National Library of Energy BETA

Sample records for administration mail stop

  1. Electronic Mail Analysis Capability

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    2001-01-08

    Establishes the pilot program to test the Department of Energy (DOE) Electronic Mail Analysis Capability (EMAC), which will be used to monitor and analyze outgoing and incoming electronic mail (e-mail) from the National Nuclear Security Administration (NNSA) and DOE laboratories that are engaged in nuclear weapons design or work involving special nuclear material. No cancellation.

  2. Mailing List Subscription

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mail and Distribution Mail and Distribution The DOE Mail Center provides a variety of mail services for all official and other authorized mail for the Department of Energy and its employees. The services provided include the processing of all incoming postal mail, outgoing official mail, internal mail processing, accountable mail processing, pouch mail, a variety of overnight express mail services, directory services, and pick-up and delivery services. The Mail Management Memorandum (pdf)

  3. Mail Services User's Guide

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    2005-10-03

    This Guide provides information on using Department of Energy (DOE) mail services in accordance with U.S. Postal Service, General Services Administration (GSA), and DOE regulations. Cancels DOE M 573.1-1. Canceled by DOE N 251.89.

  4. Minutes from the January 10, 2013 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    January 10, 2013 Mail discussion Al Majors opened the meeting by discussing the Mail Management Report and latest update on status. One final report is yet to be submitted, after which close out will be accomplished. Copies will be provided to the Mail Managers once completed. Al introduced Derrick Miliner, Program Manager from the General Services Administration, Office of Government-wide Policy, and acknowledged Mr. Miliner's role in completing the Mail Management Report. Mail Security Plans A

  5. Minutes from the Print and Mail Managers Exchange Forum Teleconferences

    Broader source: Energy.gov [DOE]

    Minutes from the Print and Mail Managers Exchange Forum Teleconferences.  Contact the Office of Administrative Management and Support at (202) 586-4318 with any questions.

  6. Mail Services User's Manual

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    2000-07-12

    This Manual provides detailed information on using the Department of Energy (DOE) mail services. Canceled by DOE G 573.1-1.

  7. mail_paycheck_111609

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Updated:
11/16/09
 P.O Box 1663 Los Alamos, New Mexico 87544 MAIL PAYCHECK FORM TO: CRAFT PAYROLL DEPARTMENT - P238 FROM: (Please Print) Z# ORG CODE PLEASE MAIL MY PAYCHECK, TO THE ADDRESS ON FILE WITH PAYROLL, FOR THE PAY PERIOD BEGINNING: EMPLOYEE SIGNATURE Z# DATE SUPERVISOR SIGNATURE Z# DATE

  8. Alternative Fuels Data Center: Truck Stop Electrification Site Data

    Alternative Fuels and Advanced Vehicles Data Center [Office of Energy Efficiency and Renewable Energy (EERE)]

    Collection Methods Tools Printable Version Share this resource Send a link to Alternative Fuels Data Center: Truck Stop Electrification Site Data Collection Methods to someone by E-mail Share Alternative Fuels Data Center: Truck Stop Electrification Site Data Collection Methods on Facebook Tweet about Alternative Fuels Data Center: Truck Stop Electrification Site Data Collection Methods on Twitter Bookmark Alternative Fuels Data Center: Truck Stop Electrification Site Data Collection Methods

  9. Request Repository Mailing List

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Policies User Surveys NERSC Users Group User Announcements Help Staff Blogs Request Repository Mailing List Operations for: Passwords & Off-Hours Status 1-800-66-NERSC, option 1 or 510-486-6821 Account Support https://nim.nersc.gov accounts@nersc.gov 1-800-66-NERSC, option 2 or 510-486-8612 Consulting http://help.nersc.gov consult@nersc.gov 1-800-66-NERSC, option 3 or 510-486-8611 Home » For Users » Request Repository Mailing List Request Repository Mailing List Use this form to request a

  10. Mail and Distribution | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Mail and Distribution Mail and Distribution The DOE Mail Center provides a variety of mail services for all official and other authorized mail for the Department of Energy and its employees. The services provided include the processing of all incoming postal mail, outgoing official mail, internal mail processing, accountable mail processing, pouch mail, a variety of overnight express mail services, directory services, and pick-up and delivery services. The Mail Management Memorandum (pdf)

  11. By Certified Mail May

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    By Certified Mail May 4,2012 Dorothy Riehle FOIA Office U.S. Department of Energy P. O. Box 550 Richland, WA 99352 Re: FOIA RequestLand Transfer Dear Ms. Riehle: Pursuant to the...

  12. By E-Mail

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    By E-Mail May 29, 2012 Dorothy Riehle FOIA Office U.S. Department of Energy P. O. Box 550 Richland, WA 99352 Re: FOIA RequestTank Inventories Dear Ms. Riehle: Pursuant to the...

  13. Minutes from the November 01, 2012 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    November 1, 2012 Mail discussion Al Majors opened the meeting by introducing Derrick Milner, Program Manager from the General Services Administration, Office of Government-wide Policy. Mr. Majors and Mr. Miliner discussed the pending Official Mail Management Report for the FY-2012. The question on where to put data relating to certified and registered mail was addressed. It should be placed under the others section or under first class, standard delivery. Mr. Majors also discussed the pending

  14. Mail Services | The Ames Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mail Management Memorandum, July 2, 2010 Mail Management Memorandum, July 2, 2010 Mail Management Memorandum prescribing policy and requirements for the effective, economical, and secure management of incoming, internal, and outgoing mail in Federal agencies. These requirements pertain to all DOE offices, and may also apply to national laboratories and other contractor facilities, depending on whether they qualify as Federal facilities as defined in the regulations. PDF icon Mail Management

  15. PDSF Mailing Lists

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mailing Lists PDSF Mailing Lists pdsf-status@nersc.gov This is voluntary. You have to subscribe to it. This list can be chatty, since major and minor problems are sent to this list. Also multiple status updates will be sent for extended outages. Subscribe: Send email to pdsf-status-request@nersc.gov with subscribe in the subject of the message. Unsubscribe: Send email to pdsf-status-request@nersc.gov with unsubscribe in the subject of the message. pdsf-users@nersc.gov Users are subscribed to

  16. Administration

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    the Administrator of the Bonneville Power Administration Reprinted from the Annual Report of the Secretary of the Interior for the Fiscal * Year ended June 30; 1944 Bonneville...

  17. Alternative Fuels Data Center: Truck Stop Electrification for Heavy-Duty

    Alternative Fuels and Advanced Vehicles Data Center [Office of Energy Efficiency and Renewable Energy (EERE)]

    Trucks Truck Stop Electrification for Heavy-Duty Trucks to someone by E-mail Share Alternative Fuels Data Center: Truck Stop Electrification for Heavy-Duty Trucks on Facebook Tweet about Alternative Fuels Data Center: Truck Stop Electrification for Heavy-Duty Trucks on Twitter Bookmark Alternative Fuels Data Center: Truck Stop Electrification for Heavy-Duty Trucks on Google Bookmark Alternative Fuels Data Center: Truck Stop Electrification for Heavy-Duty Trucks on Delicious Rank Alternative

  18. Alternative Fuels Data Center: U.S. Truck Stop Electrification Locations

    Alternative Fuels and Advanced Vehicles Data Center [Office of Energy Efficiency and Renewable Energy (EERE)]

    Conserve Fuel Printable Version Share this resource Send a link to Alternative Fuels Data Center: U.S. Truck Stop Electrification Locations to someone by E-mail Share Alternative Fuels Data Center: U.S. Truck Stop Electrification Locations on Facebook Tweet about Alternative Fuels Data Center: U.S. Truck Stop Electrification Locations on Twitter Bookmark Alternative Fuels Data Center: U.S. Truck Stop Electrification Locations on Google Bookmark Alternative Fuels Data Center: U.S. Truck Stop

  19. Administrative

    Broader source: Energy.gov [DOE]

    The Office of Management provides many of the administrative services that keep the Department of Energy operational.  These functions are primarily provided by the Office of Administration, MA-40,...

  20. Mailing List Subscription

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mailing List Subscription Jefferson Lab Home Search Contact JLab Descriptions A - C autocad: No description available briefs: On-Target Briefs cctest-alert: No description available clas_drift_chambers: Hall B Drift Chambers Group clas_offline: Discussion group for CLAS RECSIS group clas_slow_control: CLAS slow control working group clas_strangep: Hall B Strange Particles using CLAS discussion group clas_tof: CLAS Time of Flight Collaboration credit-card: List of JLab Credit Card buyers csc_all:

  1. Printing and Mail Managers Exchange Forum Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    May 16, 2013 Mail discussion Joe Whitford opened the meeting by introducing Al Majors to talk about mail related items. 1) Update on the USPS mail name changes. If approved by the Postal Regulatory Commission the following name changes will go into effective July 28, 2013: a. Express Mail will be called Priority Mail Express b. Express Mail International will be Priority Mail International c. Express Mail Corporate Account will become USPS Express Corporate Account Only the names of these

  2. Full Hybrid: Stopped

    Alternative Fuels and Advanced Vehicles Data Center [Office of Energy Efficiency and Renewable Energy (EERE)]

    Braking button Stopped button STOPPED When the vehicle is stopped, such as at a red light, the gasoline engine and electric motor shut off automatically so that energy is not wasted in idling. All other systems, including the electric air conditioning, continue to run. stage graphic: vertical blue rule Main stage: See through car with battery, engine, generator, power split device, and electric motor visible. the car is stopped at an intersection. Main stage: See through car with battery,

  3. LLNL E-Mail Utilities

    Energy Science and Technology Software Center (OSTI)

    2005-10-31

    The LLNL E-mail Utilities software library is a Java API that simplifies the creation and delivery of email in Java business applications. It consists of a database-driven template engine, various strategies for composing, queuing, dispatching email and a Java Swing GUI for creating and editing email templates.

  4. U.S. DEPARTMENT OF ENERGY RECEIPT FOR CONTROLLED MAIL PARCEL SERVICE

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    HQ F 1410.2 (06-93) U.S. DEPARTMENT OF ENERGY RECEIPT FOR CONTROLLED MAIL PARCEL SERVICE (Receipt No.) MAIL STATION: DATE: TO: NAME: ROUTING SYMBOL: FROM: DOE Mail Facility, Office of Administration Services 1. 2. 3. 4. 5. 6. 7. 8. 9. 10. 11. 12. 13. 14. 15. 16. 17. 18. ITEM NO. ITEM NO. ITEM NO. SIGN AND RETURN WITHIN 24 HOURS TO AVOID TRACER ACTION TO DOE MAIL FACILITY (Stamp Location) RECEIVED BY: DATE: Printed with soy ink on recycled paper

  5. Stop/Start: Overview

    Alternative Fuels and Advanced Vehicles Data Center [Office of Energy Efficiency and Renewable Energy (EERE)]

    highlighted Driving button Braking button subbanner graphic: gray bar OVERVIEW Stop/Start hybrids are not true hybrids since electricity from the battery is not used to propel the vehicle. However, the Stop/Start feature is an important, energy-saving building block used in hybrid vehicles. Stop/Start technology conserves energy by shutting off the gasoline engine when the vehicle is at rest, such as at a traffic light, and automatically re-starting it when the driver pushes the gas pedal to go

  6. Mail Management Memorandum, July 2, 2010 | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Mail Management Memorandum, July 2, 2010 Mail Management Memorandum, July 2, 2010 Mail Management Memorandum prescribing policy and requirements for the effective, economical, and ...

  7. Minutes from the Print and Mail Managers Exchange Forum Teleconference...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Minutes from the Print and Mail Managers Exchange Forum Teleconferences Minutes from the Print and Mail Managers Exchange Forum Teleconferences Minutes from the Print and Mail...

  8. Sneaky light stop

    DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

    Eifert, Till; Nachman, Benjamin

    2015-02-20

    A light supersymmetric top quark partner (stop) with a mass nearly degenerate with that of the standard model (SM) top quark can evade direct searches. The precise measurement of SM top properties such as the cross-section has been suggested to give a handle for this ‘stealth stop’ scenario. We present an estimate of the potential impact a light stop may have on top quark mass measurements. The results indicate that certain light stop models may induce a bias of up to a few GeV, and that this effect can hide the shift in, and hence sensitivity from, cross-section measurements. Duemore » to the different initial states, the size of the bias is slightly different between the LHC and the Tevatron. The studies make some simplifying assumptions for the top quark measurement technique, and are based on truth-level samples.« less

  9. Quick stop device

    DOE Patents [OSTI]

    Hipwell, Roger L. (35 Hounds Ditch La., Duxbury, MA 02332); Hazelton, Andrew J. (3877 Army St., San Francisco, CA 94131)

    1996-01-01

    A quick stop device for abruptly interrupting the cutting of a workpiece by a cutter is disclosed. The quick stop device employs an outer housing connected to an inner workpiece holder by at least one shear pin. The outer housing includes an appropriate shank designed to be received in the spindle of a machine, such as a machine tool. A cutter, such as a drill bit, is mounted in a stationary position and the workpiece, mounted to the workpiece holder, is rotated during engagement with the cutter. A trigger system includes at least one spring loaded punch disposed for movement into engagement with the workpiece holder to abruptly stop rotation of the workpiece holder. This action shears the shear pin and permits continued rotation of the spindle and outer housing without substantially disturbing the chip root formed during cutting.

  10. Field Facilities Contacts for Printing and Mail

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Field Facilities Contacts for Printing and Mail Print and Mail Contacts Site Printing Contact Mail Contact NNSA, Albuquerque Deborah Miller (505) 845-6049 Thomas H. Clinkenbeard NNSA Service Center PO Box 5400 Albuquerque, NM 87185-5400 (505) 845-4602 tclinkenbeard@doeal.gov (mailto:tclinkenbeard@doeal.gov) Argonne National Laboratory Doreen Schoening Argonne National Laboratory U.S. Department of Energy 9700 South Cass Avenue Blvd 340 Lemonmt, IL 60439 (630) 840-6399 dschoening@anl.gov

  11. Printing and Mail Managers Exchange Forum Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    November 21, 2013 Mail Managers discussion Joe Whitford opened the meeting by introducing Tony Nellums to talk about mail related items. 1) Mr. Nellums introduced Derek Milner, Policy Advisor from the GSA Office of Government-wide policy. a. Mr. Milner stated that he is being replaced as primary policy contact by Linda Willoughby (Linda.Willoughby@gsa.gov) or (202) 219-1083. b. Initiatives discussed by Mr. Milner included: Upcoming mail reports. The SMART system is online and available now.

