunosensor has been developed for quantification of organophosphorylated acetylcholinesterase (OP-AChE), an exposure biomarker of organophosphate pesticides and nerve agents. Zirconia nanoparticles (ZrO2 NPs) were anchored on a screen printed electrode (SPE) to preferably capture OP-AChE adducts by metal chelation with phospho-moieties, which was selectively recognized by lead phosphate-apoferritin labeled anti-AChE antibody (LPA-anti-AChE). The sandwich-like immunoreactions were performed among ZrO2 NPs, OP-AChE and LPA-anti-AChE to form ZrO2/OP-AChE/LPA-anti-AChE complex and the released lead ions were detected on a disposable SPE. The binding affinity was investigated by both square wave voltammetry (SWV) and quartz crystal microbalance (QCM) measurements. The proposed immunosensor yielded a linear response current over a broad OP-AChE concentrations range from 0.05 nM to 10 nM, with detection limit of 0.02 nM, which has enough sensitivity for monitoring of low-dose exposure to OPs. This method avoids the drawback of unavailability of commercial OP-specific antibody as well as amplifies detection signal by using apoferritin encoded metallic phosphate nanoparticle tags. This nanoparticle-based immunosensor offers a new method for rapid, sensitive, selective and inexpensive quantification of phosphorylated adducts for monitoring of OP pesticides and nerve agents exposures.

  17. Integrable perturbed magnetic fields in toroidal geometry: An exact analytical flux surface label for large aspect ratio

    SciTech Connect (OSTI)

    Kallinikos, N.; Isliker, H.; Vlahos, L.; Meletlidou, E.

    2014-06-15

    An analytical description of magnetic islands is presented for the typical case of a single perturbation mode introduced to tokamak plasma equilibrium in the large aspect ratio approximation. Following the Hamiltonian structure directly in terms of toroidal coordinates, the well known integrability of this system is exploited, laying out a precise and practical way for determining the island topology features, as required in various applications, through an analytical and exact flux surface label.

  18. Savings estimates for the United States Environmental Protection Agency?s ENERGY STAR voluntary product labeling program

    SciTech Connect (OSTI)

    Sanchez, Marla Christine; Sanchez, Marla Christine; Brown, Richard; Homan, Gregory; Webber, Carrie

    2008-06-03

    ENERGY STAR is a voluntary energy efficiency-labeling program operated jointly by the United States Department of Energy and the United States Environmental Protection Agency (US EPA). Since the program inception in 1992, ENERGY STAR has become a leading international brand for energy efficient products. ENERGY STAR's central role in the development of regional, national, and international energy programs necessitates an open process whereby its program achievements to date as well as projected future savings are shared with committed stakeholders. Through 2006, US EPA?S ENERGY STAR labeled products saved 4.8 EJ of primary energy and avoided 82 Tg C equivalent. We project that US EPA?S ENERGY STAR labeled products will save 12.8 EJ and avoid 203 Tg C equivalent over the period 2007-2015. A sensitivity analysis examining two key inputs (carbon factor and ENERGY STAR unit sales) bounds the best estimate of carbon avoided between 54 Tg C and 107 Tg C (1993 to 2006) and between 132 Tg C and 278 Tg C (2007 to 2015).

  19. A nanoparticle label/immunochromatographic electrochemical biosensor for rapid and sensitive detection of prostate-specific antigen

    SciTech Connect (OSTI)

    Lin, Ying-Ying; Wang, Jun; Liu, Guodong; Wu, Hong; Wai, Chien M.; Lin, Yuehe

    2008-06-15

    We present a nanoparticle (NP) label/immunochromatographic electrochemical biosensor (IEB) for rapid and sensitive detection of prostate-specific antigen (PSA) in human serum. This IEB integrates the immunochromatographic strip with the electrochemical detector for transducing quantitative signals. The NP label, made of CdSe@ZnS, serves as a signal-amplifier vehicle. A sandwich immunoreaction was performed on the immunochromatographic strip. The captured NP labels in the test zone were determined by highly sensitive stripping voltammetric measurement of the dissolved metallic component (cadmium) with a disposable-screen-printed electrode, which is embedded underneath the membrane of the test zone. Experimental parameters (e.g., immunoreaction time, the amount of anti-PSA-NP conjugations applied) and electrochemical detection conditions (e.g., preconcentration potential and time) were optimized using this biosensor for PSA detection. The analytical performance of this biosensor was evaluated with serum PSA samples according to the figure-of-merits (e.g., dynamic range, reproducibility, and detection limit). The results were validated with enzyme-linked immunosorbent assay (ELISA) and show high consistency. It is found that this biosensor is very sensitive with the detection limit of 0.02 ng/mL PSA and is quite reproducible. This method is rapid, clinically accurate, and less expensive than other diagnosis tools for PSA; therefore, this IEB coupled with a portable electrochemical analyzer shows great promise for simple, sensitive, quantitative point-of-care testing of disease-related protein biomarkers.

  20. Giant Magnetoresistive Sensors and Magnetic Labels for Chip-Scale Detection of Immunosorbent Assays

    SciTech Connect (OSTI)

    Rachel Lora Millen

    2005-12-17

    The combination of giant magnetoresistive sensors, magnetic labeling strategies, and biomolecule detection is just beginning to be explored. New readout methods and assay formats are necessary for biomolecules detection to flourish. The work presented in this dissertation describes steps toward the creation of a novel detection method for bioassays utilizing giant magnetoresistive sensors as the readout method. The introduction section contains a brief review of some of the current methods of bioassay readout. The theoretical underpinnings of the giant magnetoresistive effect are also discussed. Finally, the more prominent types of giant magnetoresistive sensors are described, as well as their complicated fabrication. Four data chapters follow the introduction; each chapter is presented as a separate manuscript, either already published or soon to be submitted. Chapter 1 presents research efforts toward the production of a bioassay on the surface of a gold-modified GMR sensor. The testing of this methodology involved the capture of goat a-mouse-coated magnetic nanoparticles on the mouse IgG-modified gold surface. The second, third and fourth chapters describe the utilization of a self-referenced sample stick for scanning across the GMR sensor. The sample stick consisted of alternating magnetic reference and bioactive gold addresses. Chapter 2 is concerned with the characterization of both the scanning readout method and the binding and detection of streptavidin-coated magnetic particles to a biotinylated surface. Chapter 3 advances the sample stick readout with the use of the system for detection of a sandwich immunoassay with rabbit IgG proteins. Finally, simultaneous detection of three IgG proteins is demonstrated in Chapter 4. The dissertation is concluded with a brief summary of the research presented and a discussion of the possible future applications and direction of this work.

  1. Final report-98-ERI-003 identification of population with lifetime 41Ca-labeled skeletons

    SciTech Connect (OSTI)

    Freeman, S P

    1999-02-25

    In 1997 we first postulated the existence of a special human population that had had their skeletons inadvertently isotopically adulterated in the past. We theorized that the population, and the necessary LLNL accelerator mass spectrometer (AMS) measurement technology, would prove a significant resource in the fight to combat osteoporosis. This LDRD project was to establish such. The project was significantly successful in its initial year, but was not renewed for another and the research is now ended at LLNL. We proposed a three-year program to (1) confirm the magnitude and extent of historical 41 Ca dosing, (2) exactly characterize the long-term 41 Ca signal by comparing it with conventional measurements of skeletal health, and (3) demonstrate the utility of the historically labeled population in evaluating an actual potential therapy for osteoporosis. However, rather than investigate historical records to learn the identity of those inadvertently dosed, find them, and if possible enroll them into a new protocol, this project was to be particularly efficient by making use of a multiyear archive of samples from original, inadvertent 41 Ca-dosing experiments at Creighton University in Omaha, Nebraska. Because the subjects had been dosed in conventional studies of calcium kinetics, much important correlating historical data would also be available for comparison. Measurements of contemporary urine samples specifically provided for this project by selected identified subjects would follow. We discovered a second archive at the University of Texas Southwestern Medical Center. This is potentially a better source of material as the samples were generated in numerous historical evaluations of actual osteoporosis therapies in which 41 Ca-impure radiotracers were used. The therapies might now powerfully be retrospectively evaluated, both to contribute to our understanding of the therapies and to highlight the potential of the use of 41 Ca tracer and LLNL measurement.

  2. Transport of fluorescently labeled hydroxyapatite nanoparticles in saturated granular media at environmentally relevant concentrations of surfactants

    SciTech Connect (OSTI)

    Wang, Dengjun; Su, Chuming; Liu, Chongxuan; Zhou, Dongmei

    2014-05-01

    Hydroxyapatite nanoparticle (nHAP) is being used to remediate soils and aquifers contaminated with metals and radionuclides; however, the mobility of nHAP is still poorly understood in subsurface granular environments. In this study, transport and retention kinetics of alizarin red S (ARS)-labeled nHAP were investigated in water-saturated quartz sand at low concentrations of surfactants: sodium dodecyl benzene sulfonate (SDBS, an anionic surfactant, 050 mg L1) and cetyltrimethylammonium bromide (CTAB, a cationic surfactant, 05 mg L1). Both surfactants were found to have a marked effect on the electrokinetic properties of ARS-nHAP and, consequently, on their transport and retention behaviors. Transport of nanoparticles (NPs) increased significantly with increasing SDBS concentration, largely because of enhanced colloidal stability and reduced aggregate size arising from enhanced electrostatic, osmotic, and elastic-steric repulsions between ARS-nHAP and sand grains. Conversely, transport decreased significantly in the presence of increasing CTAB concentrations due to reduced surface charge and consequential enhanced aggregation of the NPs. Osmotic and elastic-steric repulsions played only a minor role in enhancing the colloidal stability of ARS-nHAP in the presence of CTAB. Retention profiles of ARS-nHAP exhibited hyperexponential-shapes (decreasing rates of retention with increasing distance) for all conditions tested, and became more pronounced as CTAB concentration increased. The phenomenon was attributed to the aggregation and ripening of ARS-nHAP in the presence of surfactants, particularly CTAB. Overall, the present study suggests that surfactants at environmentally relevant concentrations may be an important consideration in employing nHAP for engineered in-situ remediation of certain metals and radionuclides in contaminated soils and aquifers.

  3. Progress towards Managing Residential Electricity Demand: Impacts of Standards and Labeling for Refrigerators and Air Conditioners in India

    SciTech Connect (OSTI)

    McNeil, Michael A.; Iyer, Maithili

    2009-05-30

    The development of Energy Efficiency Standards and Labeling (EES&L) began in earnest in India in 2001 with the Energy Conservation Act and the establishment of the Indian Bureau of Energy Efficiency (BEE). The first main residential appliance to be targeted was refrigerators, soon to be followed by room air conditioners. Both of these appliances are of critical importance to India's residential electricity demand. About 15percent of Indian households own a refrigerator, and sales total about 4 million per year, but are growing. At the same time, the Indian refrigerator market has seen a strong trend towards larger and more consumptive frost-free units. Room air conditioners in India have traditionally been sold to commercial sector customers, but an increasing number are going to the residential sector. Room air conditioner sales growth in India peaked in the last few years at 20percent per year. In this paper, we perform an engineering-based analysis using data specific to Indian appliances. We evaluate costs and benefits to residential and commercial sector consumers from increased equipment costs and utility bill savings. The analysis finds that, while the BEE scheme presents net benefits to consumers, there remain opportunities for efficiency improvement that would optimize consumer benefits, according to Life Cycle Cost analysis. Due to the large and growing market for refrigerators and air conditioners in India, we forecast large impacts from the standards and labeling program as scheduled. By 2030, this program, if fully implemented would reduce Indian residential electricity consumption by 55 TWh. Overall savings through 2030 totals 385 TWh. Finally, while efficiency levels have been set for several years for refrigerators, labels and MEPS for these products remain voluntary. We therefore consider the negative impact of this delay of implementation to energy and financial savings achievable by 2030.

  4. Thrombus detection using a Tc-99m labeled antifibrin monoclonal antibody (MoAb). Experiments in vitro and in animals

    SciTech Connect (OSTI)

    Wasser, M.N.; Pauwels, E.K.; Nieuwenhuizen, W. )

    1990-01-01

    This paper describes the production and characterization of an antifibrin monoclonal antibody, produced by immunizing mice with fibrinogen degradation fragment Y. The antibody (designated Y22) is directed against a conformation dependent epitope in the D-domain of fibrin Y22 was labeled with the radionuclide Tc-99m. Experiments in vitro and in rats are presented which show the potential of scintigraphic detection of thrombi with Tc-99m-Y22. Preliminary results show that immunoscintigraphy of thrombi may also have potential for the monitoring of thrombolytic therapy (eg with t-PA).

  5. Preparation and immunoreactivity of high specific activity indium-111-DTPA labeled monoclonal antibody (MoAb) using ultrapure indium-111

    SciTech Connect (OSTI)

    Zoghbi, S.S.; Neumann, R.D.; Gottschalk, A.

    1986-10-01

    The preparation of high-specific activity /sup 111/In-DTPA-MoAb without increasing the number of DTPA molecules per Ab was investigated. Instant thin layer chromatography was used to assay the relationship between labeling efficiencies and specific activities. With ultrapurified /sup 111/In, the specific activity of the radiolabeled MoAb approached the expected theoretic maximum of 100 muCi/microgram. The bioactivity of such high-specific activity preparation showed no degradation as measured by in vitro cell binding assay.

  6. Subscribe Today to E-mail Alerts from GTO

    Broader source: Energy.gov [DOE]

    Sign up today to get the most up-to-date information on Geothermal Technologies Office (GTO)-sponsored webinars and funding announcements as they become available—delivered right to your inbox for free.

  7. Customer Feedback during Development of 1998 MECS: Mail/Electronic...

    U.S. Energy Information Administration (EIA) Indexed Site

    and its composition (by fuel type) in China; - commercial and industrial energy management market data, specifically in software market; - energy consumption in health,...

  8. Data-Driven Mailing Helps Heat Up Untapped Seattle Market

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ... you're probably reaching folks who aren't strong prospects for energy efficiency upgrades. ... Whether it's the age of the home, heating source, or age of the families living there, use ...

  9. Fermilab | Press Room | Subscribe to Press Release mailing list

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Sheets and Brochures Fermilab Today symmetry Interactions.org Photo and Video Archive Resources for ... Employees Researchers, Postdocs and Graduate Students Job Seekers Neighbors...

  10. Mailing Addresses and Information Numbers for Operations, Field...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    of Energy National Nuclear Security Administration ... Rocky Mountain Oilfield Testing Center 907 N. Poplar, ... Contractors News & Blog Data Phonebook Web Policies History

  11. Report Period: EIA ID NUMBER: Appendix A: Mailing Address: Appendix...

    U.S. Energy Information Administration (EIA) Indexed Site

    This report is mandatory under the Federal Energy Administration Act of 1974 (Public Law 93-275). Failure to comply may result in criminal fines, civil penalties and other ...

  12. Mailing Addresses for National Laboratories and Technology Centers...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ... Livermore, CA 94551-0969 925-294-3000 U.S. Department of Energy Savannah River Ecology Laboratory Building 737-A, Drawer E Aiken, SC 29802 803-725-2472 U.S. Department of Energy ...

  13. Minutes from the March 17, 2010 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Printing Agenda Items... Upcoming Congressional Joint Committee on Printing Commercial ... Woodruff also said Headquarters is planning visits to other sites this fiscal year. ...

  14. Epi-detected quadruple-modal nonlinear optical microscopy for label-free imaging of the tooth

    SciTech Connect (OSTI)

    Wang, Zi; Zheng, Wei; Huang, Zhiwei; Stephen Hsu, Chin-Ying

    2015-01-19

    We present an epi-detected quadruple-modal nonlinear optical microscopic imaging technique (i.e., coherent anti-Stokes Raman scattering (CARS), second-harmonic generation (SHG), third-harmonic generation (THG), and two-photon excited fluorescence (TPEF)) based on a picosecond (ps) laser-pumped optical parametric oscillator system for label-free imaging of the tooth. We demonstrate that high contrast ps-CARS images covering both the fingerprint (500–1800 cm{sup −1}) and high-wavenumber (2500–3800 cm{sup −1}) regions can be acquired to uncover the distributions of mineral and organic biomaterials in the tooth, while high quality TPEF, SHG, and THG images of the tooth can also be acquired under ps laser excitation without damaging the samples. The quadruple-modal nonlinear microscopic images (CARS/SHG/THG/TPEF) acquired provide better understanding of morphological structures and biochemical/biomolecular distributions in the dentin, enamel, and the dentin-enamel junction of the tooth without labeling, facilitating optical diagnosis and characterization of the tooth in dentistry.

  15. Comparison of Test Procedures and Energy Efficiency Criteria in Selected International Standards & Labeling Programs for Copy Machines, External Power Supplies, LED Displays, Residential Gas Cooktops and Televisions

    SciTech Connect (OSTI)

    Zheng, Nina; Zhou, Nan; Fridley, David

    2012-03-01

    This report presents a technical review of international minimum energy performance standards (MEPS), voluntary and mandatory energy efficiency labels and test procedures for five products being considered for new or revised MEPS in China: copy machines, external power supply, LED displays, residential gas cooktops and flat-screen televisions. For each product, an overview of the scope of existing international standards and labeling programs, energy values and energy performance metrics and description and detailed summary table of criteria and procedures in major test standards are presented.