  12. Labs Race to Stop Iran"

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    New York Times covers "National Labs Race to Stop Iran" May 15, 2015 National labs race to stop Iran Given the stakes in the sensitive negotiations with Iran, the labs would...

  13. Sign Up for E-mail Updates | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    Sign Up for E-mail Updates Materials Sciences and Engineering (MSE) Division MSE Home About Staff What's New Research Areas Reports and Activities Science Highlights Principal Investigators' Meetings BES Home What's New Sign Up for E-mail Updates Print Text Size: A A A FeedbackShare Page The Division has a "Dear Colleague" email list, which is used to circulate general information such as funding opportunity announcements and administrative information such as position openings. To

  14. About EIA - Organization - U.S. Energy Information Administration...

    Annual Energy Outlook [U.S. Energy Information Administration (EIA)]

    John Conti is the Assistant Administrator for Energy Analysis and analyzes energy supply, demand, and prices including the impact of financial markets... Read more > E-mail: ...

  15. Field Facilities Contacts for Printing and Mail | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Field Facilities Contacts for Printing and Mail Field Facilities Contacts for Printing and Mail This is the list of DOE field facilities contacts for Printing and Mail as of April 27, 2011. Go to Mail Services Go to Printing Services PDF icon Field_Facilities_Contacts_Print-Mail.pdf More Documents & Publications Director's Perspective by George Miller Tenant Education and Training Fire Safety Committee Membership List

  16. Read Your E-mail | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Read Your E-mail All Argonne employees can read their e-mail through the web. Argonne E-Mail service is a robust, reliable electronic communication solution for supporting day-to-day business activities. Features include e-mail, calendar, task lists, and contact lists. While it is designed to work Microsoft Outlook, it also works with other POP- and IMAP-based clients. All employees can read their e-mail through the web. Use the login link at right to get started. Login to E-mail

  17. Contact Us | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    For general information about NNSA, please feel free to contact us: Mailing Address National Nuclear Security Administration U.S. Department of Energy 1000 Independence Ave., S.W. ...

  18. T-618: Debian update for exim4: Mail Transport Agent

    Broader source: Energy.gov [DOE]

    It was discovered that Exim, the default mail transport agent in Debian, uses DKIM data obtain from DNS directly in a format string, potentially allowing malicious mail senders to execute arbitrary code.

  19. Mixing stops at the LHC

    DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

    Agrawal, Prateek; Frugiuele, Claudia

    2014-01-01

    We study the phenomenology of a light stop NLSP in the presence of large mixing with either the first or the second generation. R-symmetric models provide a prime setting for this scenario, but our discussion also applies to the MSSM when a significant amount of mixing can be accommodated. In our framework the dominant stop decay is through the flavor violating mode into a light jet and the LSP in an extended region of parameter space. There are currently no limits from ATLAS and CMS in this region. We emulate shape-based hadronic SUSY searches for this topology, and find thatmore » they have potential sensitivity. If the extension of these analyses to this region is robust, we find that these searches can set strong exclusion limits on light stops. If not, then the flavor violating decay mode is challenging and may represent a blind spot in stop searches even at 13 TeV. Thus, an experimental investigation of this scenario is well motivated.« less

  20. Stopping power: Effect of the projectile deceleration

    SciTech Connect (OSTI)

    Kompaneets, Roman Ivlev, Alexei V.; Morfill, Gregor E.

    2014-11-15

    The stopping force is the force exerted on the projectile by its wake. Since the wake does not instantly adjust to the projectile velocity, the stopping force should be affected by the projectile deceleration caused by the stopping force itself. We address this effect by deriving the corresponding correction to the stopping force in the cold plasma approximation. By using the derived expression, we estimate that if the projectile is an ion passing through an electron-proton plasma, the correction is small when the stopping force is due to the plasma electrons, but can be significant when the stopping force is due to the protons.

  1. Obama Administration's Rural Tour Stops in Western Alaska | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    to Zanesville, OH, to discuss green jobs and a new energy economy, with a focus on renewable energies. AUGUST 17TH Secretaries Arne Duncan and Tom Vilsack will travel to Hamlet,...

  2. Obama Administration's Rural Tour Stops in Western Alaska | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ... On August 3, 2006, a fire destroyed thirty-five structures including twelve homes, an elementary school and high school, a teacher housing complex, stores, offices and storage ...

  3. Apparatus for stopping a vehicle

    DOE Patents [OSTI]

    Wattenburg, Willard H.; McCallen, David B.

    2007-03-20

    An apparatus for externally controlling one or more brakes on a vehicle having a pressurized fluid braking system. The apparatus can include a pressurizable vessel that is adapted for fluid-tight coupling to the braking system. Impact to the rear of the vehicle by a pursuit vehicle, shooting a target mounted on the vehicle or sending a signal from a remote control can all result in the fluid pressures in the braking system of the vehicle being modified so that the vehicle is stopped and rendered temporarily inoperable. A control device can also be provided in the driver's compartment of the vehicle for similarly rendering the vehicle inoperable. A driver or hijacker of the vehicle preferably cannot overcome the stopping action from the driver's compartment.

  4. NREL: Transportation Research - Truck Stop Electrification Testing

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Truck Stop Electrification Testing Photo of series of truck stop electrification pedestals near highway with heavy-duty truck parked in the background. NREL is monitoring the use of truck stop electrification sites across the nation. Photo courtesy of Shorepower Technologies NREL's fleet test and evaluation team is evaluating and documenting the use of 50 truck stop electrification (TSE) sites along the busiest transportation corridors in the United States. Truck drivers typically idle their

  5. Minutes from the January 19, 2011 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    January 2010 Printing and Mail Managers Exchange Forum Teleconference Twenty-one individuals participated in the Printing and Mail Managers Exchange Forum, which included Printing and Mail Managers and Contractors Comments/Additions to last Months Minutes No comments. Printing Agenda Items......... Update on the Department-wide FY-2010 Three-Year Plan Dallas Woodruff, Headquarters in formed the group that the Department-wide Printing and Publishing Activities is currently in the concurrence

  6. Minutes from the January 20, 2010 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    , 2010 Printing and Mail Managers Exchange Forum Teleconference Twenty-one individuals participated in the Printing and Mail Managers Exchange Forum, which included Printing and Mail Managers and Contractors. Comments/Additions to last Months Minutes Dallas Woodruff, Headquarters opened the meeting by thanking everyone for participating in the today's teleconference. Printing Agenda Items... Update on the Department-wide Printing and Publishing Activities Report Three-Year Plan. Dallas Woodruff,

  7. Minutes from the July 21, 2010 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    July 21, 2010 Printing and Mail Managers Exchange Forum Teleconference Twenty-one individuals participated in the Printing and Mail Managers Exchange Forum, which included Printing and Mail Managers and Contractors. Comments/Additions to last Months Minutes Dallas Woodruff, Headquarters opened the meeting by thanking everyone for participating in the today's teleconference. Printing Agenda Items... Update on the Government Printing Office revisions to the Standard Form one (SF!), Twenty-five

  8. Minutes from the June 28, 2012 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    June 28, 2012 Mail discussion Al Majors opened the meeting by introducing United Parcel Service (UPS) Representative Shelly Scott. Ms. Scott's contact information is: Shelly Scott shellyscott@ups.com 404 402-9827 (cell) Ms. Scott discussed issues relating to various UPS services available to the department. Next Al introduced Michael R. Sanders, President and Chief Executive Officer of Intra-Mail Network, an innovative, information Technology Company that improves the delivery of mail or email

  9. Minutes from the May 26, 2010 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    26, 2010 Printing and Mail Managers Exchange Forum Teleconference Seventeen individuals participated in the Printing and Mail Managers Exchange Forum, which included Printing and Mail Managers and Contractors. Comments/Additions to last Months Minutes Dallas Woodruff, Headquarters opened the meeting by thanking everyone for participating in the today's teleconference. Printing Agenda Items... Update on the FY 2010, Congressional Joint Committee on Printing Commercial Printing Report "JCP

  10. Minutes from the November 17, 2010 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    November 17, 2010 Printing and Mail Managers Exchange Forum Teleconference Twenty seven individuals participated in the Printing and Mail Managers Exchange Forum, which included Printing and Mail Managers and Contractors Comments/Additions to last Months Minutes No comments. Printing Agenda Items......... Update on the Department-wide "Three-Year Plan" Dallas Woodruff, Headquarters opened the meeting by thanking everyone for providing their sites Three-Year Plan data to Headquarters in

  11. Minutes from the September 15, 2010 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    September 15, 2010 Printing and Mail Managers Exchange Forum Teleconference Twenty-four individuals participated in the Printing and Mail Managers Exchange Forum, which included Printing and Mail Managers and Contractors. Comments/Additions to last Months Minutes Dallas Woodruff, Headquarters opened the meeting by thanking everyone for participating in the today's teleconference. Printing Agenda Items... Upcoming FY 2010 Department-wide Three-Year Plan Dallas Woodruff, Headquarters informed the

  12. Headquarters Program & Staff Office Mailing Addresses | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Headquarters Program & Staff Office Mailing Addresses Headquarters Program & Staff Office Mailing Addresses The following addresses are for delivery of regular mail and small packages: Delivery to the Headquarters buildings in Washington, DC: Name of Individual Title Routing Symbol/Forrestal Building U.S. Department of Energy 1000 Independence Ave., S.W. Washington, DC 20585 Name of Individual Title Routing Symbol/L'Enfant Plaza Building U.S. Department of Energy 1000

  13. NNSA-developed simulation seeks to understand and stop terrorist

    National Nuclear Security Administration (NNSA)

    recruitment | National Nuclear Security Administration NNSA-developed simulation seeks to understand and stop terrorist recruitment Friday, April 29, 2016 - 11:14am NNSA Blog As NNSA verifies and maintains the U.S. nuclear deterrent without underground explosive nuclear testing, computer simulation has become a key capability and a vital part of the nuclear security enterprise. By modeling the extreme physics that make up nuclear reactions, scientists can ensure our stockpile is safe,

  14. Mail-Order Metal-Organic Frameworks (MOFs): Designing Isoreticular...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mail-Order Metal-Organic Frameworks (MOFs): Designing Isoreticular MOF-5 Analogues Comprising Commercially Available Organic Molecules Previous Next List R. L. Martin, L.-C. Lin,...

  15. Minutes from the May 3, 2012 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    http:www.gsa.govmailpolicy (for training options) https:www.intra-mail.com ... discussion Brainstorming discussion on methodsapproaches to reduce printing expenses: ...

  16. Quality Procedure - Stop Work | Department of Energy

    Energy Savers [EERE]

    Stop Work Quality Procedure - Stop Work This Quality Procedure establishes the Office of Standards and Quality Assurance authority, responsibilities, and instructions to direct that unsafe work be stopped, during the execution and operations of its activities, specifically in oversight activities. this procedure is utilized and accomplished upon coordination with management of the Environmental Management (EM) Headquarters and Field Office. This procedure also provides provisions for the restart

  17. U.S. Works With Kazakhstan to Stop Nuclear and Radioactive Material

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Smuggling | Department of Energy Works With Kazakhstan to Stop Nuclear and Radioactive Material Smuggling U.S. Works With Kazakhstan to Stop Nuclear and Radioactive Material Smuggling May 6, 2006 - 10:34am Addthis WASHINGTON, DC - As part of the overall U.S. strategy to prevent nuclear and dangerous radiological materials from falling into the hands of terrorists, the Department of Energy's National Nuclear Security Administration (NNSA) announced today that an agreement with the government

  18. Southwestern Power Administration

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Contact Us U.S. Department of Energy Southwestern Power Administration Gore Maintenance Office Mailing Address: P.O. Box 728 Gore, OK 74435-0728 Delivery Address: 14165 East 143rd Street South Gore, OK 74435-5353 Voice: 918-489-5582 / Fax: 918-489-5527 Jonesboro Maintenance Office 305 North Floyd Street Jonesboro, AR 72401-1908 Voice: 870-972-4686 / Fax: 870-932-6153 Springfield Maintenance & Operations 2858 South Golden Avenue Springfield, MO 65807-3213 Maintenance Office Voice:

  19. Minutes from the October 26, 2011 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Woodruff also said the files are due back to Headquarters no later November 11, 2011, and the report is due to congress by February 10, 2012. Mail Agenda Items...... Fiscal ...

  20. The Future of Electric Vehicles and Arizona State University's MAIL

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Battery | Department of Energy The Future of Electric Vehicles and Arizona State University's MAIL Battery The Future of Electric Vehicles and Arizona State University's MAIL Battery August 11, 2010 - 4:26pm Addthis Cody Friesen and his team at Arizona State University | Photo Credit Arizona State University Cody Friesen and his team at Arizona State University | Photo Credit Arizona State University Andy Oare Andy Oare Former New Media Strategist, Office of Public Affairs What does this

  1. Minutes from the March 14, 2013 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    March 14, 2013 Mail discussion Al Majors is on leave today. Ellsworth Howell Jr. and Tony Nellums are sitting for Al. There are no agenda items for the Mail portion. A discussion period for questions, comments, or suggestions was opened without response Printing discussion Discussed suggestions for reducing printing expenses Presidential Executive Order 13589 and reducing hard copy printing in favor of electronic publishing Sec. 5. Printing. Agencies are encouraged to limit the publication and

  2. Boondocks Truck Stop Wind Farm | Open Energy Information

    Open Energy Info (EERE)

    In Service Owner Boondocks Truck Stop Energy Purchaser Boondocks Truck Stop Location IA Coordinates 42.4703, -93.5624 Show Map Loading map... "minzoom":false,"mappingservi...

  3. Contact Us | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    Contact Us If you have questions about activities at the Sandia Field Office, please contact the SFO Public Affairs Director at (505) 845-5264. Our mailing address is: U. S. Department of Energy, National Nuclear Security Administration, Sandia Field Office, P.O. Box 5400, Albuquerque, NM 87185

  4. Mailing Addresses and Information Numbers for Operations, Field, and Site

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Offices | Department of Energy About Energy.gov » Mailing Addresses and Information Numbers for Operations, Field, and Site Offices Mailing Addresses and Information Numbers for Operations, Field, and Site Offices Name Telephone Number U.S. Department of Energy Ames Site Office 111 TASF, Iowa State University Ames, Iowa 50011 515-294-9557 U.S. Department of Energy Argonne Site Office 9800 S. Cass Avenue Argonne, IL 60439 630-252-2000 U.S. Department of Energy Berkeley Site Office Berkeley

  5. This form may be submitted to the EIA by mail, fax, e-mail, or...

    U.S. Energy Information Administration (EIA) Indexed Site

    under the Federal Energy Administration Act of 1974 (Public Law 93-275). Failure to comply may result in criminal fines, civil penalties and other sanctions as provided by law. ...

  6. Epoxy bond and stop etch fabrication method

    DOE Patents [OSTI]

    Simmons, Jerry A.; Weckwerth, Mark V.; Baca, Wes E.

    2000-01-01

    A class of epoxy bond and stop etch (EBASE) microelectronic fabrication techniques is disclosed. The essence of such techniques is to grow circuit components on top of a stop etch layer grown on a first substrate. The first substrate and a host substrate are then bonded together so that the circuit components are attached to the host substrate by the bonding agent. The first substrate is then removed, e.g., by a chemical or physical etching process to which the stop etch layer is resistant. EBASE fabrication methods allow access to regions of a device structure which are usually blocked by the presence of a substrate, and are of particular utility in the fabrication of ultrafast electronic and optoelectronic devices and circuits.

  7. Labs Race to Stop Iran"

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    New York Times covers "National Labs Race to Stop Iran" May 15, 2015 National labs race to stop Iran Given the stakes in the sensitive negotiations [with Iran], the labs would check and recheck one another, making sure the answers held up. The natural rivalries among the labs sometimes worked to the negotiators' advantage: Los Alamos National Laboratory, in the mountains of New Mexico, the birthplace of the bomb, was happy to find flaws in calculations done elsewhere, and vice versa.

  8. E-mail et Web : pour une navigation sans risque

    ScienceCinema (OSTI)

    None

    2011-10-06

    Présentation orale en français, support visuel en anglais. À travers des exemples concrets, vous consoliderez vos connaissances et pourrez ainsi réajuster vos habitudes concernant l?utilisation sécurisée de votre boîte e-mail et de votre navigateur Web.

  9. About EIA - Organization - U.S. Energy Information Administration (EIA)

    Gasoline and Diesel Fuel Update (EIA)

    Gina Pearson Gina PearsonPrint-friendly PDF Assistant Administrator for Communications E-mail: gina.pearson@eia.gov Phone: (202) 586-6537 Room: 2G-090 Address: U.S. Energy Information Administration 1000 Independence Avenue, S.W. Washington, DC 20585 Duties Gina Pearson is the Assistant Administrator (AA) for Communications, and in this capacity provides leadership and direction to conduct the U.S. Energy Information Administration's comprehensive communications program for diverse external

  10. U.S. Department of Energy National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    U.S. Department of Energy National Nuclear Security Administration 2009 Report to the President Executive Order 13171 on Hispanic Employment DOE Program Office/Site:_________________National Nuclear Security Administration Human Resources Director:____________________________________ David Amaral Diversity and Outreach Manager:______________________________Mary Ann Fresco EEO & Diversity Program Manager:______________________________Yolanda Girón Submission Contact E-mail

  11. Oil Stop Valve : Oil Spill Containment Research and Development Project.

    SciTech Connect (OSTI)

    Bourn, Robert D.

    1982-07-01

    This report summarizes the research and development project conducted by the Civil Engineering Section, Division of Substation and Control Engineering, to determine the effectiveness of the oil stop valve for use in the Bonneville Power Administration's Oil Spill Containment and Countermeasure Program. The most attractive alternative to lagoons and separator tanks was found in the oil stop valve manufactured by AFL/Clark Industries of Riviera Beach, Florida. This small, direct-acting and relatively inexpensive valve requires little maintenance and can either be employed independently, using existing drain lines for effluent storage, or in conjunction with oil separator tanks and lagoon systems. The AFL/Clark valve requires no power and has only one moving part, a ballasted float having a specific gravity between that of oil and water. In water, the float rides above the throat of the discharge pipe allowing water to flow out. When oil enters the water the float begins losing its relative bouyancy and sinks until it seats itself over the throat of the outlet, closing the valve. Usually installed in a manhole within a typical storm drainage system, the valve backs spilled oil into drainways and contains it for temporary storage within the switchyard.

  12. V-147: IBM Lotus Notes Mail Client Lets Remote Users Execute...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    7: IBM Lotus Notes Mail Client Lets Remote Users Execute Java Applets V-147: IBM Lotus Notes Mail Client Lets Remote Users Execute Java Applets May 2, 2013 - 6:00am Addthis...

  13. Mail-Order Metal-Organic Frameworks (MOFs) | Center for Gas

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    SeparationsRelevant to Clean Energy Technologies | Blandine Jerome Mail-Order Metal-Organic Frameworks (MOFs)

  14. Minutes from the February 23, 2012 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Minutes Printing and Mail Managers Exchange Forum Teleconference February 23, 2012 Participants: Headquarters (5) National Energy Technology Laboratory, PA National Security Complex Y-12 (2) Oak Ridge National Laboratory Y-12 Site Office (2) Hanford Site Office Oak Ridge Association University Oak Ridge Operations Office BWXT Pantex Site Office JanTec Corporation, Richland, Washington Los Alamos National Laboratory Chicago Office Bettis Atomic Power Laboratory National Security Technology C1,

  15. Energy Savers: Your One Stop Shop for Energy Efficiency Upgrades...

    Office of Environmental Management (EM)

    Your One Stop Shop for Energy Efficiency Upgrades Energy Savers: Your One Stop Shop for Energy Efficiency Upgrades This is a presentation from Energy Impact Illinois posted on the...

  16. About EIA - Organization - U.S. Energy Information Administration (EIA)

    Gasoline and Diesel Fuel Update (EIA)

    Howard K. Gruenspecht, Acting Administrator and Deputy Administrator Howard K. Gruenspecht Print friendly PDF Deputy Administrator E-mail: howard.gruenspecht@eia.gov Phone: (202) 586-6351 Fax: (202) 586-0329 Room: 2H-027 Address: U.S. Energy Information Administration 1000 Independence Avenue, S.W. Washington, DC 20585 Duties Howard Gruenspecht was named Deputy Administrator of the U.S. Energy Information Administration (EIA) in March 2003. As the second-in-command at EIA and the agency's top

  17. About EIA - Organization - U.S. Energy Information Administration (EIA)

    Gasoline and Diesel Fuel Update (EIA)

    Nalley Stephen Nalley Print-friendly PDF Assistant Administrator for Resource and Technology Management E-mail: Stephen.Nalley@eia.gov Phone: (202) 586-0959 Address: U.S. Energy Information Administration 1000 Independence Avenue, S.W. Washington, DC 20585 Duties Stephen Nalley is the Assistant Administrator (AA) for Resource and Technology Management and is responsible for leading and directing all of EIA's mission support functions, including workforce recruitment and development, IT

  18. Microsoft Word - WD Proposed Plan D5 R8 MASTER 10-29-14 _final with reply mail_ rev 1

    Energy Savers [EERE]

    WD-PLN-0034, Rev. 8 1 DOE/PPPO/03-0312&D5 Aerial photo of the Portsmouth Gaseous Diffusion Plant showing the three large process buildings (center of photo) and other support facilities, facing southwest PUBLIC COMMENT PERIOD NOVEMBER 12, 2014 TO JANUARY 10, 2015 HOW YOU CAN PARTICIPATE Read this Proposed Plan and review related documents in the Administrative Record. Comment on this Proposed Plan by mail, email, or fax to: Ms. Kristi Wiehle Department of Energy P.O. Box 370 Piketon, Ohio

  19. Searching for Stopped Gluinos at CMS

    SciTech Connect (OSTI)

    Ratnikov, Fedor

    2010-02-10

    We describe plans for a search for long-lived particles which will become stopped by the CMS detector. We will look for the subsequent decay of these particles during time intervals where there are no pp collisions in CMS: during gaps between crossings in the LHC beam structure, and during inter-fill periods between the beam being dumped and re-injection. Such long living particles decays will be recorded with dedicated calorimeter triggers. For models predicting these particles, such as split-susy gluinos, the large cross-section combined with good stopping power of CMS, yields a significant number of triggerable decays. If LHC instantaneous luminosity approaches 10{sup 32} cm{sup -2}s{sup -1} in 2009-10, 5sigma significance can be established in a matter of days, since these decays occur on top of a negligible background.Due to limited size, this paper concentrates on main idea and expected results. More details are available in https://twiki.cern.ch/twiki/bin/view/CMS/PhysicsResults.

  20. Program Administration

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    1997-08-21

    This volume describes program administration that establishes and maintains effective organizational management and control of the emergency management program. Canceled by DOE G 151.1-3.

  1. Stop Codon Reassignment in the Wild

    SciTech Connect (OSTI)

    Ivanova, Natalia; Schwientek, Patrick; Tripp, H. James; Rinke, Christian; Pati, Amrita; Huntemann, Marcel; Visel, Axel; Woyke, Tanja; Kyrpides, Nikos; Rubin, Edward

    2014-03-21

    Since the discovery of the genetic code and protein translation mechanisms (1), a limited number of variations of the standard assignment between unique base triplets (codons) and their encoded amino acids and translational stop signals have been found in bacteria and phages (2-3). Given the apparent ubiquity of the canonical genetic code, the design of genomically recoded organisms with non-canonical codes has been suggested as a means to prevent horizontal gene transfer between laboratory and environmental organisms (4). It is also predicted that genomically recoded organisms are immune to infection by viruses, under the assumption that phages and their hosts must share a common genetic code (5). This paradigm is supported by the observation of increased resistance of genomically recoded bacteria to phages with a canonical code (4). Despite these assumptions and accompanying lines of evidence, it remains unclear whether differential and non-canonical codon usage represents an absolute barrier to phage infection and genetic exchange between organisms. Our knowledge of the diversity of genetic codes and their use by viruses and their hosts is primarily derived from the analysis of cultivated organisms. Advances in single-cell sequencing and metagenome assembly technologies have enabled the reconstruction of genomes of uncultivated bacterial and archaeal lineages (6). These initial findings suggest that large scale systematic studies of uncultivated microorganisms and viruses may reveal the extent and modes of divergence from the canonical genetic code operating in nature. To explore alternative genetic codes, we carried out a systematic analysis of stop codon reassignments from the canonical TAG amber, TGA opal, and TAA ochre codons in assembled metagenomes from environmental and host-associated samples, single-cell genomes of uncultivated bacteria and archaea, and a collection of phage sequences

  2. Report on the first VLHC photon stop cryogenic design experiment

    SciTech Connect (OSTI)

    Michael Geynisman et al.

    2003-09-15

    As part of Fermilab's study of a Very Large Hadron Collider, a water-cooled photon stop was proposed as a device to intercept the synchrotron radiation emitted by the high-energy proton beams in the high field superconducting magnets with minimal plug-cooling power. Photon stops are radiation absorbers operating at room temperature that protrude into the beam tube at the end of each bending magnet to scrape the synchrotron light emitted by the beam one magnet up-stream. Among the technological challenges regarding photon stops is their cryo-design. The photon stop is water-cooled and operates in a cryogenic environment. A careful cryo-design is therefore essential to enable operation at minimum heat transfer between the room temperature sections and the cryogenic parts. A photon stop cryo-design was developed and a prototype was built. This paper presents the results of the cryogenic experiments conducted on the first VLHC photon stop prototype.

  3. Mobile Truck Stop Electrification Locator Now Available - News Releases |

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    NREL Mobile Truck Stop Electrification Locator Now Available Truck drivers can find idle reduction facilities using cell phones and PDAs September 15, 2009 The U.S. Department of Energy's (DOE) National Renewable Energy Laboratory (NREL) expanded its suite of Web-based, fuel-efficiency tools by launching the Mobile Truck Stop Electrification Locator. This comprehensive mobile application helps truck drivers find public truck stops with idle reduction facilities using a cell phone,

  4. CALCULATION OF STOPPING POWER VALUES AND RANGES OF FAST IONS.

    Energy Science and Technology Software Center (OSTI)

    2003-03-18

    STOPOW calculates a set of stopping power values and ranges of fast ions in matter for any materials. Furthermore STOPOW can calculate a set of values for one special auxiliary function (e.g. kinematic factors, track structure parameters, time of flight or correction factors in the stopping function) . The user chooses the physical units for stopping powers and ranges and the energy range for calculations.

  5. Energy Savers: Your One Stop Shop for Energy Efficiency Upgrades |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy Your One Stop Shop for Energy Efficiency Upgrades Energy Savers: Your One Stop Shop for Energy Efficiency Upgrades This is a presentation from Energy Impact Illinois posted on the website of the U.S. Department of Energy's Better Buildings Neighborhood Program. PDF icon Energy Savers from CNT Energy More Documents & Publications Energy Savers: A one-stop energy efficiency shop for multifamily building owners Energy Savers: Fireplaces

  6. U-157: Ruby Mail Gem Directory Traversal and Shell Command Injection Vulnerabilities

    Broader source: Energy.gov [DOE]

    Some vulnerabilities have been reported in the Mail gem for Ruby, which can be exploited by malicious people to manipulate certain data and compromise a vulnerable system.

  7. Fact #787: July 8, 2013 Truck Stop Electrification Reduces Idle...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    heating, cooling and use of electrical appliances. Electrification at truck stops allows truckers to "plug-in" vehicles to operate the necessary systems without idling the engine. ...