  16. Microfluidic Technology Platforms for Synthesizing, Labeling and Measuring the Kinetics of Transport and Biochemical Reactions for Developing Molecular Imaging Probes

    SciTech Connect (OSTI)

    Phelps, Michael E.

    2009-09-01

    Radiotracer techniques are used in environmental sciences, geology, biology and medicine. Radiotracers with Positron Emission Tomography (PET) provided biological examinations of ~3 million patients 2008. Despite the success of positron labeled tracers in many sciences, there is limited access in an affordable and convenient manner to develop and use new tracers. Integrated microfluidic chips are a new technology well matched to the concentrations of tracers. Our goal is to develop microfluidic chips and new synthesis approaches to enable wide dissemination of diverse types of tracers at low cost, and to produce new generations of radiochemists for which there are many unfilled jobs. The program objectives are to: 1. Develop an integrated microfluidic platform technology for synthesizing and 18F-labeling diverse arrays of different classes of molecules. 2. Incorporate microfluidic chips into small PC controlled devices (“Synthesizer”) with a platform interfaced to PC for electronic and fluid input/out control. 3. Establish a de-centralized model with Synthesizers for discovering and producing molecular imaging probes, only requiring delivery of inexpensive [18F]fluoride ion from commercial PET radiopharmacies vs the centralized approach of cyclotron facilities synthesizing and shipping a few different types of 18F-probes. 4. Develop a position sensitive avalanche photo diode (PSAPD) camera for beta particles embedded in a microfluidic chip for imaging and measuring transport and biochemical reaction rates to valid new 18F-labeled probes in an array of cell cultures. These objectives are met within a research and educational program integrating radio-chemistry, synthetic chemistry, biochemistry, engineering and biology in the Crump Institute for Molecular Imaging. The Radiochemistry Training Program exposes PhD and post doctoral students to molecular imaging in vitro in cells and microorganisms in microfluidic chips and in vivo with PET, from new technologies for radiochemistry (macro to micro levels), biochemistry and biology to imaging principles, tracer kinetics, pharmacokinetics and biochemical assays. New generations of radiochemists will be immersed in the biochemistry and biology for which their labeled probes are being developed for assays of these processes. In this program engineers and radio-chemists integrate the principles of microfluidics and radiolabeling along with proper system design and chemistry rule sets to yield Synthesizers enabling biological and pharmaceutical scientists to develop diverse arrays of probes to pursue their interests. This progression would allow also radiochemists to focus on the further evolution of rapid, high yield synthetic reactions with new enabling technologies, rather than everyday production of radiotracers that should be done by technologists. The invention of integrated circuits in electronics established a platform technology that allowed an evolution of ideas and applications far beyond what could have been imagined at the beginning. Rather than provide a technology for the solution to a single problem, it is hoped that microfluidic radiochemistry will be an enabling platform technology for others to solve many problems. As part of this objective, another program goal is to commercialize the technologies that come from this work so that they can be provided to others who wish to use it.

  17. Posting and Labeling for Radiological Control Guide for use with Title 10, Code of Federal Regulations, Part 835, Occupational Radiation Protection

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    1999-05-24

    This Guide provides an acceptable methodology for establishing and operating a radiological hazard posting and labeling program that will comply with U.S. Department of Energy (DOE) requirements specified in Title 10 of the Code of Federal Regulations (CFR), Part 835, Occupational Radiation Protection Canceled by DOE G 441.1-1B.

  18. Use of Label-Free Quantitative Proteomics To Distinguish the Secreted Cellulolytic Systems of Caldicellulosiruptor bescii and Caldicellulosiruptor obsidiansis

    SciTech Connect (OSTI)

    Lochner, Adriane; Giannone, Richard J; Rodriguez, Jr., Miguel; Mielenz, Jonathan R; Keller, Martin; Antranikian, Garabed; Graham, David E; Hettich, Robert {Bob} L

    2011-01-01

    The understanding of microbial cellulose degradation systems is a crucial prerequisite to designing an effective operating process for the bioconversion of lignocellulosic biomass into sustainable biofuels. Relevant in this context are members of the extremely thermophilic Gram-positive bacteria genus Caldicellulosiruptor that have been shown to efficiently degrade cellulose, as well as hemicellulose. Although individual representatives from this genus have been closely examined in bioenergy related studies and single components of their cellulolytic enzyme systems have been described, an overall characterization of the cellulose degradation system is still lacking. To this end, a comparative systems level investigation of two closely related species, Caldicellulosiruptor bescii and Caldicellulosiruptor obsidiansis, based on label free quantitative proteomics was conducted to determine the protein composition in the organisms secretome over the course of crystalline cellulose fermentations. Mass spectrometric characterizations together with cellulase activity measurements revealed a substantial abundance increase of a few bifunctional multidomain glycosidases that were composed of the domain families 5, 9, 10 and 48, that appear to be important elements for the cellulose degradation process in Caldicellulosiruptor. However, the number and arrangement of these domains varied in the two organisms, and C. bescii enzymes also contained an additional family 44 and 74, indicating significant differences at the species level. Investigation of a glycosidase solution enriched via affinity digestion revealed the presence of highly thermostable enzymes with optimum cellulase activity at 85 C and pH 5 in both organisms. The C. obsidiansis preparation, however, displayed twice the CMCase and Avicelase activity as the C. bescii preparation.

  19. Methods for tritium labeling

    DOE Patents [OSTI]

    Andres, Hendrik; Morimoto, Hiromi; Williams, Philip G.

    1993-01-01

    Reagents and processes for reductively introducing deuterium or tritium into organic molecules are described. The reagents are deuterium or tritium analogs of trialkyl boranes, borane or alkali metal aluminum hydrides. The process involves forming these reagents in situ from alkali metal tritides or deuterides.

  20. Enhancing the sensitivity of immunoassay procedures by use of antibodies directed to the product of a reaction between probe labels and assay substrates

    DOE Patents [OSTI]

    Erlanger, B.F.; Chen, B.

    1999-07-20

    The subject invention provides an antibody which specifically binds to the product of a reaction between a labeling substance and a substrate. The subject invention also provides a method of making an immunogen used to produce the antibody of the subject invention. The invention further provides methods of using the subject antibody for detecting an antigen of interest in a sample, for example, detecting a protein comprising an amino acid sequence of interest and detecting a nucleic acid molecule comprising a nucleic acid sequence of interest, detecting a polypeptide such as those expressed by infectious agents, fungi or parasites. 25 figs.

  1. Enhancing the sensitivity of immunoassay procedures by use of antibodies directed to the product of a reaction between probe labels and assay substrates

    DOE Patents [OSTI]

    Erlanger, Bernard F.; Chen, Bi-Xing

    1999-01-01

    The subject invention provides an antibody which specifically binds to the product of a reaction between a labeling substance and a substrate. The subject invention also provides a method of making an immunogen used to produce the antibody of the subject invention. The invention further provides methods of using the subject antibody for detecting an antigen of interest in a sample, for example, detecting a protein comprising an amino acid sequence of interest and detecting a nucleic acid molecule comprising a nucleic acid sequence of interest, detecting a polypeptide such as those expressed by infectious agents, fungi or parasites.

  2. Enhancing the sensitivity of immunoassay procedures by use of antibodies directed to the product of a reaction between probe labels and assay substrates

    DOE Patents [OSTI]

    Erlanger, Bernard F.; Chen, Bi-Xing

    1997-01-01

    The subject invention provides an antibody which specifically binds to the product of a reaction between a labeling substance and a substrate. The subject invention also provides a method of making an immunogen used to produce the antibody of the subject invention. The invention further provides methods of using the subject antibody for detecting an antigen of interest in a sample, for example detecting a protein comprising an amino acid sequence of interest and detecting a nucleic acid molecule comprising a nucleic acid sequence of interest.

  3. Enhancing the sensitivity of immunoassay procedures by use of antibodies directed to the product of a reaction between probe labels and assay substrates

    DOE Patents [OSTI]

    Erlanger, B.F.; Chen, B.X.

    1997-07-22

    The subject invention provides an antibody which specifically binds to the product of a reaction between a labeling substance and a substrate. The subject invention also provides a method of making an immunogen used to produce the antibody of the subject invention. The invention further provides methods of using the subject antibody for detecting an antigen of interest in a sample, for example detecting a protein comprising an amino acid sequence of interest and detecting a nucleic acid molecule comprising a nucleic acid sequence of interest. 8 figs.

  4. Tin-117m-labeled stannic (Sn/sup 4 +/) chelate of diethylenetriamine pentaacetic acid (DTPA) for application in diagnosis and therapy

    DOE Patents [OSTI]

    Srivastava, S.C.; Meinken, G.E.; Richards, P.

    1983-08-25

    The radiopharmaceutical reagents of this invention and the class of Tin-117m radiopharmaceuticals are therapeutic and diagnostic agents that incorporate gamma-emitting nuclides that localize in bone after intravenous injection in mammals (mice, rats, dogs, and rabbits). Images reflecting bone structure or function can then be obtained by a scintillation camera that detects the distribution of ionizing radiation emitted by the radioactive agent. Tin-117m-labeled chelates of stannic tin localize almost exclusively in cortical bone. Upon intravenous injection of the reagent, the preferred chelates are phosphonate compounds, preferable, PYP, MDP, EHDP, and DTPA. This class of reagents is therapeutically and diagnostically useful in skeletal scintigraphy and for the radiotherapy of bone tumors and other disorders.

  5. Optimization of pulsed-DEER measurements for Gd-based labels: choice of operational frequencies, pulse durations and positions, and temperature

    SciTech Connect (OSTI)

    Raitsimring, Arnold; Astashkin, Andrei V.; Enemark, John H.; Kaminker, Ilia; Goldfarb, Daniella; Walter, Eric D.; Song, Y.; Meade, T. J.

    2013-06-01

    In this work, the experimental conditions and parameters necessary to optimize the long-distance (? 60 ) Double Electron-Electron Resonance (DEER) measurements of biomacromolecules labeled with Gd(III) tags are analyzed. The specific parameters discussed are the temperature, microwave band, the separation between the pumping and observation frequencies, pulse train repetition rate, pulse durations and pulse positioning in the electron paramagnetic resonance spectrum. It was found that: (i) in optimized DEER measurements, the observation pulses have to be applied at the maximum of the EPR spectrum; (ii) the optimal temperature range for Ka-band measurements is 14-17 K, while in W-band the optimal temperatures are between 6-9 K; (iii) W-band is preferable to Ka-band for DEER measurements. Recent achievements and the conditions necessary for short-distance measurements (<15 ) are also briefly discussed.

  6. Flow cytometric detection of human immunodeficiency virus type 1 proviral DNA by the polymerase chain reaction incorporating digoxigenin- or fluorescein-labeled dUTP

    SciTech Connect (OSTI)

    Yang, Gang; Olson, J.C.; Pu, R.; Vyas, G.N.

    1995-10-01

    Serological assays are routinely used in the laboratory diagnosis of human immunodeficiency virus type-1 (HrV-1) infection, but the polymerase chain reaction (PCR) is ultimately the most sensitive and direct method for establishing definitive diagnosis. As an alternative to the conventional radioactive PCR procedure we have developed and evaluated a pair of rapid nonradioisotopic flow cytometric detection methods. Using heminested PCR we directly incorporated fluorescein-12-dUTP (fluo-dUTP) or digoxigenin-11-dUTP (dig-dUTP) into the PCR-amplicons. The labeled amplicons were hybridized with biotinylated antisense and sense probes, followed by capture of the hybrid DNA using streptavidin-coated beads which were finally analyzed in a flow cytometer by (1) direct detection of the fluorescence intensity of the amplicons incorporating fluo-dUTP and (2) immunodetection of the amplicons incorporating dig-dUTP by anti-digoxigenin IgG labeled with fluorescein isothiocyanate (FITC). Although both assays were functionally comparable with radiolabeled probe in reliably detecting as low as five copies of HIV-1 proviral DNA sequences, the immunodetection of dig-dUTP consistently yielded higher mean channel fluorescence and gave a stable signal over an extended period of 12-14 weeks. In testing a panel of 20 pedigreed PBMC specimens from blood donors with or without HIV-1 infection, the results of both flow cytometric assays were identical with those of the conventional radioactive procedure. Therefore, we conclude that the dig-dUTP incorporation in amplicons, hybridization with a pair of sense-antisense biotinylated probes and immunodetection of hybrids by flow cytometric analyses is the nonisotopic method of choice for PCR-diagnosis of HIV-1 infection. 21 refs., 2 figs., 4 tabs.

  7. SciFri AM: Mountain 04: Label-free Raman spectroscopy of single tumour cells detects early radiation-induced glycogen synthesis associated with increased radiation resistance

    SciTech Connect (OSTI)

    Matthews, Q; Lum, JJ; Isabelle, M; Harder, S; Jirasek, A; Brolo, AG

    2014-08-15

    Purpose: To use label-free Raman spectroscopy (RS) for early treatment monitoring of tumour cell radioresistance. Methods: Three human tumour cell lines, two radioresistant (H460, SF{sub 2} = 0.57 and MCF7, SF{sub 2} = 0.70) and one radiosensitive (LNCaP, SF{sub 2} = 0.36), were irradiated with single fractions of 2, 4, 6, 8 or 10 Gy. In additional experiments, H460 and MCF7 cells were irradiated under co-treatment with the anti-diabetic drug metformin, a known radiosensitizing agent. Treated and control cultures were analyzed with RS daily for 3 days post-treatment. Single-cell Raman spectra were acquired from 20 live cells per sample, and experiments were repeated in triplicate. The combined data sets were analyzed with principal component analysis using standard algorithms. Cells from each culture were also subjected to standard assays for viability, proliferation, cell cycle, and radiation clonogenic survival. Results: The radioresistant cells (H460, MCF7) exhibited a RS molecular radiation response signature, detectable as early as 1 day post-treatment, of which radiation-induced glycogen synthesis is a significant contributor. The radiosensitive cells (LNCaP) exhibited negligible glycogen synthesis. Co-treatment with metformin in MCF7 cells blocked glycogen synthesis, reduced viability and proliferation, and increased radiosensitivity. Conversely, metformin co-treatment in H460 cells did not produce these same effects; importantly, both radiation-induced synthesis of glycogen and radiosensitivity were unaffected. Conclusions: Label-free RS can detect early glycogen synthesis post-irradiation, a previously undocumented metabolic mechanism associated with tumour cell radioresistance that can be targeted to increase radiosensitivity. RS monitoring of intratumoral glycogen may provide new opportunities for personalized combined modality radiotherapy treatments.

  8. Global Structure of a Three-Way Junction in a Phi29 Packaging RNA Dimer Determined Using Site-Directed Spin Labeling

    SciTech Connect (OSTI)

    Zhang, Xiaojun; Tung, Chang-Shung; Sowa, Glenna; Hatmal, Ma'mon M.; Haworth, Ian S.; Qin, Peter Z.

    2012-02-08

    The condensation of bacteriophage phi29 genomic DNA into its preformed procapsid requires the DNA packaging motor, which is the strongest known biological motor. The packaging motor is an intricate ring-shaped protein/RNA complex, and its function requires an RNA component called packaging RNA (pRNA). Current structural information on pRNA is limited, which hinders studies of motor function. Here, we used site-directed spin labeling to map the conformation of a pRNA three-way junction that bridges binding sites for the motor ATPase and the procapsid. The studies were carried out on a pRNA dimer, which is the simplest ring-shaped pRNA complex and serves as a functional intermediate during motor assembly. Using a nucleotide-independent labeling scheme, stable nitroxide radicals were attached to eight specific pRNA sites without perturbing RNA folding and dimer formation, and a total of 17 internitroxide distances spanning the three-way junction were measured using Double Electron-Electron Resonance spectroscopy. The measured distances, together with steric chemical constraints, were used to select 3662 viable three-way junction models from a pool of 65 billion. The results reveal a similar conformation among the viable models, with two of the helices (HT and HL) adopting an acute bend. This is in contrast to a recently reported pRNA tetramer crystal structure, in which HT and HL stack onto each other linearly. The studies establish a new method for mapping global structures of complex RNA molecules, and provide information on pRNA conformation that aids investigations of phi29 packaging motor and developments of pRNA-based nanomedicine and nanomaterial.

  9. Apparatus and method for preparing oxygen-15 labeled water H{sub 2}[{sup 15}O] in an injectable form for use in positron emission tomography

    DOE Patents [OSTI]

    Ferrieri, R.A.; Schlyer, D.J.; Alexoff, D.