  8. Western Area Power Administration's Control and Administration...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Management Alert Western Area Power Administration's Control and Administration of ... THE ADMINISTRATOR, WESTERN AREA POWER ADMINISTRATION FROM: Gregory H. Friedman Inspector ...

  9. Mailing Addresses and Information Numbers for Operations, Field...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    of Energy National Nuclear Security Administration ... Rocky Mountain Oilfield Testing Center 907 N. Poplar, ... Contractors News & Blog Data Phonebook Web Policies History

  10. {open_quotes}Media-On-Demand{close_quotes} multimedia electronic mail: A tool for collaboration on the web

    SciTech Connect (OSTI)

    Tsoi, Kei Nam; Rahman, S.M.

    1996-12-31

    Undoubtedly, multimedia electronic mail has many advantages in exchanging information electronically in a collaborative work. The existing design of e-mail systems architecture is inefficient in exchanging multimedia message which has much larger volume, and requires more bandwidth and storage space than the text-only messages. This paper presents an innovative method for exchanging multimedia mail messages in a heterogeneous environment to support collaborative work over YAW on the Internet. We propose a {open_quotes}Parcel Collection{close_quotes} approach for exchanging multimedia electronic mail messages. This approach for exchanging multimedia electronic mail messages integrates the current WWW technologies with the existing electronic mail systems.

  11. Laboratory Equipment Donation Program - Administrative Login

    Office of Scientific and Technical Information (OSTI)

    Logon Reset Forgot your username or password or need to change your e-mail address? Send e-mail to pf-lepd@osti.gov. Need to change OPMO contact (i.e., e-mail, name, telephone ...

  12. Report Period: EIA ID NUMBER: Appendix A: Mailing Address: Appendix...

    U.S. Energy Information Administration (EIA) Indexed Site

    This report is mandatory under the Federal Energy Administration Act of 1974 (Public Law 93-275). Failure to comply may result in criminal fines, civil penalties and other ...

  13. Nanomachines: How Viruses Work, and How We Can Stop Them

    ScienceCinema (OSTI)

    Carolyn Bertozzi

    2010-01-08

    Nature's Nasty Nanomachines: How Viruses Work, and How We Can Stop Them. Carolyn Bertozzi, director of Berkeley Lab's Molecular Foundry, discusses this topic at a Feb. 21, 2009 Nano*High talk.

  14. Subfreezing Start/Stop Protocol for and Advanced Metallic Open...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Subfreezing StartStop Protocol for and Advanced Metallic Open-Flowfield Fuel Cell Stack Part of a 100 million fuel cell award announced by DOE Secretary Bodman on Oct. 25, 2006. ...

  15. Fact #628: June 21, 2010 Truck Stop Electrification Sites

    Broader source: Energy.gov [DOE]

    Long haul truck drivers routinely idle their engines to heat or cool their cab during their rest period. (Federal laws require 10 hours of rest for every 11 hours on the road.) Truck Stop...

  16. Using laser-driven neutrons to stop nuclear smugglers

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Using laser-driven neutrons to stop nuclear smugglers Using laser-driven neutrons to stop nuclear smugglers Researchers have successfully demonstrated for the first time that laser-generated neutrons can be enlisted as a useful tool in the War on Terror. June 4, 2013 A burst of laser energy 50 times greater than the worldwide output of electrical power slams into an extremely thin foil target to produce neutrons at Los Alamos National Laboratory's TRIDENT laser facility during a recent

  17. New Truck Stop Electrification Station Maps Help Truckers Reduce Idling -

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    News Releases | NREL New Truck Stop Electrification Station Maps Help Truckers Reduce Idling April 21, 2006 Golden, Colo. - A new internet-based mapping program is helping truckers find truck stops with idle reduction facilities-on-site systems that can substantially cut fuel use while reducing air emissions. Idle reduction systems hold great promise for the approximately 500,000 long-haul trucks with sleeper cabs currently operating in the United States. Estimates show idle reduction

  18. Newly Invented Shielding For Stopping Neutrons Cold | Jefferson Lab

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Newly Invented Shielding For Stopping Neutrons Cold Newly Invented Shielding For Stopping Neutrons Cold NEWPORT NEWS, VA, Dec. 9, 2013 - When faced with the challenge of protecting sensitive scientific equipment and computers from radiation, engineers at the U.S. Department of Energy's Thomas Jefferson National Accelerator Facility decided to take matters into their own hands. They came up with three innovative products that could soon find their way to nuclear power plants, particle

  19. Nuclear stopping power in warm and hot dense matter

    SciTech Connect (OSTI)

    Faussurier, Gerald; Blancard, Christophe; Gauthier, Maxence

    2013-01-15

    We present a method to estimate the nuclear component of the stopping power of ions propagating in dense matter. Three kinds of effective pair potentials are proposed. Results from the warm dense matter regime and the domain of high energy density physics are presented and discussed for proton and helium. The role of ionic temperature is examined. The nuclear stopping power can play a noticeable role in hot dense matter.

  20. About EIA - Organization - U.S. Energy Information Administration (EIA)

    Gasoline and Diesel Fuel Update (EIA)

    John Conti, Director of the Office of Integrated Analysis and Forecasting John ContiPrint-friendly PDF Assistant Administrator for Energy Analysis E-mail: john.conti@eia.gov Phone: (202) 586-2222 Fax: (202) 586-3045 Room: 2H-073 Address: U.S. Energy Information Administration 1000 Independence Avenue, S.W. Washington, DC 20585 Duties John Conti is the Assistant Administrator for Energy Analysis and analyzes energy supply, demand, and prices including the impact of financial markets on energy

  1. About EIA - Organization - U.S. Energy Information Administration (EIA)

    Gasoline and Diesel Fuel Update (EIA)

    Harvey, Director of the Office of Oil and Gas Stephen Harvey Print-friendly PDF Assistant Administrator for Energy Statistics E-mail: stephen.harvey@eia.gov Phone: (202) 586-6012 Fax: (202) 586-9739 Room: 2G-020 Address: U.S. Energy Information Administration 1000 Independence Avenue, S.W. Washington, DC 20585 Duties Stephen Harvey is the Assistant Administrator (AA) for Energy Statistics and is responsible for a wide range of survey, statistical methods, and integration activities related to:

  2. Data-Driven Mailing Helps Heat Up Untapped Seattle Market | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Data-Driven Mailing Helps Heat Up Untapped Seattle Market Abridged transcript of an interview with Community Power Works Project Manager Ruth Bell and ProgramSystem Analyst Vince ...

  3. New Online Tool Creates One-Stop Shop for Federal Program Opportunitie...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Online Tool Creates One-Stop Shop for Federal Program Opportunities That Support Tribal Energy Development New Online Tool Creates One-Stop Shop for Federal Program Opportunities ...

  4. Reaction-in-Flight Neutrons and the Stopping Power in Cryogenic...

    Office of Scientific and Technical Information (OSTI)

    Stopping Power in Cryogenic NIF Capsules Citation Details In-Document Search Title: Reaction-in-Flight Neutrons and the Stopping Power in Cryogenic NIF Capsules Authors: ...

  5. Reaction-in-Flight Neutrons and the Stopping Power in Cryogenic...

    Office of Scientific and Technical Information (OSTI)

    Stopping Power in Cryogenic NIF Capsules Citation Details In-Document Search Title: Reaction-in-Flight Neutrons and the Stopping Power in Cryogenic NIF Capsules You are ...

  6. Data-Driven Mailing Helps Heat Up Untapped Seattle Market | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Data-Driven Mailing Helps Heat Up Untapped Seattle Market Data-Driven Mailing Helps Heat Up Untapped Seattle Market Abridged transcript of an interview with Community Power Works Project Manager Ruth Bell and Program/System Analyst Vince Schueler of the Washington State University Energy Program. PDF icon Seattle Focus Series More Documents & Publications The Better Buildings Neighborhood View -- January 2013 howtodesignandmarketenergyefficiencyprogramstospecificneighborhoods.doc

  7. Legal and policy issues associated with monitoring employee E-mail

    SciTech Connect (OSTI)

    Segura, M.A.; Rither, A.C.

    1997-01-01

    This paper examines the legal issues involved with employer monitoring of employee e-mail. In addition to identifying pertinent legal issues, the paper provides guidelines that will help the Pacific Northwest National Laboratory (PNNL) establish a program for monitoring outgoing e-mail to insure compliance with company policies, particularly those regarding protection of trade secrets and proprietary information, and to comply with the Department of Energy`s (DOE) procedures for protecting Export Controlled Information (ECI). Electronic communication has allowed companies to enhance efficiency, responsiveness and effectiveness. E-mail allows employees to transmit all types of data to other individuals inside and outside of their companies. The ease with which information can be transmitted by e-mail has placed trade secrets, proprietary information, and other sensitive data at risk from inadvertent disclosure by employees. As employers attempt to protect their interests through measures such as monitoring e-mail, they may expose themselves to liability under federal and state laws for violating employee privacy. Business use of e-mail has proliferated so rapidly that the federal and state legal systems have not been able to adequately address the issues arising out of its use in the workplace.

  8. Stopping Power and Range of Ions in Matter

    Energy Science and Technology Software Center (OSTI)

    2001-06-19

    SRIM is a group of programs which calculate the stopping and range of ions (10ev - 2 GeV/amu) into matter. TRIM (the Transport of Ions in Matter) is the most comprehensive program included. Trim will accept complex targets made of compound materials with up to eight layers, each with different materials. It will calculate both the final 3d distribution of the inner ions and also all kinetic phenomena associated with the ion''s energy loss; targetmore » damage, sputtering, ionization, and phonon production. All targets atom cascades in the target are followed in detail. It can be used for physics of recoil cascades, physics of sputtering, the stopping of ions in compounds and stopping power for ions in gases; This included radiation damage from neutron , electrons, and photons.« less

  9. QUARTER SHORT-T ERM ENERGY OUTLOO K QUARTERLY PROJECTIONS ENERGY INFORMATION ADMINISTRATION

    Gasoline and Diesel Fuel Update (EIA)

    3Q) 1991 3 QUARTER SHORT-T ERM ENERGY OUTLOO K QUARTERLY PROJECTIONS ENERGY INFORMATION ADMINISTRATION August 1991 This publication may be purchased from the Superintenden t of Documents, U.S. Government Printing Office. Purchasing in formation for this or other Energy Information Administration (EIA) publications may be obtained from the Government Printing Office or ElA's National Energy Information Center. Questions on energy statistics should be directed to the Center by mail, telephone, or

  10. Management & Administration | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Management & Administration Management & Administration Management & Administration The Office of Management and Administration directs the development, coordination, and execution ...

  11. Stopping executions, saving computers with new malware detection tool

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Saving computers with new malware detection tool Stopping executions, saving computers with new malware detection tool A computer tool that allows the machine to identify malicious executable files without being exposed to their harmful actions. October 21, 2009 Los Alamos National Laboratory sits on top of a once-remote mesa in northern New Mexico with the Jemez mountains as a backdrop to research and innovation covering multi-disciplines from bioscience, sustainable energy sources, to plasma

  12. Southwestern Power Administration

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Privacy Notice For statistical purposes only, Southwestern collects the following data: IP addresses of users who visit our Web site Dates of average Web site activity Most viewed web pages on Southwestern's site We use these statistics only for improvement purposes for Southwestern's Web site, not to identify any individual users. We do NOT enable "cookies" on Southwestern's website. Personal information submitted by a user via phone, fax, or e-mail is not distributed to any parties

  13. Energy Savers: A one-stop energy efficiency shop for multifamily...

    Office of Environmental Management (EM)

    A one-stop energy efficiency shop for multifamily building owners Energy Savers: A one-stop energy efficiency shop for multifamily building owners This is a document from Energy...

  14. BONNEVILLE POWER ADMINISTRATION

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    October 2013 (Revised 060914) United States Department of Energy Bonneville Power Administration 905 N.E. 11th Avenue Portland, OR 97232 Bonneville Power Administration's 2014...

  15. Lustre Administrative Tool

    Energy Science and Technology Software Center (OSTI)

    2003-12-24

    The Lustre Administrative Tools (LAT) is a set of programs and utilities designed to facilitate management of the Lustre File System by System Administrators.

  16. ADMINISTRATIVE RECORDS SCHEDULE 23: ADMINISTRATIVE RECORDS SCHEDULE...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    This schedule provides for the disposal of certain records common to most offices. It covers administrative subject files; facilitative records such as suspense files, tracking and ...

  17. Your First Stop for Clean Energy Policy Support (Fact Sheet)

    SciTech Connect (OSTI)

    Not Available

    2012-06-01

    The Clean Energy Solutions Center, an initiative of the Clean Energy Ministerial and UN-Energy, helps governments design and adopt policies and programs that support the deployment of transformational low-carbon technologies. The Solutions Center serves as a first-stop clearinghouse of clean energy policy reports, data, and tools and provides expert assistance and peer-to-peer learning forums. This factsheet highlights key Solutions Center offerings, including 'ask an expert' assistance on clean energy policy matters, training and peer learning, and technical resources for policy makers worldwide.

  18. By E-Mail Daniel Cohen Assistant General Counsel for Legislation, Regulation, and Energy Efficiency

    Energy Savers [EERE]

    June 19, 2012 By E-Mail Daniel Cohen Assistant General Counsel for Legislation, Regulation, and Energy Efficiency U.S. Department of Energy Office of the General Counsel 1000 Independence Ave., SW Washington, D.C. 20585 Regulatory.Review@hq.doe.gov Re: Regulatory Burden RFI Dear Mr. Cohen: The Association of Home Appliance Manufacturers (AHAM) respectfully submits the following comments to the Department of Energy (DOE) on its Regulatory Burden RFI, 77 Fed. Reg. 28518 (May 15, 2012). AHAM

  19. Extremely High-Frequency Holographic Radar Imaging of Personnel and Mail

    SciTech Connect (OSTI)

    McMakin, Douglas L.; Sheen, David M.; Griffin, Jeffrey W.; Lechelt, Wayne M.