    1996-01-09

    A handling and processing apparatus is revealed for preparing Oxygen-15 labeled water (H{sub 2}[{sup 15}O]) in injectable form for use in Positron Emission Tomography from preferably H{sub 2}[{sup 15}O] produced by irradiating a flowing gas target of nitrogen and hydrogen. The apparatus includes a collector for receiving and directing a gas containing H{sub 2}[{sup 15}O] gas and impurities, mainly ammonia (NH{sub 3}) gas into sterile water to trap the H{sub 2}[{sup 15}O] and form ammonium (NH{sub 4}{sup +}) in the sterile water. A device for displacing the sterile water containing H{sub 2}[{sup 15}O] and NH{sub 4}{sup +} through a cation resin removes NH{sub 4}{sup +} from the sterile water. A device for combining the sterile water containing H{sub 2}[{sup 15}O] with a saline solution produces an injectable solution. Preferably, the apparatus includes a device for delivering the solution to a syringe for injection into a patient. Also, disclosed is a method for preparing H{sub 2}[{sup 15}O] in injectable form for use in Positron Emission Tomography in which the method neither requires isotopic exchange reaction nor application of high temperature. 7 figs.

  10. Apparatus and method for preparing oxygen-15 labeled water H.sub.2 [.sup.15 O] in an injectable form for use in positron emission tomography

    DOE Patents [OSTI]

    Ferrieri, Richard A.; Schlyer, David J.; Alexoff, David

    1996-01-09

    A handling and processing apparatus for preparing Oxygen-15 labeled water (H.sub.2 [.sup.15 O]) in injectable form for use in Positron Emission Tomography from preferably H.sub.2 [.sup.15 O] produced by irradiating a flowing gas target of nitrogen and hydrogen. The apparatus includes a collector for receiving and directing a gas containing H.sub.2 [.sup.15 O] gas and impurities, mainly ammonia (NH.sub.3) gas into sterile water to trap the H.sub.2 [.sup.15 O] and form ammonium (NH.sub.4.sup.+) in the sterile water. A device for displacing the sterile water containing H.sub.2 [.sup.15 O] and NH.sub.4.sup.+ through a cation resin removes NH.sub.4.sup.+ from the sterile water. A device for combining the sterile water containing H.sub.2 [.sup.15 O] with a saline solution produces an injectable solution. Preferably, the apparatus includes a device for delivering the solution to a syringe for injection into a patient. Also, disclosed is a method for preparing H.sub.2 [.sup.15 O] in injectable form for use in Positron Emission Tomography in which the method neither requires isotopic exchange reaction nor application of high temperature.

  11. Effect of dietary fat on plasma glutathione peroxidase levels and intestinal absorption of /sup 75/Se-labeled sodium selenite in chicks

    SciTech Connect (OSTI)

    Mutanen, M.L.; Mykkaenen, H.M.

    1984-05-01

    The effect of dietary fat on the availability of selenium was investigated in chicks fed either 4 or 20% butter, olive oil, rape oil, corn oil or sunflower oil in the diet for 3 weeks after hatching. Plasma glutathione peroxidase (GSH-Px) activity was used as an indicator of the body selenium status. In addition, the intestinal absorption of sodium selenite (/sup 75/Se-labeled) was determined by using both the in vivo ligated loop procedure and oral administration of the isotope. The plasma GSH-Px levels increased with increasing proportion of the polyunsaturated fatty acids in the diet. Increasing the amount of fat from 4 to 20% significantly enhanced the GSH-Px activity in the groups receiving butter or olive oil, but had no effect in animals fed the unsaturated fats. The absorption of (/sup 75/Se)selenite from the ligated duodenal loops tended to be reduced in chicks fed corn oil or sunflower oil as compared to the animals receiving butter in their diet. On the other hand, the type of dietary fat did not appear to affect the absorption of the orally administered selenite. The present study demonstrates that the type of dietary fat can affect the plasma GSH-Px levels in chicks without altering the intestinal absorption of selenite. However, the results on the absorption of the intraduodenally injected sodium selenite suggest that dietary fat plays some role in the intestinal transport of selenium.

  12. DOE Challenge Home Label Methodology

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ... level would have a measure from another construction level for some other reason. ... considered as a comfort measure because of reduction in drafts and better thermal comfort. ...

  13. Isotopically labeled compositions and method

    DOE Patents [OSTI]

    Schmidt, Jurgen G.; Kimball, David B.; Alvarez, Marc A.; Williams, Robert F.; Martinez, Rudolfo A.

    2011-07-12

    Compounds having stable isotopes .sup.13C and/or .sup.2H were synthesized from precursor compositions having solid phase supports or affinity tags.

  14. NOTICE TO SUPPLIERS Fraudulent Quote Requests/Purchase Order E-Mail Activity

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    * The email message may be poorly written, with misspellings and awkward sentence structure. * The sender's email address is not the same as CNS standard email address domain. The email address domain for Y-12: xxx@y12.doe.gov, for Pantex: xxx@pantex.com. Email from either site may also be in this form: xxx@cns.doe.gov. * The message and purchase order requests shipment/delivery of products to non-CNS facilities. * The message will include an attachment that is designed to look like a purchase

  15. NOTICE TO SUPPLIERS Fraudulent Quote Requests/Purchase Order E-Mail Activity

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

     The email message may be poorly written, with misspellings and awkward sentence structure.  The senders email address is not the same as CNS standard email address domain. The email address domain for Y-12: xxx@y12.doe.gov, for Pantex: xxx@pantex.com.  The message and purchase order requests shipment/delivery of products to non-CNS facilities.  The message will include an attachment that is designed to look like a purchase order, and includes a logo or other graphic, and a signature

  16. U.S. Postal Service General Mail Facility, San Diego, California...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    to easily carry over their "best value" philosophy in considering energy consumption, ... Education: The former National Energy Coordinator for USPS published a paper (see ...

  17. CERTIFIED MAIL RETURN RECEIPT REQUESTED Dr. Chi-Chang Kao Laboratory...

    Energy Savers [EERE]

    health program requirements related to laser and electron beam equipment at SLAC ... principles necessary for safe operation of laser systems and energetic beam equipment. ...

  18. E-Alerts: Environmental pollution and control (solid waste pollution and control). E-mail newsletter

    SciTech Connect (OSTI)

    1999-04-01

    The paper discusses pollution by solid wastes including garbage, scrap, junked automobiles, spoil, sludge, containers; Disposal methods such as composts or land application, injection wells, incineration, sanitary landfills; Mining wastes; Processing for separation and materials recovery; Solid waste utilization; Recycling; Biological and ecological effects; Superfund (Records of Decision, etc.); SITE technology; Laws, legislation, and regulations; Public administration; Economics; Land use. The discussion includes disposal of concentrated or pure liquids such as brines, oils, chemicals, and hazardous materials.

  19. Via E-Mail Michael Li Electricity Policy Specialist U.S. Department of Energy

    Energy Savers [EERE]

    Veterans Solving Energy Challenges Veterans Solving Energy Challenges August 6, 2014 - 10:31am Addthis Ronald J. (R.J.) McIntosh receives a Certificate of Special Congressional Recognition from Rep. Suzan DelBene of Washington. | Photo courtesy of Rep. Suzan DelBene’s office Ronald J. (R.J.) McIntosh receives a Certificate of Special Congressional Recognition from Rep. Suzan DelBene of Washington. | Photo courtesy of Rep. Suzan DelBene's office Six of the eight FEMP veteran internship

  20. E-Alerts: Combustion, engines, and propellants (reciprocation and rotating combustion engines). E-mail newsletter

    SciTech Connect (OSTI)

    1999-04-01

    Design, performance, and testing of reciprocating and rotating engines of various configurations for all types of propulsion. Includes internal and external combustion engines; engine exhaust systems; engine air systems components; engine structures; stirling and diesel engines.

  1. Site Office Contracting Officer E-mail address Ames Site Office...

    National Nuclear Security Administration (NNSA)

    ...leod@pnso.science.doe.gov Sandia Site Office Dave Ferguson Dave.Ferguson@nnsa.doe.gov Savannah River Site Office Carol Elliot carol.elliott@nnsa.srs.gov Y-12 Site Office Jill ...

  2. C:MydocsMYDOCSHATTIERECS97recsForms97Mail.PDF

    Gasoline and Diesel Fuel Update (EIA)

    ... 06 Coal or Coke 07 Wood 08 Solar Collectors 21 Other Fuel (SPECIFY): ... How do you pay for your air-conditioning costs? 1 We pay directly to the gas or ...

  3. By E-Mail Daniel Cohen Assistant General Counsel for Legislation, Regulation, and Energy Efficiency

    Energy Savers [EERE]

    of Energy Buying a Car? Find Out What it Will REALLY Cost You Each Year Buying a Car? Find Out What it Will REALLY Cost You Each Year November 9, 2009 - 12:52pm Addthis Allison Casey Senior Communicator, NREL If you're in the market for a new car, you've probably been doing a lot of research. Talking to friends, reading reviews, scoping out other cars on the road, maybe even taking some test drives. You probably have a list of things you want in car, and you should consider all of these

  4. E-Alerts: Energy (engine studies (energy related)). E-mail newsletter

    SciTech Connect (OSTI)

    1999-04-01

    Operation and design of engines when related to energy conservation and energy use. Covers turbine, rotary, and reciprocating engines.

  5. Cyber in the Cloud -- Lessons Learned from INL's Cloud E-Mail Acquisition

    SciTech Connect (OSTI)

    Troy Hiltbrand; Daniel Jones

    2012-12-01

    As we look at the cyber security ecosystem, are we planning to fight the battle as we did yesterday, with firewalls and intrusion detection systems (IDS), or are we sensing a change in how security is evolving and planning accordingly? With the technology enablement and possible financial benefits of cloud computing, the traditional tools for establishing and maintaining our cyber security ecosystems are being dramatically altered.

  6. By E-Mail Daniel Cohen Assistant General Counsel for Legislation...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ... to incorporate by reference specific clauses from IEC Standard 62301, First Edition. 2 ... verification programs that utilize independent testing laboratories and are developed ...

  7. ORISE: Contact information for REAC/TS - phone numbers, e-mail

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Contact Us Radiation Emergency Assistance CenterTraining Site staff contact information Emergency Number 865.576.1005 (Ask for REACTS) Nicholas Dainiak, M.D., FACP Medical and...

  8. SU-E-CAMPUS-I-03: Dosimetric Comparison of the Hypoxia Agent Iodoazomycin Arabinoside (IAZA) Labeled with the Radioisotopes I-123, I-131 and I-124

    SciTech Connect (OSTI)

    Jans, H-S; Stypinski, D; Mcquarrie, S; Kumar, P; Mercer, J; McEwan, S; Wiebe, L

    2014-06-15

    Purpose: To compare the radiation dose to normal organs from the radio-iodinated, hypoxia-binding radiosensitizer iodoazomycin arabinoside (IAZA) for three different isotopes of iodine. Methods: Dosimety studies with normal volunteers had been carried out with [{sup 123}I]IAZA, a drug binding selectively to hypoxic sites. Two other isotopes of iodine, {sup 131}I and {sup 124}I, offer the opportunity to use IAZA as an agent for radioisotope therapy and as an imaging tracer for Positron Emission Tomography. Radioisotope dosimetry for {sup 131}I and {sup 124}I was performed by first deriving from the [{sup 123}I]IAZA studies biological uptake and excretion data. The cumulated activities for {sup 131}I or {sup 124}I where obtained by including their half-lives when integrating the biological data and then extrapolating to infinite time points considering a) physical decay only or b) physical and biological excretion. Doses were calculated using the Medical Internal Radiation Dose (MIRD) schema (OLINDA1.1 code, Vanderbilt 2007). Results: Compared to {sup 123}I, organ doses were elevated on average by a factor 6 and 9 for {sup 131}I and {sup 124}I, respectively, if both physical decay and biological excretion were modeled. If only physical decay is considered, doses increase by a factor 18 ({sup 131}I) and 19 ({sup 124}I). Highest organ doses were observed in intestinal walls, urinary bladder and thyroid. Effective doses increased by a factor 11 and 14 for {sup 131}I and {sup 124}I, respectively, if biological and physical decay are present. Purely physical decay yields a 23-fold increase over {sup 123}I for both, {sup 131}I and {sup 124}I. Conclusion: Owing to the significant dose increase, caused by their longer half life and the approximately 10 times larger electronic dose deposited in tissue per nuclear decay, normal tissue doses of IAZA labeled with {sup 131}I and {sup 124}I need to be carefully considered when designing imaging and therapy protocols for clinical trials. Effective blocking of iodine uptake in the thyroid is essential. Alberta Innovates - Health Solutions (AIHS) and Canadian Institutes of Health Research (CIHR)

  9. Grazing incidence angle based sensing approach integrated with fiber-optic Fourier transform infrared (FO-FTIR) spectroscopy for remote and label-free detection of medical device contaminations

    SciTech Connect (OSTI)

    Hassan, Moinuddin Ilev, Ilko

    2014-10-15

    Contamination of medical devices has become a critical and prevalent public health safety concern since medical devices are being increasingly used in clinical practices for diagnostics, therapeutics and medical implants. The development of effective sensing methods for real-time detection of pathogenic contamination is needed to prevent and reduce the spread of infections to patients and the healthcare community. In this study, a hollow-core fiber-optic Fourier transform infrared spectroscopy methodology employing a grazing incidence angle based sensing approach (FO-FTIR-GIA) was developed for detection of various biochemical contaminants on medical device surfaces. We demonstrated the sensitivity of FO-FTIR-GIA sensing approach for non-contact and label-free detection of contaminants such as lipopolysaccharide from various surface materials relevant to medical device. The proposed sensing system can detect at a minimum loading concentration of approximately 0.7 ?g/cm{sup 2}. The FO-FTIR-GIA has the potential for the detection of unwanted pathogen in real time.

  10. Lead-203 as a label for radioimaging

    DOE Patents [OSTI]

    Srivastava, Suresh C.; Meinken, George E.

    1990-01-01

    A radiopharmaceutical composition comprising a radioactive isotope of lead (Pb-203) in combination with a pharmaceutical or an antibody or antibody fragment and a bifunctional chelating agent. These compositions are especially useful in the imaging and diagnosis of tumors and tumor metastases.

  11. North America Energy Efficiency Standards and Labeling

    Energy Savers [EERE]

    Norman Augustine About Us Norman Augustine - Former Chairman and CEO, Lockheed Martin, Former Under Secretary for the Army Photo of Norman Augustine Norman R. Augustine was raised in Colorado and attended Princeton University where he graduated with a BSE in Aeronautical Engineering, magna cum laude, and an MSE. He was elected to Phi Beta Kappa, Tau Beta Pi and Sigma Xi. In 1958 he joined the Douglas Aircraft Company in California where he worked as a Research Engineer, Program Manager and Chief

  12. Microfluidic devices, systems, and methods for quantifying particles using centrifugal force

    DOE Patents [OSTI]

    Schaff, Ulrich Y.; Sommer, Gregory J.; Singh, Anup K.

    2015-11-17

    Embodiments of the present invention are directed toward microfluidic systems, apparatus, and methods for measuring a quantity of cells in a fluid. Examples include a differential white blood cell measurement using a centrifugal microfluidic system. A method may include introducing a fluid sample containing a quantity of cells into a microfluidic channel defined in part by a substrate. The quantity of cells may be transported toward a detection region defined in part by the substrate, wherein the detection region contains a density media, and wherein the density media has a density lower than a density of the cells and higher than a density of the fluid sample. The substrate may be spun such that at least a portion of the quantity of cells are transported through the density media. Signals may be detected from label moieties affixed to the cells.

  13. Large scale DNA microsequencing device

    DOE Patents [OSTI]

    Foote, Robert S.

    1997-01-01

    A microminiature sequencing apparatus and method provide means for simultaneously obtaining sequences of plural polynucleotide strands. The apparatus comprises a microchip into which plural channels have been etched using standard lithographic procedures and chemical wet etching. The channels include a reaction well and a separating section. Enclosing the channels is accomplished by bonding a transparent cover plate over the apparatus. A first oligonucleotide strand is chemically affixed to the apparatus through an alkyl chain. Subsequent nucleotides are selected by complementary base pair bonding. A target nucleotide strand is used to produce a family of labelled sequencing strands in each channel which are separated in the separating section. During or following separation the sequences are determined using appropriate detection means.

  14. Large scale DNA microsequencing device

    DOE Patents [OSTI]

    Foote, Robert S.

    1999-01-01

    A microminiature sequencing apparatus and method provide means for simultaneously obtaining sequences of plural polynucleotide strands. The apparatus comprises a microchip into which plural channels have been etched using standard lithographic procedures and chemical wet etching. The channels include a reaction well and a separating section. Enclosing the channels is accomplished by bonding a transparent cover plate over the apparatus. A first oligonucleotide strand is chemically affixed to the apparatus through an alkyl chain. Subsequent nucleotides are selected by complementary base pair bonding. A target nucleotide strand is used to produce a family of labelled sequencing strands in each channel which are separated in the separating section. During or following separation the sequences are determined using appropriate detection means.

  15. Large scale DNA microsequencing device

    DOE Patents [OSTI]

    Foote, R.S.

    1997-08-26

    A microminiature sequencing apparatus and method provide a means for simultaneously obtaining sequences of plural polynucleotide strands. The apparatus cosists of a microchip into which plural channels have been etched using standard lithographic procedures and chemical wet etching. The channels include a reaction well and a separating section. Enclosing the channels is accomplished by bonding a transparent cover plate over the apparatus. A first oligonucleotide strand is chemically affixed to the apparatus through an alkyl chain. Subsequent nucleotides are selected by complementary base pair bonding. A target nucleotide strand is used to produce a family of labelled sequencing strands in each channel which are separated in the separating section. During or following separation the sequences are determined using appropriate detection means. 17 figs.