    2006-08-01

    The awareness of terrorists covertly transporting chemical warfare (CW) and biological warfare (BW) agents into government, military, and civilian facilities to harm the occupants has increased dramatically since the attacks of 9/11. Government and civilian security personnel have a need for innovative surveillance technology that can rapidly detect these lethal agents, even when they are hidden away in sealed containers and concealed either under clothing or in hand-carried items such as mailed packages or handbags. Sensor technology that detects BW and CW agents in mail or sealed containers carried under the clothing are under development. One promising sensor technology presently under development to defeat these threats is active millimeter-wave holographic radar imaging, which can readily image concealed items behind paper, cardboard, and clothing. Feasibility imaging studies at frequencies greater than 40 GHz have been conducted to determine whether simulated biological or chemical agents concealed in mail packages or under clothing could be detected using this extremely high-frequency imaging technique. The results of this imaging study will be presented in this paper.

  20. Administrative Forms/Policies

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Administrative Forms Microfab Project Proposal Form Exit Form After Hours Request Form

  1. Southwestern Power Administration

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    November 20, 2015 Scott Carpenter Named Southwestern Administrator Scott Carpenter Scott Carpenter Administrator TULSA, OK - Scott Carpenter was named the new Administrator of the Southwestern Power Administration (Southwestern) in Tulsa, Oklahoma, on November 19, 2015. Mr. Carpenter has over 20 years of utility and architectural engineering consulting experience, including utility load and fuel price forecasting, transmission and generation planning, transmission congestion forecasting, and

  2. Southwestern Power Administration

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    FOIA/Privacy Act Submit a FOIA Request DOE FOIA Requester Service Center Electronic Reading Room FOIA Links Power Marketing Administrations' FOIA Links Bonneville Power Administration FOIA Program Department of Energy FOIA Program Southeastern Power Administration FOIA Program Western Area Power Administration FOIA Program Contact FOIA/Privacy Act Officer Southwestern Power Administration One West Third Street Tulsa, Oklahoma 74103-3502 Phone: 918-595-6609 Fax: 918-595-6755 foia@swpa.gov Last

  3. Southwestern Power Administration

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    April 2, 2014 Smith Named as New Deputy Assistant Administrator Smith Named as New Deputy Assistant Administrator Barbara Smith Barbara Smith, a former Liaison Specialist for Southwestern Power Administration (Southwestern), assumed the duties of Deputy Assistant Administrator in the Power Marketing Liaison Office in Washington, D.C., on March 9, 2014. Smith will serve as the primary contact for Southwestern and the Southeastern Power Administration (Southeastern), representing both Power

  4. AVTA: 2010 Volkswagon Golf Diesel Start-Stop Testing Results

    Broader source: Energy.gov [DOE]

    The Vehicle Technologies Office's Advanced Vehicle Testing Activity carries out testing on a wide range of advanced vehicles and technologies on dynamometers, closed test tracks, and on-the-road. These results provide benchmark data that researchers can use to develop technology models and guide future research and development. The following reports describe results of testing done on a 2010 Volkswagon Golf Diesel vehicle with stop-start technology. Baseline data, which provides a point of comparison for the other test results, was collected at two different research laboratories. Baseline and other data collected at Idaho National Laboratory is in the attached documents. Baseline and battery testing data collected at Argonne National Laboratory is available in summary and CSV form on the Argonne Downloadable Dynometer Database site (http://www.anl.gov/energy-systems/group/downloadable-dynamometer-databas...). Taken together, these reports give an overall view of how this vehicle functions under extensive testing.

  5. AVTA: 2010 Mazda 3 Hatchback Start-Stop Testing Results

    Broader source: Energy.gov [DOE]

    The Vehicle Technologies Office's Advanced Vehicle Testing Activity carries out testing on a wide range of advanced vehicles and technologies on dynamometers, closed test tracks, and on-the-road. These results provide benchmark data that researchers can use to develop technology models and guide future research and development. The following reports describe results of testing done on a 2010 Mazda3 hatchback with stop-start technology. Baseline and other data collected at Idaho National Laboratory is in the attached documents. Baseline and battery testing data collected at Argonne National Laboratory is available in summary and CSV form on the Argonne Downloadable Dynometer Database site (http://www.anl.gov/energy-systems/group/downloadable-dynamometer-databas...). Taken together, these reports give an overall view of how this vehicle functions under extensive testing.

  6. Low velocity ion stopping in binary ionic mixtures

    SciTech Connect (OSTI)

    Tashev, Bekbolat; Baimbetov, Fazylkhan; Deutsch, Claude; Fromy, Patrice

    2008-10-15

    Attention is focused on the low ion velocity stopping mechanisms in multicomponent and dense target plasmas built of quasiclassical electron fluids neutralizing binary ionic mixtures, such as, deuterium-tritium of current fusion interest, proton-heliumlike iron in the solar interior or proton-helium ions considered in planetology, as well as other mixtures of fiducial concern in the heavy ion beam production of warm dense matter at Bragg peak conditions. The target plasma is taken in a multicomponent dielectric formulation a la Fried-Conte. The occurrence of projectile ion velocities (so-called critical) for which target electron slowing down equals that of given target ion components is also considered. The corresponding multiquadrature computations, albeit rather heavy, can be monitored analytical through a very compact code operating a PC cluster. Slowing down results are systematically scanned with respect to target temperature and electron density, as well as ion composition.

  7. Search for stop pairs in the emu channel

    SciTech Connect (OSTI)

    Tissandier, Fabrice; /Clermont-Ferrand U.

    2007-10-01

    The Standard Model gives a satisfying description of subatomic processes at low energy (< 1 TeV). Beyond this energy scale, other models must be considered. Supersymmetry is one of them. It gives in an elegant way, solutions to several Standard Model short comings. This document reports the search for a supersymmetric signal characterized by the production of two stops decaying into two b-jets, one electron, one muon and missing energy. This study has been performed at the D0 experiment, located on the ring of Tevatron collider at FermiLab, (Chicago, USA), whose energy in the center of mass reaches {radical}s = 1.96 TeV. The data used for this analysis have been collected during Run IIa of D0 detector; from april 2003 to march 2006 ({approx} 1fb{sup -1}). The objects handled for this analysis require a good understanding of both calorimeters, muon detectors and trackers. As Tevatron is an hadronic collider and the number of Standard Model processes with the same signature as the signal is low, the background is thus dominated by QCD processes. After the selection cuts, no excess of data has been observed with respect to the Standard Model expectation. D0 experiment sensibility has been improved and the 95% CL exclusion area in [m{sub {bar {nu}}}, m{sub {bar t}{sub 1}}], extended up to stop masses of 170 GeV/c{sup 2} and sneutrino masses of 105 GeV/c{sup 2}. Besides, a part of my work for the collaboration consisted in elaborating a tool to discriminate calorimetric objects at level 3 trigger system; and also in calibrating the two simulated level 1 readouts.

  8. Southwestern Power Administration

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    7 ANNUAL REPORT Southwestern Power Administration Letter to the Secretary. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2 About Southwestern. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 4 Accomplishments . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 6 Supplementary

  9. Stopping distance for high energy jets in weakly coupled quark-gluon plasmas

    SciTech Connect (OSTI)

    Arnold, Peter; Cantrell, Sean; Xiao Wei

    2010-02-15

    We derive a simple formula for the stopping distance for a high-energy quark traveling through a weakly coupled quark-gluon plasma. The result is given to next-to-leading order in an expansion in inverse logarithms ln(E/T), where T is the temperature of the plasma. We also define a stopping distance for gluons and give a leading-log result. Discussion of stopping distance has a theoretical advantage over discussion of energy loss rates in that stopping distances can be generalized to the case of strong coupling, where one may not speak of individual partons.

  10. The New York Times covers "National Labs Race to Stop Iran"

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    The New York Times covers "National Labs Race to Stop Iran" The New York Times covers "National Labs Race to Stop Iran" Given the stakes in the sensitive negotiations [with Iran], the labs would check and recheck one another, making sure the answers held up. May 15, 2015 The New York Times covers "National Labs Race to Stop Iran" Los Alamos National Laboratory's main complex, Los Alamos, New Mexico National labs race to stop Iran Given the stakes in the sensitive

  11. ADMINISTRATIVE RECORDS SCHEDULE 2: PAYROLL AND PAY ADMINISTRATION...

    Broader source: Energy.gov (indexed) [DOE]

    Documents & Publications ADMINISTRATIVE RECORDS SCHEDULE 2: PAYROLL AND PAY ADMINISTRATION RECORDS ADMINISTRATIVE RECORDS SCHEDULE 6: ACCOUNTABLE OFFICERS' ACCOUNTS RECORDS ADM 6...

  12. Gina Pearson Assistant Administrator

    Gasoline and Diesel Fuel Update (EIA)

    Gina Pearson Assistant Administrator for Communications Duties Gina Pearson is the Assistant Administrator (AA) for Communications, and in this capacity provides leadership and direction to conduct the U.S. Energy Information Administration's comprehensive communications program for diverse external customer groups and agency employees. The AA for Communications is responsible for Agency communications policies and standards, the www.eia.gov website, press and media rela- tions, marketing and

  13. Southwestern Power Administration

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    September 27, 2012 Turner Named Southwestern Administrator Chris Turner Chris Turner Christopher Turner has been named as the new Administrator of the Southwestern Power Administration (Southwestern) in Tulsa, OK, effective July 29, 2012. Mr. Turner brings to Southwestern 30 years' experience in the electric utility industry, including various leadership positions involving transmission and distribution construction, energy trading, bulk power operations, resource planning, and compliance with

  14. National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    The Department of Energy (DOE), the National Nuclear Security Administration (NNSA) and the University of California (UC) have agreed on new management and operations contracts for ...

  15. SOUTHWESTERN POWER ADMINISTRATION

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    ADMINISTRATION CATEGORICAL EXCLUSION (CX) DETERMINATION BRIEF DESCRIPTION OF PROPOSED ACTION: Hydroelectric Power Rate Increase for the Integrated System of Hydropower Projects. ...

  16. Administrative - Hanford Site

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Administrative Freedom of Information and Privacy Act DOE Headquarters FOIA Web Page A Citizen's Guide to the FOIA and Privacy Act Making a Privacy Act Request Freedom of...

  17. SMALL BUSINESS ADMINISTRATION

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ... in the 8(a) BD program benefited the Tribal or native members andor communities. ... List of Subjects 13 CFR Part 121 Administrative practice and procedure, Government ...

  18. Bonneville Power Administration

    Energy Savers [EERE]

    March 2015 Bonneville Power Administration's Hooper ... circuit 115-kV transmission line that will extend generally ... new land rights acquired for ROW or access road easements. ...

  19. Portsmouth Administrative Consent Order

    Broader source: Energy.gov [DOE]

    Portsmouth Administrative Consent Order ensures compliance by DOE at the Portsmouth Site with the Resource Recovery and Compensation Act, the Comprehensive Environmental Response, Compensation, and...

  20. BONNEVILLE POWER ADMINISTRATION

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Training: Fundamentals of Building Measurement & Verification (CMVP prep) When: 2222016 8:00am - 2242016 5:00pm Where: Tacoma Public Utilities Administration Building 3628 S....

  1. BONNEVILLE POWER ADMINISTRATION

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    and SCS Administrative Charge, specified in GRSP II.U.2. 5.4 Grandfathered Generation Management Service (GMS) Load Following Customers dedicating the entire output of an...

  2. Bonneville Power Administration

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    agreement (Agreement) between the BC Hydro and Power uthority (BCH) and the Bonneville Power Administration (BP A), jointly the Parties, which BA for accounting purposes is...

  3. National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    U.S. Department of Energy National Nuclear Security Administration Federal Equal ... of September 24, 2011 3 The Department of Energy (DOE) National Nuclear Security ...

  4. the Bonneville Power Administration

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Bonneville Power Administration deposited 12, 535,000 to the reclamation fund in the United States Treasury for the ac- count of Columbia Basin Project, Yakima Project...

  5. Fish and Wildlife Administrator

    Broader source: Energy.gov [DOE]

    This position is located in the Planning and Policy organization (EWP) in the Division of Environment, Fish & Wildlife, Bonneville Power Administration (BPA) and reports to the EWP manager....

  6. BPA-2012-01616-FOIA Request

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    (ECE1VED IOTA OFFICE TWS June 29, 2012 TE: F DATE: Bonneville Power Administration Christina J. Munro, FOIA Officer Mail Stop DK-7 r - P.O. Box 3621 Portland, OR 97208 RE: FOIA...

  7. Management and Administration | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    Management and Administration NNSA's Naval Reactors is committed to excellence and dedicated to meeting its human resource needs in a manner that is customer driven. NNSA's Naval Reactors is committed to excellence and dedicated to meeting its human resource needs in a manner that is customer driven. EMPLOYEE RESOURCES All Employees Thrift Savings Plan off site link (TSP) - Retirement savings plan for civilians who are employed by the United States Government and members of the uniformed

  8. Energy Department Names Elliot Mainzer Bonneville Power Administration Administrator

    Broader source: Energy.gov [DOE]

    The Energy Department announced that Elliot Mainzer has been appointed Administrator for the Bonneville Power Administration (BPA).

  9. ADMINISTRATIVE RECORDS SCHEDULE 2: PAYROLL AND PAY ADMINISTRATION RECORDS |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy : PAYROLL AND PAY ADMINISTRATION RECORDS ADMINISTRATIVE RECORDS SCHEDULE 2: PAYROLL AND PAY ADMINISTRATION RECORDS Payrolling and pay administration records pertain to the disbursements employees receive in return for their personal services. This schedule covers commonly used pay records PDF icon ADMINISTRATIVE RECORDS SCHEDULE 2: PAYROLL AND PAY ADMINISTRATION RECORDS More Documents & Publications ADMINISTRATIVE RECORDS SCHEDULE 2: PAYROLL AND PAY ADMINISTRATION

  10. Grants Administration | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Grants Administration Grants Administration Better Buildings Neighborhood Program award recipients were selected through two competitive funding opportunity announcements (FOA): ...

  11. Fact #853 December 29, 2014 Stop/Start Technology is in nearly 5% of All New Light Vehicles Produced

    Broader source: Energy.gov [DOE]

    Stop/Start technology improves fuel economy by reducing engine idle time. As a vehicle slows to a stop, the engine is shut down but then immediately restarts when the break pedal is released so...

  12. Study of stopping power for a proton moving in a plasma with arbitrary degeneracy

    SciTech Connect (OSTI)

    Zhang, Ya; Song, Yuan-Hong; Wang, You-Nian [School of Physics and Optoelectronic Technology, Dalian University of Technology, Dalian 116024 (China)] [School of Physics and Optoelectronic Technology, Dalian University of Technology, Dalian 116024 (China)

    2013-10-15

    Excitation of bulk solid electrons with arbitrary degeneracy, by external charged particles, is investigated by a two-dimensional nonlinear quantum hydrodynamic (QHD) model. The nonlinear stopping power and wake potential are calculated by solving the nonlinear QHD equations with the flux corrected transport numerical method. Two cases of fully degenerated and partially degenerated electrons are compared and discussed in the same self-consistent QHD model. Our results are consistent with the well known dielectric calculation of the stopping power at higher velocity, but include the nonlinear terms of the interactions and give larger stopping power at smaller velocity.

  13. Optimization of the muon stopping target for the MU2E collaboration

    SciTech Connect (OSTI)

    Hodge, Zachary Donovan

    2013-01-01

    The Mu2e Experiment utilizes state of the art accelerators, superconducting magnets, detectors, electronics, and other equipment to maximize the sensitivity to such a rare process. Many of the components of the Mu2e hardware are critical to the overall physics capability of the experiment. The muon stopping target, where muons are stopped and may interact via this very rare process, is one such component where any improvements beyond the base design can have a significant impact on the experiment. This thesis explores possible modifications to the geometry of the muon stopping target. The goal is to determine if any modifications can improve the sensitivity of observing the muon conversion process.

  14. Automatic generation of stop word lists for information retrieval and analysis

    DOE Patents [OSTI]

    Rose, Stuart J

    2013-01-08

    Methods and systems for automatically generating lists of stop words for information retrieval and analysis. Generation of the stop words can include providing a corpus of documents and a plurality of keywords. From the corpus of documents, a term list of all terms is constructed and both a keyword adjacency frequency and a keyword frequency are determined. If a ratio of the keyword adjacency frequency to the keyword frequency for a particular term on the term list is less than a predetermined value, then that term is excluded from the term list. The resulting term list is truncated based on predetermined criteria to form a stop word list.

  15. Energy Information Administration

    U.S. Energy Information Administration (EIA) Indexed Site

    Annual Report of the Origin of Natural Gas Liquids Production 1 U.S. DEPARTMENT OF ENERGY Energy Information Administration Washington, DC 20585 Form Approved OMB Number: 1905-0057 ...

  16. Energy Information Administration

    U.S. Energy Information Administration (EIA) Indexed Site

    X EIA-64A Annual Report of the Origin of Natural Gas Liquids Production 1 U.S. DEPARTMENT OF ENERGY Energy Information Administration Washington, DC 20585 Form Approved OMB Number: ...

  17. Bonneville Power Administration

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    1,NT OF Bonneville Power Administration P.O Box 3621 Portland, Oregon 97208-3621 PUBLIC AFFAIRS March 10, 2010 In reply refer to: DK-7 Tom Jacobs Ex RE: BPA-2010-01030-F Dear Mr....

  18. ADMINISTRATIVE RECORDS SCHEDULES COMPILED

    Broader source: Energy.gov [DOE]

    The Administrative Records Schedules are intended to provide a consolidated and customized DOE listing of schedule information compiled from NARA-approved GRS and DOE-specific Records Control...

  19. Southwestern Power Administration

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Occupational Safety & Health Administration Safety The safety and well-being of all Southwestern Power Administration employees are the firm and continuing responsibilities of every member of management. Each employee, in turn, shares with management the responsibility for his or her own safety by performing his or her duties in a safe and conscientious manner, complying with all safety rules and regulations, and observing the provisions of Executive Order 12196, "Occupational Safety

  20. Southwestern Power Administration

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    12, 2014 Southwestern Operates for Drought at Texoma Significantly lower inflow than normal into the Lake Texoma (Denison Dam) watershed has caused Southwestern Power Administration, a not-for-profit administration within the U.S. Department of Energy (Southwestern), to severely limit power generation at Denison to conserve water storage. "From May 2012 through February 2014, Southwestern generated only about 20% of average, which works out to about 1.8 hours a day," explains Fritha

  1. Southwestern Power Administration

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Changing Utility Industry Prompts Realignment of Resources With the onset of energy markets, increased regulation, clean energy trends, and efforts to modernize the transmission grid, the utility industry is being challenged to keep up. According to Southwestern Power Administration (Southwestern) Administrator Chris Turner, Southwestern, too, has found itself responding to meet the challenges of a shifting business environment. Organizational Realignment "Our people are our greatest

  2. Southeastern Power Administration | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Southeastern Power Administration Southeastern Power Administration Southeastern Power Administration View All Maps Addthis

  3. Heavy standard model-like Higgs boson and a light stop fromYukawa...

    Office of Scientific and Technical Information (OSTI)

    Title: Heavy standard model-like Higgs boson and a light stop from Yukawa-deflected gauge mediation Authors: Kang, Zhaofeng ; Li, Tianjun ; Liu, Tao ; Tong, Chunli ; Yang, Jin Min ...

  4. Fact #787: July 8, 2013 Truck Stop Electrification Reduces Idle Fuel Consumption

    Broader source: Energy.gov [DOE]

    The U.S. Department of Transportation mandates that truckers rest for 10 hours after driving for 11 hours, during which time they often park at truck stops idling the engines to provide heating,...

  5. Vehicle Technologies Office Merit Review 2015: A 12V Start-Stop Li Polymer Battery Pack

    Broader source: Energy.gov [DOE]

    Presentation given by LG Chem Power at 2015 DOE Hydrogen and Fuel Cells Program and Vehicle Technologies Office Annual Merit Review and Peer Evaluation Meeting about A 12V start-stop Li polymer...

  6. Fact #853 December 29, 2014 Stop/Start Technology is in nearly...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Note: 2014 estimates are preliminary. Fact 853 Dataset Supporting Information Penetration of Non-Hybrid StopStart in New Light Vehicles Model Year Cars Light Trucks All Cars and ...

  7. Method and apparatus for rapid stopping and starting of a thermoacoust...

    Office of Scientific and Technical Information (OSTI)

    Title: Method and apparatus for rapid stopping and starting of a thermoacoustic engine A thermoacoustic engine-driven system with a hot heat exchanger, a regenerator or stack, and ...

  8. Hanford Railcars Make Final Stop at B Reactor: Move Enhances Visitor Experience at Historic Reactor

    Broader source: Energy.gov [DOE]

    RICHLAND, WASH. – Two locomotives that hauled irradiated fuel around the Hanford Site for a half-century will reach their final stop this week when they are delivered to the Historic B Reactor for preservation and public display.

  9. Heavy standard model-like Higgs boson and a light stop from

    Office of Scientific and Technical Information (OSTI)

    Yukawa-deflected gauge mediation (Journal Article) | SciTech Connect Heavy standard model-like Higgs boson and a light stop from Yukawa-deflected gauge mediation Citation Details In-Document Search Title: Heavy standard model-like Higgs boson and a light stop from Yukawa-deflected gauge mediation Authors: Kang, Zhaofeng ; Li, Tianjun ; Liu, Tao ; Tong, Chunli ; Yang, Jin Min Publication Date: 2012-11-16 OSTI Identifier: 1101779 Type: Publisher's Accepted Manuscript Journal Name: Physical

  10. Stop-catalyzed baryogenesis beyond the MSSM (Journal Article) | SciTech

    Office of Scientific and Technical Information (OSTI)

    Connect Stop-catalyzed baryogenesis beyond the MSSM Citation Details In-Document Search Title: Stop-catalyzed baryogenesis beyond the MSSM Authors: Katz, Andrey ; Perelstein, Maxim ; Ramsey-Musolf, Michael J. ; Winslow, Peter Publication Date: 2015-11-19 OSTI Identifier: 1226507 Grant/Contract Number: SC0011095 Type: Published Article Journal Name: Physical Review D Additional Journal Information: Journal Volume: 92; Journal Issue: 9; Journal ID: ISSN 1550-7998 Publisher: American Physical

  11. DOE Takes Action to Stop the Sales of Air-Con Air Conditioner Models Shown

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    to Violate Federal Energy Efficiency Appliance Standards | Department of Energy Action to Stop the Sales of Air-Con Air Conditioner Models Shown to Violate Federal Energy Efficiency Appliance Standards DOE Takes Action to Stop the Sales of Air-Con Air Conditioner Models Shown to Violate Federal Energy Efficiency Appliance Standards September 23, 2010 - 12:00am Addthis Washington, DC - The Department of Energy announced today that it has taken action against Air-Con, International, requiring

  12. Reaction-in-Flight Neutrons and the Stopping Power in Cryogenic NIF

    Office of Scientific and Technical Information (OSTI)

    Capsules (Conference) | SciTech Connect Reaction-in-Flight Neutrons and the Stopping Power in Cryogenic NIF Capsules Citation Details In-Document Search Title: Reaction-in-Flight Neutrons and the Stopping Power in Cryogenic NIF Capsules Authors: Hayes-Sterbenz, Anna Catherine [1] ; Jungman, Gerard [1] ; Boswell, Melissa [1] ; Fowler, Malcolm M. [1] ; Grim, Gary P. [1] ; Klein, Andreas [1] ; Rundberg, Robert S. [1] ; Wilhelmy, Jerry B. [1] ; Wilson, Douglas Carl [1] ; Cerjan, Charles [2] ;

  13. Reducing or stopping the uncontrolled flow of fluid such as oil from a well

    DOE Patents [OSTI]

    Hermes, Robert E

    2014-02-18

    The uncontrolled flow of fluid from an oil or gas well may be reduced or stopped by injecting a composition including 2-cyanoacrylate ester monomer into the fluid stream. Injection of the monomer results in a rapid, perhaps instantaneous, polymerization of the monomer within the flow stream of the fluid. This polymerization results in formation of a solid plug that reduces or stops the flow of additional fluid from the well.

  14. Method and apparatus for rapid stopping and starting of a thermoacoustic engine

    DOE Patents [OSTI]

    Swift, Gregory W.; Backhaus, Scott N.; Gardner, David L.

    2003-11-11

    A thermoacoustic engine-driven system with a hot heat exchanger, a regenerator or stack, and an ambient heat exchanger includes a side branch load for rapid stopping and starting, the side branch load being attached to a location in the thermoacoustic system having a nonzero oscillating pressure and comprising a valve, a flow resistor, and a tank connected in series. The system is rapidly stopped simply by opening the valve and rapidly started by closing the valve.

  15. Associate Administrator for Management and Administration, National Nuclear

    National Nuclear Security Administration (NNSA)

    Security Administration | National Nuclear Security Administration Associate Administrator for Management and Administration, National Nuclear Security Administration Michael C. Kane with North Star Award, NNSA Michael Kane September 2009 Senior Executive Service Development Program's "North Star Award" Michael C. Kane of the National Nuclear Security Administration received the Senior Executive Service Development Program's "North Star Award" at a ceremony here in

  16. Computer hardware fault administration

    DOE Patents [OSTI]

    Archer, Charles J.; Megerian, Mark G.; Ratterman, Joseph D.; Smith, Brian E.

    2010-09-14

    Computer hardware fault administration carried out in a parallel computer, where the parallel computer includes a plurality of compute nodes. The compute nodes are coupled for data communications by at least two independent data communications networks, where each data communications network includes data communications links connected to the compute nodes. Typical embodiments carry out hardware fault administration by identifying a location of a defective link in the first data communications network of the parallel computer and routing communications data around the defective link through the second data communications network of the parallel computer.

  17. MCS Systems Administration Toolkit

    Energy Science and Technology Software Center (OSTI)

    2001-09-30

    This package contains a number of systems administration utilities to assist a team of system administrators in managing a computer environment by automating routine tasks and centralizing information. Included are utilities to help install software on a network of computers and programs to make an image of a disk drive, to manage and distribute configuration files for a number of systems, and to run self-testss on systems, as well as an example of using amore » database to manage host information and various utilities.« less

  18. National Nuclear Security Administration

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    or 1-888-246-2460 using the following timeframes

    using the following timeframes

    //A * ~ w r_ra (b11 II V &. l,4t~Cf..-"i National Nuclear Security Administration DOE/NV--325-Rev. lOa February 2015 Nevada National Security Site Waste Acceptance Criteria Prepared by U.S. Department of Energy National Nuclear Security Administration Nevada Field Office . Environmental Management Operations February 2015 Nevada National Security Site Waste Acceptance Criteria Disclaimer Notice

  19. Redis database administration tool

    Energy Science and Technology Software Center (OSTI)

    2013-02-13

    MyRedis is a product of the Lorenz subproject under the ASC Scirntific Data Management effort. MyRedis is a web based utility designed to allow easy administration of instances of Redis databases. It can be usedd to view and manipulate data as well as run commands directly against a variety of different Redis hosts.

  20. Contact Us | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    NNSA Production Office Contact Us Contact Us NPO Public Affairs Manager Steven Wyatt (865) 576-9918 NPO Mailing Address NNSA Production Office PO Box 2050 Oak Ridge, TN 37831 Fax...

  1. Light Stops, Light Staus and the 125 GeV Higgs

    SciTech Connect (OSTI)

    Carena, Marcela; Gori, Stefania; Shah, Nausheen R.; Wagner, Carlos E.M.; Wang, Lian-Tao

    2013-08-01

    The ATLAS and CMS experiments have recently announced the discovery of a Higgs-like resonance with mass close to 125 GeV. Overall, the data is consistent with a Standard Model (SM)-like Higgs boson. Such a particle may arise in the minimal supersymmetric extension of the SM with average stop masses of the order of the TeV scale and a sizable stop mixing parameter. In this article we discuss properties of the SM-like Higgs production and decay rates induced by the possible presence of light staus and light stops. Light staus can affect the decay rate of the Higgs into di-photons and, in the case of sizable left-right mixing, induce an enhancement in this production channel up to $\\sim$ 50% of the Standard Model rate. Light stops may induce sizable modifications of the Higgs gluon fusion production rate and correlated modifications to the Higgs diphoton decay. Departures from SM values of the bottom-quark and tau-lepton couplings to the Higgs can be obtained due to Higgs mixing effects triggered by light third generation scalar superpartners. We describe the phenomenological implications of light staus on searches for light stops and non-standard Higgs bosons. Finally, we discuss the current status of the search for light staus produced in association with sneutrinos, in final states containing a $W$ gauge boson and a pair of $\\tau$s.