  16. System and method for acquisition management of subject position information

    DOE Patents [OSTI]

    Carrender, Curt

    2005-12-13

    A system and method for acquisition management of subject position information that utilizes radio frequency identification (RF ID) to store position information in position tags. Tag programmers receive position information from external positioning systems, such as the Global Positioning System (GPS), from manual inputs, such as keypads, or other tag programmers. The tag programmers program each position tag with the received position information. Both the tag programmers and the position tags can be portable or fixed. Implementations include portable tag programmers and fixed position tags for subject position guidance, and portable tag programmers for collection sample labeling. Other implementations include fixed tag programmers and portable position tags for subject route recordation. Position tags can contain other associated information such as destination address of an affixed subject for subject routing.

  17. System and method for acquisition management of subject position information

    DOE Patents [OSTI]

    Carrender, Curt

    2007-01-23

    A system and method for acquisition management of subject position information that utilizes radio frequency identification (RF ID) to store position information in position tags. Tag programmers receive position information from external positioning systems, such as the Global Positioning System (GPS), from manual inputs, such as keypads, or other tag programmers. The tag programmers program each position tag with the received position information. Both the tag programmers and the position tags can be portable or fixed. Implementations include portable tag programmers and fixed position tags for subject position guidance, and portable tag programmers for collection sample labeling. Other implementations include fixed tag programmers and portable position tags for subject route recordation. Position tags can contain other associated information such as destination address of an affixed subject for subject routing.

  18. Large scale DNA microsequencing device

    DOE Patents [OSTI]

    Foote, R.S.

    1999-08-31

    A microminiature sequencing apparatus and method provide means for simultaneously obtaining sequences of plural polynucleotide strands. The apparatus comprises a microchip into which plural channels have been etched using standard lithographic procedures and chemical wet etching. The channels include a reaction well and a separating section. Enclosing the channels is accomplished by bonding a transparent cover plate over the apparatus. A first oligonucleotide strand is chemically affixed to the apparatus through an alkyl chain. Subsequent nucleotides are selected by complementary base pair bonding. A target nucleotide strand is used to produce a family of labelled sequencing strands in each channel which are separated in the separating section. During or following separation the sequences are determined using appropriate detection means. 11 figs.

  19. Microsoft PowerPoint - Copy of Boron-Based nanoPCs.ppt [Compatibility...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    has investigated an alternative to conventionally constructed gas-filled PCs using a boron-coated nanostructured array affixed on an insulating substrate to replace the...

  20. Metal-Air Electric Vehicle Battery: Sustainable, High-Energy Density, Low-Cost Electrochemical Energy Storage Metal-Air Ionic Liquid (MAIL) Batteries

    SciTech Connect (OSTI)

    2009-12-21

    Broad Funding Opportunity Announcement Project: ASU is developing a new class of metal-air batteries. Metal-air batteries are promising for future generations of EVs because they use oxygen from the air as one of the batterys main reactants, reducing the weight of the battery and freeing up more space to devote to energy storage than Li-Ion batteries. ASU technology uses Zinc as the active metal in the battery because it is more abundant and affordable than imported lithium. Metal-air batteries have long been considered impractical for EV applications because the water-based electrolytes inside would decompose the battery interior after just a few uses. Overcoming this traditional limitation, ASUs new battery system could be both cheaper and safer than todays Li-Ion batteries, store from 4-5 times more energy, and be recharged over 2,500 times.

  1. Search for: All records | SciTech Connect

    Office of Scientific and Technical Information (OSTI)

    Silverstein, Eva (1) Smith, Kendrick M., E-mail: siavoshrezvan@gmail.com, E-mail: ... Mirbabayi, Mehrdad ; Senatore, Leonardo ; Smith, Kendrick M., E-mail: ...

  2. Search for: All records | SciTech Connect

    Office of Scientific and Technical Information (OSTI)

    ... Enhancement in magnetic properties of magnesium substituted bismuth ferrite nanoparticles Xu, Jianlong ; Xie, Dan, E-mail: xiedan@mail.tsinghua.edu.cn, E-mail: ...

  3. Rotatable stem and lock

    DOE Patents [OSTI]

    Deveney, J.E.; Sanderson, S.N.

    1981-10-27

    A valve stem and lock is disclosed which includes a housing surrounding a valve stem, a solenoid affixed to an interior wall of the housing, an armature affixed to the valve stem and a locking device for coupling the armature to the housing body. When the solenoid is energized, the solenoid moves away from the housing body, permitting rotation of the valve stem.

  4. Hanford Site Beryllium Posting and Labeling Requirements Procedure

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    DateSection Changed Change Details 1 31913, Misc. changes as listed Minor editorial changes throughout. 1.0, added callout to Attachment 1. 5.2, directed reader to...

  5. Process of labeling specific chromosomes using recombinant repetitive DNA

    DOE Patents [OSTI]

    Moyzis, R.K.; Meyne, J.

    1988-02-12

    Chromosome preferential nucleotide sequences are first determined from a library of recombinant DNA clones having families of repetitive sequences. Library clones are identified with a low homology with a sequence of repetitive DNA families to which the first clones respectively belong and variant sequences are then identified by selecting clones having a pattern of hybridization with genomic DNA dissimilar to the hybridization pattern shown by the respective families. In another embodiment, variant sequences are selected from a sequence of a known repetitive DNA family. The selected variant sequence is classified as chromosome specific, chromosome preferential, or chromosome nonspecific. Sequences which are classified as chromosome preferential are further sequenced and regions are identified having a low homology with other regions of the chromosome preferential sequence or with known sequences of other family members and consensus sequences of the repetitive DNA families for the chromosome preferential sequences. The selected low homology regions are then hybridized with chromosomes to determine those low homology regions hybridized with a specific chromosome under normal stringency conditions.

  6. Indium-111 labeled anti-melanoma monoclonal antibodies

    DOE Patents [OSTI]

    Srivastava, S.C.; Fawwaz, R.A.; Ferrone, S.

    1984-04-30

    A monoclonal antibody to a high molecular weight melanoma-associated antigen was chelated and radiolabeled with indium-111. This material shows high affinity for melanoma and thus can be used in the detection, localization and imaging of melanoma. 1 figure.

  7. Palladium-109 labeled anti-melanoma monoclonal antibodies

    DOE Patents [OSTI]

    Srivastava, Suresh C.; Fawwaz, Rashid A.; Ferrone, Soldano

    1990-01-01

    Palladium-109, a beta-emitting radionuclide, when chelated to anti-melanoma monoclonal antibody demonstrates high uptake in melanoma and thus is useful for tumor therapy.

  8. DOE Requires Manufacturer and Labeler to Cease Sale of Incandescent...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    of Non-Compliance Determination to Westinghouse Lighting Corporation and Fuzhou Sunlight Lighting Electrical Appliance Company requiring that they halt the sale of 8 basic...

  9. Biosensor for label-free DNA quantification based on functionalized...

    Office of Scientific and Technical Information (OSTI)

    Additional Journal Information: Journal Volume: 84; Journal Issue: C; Related Information: CHORUS Timestamp: 2016-05-14 00:13:49; Journal ID: ISSN 0956-5663 Publisher: Elsevier ...

  10. Invariants and labels for Lie-Poisson Systems

    SciTech Connect (OSTI)

    Thiffeault, J.L.; Morrison, P.J.

    1998-04-01

    Reduction is a process that uses symmetry to lower the order of a Hamiltonian system. The new variables in the reduced picture are often not canonical: there are no clear variables representing positions and momenta, and the Poisson bracket obtained is not of the canonical type. Specifically, we give two examples that give rise to brackets of the noncanonical Lie-Poisson form: the rigid body and the two-dimensional ideal fluid. From these simple cases, we then use the semidirect product extension of algebras to describe more complex physical systems. The Casimir invariants in these systems are examined, and some are shown to be linked to the recovery of information about the configuration of the system. We discuss a case in which the extension is not a semidirect product, namely compressible reduced MHD, and find for this case that the Casimir invariants lend partial information about the configuration of the system.

  11. Lumens and the Lighting Facts Label | Department of Energy

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    light be any different? For decades, we have been buying lightbulbs based on how much energy they consume (watts) -- no matter how much light they give us (lumens). What's a...

  12. EIA Energy Efficiency-Appliance Standards and Labeling Links

    U.S. Energy Information Administration (EIA) Indexed Site

    and enforcement requirements for residential appliances; final rule Energy Efficiency and Renewable Energy - Appliances & Commercial Equipment Standards, the program develops test...

  13. Method and apparatus for detection of fluorescently labeled materials

    DOE Patents [OSTI]

    Stern, David; Fiekowsky, Peter

    2004-05-25

    Fluorescently marked targets bind to a substrate 230 synthesized with polymer sequences at known locations. The targets are detected by exposing selected regions of the substrate 230 to light from a light source 100 and detecting the photons from the light fluoresced therefrom, and repeating the steps of exposure and detection until the substrate 230 is completely examined. The resulting data can be used to determine binding affinity of the targets to specific polymer sequences.

  14. Bureau of Energy Efficiency Standard & Labelling (India) Website...

    Open Energy Info (EERE)

    URI: cleanenergysolutions.orgcontentbureau-energy-efficiency-standard-lab Language: English Policies: "Deployment Programs,Regulations" is not in the list of possible...

  15. Microsoft Word - Smart Grid Certification and Labeling Program...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    ... mandated by the Energy Policy and Conservation Act of ... Energy Efficiency and Sustainability" summarizes the main ... merit. * Targeted Product Category-It is important ...

  16. Label Building Natural Gas Usage Form 1999 Commercial Buildings...

    Gasoline and Diesel Fuel Update (EIA)

    (toll free) at 1-888-861-0464. For general information about the survey, visit our Web site at http:www.ei a.doe.govemeucbecs. 6. Please use the enclosed self-addre ssed, ...

  17. Efficient and selective isotopic labeling of hemes to facilitate...

    Office of Scientific and Technical Information (OSTI)

    This method achieves, in a single step, efficient expression and incorporation of hemes ... OSTI Identifier: 1115846 Report Number(s): PNNL-SA-87210 KP1702030 DOE Contract Number: ...

  18. Hyekyung Kim | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Hyekyung Kim Hyekyung Kim Postdoctoral Appointee E-mail clarisse

  19. Osman Eryilmaz | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Osman Eryilmaz Principal Materials Scientist E-mail eryilmaz

  20. Balendra Sutharshan | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Balendra Sutharshan Chief Operations Officer - EGS E-mail bsutharshan

  1. Ryne T. Willig | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Ryne T. Willig Safety Associate - EGS E-mail rwillig

  2. Search for: All records | SciTech Connect

    Office of Scientific and Technical Information (OSTI)

    macintosh1@llnl.gov, E-mail: jaisaacs@wisc.edu, E-mail: artie@tls-tautenburg.de, ... macintosh1@llnl.gov, E-mail: jaisaacs@wisc.edu, E-mail: artie@tls-tautenburg.de, ...

  3. Better Buildings Neighborhood Program

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ... * Contest held * Neighborhood meetings * Contest had participants * Social media * Direct mail * Social media applications * Direct mail resulted in applications * Telethon ...

  4. Desmond Toa | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Desmond Toa Desmond Toa Desmond Toa Graduate Student E-mail: desmond.toa@mail.utoronto.ca Website: Princeton University

  5. Reversible brazing process

    DOE Patents [OSTI]

    Pierce, Jim D.; Stephens, John J.; Walker, Charles A.

    1999-01-01

    A method of reversibly brazing surfaces together. An interface is affixed to each surface. The interfaces can be affixed by processes such as mechanical joining, welding, or brazing. The two interfaces are then brazed together using a brazing process that does not defeat the surface to interface joint. Interfaces of materials such as Ni-200 can be affixed to metallic surfaces by welding or by brazing with a first braze alloy. The Ni-200 interfaces can then be brazed together using a second braze alloy. The second braze alloy can be chosen so that it minimally alters the properties of the interfaces to allow multiple braze, heat and disassemble, rebraze cycles.

  6. Solar reflection panels

    DOE Patents [OSTI]

    Diver, Jr., Richard B.; Grossman, James W.; Reshetnik, Michael

    2006-07-18

    A solar collector comprising a glass mirror, and a composite panel, wherein the back of the mirror is affixed to a front surface of the composite panel. The composite panel comprises a front sheet affixed to a surface of a core material, preferably a core material comprising a honeycomb structure, and a back sheet affixed to an opposite surface of the core material. The invention may further comprise a sealing strip, preferably comprising EPDM, positioned between the glass mirror and the front surface of the composite panel. The invention also is of methods of making such solar collectors.

  7. Undergraduate Students | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Undergraduate Students Undergraduate Students Ingrid Archibald Undergraduate Student E-mail: ingridarchibald@wustl.edu Divya Babbula Undergraduate Student E-mail: divya.babbula@wustl.edu Stephanie Botkin E-mail: stephanie.botkin@wustl.edu Kyle Cepeda Undergraduate Student E-mail: kcepeda@wustl.edu Andrew Ells Undergraduate Student E-mail: andrew.ells@wustl.edu Ryan Farhat-Sabet Undergraduate Student E-mail: r.farhat-sabet@wustl.edu Caroline Focht Undergraduate Student E-mail:

  8. RS-CO-0001-001.PDF

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Visitor Compliance Form By my signature affixed below, I understand that I must stay with a badged person at all times when in the CAMD Experimental Hall, Storage Ring or...

  9. Solar Rights

    Broader source: Energy.gov [DOE]

    A solar energy system is defined as "a system affixed to a building or buildings that uses solar devices, which are thermally isolated from living space or any other area where the energy is used...

  10. DOE-0336

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    by this procedure. "Danger Do Not Operate" tags shall be constructed to include an adhesive laminate to be affixed after tag completion. * 3x5-12 Danger Tag, (AW) 54-6001-955....

  11. Distribution System State Estimation

    Office of Scientific and Technical Information (OSTI)

    This Notice shall be affixed to any reproductions of these data in whole or in part. Executive Summary State estimation is a key enabler for any number of "smart grid" applications ...

  12. Treatment of arsenic-contaminated water using akaganeite adsorption

    DOE Patents [OSTI]

    Cadena C., Fernando; Johnson, Michael D.

    2008-01-01

    The present invention comprises a method and composition using akaganeite, an iron oxide, as an ion adsorption medium for the removal of arsenic from water and affixing it onto carrier media so that it can be used in filtration systems.

  13. Email Updates about the Small Business Vouchers Pilot | NREL

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Email Updates about the Small Business Vouchers Pilot Subscribe Please enter and submit your e-mail address to receive periodic updates about the Small Business Vouchers Pilot. E-mail Address: Subscribe Unsubscribe Please enter and submit your e-mail address to unsubscribe from the mailing list for the Small Business Vouchers Pilot. E-mail Address: Unsubscribe

  14. Laser target fabrication, structure and method for its fabrication

    DOE Patents [OSTI]

    Farnum, Eugene H.; Fries, R. Jay

    1985-01-01

    The disclosure is directed to a laser target structure and its method of fabrication. The target structure comprises a target plate containing an orifice across which a pair of crosshairs are affixed. A microsphere is affixed to the crosshairs and enclosed by at least one hollow shell comprising two hemispheres attached together and to the crosshairs so that the microsphere is juxtapositioned at the center of the shell.

  15. GS-CO-0001-001.PDF

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    GS-CO-0001-001.doc Two-Person Rule Date: 2000/04/06 By my signature affixed below, I commit to abide by the Two-Person rule while working at CAMD. Further, I understand that failure to comply with this rule may impair my ability to access the CAMD facility. Signature: _______________________ Name: ________________ Date: _______ (print) Affiliation: ______________________ Contact Number: _____________________ Two-Person Contractor/ Visitor Compliance Form By my signature affixed below, I commit

  16. Evaluation of the exothermicity of the chemi-ionization reaction...

    Office of Scientific and Technical Information (OSTI)

    Authors: Cox, Richard M ; Kim, JungSoo ; Armentrout, P. B., E-mail: armentrout@chem.utah.edu, E-mail: mheaven@emory.edu, E-mail: albert.viggiano@us.af.mil 1 ; Bartlett, Joshua ; ...

  17. Laboratory Equipment Donation Program - Administrative Login

    Office of Scientific and Technical Information (OSTI)

    Logon Reset Forgot your username or password or need to change your e-mail address? Send e-mail to pf-lepd@osti.gov. Need to change OPMO contact (i.e., e-mail, name, telephone ...

  18. IN-SPIRE: Creating a Visualization from Microsoft Outlook

    ScienceCinema (OSTI)

    None

    2012-12-31

    IN-SPIRE can harvest text from Microsoft Outlook e-mail messages via a simple drag-and-drop mechanism. This is great for mailing lists or systems that send search results via e-mail.

  19. EERE Publication and Product Library

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mail Requests You have not requested any products. You can request that products and publications be mailed to you by clicking on the "Request by Mail" link in the publication...

  20. Sandia National Laboratories: Contact Us

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Contact Us Contact Us New Mexico California Sandia National Laboratories, New Mexico P.O. Box 5800 Albuquerque, NM 87185-(mail stop)* Non-mail deliveries: 1515 Eubank SE Albuquerque, NM 87123 Sandia National Laboratories, California P.O. Box 969 Livermore, CA 94551-0969 Non-mail deliveries: 7011 East Avenue Livermore, CA 94550 * All mail must contain an appropriate mail stop to ensure delivery. For employee mail stops, reference our Employee Locator. Contact Information General Inquiries New

  1. My Account | Critical Materials Institute

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    My Account Primary tabs Log in Request new password(active tab) Username or e-mail address * E-mail new password

  2. User account | The Ames Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    User account User account Primary tabs Log in Request new password(active tab) Username or e-mail address * E-mail new password

  3. Contact Us | NREL

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Contact Us Find mailing addresses, phone numbers, and contact information for NREL staff. Mailing Address and Phone Numbers Golden, Colorado Laboratories and Offices National...

  4. Bryan Fry | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Bryan Fry Bryan Fry Bryan Fry Graduate Student E-mail: bryanfry@mail.med.upenn.edu Website: University of Pennsylvania Graduate...

  5. Search for: All records | SciTech Connect

    Office of Scientific and Technical Information (OSTI)

    ... Anzai, Jun, E-mail: anzaijun@kaken.co.jp Pharmacology Department, Central Research ... Asano, Taiji, E-mail: asanotaiji@kaken.co.jp Pharmacology Department, Central Research ...

  6. BPA-2014-00787-FOIA Correspondence

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mailing List of approximately 3500 members, to include the mailings regarding the 2012 Fish Accord MOA with the Kalispell Tribe. 2) The press release inviting public comment on...

  7. Research and Technical Associates | Photosynthetic Antenna Research...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    placeholder image Amy LaFountain Research Affiliate Technical Assocaite E-mail: amy.lafountain@uconn.edu Graham Leggett Graham Leggett Professor E-mail:...

  8. Slow light Mach-Zehnder interferometer as label-free biosensor...

    Office of Scientific and Technical Information (OSTI)

    OSTI Identifier: 1237162 GrantContract Number: AC05-00OR22725 Type: Accepted Manuscript Journal Name: Optics Letters Additional Journal Information: Journal Volume: 41; Journal ...

  9. High-resolution x-ray diffraction microscopy of specifically labeled yeast cells (CXIDB ID 6)

    DOE Data Explorer [Office of Scientific and Technical Information (OSTI)]

    Nelson, Johanna

    2011-07-22

    This is the third of five exposures of the same sample at different tilts. This one is at +30 degrees tilt. Check CXI IDs 4 to 8 for the complete set.

  10. High-resolution x-ray diffraction microscopy of specifically labeled yeast cells (CXIDB ID 5)

    DOE Data Explorer [Office of Scientific and Technical Information (OSTI)]

    Nelson, Johanna

    2011-07-22

    This is the second of five exposures of the same sample at different tilts. This one is at +15 degrees tilt. Check CXI IDs 4 to 8 for the complete set.

  11. High-resolution x-ray diffraction microscopy of specifically labeled yeast cells (CXIDB ID 8)

    DOE Data Explorer [Office of Scientific and Technical Information (OSTI)]

    Nelson, Johanna

    2011-07-22

    This is the fifth of five exposures of the same sample at different tilts. This one is at -30 degrees tilt. Check CXI IDs 4 to 8 for the complete set.

  12. High-resolution x-ray diffraction microscopy of specifically labeled yeast cells (CXIDB ID 4)

    DOE Data Explorer [Office of Scientific and Technical Information (OSTI)]

    Nelson, Johanna

    2011-07-22

    This is the first of five exposures of the same sample at different tilts. This one is at +0 degrees tilt. Check CXI IDs 4 to 8 for the complete set.

  13. High-resolution x-ray diffraction microscopy of specifically labeled yeast cells (CXIDB ID 7)

    DOE Data Explorer [Office of Scientific and Technical Information (OSTI)]

    Nelson, Johanna

    2011-07-22

    This is the fourth of five exposures of the same sample at different tilts. This one is at -15 degrees tilt. Check CXI IDs 4 to 8 for the complete set.

  14. Protein binding studies of technetium-99m-labeled phosphine and isocyanide cationic complexes

    SciTech Connect (OSTI)

    Zanelli, G.D.; Cook, N.; Lahiri, A.; Ellison, D.; Webbon, P.; Woolley, G.

    1988-01-01

    Most /sup 99m/Tc/phosphine/isocyanide complexes synthesized to date show preferential uptake by the myocardium of many animal species but not in man. A new complex has been synthesized, (/sup 99m/Tc(DEPE)2(CNR)2), +(DEPIC), where R = t - butyl isocyanide, which in three animal species images the myocardium very well, but in humans it remains primarily in the blood pool. One reason for the difference in the behavior of these complexes in different species could be the characteristics of their binding to plasma proteins. The protein binding characteristics of DEPIC and two other well-known complexes have therefore been studied. Whereas the other complexes bind nonspecifically to many proteins both in animal and human plasma, DEPIC binds almost exclusively to prealbumin in humans but nonspecifically to other proteins in the rabbit. The binding sites in human plasma appear to be those normally occupied by thyroxine on the prealbumin tetramer and these can be blocked by sodium salicylate.

  15. Look at the label and indicate the type of unit for which you...

    U.S. Energy Information Administration (EIA) Indexed Site

    at: http:www.eia.doe.govcbecsess Privacy of account numbers: We identify buildings ... If you have privacy concerns for your customers, please mark out or omit your own account ...

  16. Computational design of a red fluorophore ligase for site-specific protein labeling in living cells

    SciTech Connect (OSTI)

    Liu, Daniel S.; Nivon, Lucas G.; Richter, Florian; Goldman, Peter J.; Deerinck, Thomas J.; Yao, Jennifer Z.; Richardson, Douglas; Phipps, William S.; Ye, Anne Z.; Ellisman, Mark H.; Drennan, Catherine L.; Baker, David; Ting, Alice Y.

    2014-10-13

    In this study, chemical fluorophores offer tremendous size and photophysical advantages over fluorescent proteins but are much more challenging to target to specific cellular proteins. Here, we used Rosetta-based computation to design a fluorophore ligase that accepts the red dye resorufin, starting from Escherichia coli lipoic acid ligase. X-ray crystallography showed that the design closely matched the experimental structure. Resorufin ligase catalyzed the site-specific and covalent attachment of resorufin to various cellular proteins genetically fused to a 13-aa recognition peptide in multiple mammalian cell lines and in primary cultured neurons. We used resorufin ligase to perform superresolution imaging of the intermediate filament protein vimentin by stimulated emission depletion and electron microscopies. This work illustrates the power of Rosetta for major redesign of enzyme specificity and introduces a tool for minimally invasive, highly specific imaging of cellular proteins by both conventional and superresolution microscopies.

  17. Computational design of a red fluorophore ligase for site-specific protein labeling in living cells

    DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

    Liu, Daniel S.; Nivon, Lucas G.; Richter, Florian; Goldman, Peter J.; Deerinck, Thomas J.; Yao, Jennifer Z.; Richardson, Douglas; Phipps, William S.; Ye, Anne Z.; Ellisman, Mark H.; et al

    2014-10-13

    In this study, chemical fluorophores offer tremendous size and photophysical advantages over fluorescent proteins but are much more challenging to target to specific cellular proteins. Here, we used Rosetta-based computation to design a fluorophore ligase that accepts the red dye resorufin, starting from Escherichia coli lipoic acid ligase. X-ray crystallography showed that the design closely matched the experimental structure. Resorufin ligase catalyzed the site-specific and covalent attachment of resorufin to various cellular proteins genetically fused to a 13-aa recognition peptide in multiple mammalian cell lines and in primary cultured neurons. We used resorufin ligase to perform superresolution imaging of themore » intermediate filament protein vimentin by stimulated emission depletion and electron microscopies. This work illustrates the power of Rosetta for major redesign of enzyme specificity and introduces a tool for minimally invasive, highly specific imaging of cellular proteins by both conventional and superresolution microscopies.« less

  18. Look at the label and indicate the type of unit for which you...

    Gasoline and Diesel Fuel Update (EIA)

    District SteamHot Water Usage Form (Form EIA-871D) Form approval OMB No.: 1905-0145 ... Reporting Period: Report district steamhot water data for all of 2007. We ask for the 14 ...

  19. Four-State Residential Retrofit and Energy Labeling Project: Process Evaluation and Results Webinar

    Broader source: Energy.gov [DOE]

    The State Energy Offices in Alabama, Massachusetts, Virginia, and Washington recently completed a multi-year residential energy efficiency pilot program funded by a competitive State Energy Program...

  20. DOE Requires Manufacturer and Labeler to Cease Sale of Incandescent Reflector Lamps

    Broader source: Energy.gov [DOE]

    DOE has issued Notices of Non-Compliance Determination to Westinghouse Lighting Corporation and Fuzhou Sunlight Lighting Electrical Appliance Company requiring that they halt the sale of 8 basic...

  1. Simple electronic apparatus for the analysis of radioactively labeled gel electrophoretograms

    DOE Patents [OSTI]

    Goulianos, Konstantin; Smith, Karen K.; White, Sebastian N.

    1982-01-01

    A high resolution position sensitive radiation detector for analyzing radiation emanating from a source, constructed of a thin plate having an elongated slot with conductive edges acting as a cathode, a charged anode wire positioned within 0.5 mm adjacent the source and running parallel to the slot and centered therein, an ionizable gas ionized by radiation emanating from the source provided surrounding the anode wire in the slot, a helical wire induction coil serving as a delay line and positioned beneath the anode wire for detecting gas ionization and for producing resulting ionization signals, and processing circuits coupled to the induction coil for receiving ionization signals induced therein after determining therefrom the location along the anode wire of any radiation emanating from the source. An ionization gas of 70% Ar, 29% Isobutane, 0.6% Freon 13BI, and 0.4% Methylal is used.

  2. Eric Rask | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Rask Eric Rask Principal Research Engineer E-mail erask@anl.gov

  3. Eugene Stewart | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Technician Sr. Eugene Stewart Telephone 630.252.4466 E-mail estewart

  4. Jared Ross | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Jared Ross Jared Ross Jared Ross Undergraduate Student E-mail: jbross

  5. Hussein S. Khalil | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Hussein S. Khalil Nuclear Energy and Security Program Leader - EGS E-mail hkhalil

  6. Todd E. Combs | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Todd E. Combs Interim Associate Laboratory Director - EGS E-mail tcombs

  7. Peter Fuesz | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Scientific Associate Peter Fuesz Telephone 630.252.7151 E-mail fuesz

  8. William Brocker | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    William Brocker ESH/QA Coordinator - EGS E-mail wbrocker

  9. Youngjin Kim | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Youngjin Kim Postdoctoral Appointee E-mail kimy@anl.gov Projects Distribution Automation

  10. Nicholaos Demas | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Photo of Nick Demas Nicholaos Demas Assistant Materials Scientist E-mail ndemas@anl.gov

  11. Edward J. Daniels | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Edward J. Daniels Sr. Energy Systems Scientist Telephone (630) 252-5279 E-mail edaniels

  12. Microsoft Word - Microfabrication Project Proposal Form-April16...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Project Proposal Form Principle Investigator: (Person responsible for project) Name: E-Mail Address: ...

  13. Ron Tollner | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Ron Tollner Manager, Building & Systems Operations Telephone 630.252.4457 E-mail tollner

  14. Nathan Soulier | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Nathan Soulier Nathan Soulier Nathan Soulier Graduate Student E-mail: nts116

  15. Susan R. Podoba | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Susan R. Podoba Executive Secretary to the Associate Laboratory Director - EGS E-mail spodoba

  16. A. Scott Dunlop | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    A. Scott Dunlop National Security Facility Director - EGS E-mail adunlop

  17. Renee M. Nault | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Renee M. Nault Senior Manager, Business Development - EGS E-mail rmnault

  18. Mary A. McIntyre | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    A. McIntyre Business Strategist - EGS E-mail mmcintyre

  19. Mary Ellen Hennebry | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Ellen Hennebry Assistant to the Associate Laboratory Director - EGS E-mail mehennebry

  20. Scott Goldsborough | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Scott Goldsborough Principal Mechanical Engineer E-mail sgoldsborough@anl.gov Projects Fuel Kinetics

  1. Sharon Nykolyshyn | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Sharon Nykolyshyn Executive Secretary - EGS Telephone 630-252-3739 E-mail snykolyshyn

  2. David Eckstein | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Eckstein Principal Application Developer Telephone 630.252.7918 E-mail deckstein@anl.gov

  3. Denise M. Voss | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Denise M. Voss Executive Secretary to the Chief Operations Officer - EGS E-mail dvoss

  4. Aaron Greco | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Aaron Greco Principal Materials Scientist E-mail agreco@anl.gov Website Argonne Experts

  5. Alex Martinson | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Alex Martinson Telephone (630) 252-7520 E-mail martinson

  6. Graduate Students | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    People / Graduate Students Graduate Students Sam Barnett Graduate Student E-mail: sbarnett1@sheffield.ac.uk Hui-Yuan Chen Graduate Student E-mail: chen.hui-yuan@wustl.edu Kaitlyn Faries Kaitlyn Faries Graduate Student E-mail: kaitlyn.faries@wustl.edu Phone: 314.935.6566 Kirsty Hacking Graduate Student E-mail: k.hacking.1@research.gla.ac.uk Ming-Yang Ho Graduate Student E-mail: mxh504@psu.edu Don Hood Graduate Student E-mail: dhood@wustl.edu Xia Huang Graduate Student E-mail:

  7. March 2016 APM newsletter | Department of Energy

    Energy Savers [EERE]

    Mail Management Memorandum, July 2, 2010 Mail Management Memorandum, July 2, 2010 Mail Management Memorandum prescribing policy and requirements for the effective, economical, and secure management of incoming, internal, and outgoing mail in Federal agencies. These requirements pertain to all DOE offices, and may also apply to national laboratories and other contractor facilities, depending on whether they qualify as Federal facilities as defined in the regulations. PDF icon Mail Management

  8. Field Guide

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Field Facilities Contacts for Printing and Mail Field Facilities Contacts for Printing and Mail This is the list of DOE field facilities contacts for Printing and Mail as of April 27, 2011. Go to Mail Services Go to Printing Services PDF icon Field_Facilities_Contacts_Print-Mail.pdf More Documents & Publications Director's Perspective by George Miller Tenant Education and Training Fire Safety Committee Membership List

    Ecologist for a Day Field Guide Program supported by: ©2011, Savannah

  9. Scientific Advisory Committee | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Scientific Advisory Committee Scientific Advisory Committee Gary Brudvig Scientific Advisory Committee Member E-mail: gary.brudvig@yale.edu J. Clark Lagarias Scientific Advisory Committee Member E-mail: jclagarias@ucdavis.edu Thomas Moore Thomas Moore Scientific Advisory Committee Chair E-mail: tom.moore@asu.edu Phone: 480.965.3308 Jennifer Ogilvie Scientific Advisory Committee Member E-mail: jogilvie@umich.edu Marion Thurnauer Marion Thurnauer Scientific Advisory Committee Member E-mail:

  10. Modular, security enclosure and method of assembly

    DOE Patents [OSTI]

    Linker, Kevin L.; Moyer, John W.

    1995-01-01

    A transportable, reusable rapidly assembled and disassembled, resizable modular, security enclosure utilizes a stepped panel construction. Each panel has an inner portion and an outer portion which form joints. A plurality of channels can be affixed to selected joints of the panels. Panels can be affixed to a base member and then affixed to one another by the use of elongated pins extending through the channel joints. Alternatively, the base member can be omitted and the panels themselves can be used as the floor of the enclosure. The pins will extend generally parallel to the joint in which they are located. These elongated pins are readily inserted into and removable from the channels in a predetermined sequence to allow assembly and disassembly of the enclosure. A door constructed from panels is used to close the opening to the enclosure.

  11. Carburetor icing preventing device

    SciTech Connect (OSTI)

    Nishimura, S.

    1987-09-08

    This patent describes an internal combustion engine having a body defining in part a variable volume chamber in which combustion occurs. The induction passage in the body delivers a charge to the combustion chamber. An intake manifold is affixed to the body and constructed from a highly conductive material and defines a passage communicating with the body induction passage. A highly heat conductive gasket sealingly is engaged between the body and the intake manifold for promoting heat transfer and a charge forming device is affixed to the intake manifold for delivering a fuel/air charge to the passage.

  12. Electromagnetic fasteners

    DOE Patents [OSTI]

    Crane, Randolph W.; Marts, Donna J.

    1994-11-01

    An electromagnetic fastener for manipulating objects in space uses the matic attraction of various metals. An end effector is attached to a robotic manipulating system having an electromagnet such that when current is supplied to the electromagnet, the object is drawn and affixed to the end effector, and when the current is withheld, the object is released. The object to be manipulated includes a multiplicity of ferromagnetic patches at various locations to provide multiple areas for the effector on the manipulator to become affixed to the object. The ferromagnetic patches are sized relative to the object's geometry and mass.