  2. USABC Development of 12 Volt Battery for Start-Stop Application: Preprint

    SciTech Connect (OSTI)

    Tataria, H.; Gross, O.; Bae, C.; Cunningham, B.; Barnes, J. A.; Deppe, J.; Neubauer, J.

    2015-02-01

    Global automakers are accelerating the development of fuel efficient vehicles, as a part of meeting regional regulatory CO2 emissions requirements. The micro hybrid vehicles with auto start-stop functionality are considered economical solutions for the stringent European regulations. Flooded lead acid batteries were initially considered the most economical solution for idle-stop systems. However, the dynamic charge acceptance (DCA) at lower state-of-charge (SOC) was limiting the life of the batteries. While improved lead-acid batteries with AGM and VRLA features have improved battery longevity, they do not last the life of the vehicle. The United States Advanced Battery Consortium (or USABC, a consortium of GM, Ford, and Chrysler) analyzed energy storage needs for a micro hybrid automobile with start-stop capability, and with a single power source. USABC has analyzed the start-stop behaviors of many drivers and has developed the requirements for the start-stop batteries (Table 3). The testing procedures to validate the performance and longevity were standardized and published. The guideline for the cost estimates calculations have also been provided, in order to determine the value of the newly developed modules. The analysis effort resulted in a set of requirements which will help the battery manufacturers to develop a module to meet the automotive Original Equipment Manufacturers (OEM) micro hybrid vehicle requirements. Battery developers were invited to submit development proposals and two proposals were selected for 50% cost share with USABC/DOE.

  3. Southwestern Power Administration

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    About this site This Web site is the official Web site of the Southwestern Power Administration. It is part of a Federal computer system used to accomplish Federal functions and is monitored for security purposes to ensure it remains available to all users and to protect information in the system. By accessing this Web site, you are expressly consenting to these monitoring activities. Accessibility Southwestern is committed to providing the most up-to-date, relevant information to its

  4. Southwestern Power Administration

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    DOE Office of Economic Impact & Diversity DOE EEO Summary Statistics Equal Employment Opportunity & Diversity Policy Statement Prevention of Harassment & Retaliation Policy Statement U.S. EEOC Office of Diversity The Office of Diversity (formerly the Equal Employment Opportunity Office) reports directly to Southwestern's Administrator. Its purpose is to plan, implement, and monitor Southwestern's employment practices under the various statutes and Executive Orders that prohibit

  5. Southwestern Power Administration

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    News Items Skip Navigation Links News & Publications Archived News Items Publications Skip Navigation Links Annual Performance Plan Annual Report Newsletters Strategic Plan SWPA - Overview Video System Map Archived News Items 2015 December 9, Southwestern Leadership Announcements Nomvember 20, Scott Carpenter Named Southwestern Administrator April 29, Boyken Named VP of Corporate Operations January 29, Stockton Power Plant Back Online 2014 November 6, Carlos Valencia Named Director of

  6. Southwestern Power Administration

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Computers for Learning Personal Property Disposal Real Property Disposal Property Disposal Southwestern is required to dispose of real and personal property when it is no longer needed to fulfill the agency's mission. Most property is disposed of through the General Services Administration. However, Executive Order 12999 allows Federal agencies to transfer excess computer and related peripheral equipment directly to schools and some educational nonprofit organizations, and Southwestern

  7. Nuclear Security Administration

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    8, 2006, the National Nuclear Security Administration (NNSA) announced the selection of National Security Technologies, LLC (NSTec) to manage and operate the Nevada Test Site (NTS) for the NNSA Nevada Site Office. The contract, valued at approxi- mately $500 million annually, is for five years. There are poten- tially five additional perform- ance-based award-term years available under this contract. NSTec is made up of Northrop Grumman, AECOM, CH2M Hill, and Nuclear Fuel Services. Dr. James E.

  8. ARM - Website Administration

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    ARMFormsWebsite Administration About Become a User Recovery Act Mission FAQ Outreach Displays History Organization Participants Facility Statistics Forms Contacts Facility Documents ARM Management Plan (PDF, 1.3MB) Field Campaign Guidelines (PDF, 574KB) ARM Climate Research Facility Expansion Workshop (PDF, 1.46MB) Facility Activities ARM and the Recovery Act Contributions to International Polar Year Comments? We would love to hear from you! Send us a note below or call us at 1-888-ARM-DATA.

  9. National Nuclear Security Administration

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Nuclear Security Administration Savannah River Site 1 NNSA Budget ($ Millions) By Program Office FY 2015 Enacted FY 2016 Enacted FY 2017 President Request Delta FY Request Weapon Activities 241 242 252 10 Mixed Oxide Fuel Fabrication Facility (MOX) 340 332 270 (62) Defense Nuclear Nonproliferation (DNN) 77 58 91 33 Federal Expenses 4.7 5.2 5.4 .2 Total Budget for NNSA at SRS 662.7 637.2 618.4 (18.8)

  10. ADMINISTRATIVE CHANGE TO

    National Nuclear Security Administration (NNSA)

    450.2 Admin Change 1 1 1-27-15 ADMINISTRATIVE CHANGE TO NNSA SD 450.2 - Functions, Responsibilities, and Authorities (FRA) Document for Safety Management Locations of Changes: Page Paragraph Changed To Title Bottom Office of Safety and Health Office of Safety, Infrastructure, and Operations 1 1 This SD is issued to comply with the Secretary's direction concerning safety management responsibilities and assigns safety responsibilities and authorities described in the most recent version of DOE O

  11. Southwestern Power Administration

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Student Employment Opportunities There are currently no student employment vacancies at Southwestern Power Administration. Please check here regularly for career opportunities offered to students. In the meantime, you can explore the Pathways link located on this page for more information about employment programs for students and recent graduates. Apply At USAJOBS USAJobs is the official job site of the US Federal Government. Please visit this site to see all job vacancies within Southwestern,

  12. Southwestern Power Administration

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    December 7, 2012 Southwestern Helps Restore Power After Hurricane Sandy Southwestern Aids Sandy Recovery Line crews from Southwestern repair distribution lines in Tom's River, New Jersey, following Hurricane Sandy. In the aftermath of Hurricane Sandy in early November 2012, Southwestern Power Administration sent several line, substation, and right-of-way brush crews and 30 pieces of heavy equipment to help restore the electrical grid along the coast of New Jersey near where the storm made

  13. Southwestern Power Administration

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    March 26, 2014 Ohlson Named Director of Resources and Rates Division Ohlson Named Director of Resources and Rates Division Fritha Ohlson Fritha Ohlson has been selected to serve as Director of the Division of Resources and Rates at Southwestern Power Administration (Southwestern), effective March 23, 2014. Ohlson, who has a 16-year background in data analysis and project management, has been with Southwestern since 2006. Ohlson began her career with Electronic Data Systems as a project manager

  14. Southwestern Power Administration

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    14, 2014 Hart Selected as Director of Financial Management Hart Named as Director of Financial Management Doug Hart Doug Hart was named Director of the Division of Financial Management at Southwestern Power Administration (Southwestern), effective December 13, 2013. Hart began his career at Southwestern in 1992 as an Accounting Technician in Cash Management. Rising through the ranks and learning all aspects of financial management, he held the positions of Budget Analyst, Accountant, and

  15. Southwestern Power Administration

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    May 22, 2014 Lake Texoma Hydropower Generation to Remain Low for Near Future TULSA, OK - Southwestern Power Administration (Southwestern) announced today that in response to continuing drought conditions in the Lake Texoma watershed, Southwestern is working with its customers which receive electricity from Denison Dam at Lake Texoma to keep hydropower generation levels low in the summer of 2014, so that storage can be preserved for times when electricity demand is at its highest. "Our

  16. Southwestern Power Administration

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Doug Johnson Named Director of System Protection and Communications Doug Johnson Named Director of System Protection and Communications Doug Johnson Doug Johnson has been selected to serve as Director of the new Division of System Protection and Communications at Southwestern Power Administration (Southwestern), effective July 13, 2014. Johnson, an Electrical Engineer specializing in power system protection, has most recently served as Chief of the System Meter and Protective Relay Maintenance

  17. Southwestern Power Administration

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Danny Johnson Named Director of Maintenance Danny Johnson Named Director of Maintenance Danny Johnson Danny Johnson has been selected as Director of the Division of Maintenance at Southwestern Power Administration (Southwestern), effective July 13, 2014. Johnson has been with the agency since 1986 as an Electrical/Electronics Engineer and has extensive experience in the management of substation, transmission, and communications projects. Johnson began his Southwestern career in 1985 as an intern

  18. Southwestern Power Administration

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Carlos Valencia Named Director of Transmission Engineering and Planning Carlos Valencia Named Director of Division of Transmission Engineering and Planning Carlos Valencia Carlos Valencia has been selected to serve as Director of the Division of Transmission Engineering and Planning at Southwestern Power Administration (Southwestern), effective June 29, 2014. Valencia, who has served as the agency's Director of Maintenance since 2009, has extensive experience in the management of transmission

  19. Southwestern Power Administration

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    January 29, 2015 Stockton Power Plant Back Online Refurbished Stockton Turbine Southwestern Administrator Chris Turner and Kansas City District Commander COL Andrew Sexton dedicate the new turbine at Stockton Power Plant. After a catastrophic failure and nearly two years of major equipment replacement work, the Stockton Power Plant in Stockton, Missouri, is back online, generating low-cost, renewable hydropower and energy for electric consumers in the marketing region of Southwestern Power

  20. Southwestern Power Administration

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    December 9, 2015 Southwestern Announces New Managers Southwestern Power Administration (Southwestern) has named several individuals into management positions in the latter half of 2015. Doug Hart Doug Hart CFO (Chief Financial Officer) Hart Designated as Chief Financial Officer Doug Hart was named Chief Financial Officer of Southwestern in July 2015. Hart is Southwestern's Director of the Division of Financial Management, and will continue to serve in that position. Since 1992, Hart has served

  1. National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    U.S. Department of Energy National Nuclear Security Administration Federal Equal Opportunity Recruitment Program Plan Certification - Fiscal Year 2011 Please type or print clearly and return this sheet with original signature to: Ms. Carmen Andujar, Manager Recruiting, Examining and Assessment Group Center for Talent and Capacity Policy Strategic Human Resources Policy Attn: FY 2011 FEORP Report U.S. Office of Personnel Management 1900 E Street, NW, Room 6547 Washington, D.C. 20415-9800 A. Name

  2. National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    U.S. Department of Energy National Nuclear Security Administration Federal Equal Opportunity Recruitment Program Plan Certification - Fiscal Year 2009 Please type or print clearly and return this sheet with original signature to: Ms. Carmen Andujar, Manager Recruiting, Examining and Assessment Group Center for Talent and Capacity Policy Strategic Human Resources Policy Attn: FY 2009 FEORP Report U.S. Office of Personnel Management 1900 E Street, NW, Room 6547 Washington, D.C. 20415-9800 A. Name

  3. National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    15 National Nuclear Security Administration FY 2013 PER Babcock & Wilcox Technical Services Pantex, LLC Performance Evaluation Report NNSA Production Office Pantex Plant Performance Period: October 2012 - September 2013 November 13, 2013 APPROVED FOR PUBLIC RELEASE This document has been approved for release to the public by: Name / Title: Del W. Kellogg, NPO Pantex Classification Officer Date: 01/06/2014 NNSA Production Office, Pantex 11-13-13 Page 2 of 15 IExecutive Summary This

  4. National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    20 National Nuclear Security Administration FY 2013 PER Babcock & Wilcox Technical Services Y-12, LLC Performance Evaluation Report NNSA Production Office Y-12 Nuclear Security Complex Performance Period: October 2012 - September 2013 December 24, 2013 APPROVED FOR PUBLIC RELEASE This document has been approved for release to the public by: Name / Title: Scott A. Hawks, NPO Y-12 Classification Officer Date: 12/31/2013 NNSA Production Office, Y-12 Page 2 of 20 Executive Summary This

  5. U.S. Energy Information Administration (EIA)

    Annual Energy Outlook [U.S. Energy Information Administration (EIA)]

    ... They also conduct site visits with survey respondents to test questions, software, or new survey instruments. Growing and developing as energy professionals We never stop learning ...

  6. LOS ALAMOS, N. M., Dec. 21, 2012-The National Nuclear Security Administration, a

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    orders security enhancements December 21, 2012 LOS ALAMOS, N. M., Dec. 21, 2012-The National Nuclear Security Administration, a semi-autonomous agency of the U.S. Department of Energy, has directed Los Alamos National Laboratory to increase its security, effective immediately. Because of this government order, until further notice all vehicles entering government property will be required to stop at the East and West Jemez Road "Vehicle Access Portals" (VAPs) for a vehicle check.