  13. Electromagnetic fasteners

    DOE Patents [OSTI]

    Crane, Randolph W.; Marts, Donna J.

    1994-01-01

    An electromagnetic fastener for manipulating objects in space uses the matic attraction of various metals. An end effector is attached to a robotic manipulating system having an electromagnet such that when current is supplied to the electromagnet, the object is drawn and affixed to the end effector, and when the current is withheld, the object is released. The object to be manipulated includes a multiplicity of ferromagnetic patches at various locations to provide multiple areas for the effector on the manipulator to become affixed to the object. The ferromagnetic patches are sized relative to the object's geometry and mass.

  14. Rotary mechanical latch

    DOE Patents [OSTI]

    Spletzer, Barry L.; Martinez, Michael A.; Marron, Lisa C.

    2012-11-13

    A rotary mechanical latch for positive latching and unlatching of a rotary device with a latchable rotating assembly having a latching gear that can be driven to latched and unlatched states by a drive mechanism such as an electric motor. A cam arm affixed to the latching gear interfaces with leading and trailing latch cams affixed to a flange within the drive mechanism. The interaction of the cam arm with leading and trailing latch cams prevents rotation of the rotating assembly by external forces such as those due to vibration or tampering.

  15. Ceramic membrane reactor with two reactant gases at different pressures

    DOE Patents [OSTI]

    Balachandran, Uthamalingam; Mieville, Rodney L.

    2001-01-01

    The invention is a ceramic membrane reactor for syngas production having a reaction chamber, an inlet in the reactor for natural gas intake, a plurality of oxygen permeating ceramic slabs inside the reaction chamber with each slab having a plurality of passages paralleling the gas flow for transporting air through the reaction chamber, a manifold affixed to one end of the reaction chamber for intake of air connected to the slabs, a second manifold affixed to the reactor for removing the oxygen depleted air, and an outlet in the reaction chamber for removing syngas.

  16. Nanoengineered membrane electrode assembly interface

    DOE Patents [OSTI]

    Song, Yujiang; Shelnutt, John A

    2013-08-06

    A membrane electrode structure suitable for use in a membrane electrode assembly (MEA) that comprises membrane-affixed metal nanoparticles whose formation is controlled by a photochemical process that controls deposition of the metal nanoparticles using a photocatalyst integrated with a polymer electrolyte membrane, such as an ionomer membrane. Impregnation of the polymer membrane with the photocatalyst prior to metal deposition greatly reduces the required amount of metal precursor in the deposition reaction solution by restricting metal reduction substantially to the formation of metal nanoparticles affixed on or near the surface of the polymer membrane with minimal formation of metallic particles not directly associated with the membrane.

  17. Method of fabrication of anchored nanostructure materials

    DOE Patents [OSTI]

    Seals, Roland D; Menchhofer, Paul A; Howe, Jane Y; Wang, Wei

    2013-11-26

    Methods for fabricating anchored nanostructure materials are described. The methods include heating a nano-catalyst under a protective atmosphere to a temperature ranging from about 450.degree. C. to about 1500.degree. C. and contacting the heated nano-catalysts with an organic vapor to affix carbon nanostructures to the nano-catalysts and form the anchored nanostructure material.

  18. Document

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ... E-mail comments must be sent to emilyslistrepeal@fec.gov. If e- mail comments include an attachment, the attachment must be in either Adobe Acrobat (.pdf) or Microsoft Word (.doc) ...

  19. How is a Document Containing OUO Marked? | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    with "Document(s) transmitted contain(s) OUO information". (DOE M 471.3-1, Admin Chg 1, Chapter I, 3f.) Marking e-mail: If the e-mail contains OUO information, the first line of ...

  20. How to Submit a Freedom of Information Act Request

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    and the Fax number will change to: (720)356-1780 Email: michele.altieri@go.doe.gov Please clearly mark the mailing envelope, fax or subject line of e-mail "Freedom of ...

  1. Magnetohydrodynamics and deep mixing in evolved stars. I. Two...

    Office of Scientific and Technical Information (OSTI)

    Authors: Nucci, M. C. 1 ; Busso, M., E-mail: mariaclara.nucci@unipg.it, E-mail: busso@fisica.unipg.it 2 + Show Author Affiliations Department of Mathematics and Informatics, ...

  2. Contacts | Department of Energy

    Broader source: Energy.gov (indexed) [DOE]

    information to contact the State and Local Solution Center by mail or email: U.S. Department of Energy State and Local Solution Center Mail Stop EE-5W 1000 Independence Ave., SW...

  3. Contact Us | Y-12 National Security Complex

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Contact Us Contact Us Mail and delivery address information: Y-12 National Security Complex P.O. Box 2009 Oak Ridge, TN 37831-8245* Non-mail deliveries: Bear Creek Road P.O. Box...

  4. Research Affiliates | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Engel Gregory Engel Research Affiliate E-mail: gsengel@uchicago.edu Phone: 773.834.0818 Harry Frank Harry Frank Research Affiliate E-mail: harry.frank@uconn.edu Phone: 860.486.2844...

  5. Microsoft Word - Document3

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ...nancy@mail.house.gov; americanvoices@mail.house.gov; comments@whitehouse.gov; ... THE DESTRUCTION OF MUCH OF THE GULF OF MEXICO. DOE IS SCUM BUSHCHENEY COUNTRY AND HAS ...

  6. People | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Associate Professor, Schulich Faculty of Chemistry Research Affiliate E-mail: nadir@tx.technion.ac.il Phone: 972.4.829.2141 Dan Allen Dan Allen Multimedia Specialist E-mail: ...

  7. Operations Committee | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Manager, Research Administration and Operations E-mail: kmosley@wustl.edu Phone: 314-935-3168 Dan Allen Dan Allen Multimedia Specialist E-mail: danallen@wustl.edu Phone: ...

  8. Search for: All records | SciTech Connect

    Office of Scientific and Technical Information (OSTI)

    ... Filter by Author Fornasini, Maria L., E-mail: cfmet@chimica.unige.i (1) Fornasini, Maria Luisa (1) Manfrinetti, Pietro (1) Manfrinetti, Pietro, E-mail: chimfis@chimica.unige.i (1) ...

  9. Search for: All records | SciTech Connect

    Office of Scientific and Technical Information (OSTI)

    ... Filter by Author Manfrinetti, P. (2) Fornasini, Maria L., E-mail: cfmet@chimica.unige.i ... Perrone 24, 16152 Genova ; Fornasini, Maria L., E-mail: cfmet@chimica.unige.i Phases ...

  10. Hopping conduction in p-type MoS{sub 2} near the critical regime...

    Office of Scientific and Technical Information (OSTI)

    ; Park, Joonsuk 4 ; Lin, Der-Yuh 5 ; Huang, Ying-Sheng 6 ; Choi, Heon-Jin 7 ; Chang, Joonyeon, E-mail: cujang@kist.re.kr, E-mail: presto@kist.re.kr 1 ; Department of ...

  11. Novel short antibacterial and antifungal peptides with low cytotoxicit...

    Office of Scientific and Technical Information (OSTI)

    Ning Chen, Wei ; Ming Li, Chang ; Xu, Rong 1 ; Lamrani, Mouad 3 ; Mu, Yuguang, E-mail: ygmu@ntu.edu.sg 2 ; Leong, Susanna Su Jan 1 ; Wook Chang, Matthew, E-mail: ...

  12. ALS Beamlines Directory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    0.05-1.2 eV This e-mail address is being protected from spambots. You need JavaScript enabled to view it (510) 495-2231 This e-mail address is being protected from...

  13. ALSNews Vol. 320

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Read more... Contact: This e-mail address is being protected from spambots. You need JavaScript enabled to view it and This e-mail address is being protected from spambots. You...

  14. Contact Us

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    General Inquiries: This e-mail address is being protected from spambots. You need JavaScript enabled to view it Proposals: This e-mail address is being protected from spambots....

  15. Postdoctoral Associates | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Alastair Gardiner Research Associate E-mail: alastair.gardiner@glasgow.ac.uk Phil Jackson Phil Jackson Postdoctoral Research Associate E-mail: p.j.jackson@sheffield.ac.uk...

  16. Dr.James J.Spivey

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Post Doctoral Researcher Dr. Nitin Kumar E-mail: nkumar2@tigers.lsu.edu Ph.D, 2011, Louisiana State University, Baton Rouge Current Graduate Students Khietlethanh Mai E-mail:...

  17. Subscribe to Energy-Efficient Product Procurement Updates

    Broader source: Energy.gov [DOE]

    FEMP offers e-mail updates covering energy-efficient product procurement requirements, guidance, and assistance. Enter your e-mail address below to begin the registration process. After you...

  18. Search for: All records | SciTech Connect

    Office of Scientific and Technical Information (OSTI)

    ... E-mail: jabbari@theory.ipm.ac.ir, E-mail: shiu@physics.wisc.edu The inflationary cosmology paradigm is very successful in explaining the CMB anisotropy to the percent level. ...

  19. Search for: All records | SciTech Connect

    Office of Scientific and Technical Information (OSTI)

    ... HISTORY OF THE INTERGALACTIC MEDIUM Cen Renyue ; Chisari, Nora Elisa, E-mail: cen@astro.princeton.edu, E-mail: nchisari@astro.princeton.edu Using the state-of-the-art ...

  20. Contact information | Center for Bio-Inspired Solar Fuel Production

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Email: alexander.melkozernov@asu.edu Phone: (480) 965-1548 Fax: (480) 965-5927 Mailing address (US mail): Center for Bio-Inspired Solar Fuel Production Arizona State University ...

  1. BPA-2011-01724-FOIA Correspondence

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    the following: * An e-mail dated April 5, 2011 from Scott Bettin, BPA biologist, to Philip Key, BPA attorney. This e-mail is referred to in footnote 219 on page 77 of the...

  2. TITLE AUTHORS SUBJECT SUBJECT RELATED DESCRIPTION PUBLISHER AVAILABILI...

    Office of Scientific and Technical Information (OSTI)

    solar neighborhood XXXV Distances to M dwarf systems within PC in the southern sky Winters Jennifer G Jao Wei Chun Dieterich Sergio B E mail winters astro gsu edu E mail jao astro...

  3. DOE - Fossil Energy:

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    NEWSALERT - Keep Up to date with e-mail alerts from the Office of Fossil Energy Fossil Energy NEWSALERT is a free, e-mail notification service of the U.S. Department of Energy's ...

  4. BPA-2014-00787-FOIA Request

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    - D-1 Subject: FW: FOIA COE SL-003 BPA JOURNAL MAILING List Kalispell MOA 3-28-2014 Hi Christy and Kim, Pursuant to the FOIA, I request a copy of: 1) The BPA Journal Mailing...

  5. Search for: All records | SciTech Connect

    Office of Scientific and Technical Information (OSTI)

    Chen, Shyan-Shiou, E-mail: sschen@ntnu.edu.tw Department of Mathematics, National Taiwan Normal University, Taipei 11677, Taiwan (China) (2) Chen, Yi-Chiuan, E-mail: YCChen@math....

  6. CONTRACT EMPLOYEES

    National Nuclear Security Administration (NNSA)

    Department Mailing PhoneFax Email or web site California California Department of ... Department Mailing PhoneFax Email or web site New York New York State Division of ...

  7. Acknowledgements of Federal Support | U.S. DOE Office of Science...

    Office of Science (SC) Website

    Peer Reviewed Articles and Technical Papers News Releases, Public-Facing Web, Mailing, and ... Back to Top Back to Top News Releases, Public-Facing Web, Mailing, and Social Media For ...

  8. s-processing in AGB stars revisited. I. Does the main component...

    Office of Scientific and Technical Information (OSTI)

    Authors: Trippella, O. ; Busso, M. 1 ; Maiorca, E. 2 ; Kppeler, F. 3 ; Palmerini, S., E-mail: oscar.trippella@fisica.unipg.it, E-mail: maurizio.busso@fisica.unipg.it 4 + ...

  9. This Week In Petroleum Printer-Friendly Version

    Annual Energy Outlook [U.S. Energy Information Administration (EIA)]

    and e-mails to EIA analysts. In fact, last year an e-mail was circulating around the Internet telling which oil companies imported the most crude oil from Persian Gulf countries...

  10. Search for: All records | SciTech Connect

    Office of Scientific and Technical Information (OSTI)

    Flanagan, anna ., E-mail: sb933@cornell.edu, E-mail: eef3@cornell.edu (1) Save Results Save this search to My Library Excel (limit 2000) CSV (limit 5000) XML (limit 5000) Have ...

  11. Microsoft Word - 4500lnc.dot

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    unless changed by holiday. Mail to: Dept. 3651, MS 0165 Fax to: 844-0645 Email: In your Word document, click on FileSend ToMailRecipientclassads@sandia.gov and click on "send."...

  12. GCPCC home

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Prospective users can contact us via e-mail at hbellamyatlsudotedu or call Henry Bellamy at (225) 578- 9342. We continue to offer mail-in crystallography to both...

  13. Search for: All records | SciTech Connect

    Office of Scientific and Technical Information (OSTI)

    Lomaev, Mikhail I. (3) Shao, Tao, E-mail: st@mail.iee.ac.cn (3) Tarasenko, Victor F. (3) ... bimolecular recombination in polymer solar cells Venkatesan, Swaminathan ; Chen, ...

  14. Search for: All records | SciTech Connect

    Office of Scientific and Technical Information (OSTI)

    ... All Solution-Processed Lead Halide Perovskite-BiVO 4 Tandem Assembly for Photolytic Solar ... ; Wei, Candong, E-mail: weicando@ipbcams.ac.cn ; Jin, Qi, E-mail: zdsys@vip.sina.com ...

  15. Search for: All records | SciTech Connect

    Office of Scientific and Technical Information (OSTI)

    ... Mawr, Pennsylvania 19010-2899 ; Mallory, Frank B. ; Rheingold, Arnold L. ; Rotkina, Lolita ; Wang, Xianlong, E-mail: pbeckman@brynmawr.edu, E-mail: wangxianlong@uestc.edu.cn We ...

  16. Using gold nanorods labelled with antibodies under the photothermal action of NIR laser radiation on Staphylococcus aureus

    SciTech Connect (OSTI)

    Tuchina, E S; Petrov, P O; Kozina, K V; Tuchin, V V; Ratto, F; Pini, R; Centi, S

    2014-07-31

    The effect of NIR laser radiation (808 nm) and gold nanorods on the cells of two strains of Staphylococcus aureus, one of them being methicillin-sensitive and the other being methicillinresistant, is studied. Nanorods having the dimensions 10 × 44 nm with the absorption maximum in the NIR spectral region, functionalised with human immunoglobulins IgA and IgG, are synthesised. It is shown that the use of nanoparticles in combination with NIR irradiation leads to killing up to 97% of the population of microorganisms. (laser biophotonics)

  17. Spatially tracking 13C labeled substrate (bicarbonate) accumulation in microbial communities using laser ablation isotope ratio mass spectrometry

    SciTech Connect (OSTI)

    Moran, James J.; Doll, Charles G.; Bernstein, Hans C.; Renslow, Ryan S.; Cory, Alexandra B.; Hutchison, Janine R.; Lindemann, Stephen R.; Fredrickson, Jim K.

    2014-08-25

    This is a manuscript we would like to submit for publication in Environmental Microbiology Reports. This manuscript contains a description of a laser ablation isotope ratio mass spectrometry methodology developed at PNNL and applied to a microbial system at a PNNL project location Hot Lake, Washington. I will submit a word document containing the entire manuscript with this Erica input request form.

  18. Updates - DOE Directives, Delegations, and Requirements

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Updates by Diane Johnson Email Alerts Subscribe to automatic e-mail notification about updates to the portal. Email Alerts

  19. C:\Forms\HQ F 1410.8.cdr

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    U.S. Department of Energy Notification of Incoming Mail Receipt for Incoming Personal Mail Sender Name: Date Processed: Processed by: (Signature and Date of Person Picking up Mail) Employee Name: Routing Symbol: Room Number: Date Received: HQ F 1410.8 (8-84) HQ F 1410.8 (8-84) Date Contacted: MESSAGE To Sender: Mail must be picked up by: or item will be returned to sender. Part 1 Part 2

  20. Link Alpha G

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    (EESA) Geophysics Department (EESA) GERT - General Employee Radiological Training (English) Gift Acceptance Information Glenn T. Seaborg Center Gmail (Google Mail)...

  1. Eva Stringer | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Administrative Secretary Eva Stringer Telephone 630.252.6889 Fax 630.252.4646 E-mail stringer

  2. Jag Kottapalli | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Jag Kottapalli Jag Kottapalli Jag Kottapalli Undergraduate Student E-mail: jkottapalli@wustl.edu Website: Washington University Undergraduate Students

  3. Ning Kang | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Ning Kang Eng Systems Modeling-Simulation-Analysis 2 E-mail nkang@anl.gov Projects Distribution Automation

  4. Nozomi Shirato | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Assistant Physicst Nozomi Shirato Telephone 630.252.3605 Fax 630.252.5739 E-mail nshirato

  5. Cvetelin Vasilev | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Cvetelin Vasilev Cvetelin Vasilev Cvetelin Vasilev Cvetelin Vasilev Postdoctoral Associate E-mail: c.vasilev@sheffield.ac.uk...

  6. Matthew Cuneo | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Cuneo Matthew Cuneo Matthew Cuneo Instrument Scientist E-mail: cuneomj@ornl.gov Website: Oak Ridge National Lab...

  7. Jeremy King | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Jeremy King Jeremy King Jeremy King Graduate Student E-mail: jdking@wustl.edu Website: Washington University Graduate

  8. Joshua Auld | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Joshua Auld Joshua Auld Principal Computational Transportation Engineer E-mail jauld@anl.gov Website Profile

  9. Joshua Mancini | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Joshua Mancini Joshua Mancini Joshua Mancini Graduate Student E-mail: joshuamancini07@gmail.com Website: University of Pennsylvania

  10. Kathy Vanoskey | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Kathy Vanoskey Administrative Secretary Telephone 630.252.4106 Fax 630. 252.6866 E-mail kvanoskey

  11. Kent Bostick | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Photo of Kent Bostick Kent Bostick Deputy Director of National and Global Security Programs - EGS E-mail kbostick

  12. Khem Acharya | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Khem Acharya Khem Acharya Khem Acharya Alumnus E-mail: khem@k-state.edu Website: Kansas State University

  13. H. Larry Collins | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    H. Larry Collins Director, Intelligence Analysis Division E-mail lcollins@anl.gov Projects Counterintelligence National Security Facility...

  14. Nestor J. Zaluzec | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Nestor J. Zaluzec Senior Materials Scientist Telephone 630.252.4798 E-mail zaluzec@aaem.amc

  15. Supratik Guha | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Supratik Guha NST Division Director Telephone 630.252.7740 Fax 630.252.6866 E-mail sguha

  16. Christine Meyer | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Meyer Christine Meyer Christine Meyer Undergraduate Student E-mail: christinemeyer@wustl.edu Website: Washington University Undergraduate Students

  17. Daniel Oblinsky | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Daniel Oblinsky Daniel Oblinsky Daniel Oblinsky Graduate Student E-mail: doblinsky@gmail.com Website: Princeton University Graduate Students...

  18. Rachel Mirelez | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Administrative Secretary Rachel Mirelez Telephone 630.252.4651 Fax 630.252.6866 E-mail rmirelez

  19. Ravindra Singh | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Ravindra Singh Eng Systems Modeling-Simulation-Analysis 3 E-mail ravindra.singh@anl.gov Projects Distribution Automation

  20. Stuart Feinberg | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    ES&H/QA Coordinator Stuart Feinberg Telephone 630.252.4673 E-mail sfeinberg@anl.gov

  1. Scott Massow | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Scott Massow Assistant Facility Manager Telephone 630.252.4620 E-mail smassow@anl.gov

  2. Naryanan (Bobby) Kasthuri | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Neuroscience Researcher Naryanan (Bobby) Kasthuri Telephone 630.252.4966 Fax 630.252.5739 E-mail bobbykasthuri...

  3. Daniel Weisz | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Weisz Daniel Weisz Daniel Weisz Graduate Student E-mail: daweisz@wustl.edu Website: Washington University in St. Louis

  4. Webmaster

    Broader source: Energy.gov [DOE]

    The Bioenergy Technologies Office always welcomes your feedback and suggestions. Contact us via mail, phone or email.

  5. Gaozhong Shen | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Gaozhong Shen Gaozhong Shen Gaozhong Shen Senior Research Associate E-mail: gxs22@psu.edu Website: Pennsylvania State

  6. Guy Mayneord | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Guy Mayneord Guy Mayneord Guy Mayneord Graduate Student E-mail: gemayneord@sheffield.ac.uk Website: University of Sheffield

  7. Vijaya Subramanian | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Vijaya Subramanian Vijaya Subramanian placeholder image Vijaya Subramanian Postdoctoral Associate E-mail: vijaya65@hotmail.com Postdoctoral Associates

  8. Audit Report: IG-0463 | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    software, including electronic mail, word processing, spreadsheet, database management, application development, statistical analysis, presentation, security and virus protection. ...

  9. Oak Ridge Site Specific Advisory Board Contacts

    Broader source: Energy.gov [DOE]

    Lists Oak Ridge Site Specific Advisory Board contact information including mailing address, phone numbers, and contact email addresses.

  10. Microsoft Word - Current Contact Information2.docx

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Contact Information: Name: Date: Z Number: Home Phone: ( ) Cell Phone: ( ) Work Phone: ( ) Mailing Address: Street or PO Box Apt...

  11. Alec R. Sandy | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Alec Sandy Alec R. Sandy Physicist, Time Resolved Research Group Leader Telephone 630-252-0281 E-mail asandy

  12. Amgad Elgowainy | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Amgad Elgowainy Team Leader/Principal Energy Systems Analyst E-mail aelgowainy@anl.gov Projects Models and Tools

  13. Amit Mandal | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Amit Mandal Amit Mandal Amit Mandal Postdoctoral Research Associate E-mail: mandala@wustl.edu Website: Washington University Postdoctoral

  14. Andrew Ells | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Ells Andrew Ells Andrew Ells Undergraduate Student E-mail: andrew.ells@wustl.edu Website: Washington University

  15. Andrew Novick | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Novick Andrew Novick Andrew Novick Undergraduate Student E-mail: novick@wustl.edu Website: Washington University in St. Louis

  16. Anthony Avarca | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Anthony Avarca Systems Administrator Sr. Telephone 630.252.4940 E-mail aavarca@anl.gov

  17. Studying Altocumulus Plus Virga with Ground-based Active and Passive Remote Sensors Zhien Wang1, Kenneth Sassen2, David Whiteman3, and Belay Demoz3 1University of Maryland, Baltimore County, Catonsville, MD 21228 2University of Alaska, Fairbanks, Alaska 99775 3NASA Goddard Space Flight Center, Greenbelt, MD 20771 E-mail: zhien@agnes.gsfc.nasa.gov

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Energy Study: Environmental Benefits of LEDs Greater Than CFLs Study: Environmental Benefits of LEDs Greater Than CFLs December 9, 2013 - 4:13pm Addthis A three-part Energy Department-funded study indicates LEDs are more environmentally friendly than compact fluorescent and incandescent lights. | Energy Department graphic A three-part Energy Department-funded study indicates LEDs are more environmentally friendly than compact fluorescent and incandescent lights. | Energy Department graphic

  18. DOE HQ F 1410.8 | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    8 DOE HQ F 1410.8 Form used to notify mail recipients that they have mail to be picked up. PDF icon Notification of Incoming Mail More Documents & Publications DOE HQ F 1410.2 Headquarters Facilities Master Security Plan - Chapter 5, Classified Matter Protection and Control DOE F 1500.4

  19. Search for: All records | SciTech Connect

    Office of Scientific and Technical Information (OSTI)

    ... Che, Guang-Bo, E-mail: guangboche@jlnu.edu.cn (1) Chern, I-Liang, E-mail: chern@math.ntu.e... Sciences ; Chern, I-Liang, E-mail: chern@math.ntu.edu.tw ; Department of Mathematics, ...

  20. Sign me up to receive news and event updates

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mailing List Sign me up to receive news and event updates Find out what's happening @ the Bradbury Science Museum by joining our mailing list. Your Name Your Email Additional Comments Reset Submit News & Events Events Calendar Events Mailing List Lecture Videos Newsletter Archive All Issues

  1. Contact Us | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Contact Us Contact Us Postdoctoral Program Lead Kristene (Tina) Henne Phone: 630.252.2907 E-mail: khenne@anl.gov Administrative Support Kathy Eggers Phone: 630.252.6034 E-mail: eggers@anl.gov Mailing Address Argonne National Laboratory Postdoctoral Program Office Building 201, Room 151 9700 South Cass Avenue Argonne, Illinois 60439 U.S.A.

  2. Alumni | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Alumni Alumni Khem Acharya Alumnus E-mail: khem@k-state.edu Peter Adams Alumnus Christine Ajinjeru Alumna Srinivasa Rao Allu Alumnus Woo-Jin An Woo-Jin An Alumnus E-mail: woojinan@wustl.edu Stephen Anthony Alumnus David Armstrong Alumnus Khuram Ashraf Khuram Ashraf Alumnus Angela Barragan Alumnus Hannah Behar Alumna Sasha Berger Alumna E-mail: sashaberger@wustl.edu David Bina David Bina Alumnus E-mail: david.bina@seznam.cz Pratim Biswas Pratim Biswas Alumnus E-mail: pratim.biswas@wustl.edu

  3. 6/17/10 11:48 AM

    Office of Environmental Management (EM)

    8 AM mail 2552×3320 pixels Page 1 of 1 https://mail.google.com/mail/?ui=2&ik=a8112e8de8&view=att&th=12946e1921eda067&attid=0.3&disp=inline&realattid=f_gajudmr22&zw 6/17/10 11:50 AM mail 2552×3340 pixels Page 1 of 1 https://mail.google.com/mail/?ui=2&ik=a8112e8de8&view=att&th=12946e1921eda067&attid=0.5&disp=inline&realattid=f_gajue1sa4&zw 6/17/10 11:50 AM mail 2548×3348 pixels Page 1 of 1

  4. Wire brush fastening device

    DOE Patents [OSTI]

    Meigs, R.A.

    1995-09-19

    A fastening device is provided which is a variation on the conventional nut and bolt. The bolt has a longitudinal axis and threading helically affixed thereon along the longitudinal axis. A nut having a bore extending therethrough is provided. The bore of the nut has a greater diameter than the diameter of the bolt so the bolt can extend through the bore. An array of wire bristles are affixed within the bore so as to form a brush. The wire bristles extend inwardly from the bore and are constructed and arranged of the correct size, length and stiffness to guide the bolt within the bore and to restrain the bolt within the bore as required. A variety of applications of the wire brush nut are disclosed, including a bolt capture device and a test rig apparatus. 13 figs.

  5. Dual-keel electrodynamic maglev system

    DOE Patents [OSTI]

    He, J.L.; Wang, Z.; Rote, D.M.; Coffey, H.T.; Hull, J.R.; Mulcahy, T.M.; Cal, Y.

    1996-12-24

    A propulsion and stabilization system is disclosed with a plurality of superconducting magnetic devices affixed to the dual-keels of a vehicle, where the superconducting magnetic devices produce a magnetic field when energized. The system also includes a plurality of figure-eight shaped null-flux coils affixed to opposing vertical sides of slots in a guideway. The figure-eight shaped null-flux coils are vertically oriented, laterally cross-connected in parallel, longitudinally connected in series, and continue the length of the vertical slots providing levitation and guidance force. An external power source energizes the figure-eight shaped null-flux coils to create a magnetic traveling wave that interacts with the magnetic field produced by the superconducting magnets to impart motion to the vehicle. 6 figs.

  6. Dual-keel electrodynamic maglev system

    DOE Patents [OSTI]

    He, Jianliang; Wang, Zian; Rote, Donald M.; Coffey, Howard T.; Hull, John R.; Mulcahy, Thomas M.; Cal, Yigang

    1996-01-01

    A propulsion and stabilization system with a plurality of superconducting magnetic devices affixed to the dual-keels of a vehicle, where the superconducting magnetic devices produce a magnetic field when energized. The system also includes a plurality of figure-eight shaped null-flux coils affixed to opposing vertical sides of slots in a guideway. The figure-eight shaped null-flux coils are vertically oriented, laterally cross-connected in parallel, longitudinally connected in series, and continue the length of the vertical slots providing levitation and guidance force. An external power source energizes the figure-eight shaped null-flux coils to create a magnetic traveling wave that interacts with the magnetic field produced by the superconducting magnets to impart motion to the vehicle.

  7. Adapter plate assembly for adjustable mounting of objects

    DOE Patents [OSTI]

    Blackburn, Robert S.

    1987-01-01

    An adapter plate and two locking discs are together affixed to an optic table with machine screws or bolts threaded into a fixed array of internally threaded holes provided in the table surface. The adapter plate preferably has two, and preferably parallel, elongated locating slots each freely receiving a portion of one of the locking discs for secure affixation of the adapter plate to the optic table. A plurality of threaded apertures provided in the adapter plate are available to attach optical mounts or other devices onto the adapter plate in an orientation not limited by the disposition of the array of threaded holes in the table surface. An axially aligned but radially offset hole through each locking disc receives a screw that tightens onto the table, such that prior to tightening of the screw the locking disc may rotate and translate within each locating slot of the adapter plate for maximum flexibility of the orientation thereof.

  8. Duct joining system

    DOE Patents [OSTI]

    Proctor, John P. (44 Glen Dr., Fairfax, CA 94930); deKieffer, Robert C. (Boulder, CO)

    2001-01-01

    A duct joining system for providing an air-tight seal and mechanical connection for ducts and fittings is disclosed. The duct joining system includes a flexible gasket affixed to a male end of a duct or fitting. The flexible gasket is affixed at an angle relative to normal of the male end of the duct. The female end of the other duct includes a raised bead in which the flexible gasket is seated when the ducts are properly joined. The angled flexible gasket seated in the raised bead forms an air-tight seal as well as fastens or locks the male end to the female end. Alternatively, when a flexible duct is used, a band clamp with a raised bead is clamped over the female end of the flexible duct and over the male end of a fitting to provide an air tight seal and fastened connection.

  9. Adapter plate assembly for adjustable mounting of objects

    DOE Patents [OSTI]

    Blackburn, R.S.

    1986-05-02

    An adapter plate and two locking discs are together affixed to an optic table with machine screws or bolts threaded into a fixed array of internally threaded holes provided in the table surface. The adapter plate preferably has two, and preferably parallel, elongated locating slots each freely receiving a portion of one of the locking discs for secure affixation of the adapter plate to the optic table. A plurality of threaded apertures provided in the adapter plate are available to attach optical mounts or other devices onto the adapter plate in an orientation not limited by the disposition of the array of threaded holes in the table surface. An axially aligned but radially offset hole through each locking disc receives a screw that tightens onto the table, such that prior to tightening of the screw the locking disc may rotate and translate within each locating slot of the adapter plate for maximum flexibility of the orientation thereof.

  10. Duct Joining System

    DOE Patents [OSTI]

    Proctor, John P. (Fairfax, CA)

    2001-02-27

    A duct joining system for providing an air-tight seal and mechanical connection for ducts and fittings is disclosed. The duct joining system includes a flexible gasket affixed to a male end of a duct or fitting. The flexible gasket is affixed at an angle relative to normal of the male end of the duct. The female end of the other duct includes a raised bead in which the flexible gasket is seated when the ducts are properly joined. The angled flexible gasket seated in the raised bead forms an air-tight seal as well as fastens or locks the male end to the female end. Alternatively, when a flexible duct is used, a band clamp with a raised bead is clamped over the female end of the flexible duct and over the male end of a fitting to provide an air tight seal and fastened connection.

  11. Ball mounting fixture for a roundness gage

    DOE Patents [OSTI]

    Gauler, A.L.; Pasieka, D.F.

    1983-11-15

    A ball mounting fixture for a roundness gage is disclosed. The fixture includes a pair of chuck assemblies oriented substantially transversely with respect to one another and mounted on a common base. Each chuck assembly preferably includes a rotary stage and a wobble plate affixed thereto. A ball chuck affixed to each wobble plate is operable to selectively support a ball to be measured for roundness, with the wobble plate permitting the ball chuck to be tilted to center the ball on the axis of rotation of the rotary stage. In a preferred embodiment, each chuck assembly includes a vacuum chuck operable to selectively support the ball to be measured for roundness. The mounting fixture enables a series of roundness measurements to be taken with a conventional rotating gagehead roundness instrument, which measurements can be utilized to determine the sphericity of the ball. 6 figs.

  12. Embedded wireless sensors for turbomachine component defect monitoring

    DOE Patents [OSTI]

    Tralshawala, Nilesh; Sexton, Daniel White

    2015-11-24

    Various embodiments include detection systems adapted to monitor at least one physical property of a component in a turbomachine. In some embodiments a detection system includes at least one sensor configured to be affixed to a component of a turbomachine, the at least one sensor for sensing information regarding at least one physical property of the turbomachine component during operation of the turbomachine, a signal converter communicatively coupled to the at least one sensor and at least one RF communication device configured to be affixed to a stationary component of the turbomachine, the radio frequency communication device configured to communicate with the at least one signal converter via an RF antenna coupled to the signal converter.

  13. Externally tuned vibration absorber

    DOE Patents [OSTI]

    Vincent, Ronald J.

    1987-09-22

    A vibration absorber unit or units are mounted on the exterior housing of a hydraulic drive system of the type that is powered from a pressure wave generated, e.g., by a Stirling engine. The hydraulic drive system employs a piston which is hydraulically driven to oscillate in a direction perpendicular to the axis of the hydraulic drive system. The vibration absorbers each include a spring or other resilient member having one side affixed to the housing and another side to which an absorber mass is affixed. In a preferred embodiment, a pair of vibration absorbers is employed, each absorber being formed of a pair of leaf spring assemblies, between which the absorber mass is suspended.

  14. Power module packaging with double sided planar interconnection and heat exchangers

    DOE Patents [OSTI]

    Liang, Zhenxian; Marlino, Laura D.; Ning, Puqi; Wang, Fei

    2015-05-26

    A double sided cooled power module package having a single phase leg topology includes two IGBT and two diode semiconductor dies. Each IGBT die is spaced apart from a diode semiconductor die, forming a switch unit. Two switch units are placed in a planar face-up and face-down configuration. A pair of DBC or other insulated metallic substrates is affixed to each side of the planar phase leg semiconductor dies to form a sandwich structure. Attachment layers are disposed on outer surfaces of the substrates and two heat exchangers are affixed to the substrates by rigid bond layers. The heat exchangers, made of copper or aluminum, have passages for carrying coolant. The power package is manufactured in a two-step assembly and heating process where direct bonds are formed for all bond layers by soldering, sintering, solid diffusion bonding or transient liquid diffusion bonding, with a specially designed jig and fixture.

  15. Replica amplification of nucleic acid arrays

    DOE Patents [OSTI]

    Church, George M.

    2002-01-01

    A method of producing a plurality of a nucleic acid array, comprising, in order, the steps of amplifying in situ nucleic acid molecules of a first randomly-patterned, immobilized nucleic acid array comprising a heterogeneous pool of nucleic acid molecules affixed to a support, transferring at least a subset of the nucleic acid molecules produced by such amplifying to a second support, and affixing the subset so transferred to the second support to form a second randomly-patterned, immobilized nucleic acid array, wherein the nucleic acid molecules of the second array occupy positions that correspond to those of the nucleic acid molecules from which they were amplified on the first array, so that the first array serves as a template to produce a plurality, is disclosed.

  16. Ball mounting fixture for a roundness gage

    DOE Patents [OSTI]

    Gauler, Allen L. (Los Alamos, NM); Pasieka, Donald F. (Los Alamos, NM)

    1983-01-01

    A ball mounting fixture for a roundness gage is disclosed. The fixture includes a pair of chuck assemblies oriented substantially transversely with respect to one another and mounted on a common base. Each chuck assembly preferably includes a rotary stage and a wobble plate affixed thereto. A ball chuck affixed to each wobble plate is operable to selectively support a ball to be measured for roundness, with the wobble plate permitting the ball chuck to be tilted to center the ball on the axis of rotation of the rotary stage. In a preferred embodiment, each chuck assembly includes a vacuum chuck operable to selectively support the ball to be measured for roundness. The mounting fixture enables a series of roundness measurements to be taken with a conventional rotating gagehead roundness instrument, which measurements can be utilized to determine the sphericity of the ball.

  17. Wire brush fastening device

    DOE Patents [OSTI]

    Meigs, Richard A.

    1995-01-01

    A fastening device is provided which is a variation on the conventional nut and bolt. The bolt has a longitudinal axis and threading helically affixed thereon along the longitudinal axis. A nut having a bore extending therethrough is provided. The bore of the nut has a greater diameter than the diameter of the bolt so the bolt can extend through the bore. An array of wire bristles are affixed within the bore so as to form a brush. The wire bristles extend inwardly from the bore and are constructed and arranged of the correct size, length and stiffness to guide the bolt within the bore and to restrain the bolt within the bore as required. A variety of applications of the wire brush nut are disclosed, including a bolt capture device and a test rig apparatus.

  18. Single-Chain Antibody Library

    DOE Data Explorer [Office of Scientific and Technical Information (OSTI)]

    Baird, Cheryl

    Researchers at Pacific Northwest National Laboratory (PNNL) have constructed a nonimmune library consisting of 109 human antibody scFv fragments, which have been cloned and expressed on the surface of yeast. Nanomolar-affinity scFvs are routinely obtained by magnetic bead screening and flow cytometric sorting. The yeast library can be amplified 1010 fold without measurable loss of clonal diversity. This allows for indefinite expansion of the library. All scFv clones can be assessed directly on the yeast cell surface by immunofluorescent labeling and flow cytometry, obviating separate subcloning, expression, and purification steps. The ability to use multiplex library screening demonstrates the utility of this approach for high-throughput antibody isolation for proteomic applications. The yeast library may be used for research projects or teaching performed for U.S. Government purposes only. If you would like to request an aliquot of the single-chain antibody library for your research, please print and fill out the Materials Transfer Agreement (MTA) [PDF, 20K]. The website provides the contact information for mailing the MTA. [copied from http://www.sysbio.org/dataresources/singlechain.stm

  19. Plug in to energy-conservation media materials

    SciTech Connect (OSTI)

    Not Available

    1982-06-01

    This compendium of available energy conservation information is based on survey responses from Florida electric and gas utility companies. For each entry is given the title, source, employee contact, audience, availability, whether or not a sample may be obtained, and whether or not the publication can be reprinted. For radio and television spots there is given the length of the spot and whether or not a script may be obtained. Areas covered include: air conditioning, alternate energy sources, appliances and appliances labeling, catalogs, caulking and weatherstripping, checklists and tips, construction, electricity, energy crisis and shortages, energy saving homes, exhibits and displays, fans and ventilation, fireplaces and wood burning stoves, general information, heating, heat pumps, insulation, lighting, load management, local utility information, mobile homes, natural gas, newsletters, pools, residential conservation service and energy audits, safety, solar, solar water heating, speakers bureau, tax credits and rebates, thermostats, utility bills and meters, waste heat recovery, water heating and conservation, and windows and doors. Participating utility companies and their mailing addresses, as well as other energy resources, are listed. (LEW)

  20. Alternative Fuels Data Center

    Alternative Fuels and Advanced Vehicles Data Center [Office of Energy Efficiency and Renewable Energy (EERE)]

    High Occupancy Vehicle (HOV) and High Occupancy Toll (HOT) Lane Exemption Compressed natural gas (CNG), hydrogen, electric, and plug-in hybrid electric vehicles (PHEVs) meeting specified California and federal emissions standards and affixed with a California Department of Motor Vehicles Clean Air Vehicle sticker may use HOV lanes regardless of the number of occupants in the vehicle. White Clean Air Vehicle Stickers are available to an unlimited number of qualifying CNG, hydrogen, and electric

  1. Installation Of Service Connections For Sensors Or Transmitters In Buried Water Pipes

    DOE Patents [OSTI]

    Burnham, Alan K.; Cooper, John F.

    2006-02-21

    A system for installing warning units in a buried pipeline. A small hole is drilled in the ground to the pipeline. A collar is affixed to one of the pipes of the pipeline. A valve with an internal passage is connected to the collar. A hole is drilled in the pipe. A warning unit is installed in the pipe by moving the warning unit through the internal passage, the collar, and the hole in the pipe.

  2. Multipulsed dynamic moire interferometer

    DOE Patents [OSTI]

    Deason, Vance A.

    1991-01-01

    An improved dynamic moire interferometer comprised of a lasing medium providing a plurality of beams of coherent light, a multiple q-switch producing multiple trains of 100,000 or more pulses per second, a combining means collimating multiple trains of pulses into substantially a single train and directing beams to specimen gratings affixed to a test material, and a controller, triggering and sequencing the emission of the pulses with the occurrence and recording of a dynamic loading event.

  3. Multiple acousto-optic q-switch

    DOE Patents [OSTI]

    Deason, Vance A.

    1993-12-07

    An improved dynamic moire interferometer comprised of a lasing medium providing a plurality of beams of coherent light, a multiple q-switch producing multiple trains of 100,000 or more pulses per second, a combining means collimating multiple trains of pulses into substantially a single train and directing beams to specimen gratings affixed to a test material, and a controller, triggering and sequencing the emission of the pulses with the occurrence and recording of a dynamic loading event.

  4. Multiple acousto-optic q-switch

    DOE Patents [OSTI]

    Deason, Vance A.

    1993-01-01

    An improved dynamic moire interferometer comprised of a lasing medium providing a plurality of beams of coherent light, a multiple q-switch producing multiple trains of 100,000 or more pulses per second, a combining means collimating multiple trains of pulses into substantially a single train and directing beams to specimen gratings affixed to a test material, and a controller, triggering and sequencing the emission of the pulses with the occurrence and recording of a dynamic loading event.

  5. QUICK DISCONNECT ELECTRICAL CONNECTOR

    DOE Patents [OSTI]

    None

    1962-08-14

    A remotely actuated quick-dlsconnect electrical connector which comprises a pair of mating portrons releasably retained together by a bayonet- type joint with a rotatable sleeve on one of the mating portions providing for engagement and disengagement of the joint is described. A lanyard with ends passed through fulcrums and affixed to the sleeve erfects rotation of the sleeve and disengages the joint. (AEC)

  6. Attachment L-1 - Entity Certificates

    National Nuclear Security Administration (NNSA)

    3] Attachment L-1 1 ENTITY CERTIFICATE The offeror shall submit evidence to substantiate the authority of the person signing the offer and submit in Volume I of the proposal. CERTIFICATE I, _______________________________________________, certify that I have the signatory authority as the _________________________________________ to sign this offer/contract on behalf of said entity and to bind the entity by the authority of its governing body and within the scope of its powers. Affix the

  7. DE-SOL-0008448

    National Nuclear Security Administration (NNSA)

    4] Attachment L-1 1 ENTITY CERTIFICATE The offeror shall submit evidence to substantiate the authority of the person signing the offer and submit in Volume I of the proposal. CERTIFICATE I, _______________________________________________, certify that I have the signatory authority as the _________________________________________ to sign this offer/contract on behalf of said entity and to bind the entity by the authority of its governing body and within the scope of its powers. Affix the

  8. Environmentally-assisted technique for transferring devices onto non-conventional substrates

    DOE Patents [OSTI]

    Lee, Chi-Hwan; Kim, Dong Rip; Zheng, Xiaolin

    2014-08-26

    A device fabrication method includes: (1) providing a growth substrate including a base and an oxide layer disposed over the base; (2) forming a metal layer over the oxide layer; (3) forming a stack of device layers over the metal layer; (4) performing interfacial debonding of the metal layer to separate the stack of device layers and the metal layer from the growth substrate; and (5) affixing the stack of device layers to a target substrate.

  9. Lightweight armor system and process for producing the same

    DOE Patents [OSTI]

    Chu, Henry S.; Bruck, H. Alan; Strempek, Gary C.; Varacalle, Jr., Dominic J.

    2004-01-20

    A lightweight armor system may comprise a substrate having a graded metal matrix composite layer formed thereon by thermal spray deposition. The graded metal matrix composite layer comprises an increasing volume fraction of ceramic particles imbedded in a decreasing volume fraction of a metal matrix as a function of a thickness of the graded metal matrix composite layer. A ceramic impact layer is affixed to the graded metal matrix composite layer.

  10. Value for controlling flow of cryogenic fluid

    DOE Patents [OSTI]

    Knapp, Philip A.

    1996-01-01

    A valve is provided for accurately controlling the flow of cryogenic fluids such as liquid nitrogen. The valve comprises a combination of disc and needle valves affixed to a valve stem in such a manner that the disc and needle are free to rotate about the stem, but are constrained in lateral and vertical movements. This arrangement provides accurate and precise fluid flow control and positive fluid isolation.

  11. Device for reducing vehicle aerodynamic resistance

    DOE Patents [OSTI]

    Graham, Sean C.

    2005-02-15

    A device for a vehicle with a pair of swinging rear doors, which converts flat sheets of pliable material hinged to the sides of the vehicle adjacent the rear thereof into effective curved airfoils that reduce the aerodynamic resistance of the vehicle, when the doors are closed by hand, utilizing a plurality of stiffeners disposed generally parallel to the doors and affixed to the sheets and a plurality of collapsible tension bearings struts attached to each stiffener and the adjacent door.

  12. Method of manufacturing a heat pipe wick with structural enhancement

    DOE Patents [OSTI]

    Andraka, Charles E.; Adkins, Douglas R.; Moreno, James B.; Rawlinson, K. Scott; Showalter, Steven K.; Moss, Timothy A.

    2006-10-24

    Heat pipe wick structure wherein a stout sheet of perforated material overlays a high performance wick material such as stainless steel felt affixed to a substrate. The inventive structure provides a good flow path for working fluid while maintaining durability and structural stability independent of the structure (or lack of structure) associated with the wick material. In one described embodiment, a wick of randomly laid .about.8 micron thickness stainless steel fibers is sintered to a metal substrate and a perforated metal overlay.

  13. Process for producing elements from a fused bath using a metal strap and ceramic electrode body nonconsumable electrode assembly

    DOE Patents [OSTI]

    Byrne, Stephen C.

    1984-01-01

    A nonconsumable electrode assembly suitable for use in the production of metal by electrolytic reduction of a metal compound dissolved in a molten salt, the assembly comprising a ceramic electrode body and a metal subassembly of a metal conductor rod and at least one metal strap affixed to an end of the rod with opposing portions extending radially outwardly from the rod axis and having the ends of the strap attached to the electrode body.

  14. Microsoft PowerPoint - Copy of Boron-Based nanoPCs.ppt [Compatibility Mode]

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    SRNL has investigated an alternative to conventionally constructed gas-filled PCs using a boron-coated nanostructured array affixed on an insulating substrate to replace the traditional PC wire anode. Use of nanostructures can reduce the required operating voltage by more than 100 times compared to traditional PCs due to the inherently high electrical fields associated with nanoscale anodes. Furthermore, the new model will eliminate the need for scarce resources, making it a more economically

  15. Process for producing elements from a fused bath using a metal strap and ceramic electrode body nonconsumable electrode assembly

    DOE Patents [OSTI]

    Byrne, S.C.

    1984-07-03

    A nonconsumable electrode assembly is described suitable for use in the production of metal by electrolytic reduction of a metal compound dissolved in a molten salt, the assembly comprising a ceramic electrode body and a metal subassembly of a metal conductor rod and at least one metal strap affixed to an end of the rod with opposing portions extending radially outwardly from the rod axis and having the ends of the strap attached to the electrode body. 7 figs.

  16. Fuel cell system configurations

    DOE Patents [OSTI]

    Kothmann, Richard E.; Cyphers, Joseph A.

    1981-01-01

    Fuel cell stack configurations having elongated polygonal cross-sectional shapes and gaskets at the peripheral faces to which flow manifolds are sealingly affixed. Process channels convey a fuel and an oxidant through longer channels, and a cooling fluid is conveyed through relatively shorter cooling passages. The polygonal structure preferably includes at least two right angles, and the faces of the stack are arranged in opposite parallel pairs.

  17. Method and apparatus for staining immobilized nucleic acids

    DOE Patents [OSTI]

    Ramsey, J. Michael; Foote, Robert S.; Jacobson, Stephen C.

    2000-01-01

    A method for staining immobilized nucleic acids includes the steps of affixing DNA probes to a solid substrate, moving target DNA material into proximity with the DNA probes, whereby the target DNA hybridized with specific ones of the DNA probes, and moving a fluorescent dye into proximity with the hybridized target DNA, whereby the fluorescent dye binds to the hybridized DNA to enable subsequent detection of fluorescence.

  18. Heat pipe wick with structural enhancement

    DOE Patents [OSTI]

    Andraka, Charles E.; Adkins, Douglas R.; Moreno, James B.; Rawlinson, K. Scott; Showalter, Steven K.; Moss, Timothy A.

    2003-11-18

    Heat pipe wick structure wherein a stout sheet of perforated material overlays a high performance wick material such as stainless steel felt affixed to a substrate. The inventive structure provides a good flow path for working fluid while maintaining durability and structural stability independent of the structure (or lack of structure) associated with the wick material. In one described embodiment, a wick of randomly laid .about.8 micron thickness stainless steel fibers is sintered to a metal substrate and a perforated metal overlay.

  19. 3-dimensional telepresence system for a robotic environment

    DOE Patents [OSTI]

    Anderson, Matthew O.; McKay, Mark D.

    2000-01-01

    A telepresence system includes a camera pair remotely controlled by a control module affixed to an operator. The camera pair provides for three dimensional viewing and the control module, affixed to the operator, affords hands-free operation of the camera pair. In one embodiment, the control module is affixed to the head of the operator and an initial position is established. A triangulating device is provided to track the head movement of the operator relative to the initial position. A processor module receives input from the triangulating device to determine where the operator has moved relative to the initial position and moves the camera pair in response thereto. The movement of the camera pair is predetermined by a software map having a plurality of operation zones. Each zone therein corresponds to unique camera movement parameters such as speed of movement. Speed parameters include constant speed, or increasing or decreasing. Other parameters include pan, tilt, slide, raise or lowering of the cameras. Other user interface devices are provided to improve the three dimensional control capabilities of an operator in a local operating environment. Such other devices include a pair of visual display glasses, a microphone and a remote actuator. The pair of visual display glasses are provided to facilitate three dimensional viewing, hence depth perception. The microphone affords hands-free camera movement by utilizing voice commands. The actuator allows the operator to remotely control various robotic mechanisms in the remote operating environment.

  20. Solar Newsletters | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Newsletters Solar Newsletters The SunShot Initiative offers e-newsletters to provide up-to-date information about our latest activities and upcoming funding opportunities. The SunShot newsletter provides weekly e-mail updates on solar office activities, events, funding opportunities, and publications. The SunShot concentrating solar power newsletter provides quarterly e-mail updates specific to the CSP industry. Update your subscriptions, modify your password or e-mail address, or stop