  7. Stop Paying for Energy You Aren't Using | Department of Energy

    Energy Savers [EERE]

    Stop Paying for Energy You Aren't Using Stop Paying for Energy You Aren't Using January 6, 2009 - 4:00am Addthis Allison Casey Senior Communicator, NREL Back in October, we heard a lot about "energy vampires." A very convenient holiday metaphor, to be sure, but you're probably not in the Halloween spirit in January. Nonetheless, you may be in the mood to reduce your energy costs, and standby power is something worth considering all year round. Standby power is the minimum power used

  8. Energy Efficiency Tricks to Stop Your Energy Bill from Haunting You |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy Tricks to Stop Your Energy Bill from Haunting You Energy Efficiency Tricks to Stop Your Energy Bill from Haunting You October 26, 2015 - 10:49am Addthis This Halloween, keep ghosts and goblins at bay -- while saving energy and money -- with these home energy efficiency tricks. | Infographic by <a href="/node/379579">Sarah Gerrity</a>, Energy Department. This Halloween, keep ghosts and goblins at bay -- while saving energy and money -- with these

  9. Energy Vampires are Attacking Your Home - Here's How to Stop Them |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy Vampires are Attacking Your Home - Here's How to Stop Them Energy Vampires are Attacking Your Home - Here's How to Stop Them October 20, 2014 - 2:09pm Addthis Using a power strip to switch off appliances ensures your home won't be plagued by energy vampires. | Photo courtesy of ©iStockphoto.com/webking Using a power strip to switch off appliances ensures your home won't be plagued by energy vampires. | Photo courtesy of ©iStockphoto.com/webking Erik Hyrkas Erik

  10. DOE and FERC Joint Public Statement on Back Stop Siting | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy FERC Joint Public Statement on Back Stop Siting DOE and FERC Joint Public Statement on Back Stop Siting October 11, 2011 - 1:32pm Addthis Washington, D.C. - U.S. Energy Secretary Steven Chu announced today his decision that the Department of Energy will work more closely with the Federal Energy Regulatory Commission (FERC) in reviewing proposed electric transmission projects under section 216 of the Federal Power Act (FPA), as an alternative to delegating additional authority to FERC.

  11. Battery Test Manual For 12 Volt Start/Stop Hybrid Electric Vehicles

    SciTech Connect (OSTI)

    Belt, Jeffrey R.

    2015-05-01

    This manual was prepared by and for the United Stated Advanced Battery Consortium (USABC) Electrochemical Energy Storage Team. It is based on the targets established for 12 Volt Start/Stop energy storage development and is similar (with some important changes) to an earlier manual for the former FreedomCAR program. The specific procedures were developed primarily to characterize the performance of energy storage devices relative to the USABC requirements. However, it is anticipated that these procedures will have some utility for characterizing 12 Volt Start/Stop hybrid energy storage device behavior in general.

  12. Western Area Power Administration

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ,v*Zy- i , . r ,v * -i S # Af [, (e- . - o -A tl }r- 0 v-" l^~4~S J l ^-)^ I^U^ck iM clti ^ <p< ^^i~oeii ^' Western Area Power Administration Follow-up to Nov. 25, 2008 Transition Meeting Undeveloped Transmission Right-of-Way Western has very little undeveloped transmission right-of-way. There is a 7-mile right- of-way between Folsom, CA and Roseville, CA where Western acquired a 250' wide right-of-way but is only using half of it. Another line could be built parallel to Western's

  13. Small Business Administration Recovery Act Implementation | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Administration Recovery Act Implementation Small Business Administration Recovery Act Implementation Small Business Administration Recovery Act Implementation PDF icon Small ...

  14. Federal Aviation Administration | Open Energy Information

    Open Energy Info (EERE)

    Aviation Administration Jump to: navigation, search Logo: Federal Aviation Administration Name: Federal Aviation Administration Address: 800 Independence Ave., SW Place:...

  15. Energy Efficiency Program Administration Powerpoint Presentation...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Program Administration Powerpoint Presentation Energy Efficiency Program Administration Powerpoint Presentation Energy Efficiency Program Administration Powerpoint Presentation PDF ...

  16. Fact #853 December 29, 2014 Stop/Start Technology is in nearly 5% of All New Light Vehicles Produced- Dataset

    Broader source: Energy.gov [DOE]

    Excel file with dataset for Fact #853: December  29, 2014 Stop/Start Technology is in nearly 5% of All New Light Vehicles Produced

  17. DEPARTMENT OF DEFENSE GENERAL SERVICES ADMINISTRATION NATIONAL...

    Office of Environmental Management (EM)

    ADMINISTRATION NATIONAL AERONAUTICS AND SPACE ADMINISTRATION 48 CFR Chapter 1 Docket No. ... Services Administration (GSA), and National Aeronautics and Space Administration (NASA). ...

  18. STATEMENT FOR THE RECORD SCOTT CARPENTER ADMINISTRATOR SOUTHWESTERN POWER ADMINISTRATION

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    FOR THE RECORD SCOTT CARPENTER ADMINISTRATOR SOUTHWESTERN POWER ADMINISTRATION U.S. DEPARTMENT OF ENERGY BEFORE THE SUBCOMMITTEE ON WATER, POWER & OCEANS COMMITTEE ON NATURAL RESOURCES U.S. HOUSE OF REPRESENTATIVES MARCH 22, 2016 EXAMINING THE MISSIONS AND IMPACTS OF THE PRESIDENT'S PROPOSED FISCAL YEAR 2017 BUDGETS OF THE U.S. FISH AND WILDLIFE SERVICE, THE NATIONAL OCEAN AND ATMOSPHERIC ADMINISTRATION, THE BUREAU OF RECLAMATION AND THE POWER MARKETING ADMINISTRATIONS Mr. Chairman and

  19. ADMINISTRATIVE RECORDS SCHEDULE 23: ADMINISTRATIVE RECORDS SCHEDULE 23:

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    RECORDS COMMON TO MOST OFFICES | Department of Energy ADMINISTRATIVE RECORDS SCHEDULE 23: RECORDS COMMON TO MOST OFFICES ADMINISTRATIVE RECORDS SCHEDULE 23: ADMINISTRATIVE RECORDS SCHEDULE 23: RECORDS COMMON TO MOST OFFICES This schedule provides for the disposal of certain records common to most offices. It covers administrative subject files; facilitative records such as suspense files, tracking and control records, calendars, and indexes; and documents of transitory value PDF icon

  20. E-Alerts: Environmental pollution and control (solid waste pollution and control). E-mail newsletter

    SciTech Connect (OSTI)

    1999-04-01

    The paper discusses pollution by solid wastes including garbage, scrap, junked automobiles, spoil, sludge, containers; Disposal methods such as composts or land application, injection wells, incineration, sanitary landfills; Mining wastes; Processing for separation and materials recovery; Solid waste utilization; Recycling; Biological and ecological effects; Superfund (Records of Decision, etc.); SITE technology; Laws, legislation, and regulations; Public administration; Economics; Land use. The discussion includes disposal of concentrated or pure liquids such as brines, oils, chemicals, and hazardous materials.

  1. Vehicle Technologies Office: AVTA- Start-Stop (Micro) Hybrid Vehicles Performance Data

    Broader source: Energy.gov [DOE]

    The Advanced Vehicle Testing Activity (AVTA) uses standard procedures and test specifications to test and collect data from vehicles on dynamometers, closed test tracks, and on-the-road. Performance and testing data on the stop-start hybrid versions of the following vehicles is available: 2010 Smart Fortwo, 2010 Volkswagen Golf Diesel, and 2010 Mazda3 Hatchback.

  2. hrp | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    hrp Personnel Security Program NNSA is responsible for managing national nuclear security and supports several key program areas including Defense, Nuclear Nonproliferation, Naval Reactors, Emergency Operations, Infrastructure and Environment, Nuclear Security, Management and Administration and the Office of the Administrator.

  3. accountability | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    accountability | National Nuclear Security Administration Facebook Twitter Youtube Flickr RSS People Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear...

  4. emergencyresponse | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    emergencyresponse | National Nuclear Security Administration Facebook Twitter Youtube Flickr RSS People Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear...

  5. whistleblower | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    whistleblower | National Nuclear Security Administration Facebook Twitter Youtube Flickr RSS People Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear...

  6. NSS | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    NSS Statement on Signing of the Administrative Arrangement to the Agreement for Cooperation between the United States and Republic of Korea Concerning Peaceful Uses of Nuclear Energy (WASHINGTON, D.C.)-Today, Administrator Frank Klotz of the U.S. Department of Energy's National Nuclear Security Administration and Chairman Un Chul Lee of the Republic of Korea's (ROK) Nuclear Safety and Security Commission reached agreement on the terms of the Administrative Arrangement to the... NNSA keeps the

  7. ROK | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    ROK Statement on Signing of the Administrative Arrangement to the Agreement for Cooperation between the United States and Republic of Korea Concerning Peaceful Uses of Nuclear Energy (WASHINGTON, D.C.)-Today, Administrator Frank Klotz of the U.S. Department of Energy's National Nuclear Security Administration and Chairman Un Chul Lee of the Republic of Korea's (ROK) Nuclear Safety and Security Commission reached agreement on the terms of the Administrative Arrange

  8. Counterterrorism | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    Counterterrorism Tilden appointed as Associate Administrator of Counterterrorism and Counterproliferation We are delighted to announce two key personnel changes. Mr. Jay Tilden has officially been appointed as the Associate Administrator for Counterterrorism and Counterproliferation. Jay has been the Acting Associate Administrator since Steve Aoki's departure at the end of last year. ... NNSA announces retirement of Dr. Steve Aoki, after 33 years of service NNSA Administrator Frank Klotz, Dr.

  9. Site Office Contracting Officer E-mail address Ames Site Office Jackie York Jacquelyn.york@ch.doe.gov

    National Nuclear Security Administration (NNSA)

    Site Office Contracting Officer E-mail address Ames Site Office Jackie York Jacquelyn.york@ch.doe.gov Argonne Site Office Jacquelyn York Jacquelyn.york@ch.doe.gov Brookhaven Site Office Evelyn Landini Jennifer Hartmann elandini@bnl.gov jhartmann@bnl.gov Idaho Site Office Paul Allen allenph@id.doe.gov Kansas City Site Office Ralph Tennant rtennant@kcp.gov Lawrence Livermore Site Office Homer Williamson homer.williamson@nnsa.doe.gov Los Alamos Site Office Barbara Romero Robert M. Poole

  10. appointment | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    appointment Tilden appointed as Associate Administrator of Counterterrorism and Counterproliferation We are delighted to announce two key personnel changes. Mr. Jay Tilden has officially been appointed as the Associate Administrator for Counterterrorism and Counterproliferation. Jay has been the Acting Associate Administrator since Steve Aoki's departure at the end of last year.

  11. Congress | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    Congress NNSA administrator shows NM congressional delegation the Albuquerque Complex to make case for new facility WASHINGTON, DC - Lt. Gen. Frank Klotz (Ret.), Administrator of the Department of Energy's National Nuclear Security Administration, hosted two members of the New Mexico congressional delegation on Feb. 18 for a tour of the aging facilities occupied by 1,200 NNSA employees at the Albuquerque Complex

  12. NA 80 - Associate Administrator for Counterterrorism and

    National Nuclear Security Administration (NNSA)

    Counterproliferation | National Nuclear Security Administration 80 - Associate Administrator for Counterterrorism and Counterproliferation

  13. STATEMENT OF HOWARD GRUENSPECHT DEPUTY ADMINISTRATOR ENERGY INFORMATION ADMINISTRATION

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    STATEMENT OF HOWARD GRUENSPECHT DEPUTY ADMINISTRATOR ENERGY INFORMATION ADMINISTRATION U.S. DEPARTMENT OF ENERGY BEFORE THE COMMITTEE ON ENVIRONMENT AND PUBLIC WORKS UNITED STATES SENATE FEBRUARY 24, 2016 2 Chairman Inhofe, Ranking Member Boxer, and members of the committee, thank you for the opportunity to appear here today to discuss the Renewable Fuel Standard (RFS). The Energy Information Administration (EIA) is the statistical and analytical agency within the U.S. Department of Energy. EIA

  14. ADMINISTRATIVE RECORDS SCHEDULE 2: PAYROLL AND PAY ADMINISTRATION RECORDS (SUPERSEDED)

    Broader source: Energy.gov [DOE]

    Payrolling and pay administration records pertain to the disbursements employees receivein return for their personal services.  This schedule covers commonly used pay records.

  15. ADMINISTRATIVE RECORDS SCHEDULE 2: PAYROLL AND PAY ADMINISTRATION...

    Office of Environmental Management (EM)

    records pertain to the disbursements employees receivein return for their personal services. This schedule covers commonly used pay records. PDF icon Administrative...

  16. ADMINISTRATIVE RECORDS SCHEDULE 2: PAYROLL AND PAY ADMINISTRATION...

    Office of Environmental Management (EM)

    records pertain to the disbursements employees receive in return for their personal services. This schedule covers commonly used pay records PDF icon ADMINISTRATIVE...

  17. Measurement of charged-particle stopping in warm-dense plasma

    DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

    Zylstra, A.  B.; Frenje, J.  A.; Grabowski, P. E.; Li, C.  K.; Collins, G.  W.; Fitzsimmons, P.; Glenzer, S.; Graziani, F.; Hansen, S.  B.; Hu, S. X.; et al

    2015-05-27

    We measured the stopping of energetic protons in an isochorically-heated solid-density Be plasma with an electron temperature of ~32 eV, corresponding to moderately-coupled [(e²/a/(kBTe + EF ) ~ 0.3] and moderately-degenerate [kBTe/EF ~2] 'warm dense matter' (WDM) conditions. We present the first high-accuracy measurements of charged-particle energy loss through dense plasma, which shows an increased loss relative to cold matter, consistent with a reduced mean ionization potential. The data agree with stopping models based on an ad-hoc treatment of free and bound electrons, as well as the average-atom local-density approximation; this work is the first test of these theories inmore » WDM plasma.« less

  18. workforce | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    workforce NNSA administrator shows NM congressional delegation the Albuquerque Complex to make case for new facility WASHINGTON, DC - Lt. Gen. Frank Klotz (Ret.), Administrator of the Department of Energy's National Nuclear Security Administration, hosted two members of the New Mexico congressional delegation on Feb. 18 for a tour of the aging facilities occupied by 1,200 NNSA employees at the Albuquerque Complex... DOE Celebrates LGBT Pride Month To recognize the accomplishments of Lesbian,

  19. AVTA: Quantifying the Effects of Idle Stop Systems on Fuel Economy

    Broader source: Energy.gov [DOE]

    The Vehicle Technologies Office's Advanced Vehicle Testing Activity carries out testing on a wide range of advanced vehicles and technologies on dynamometers, closed test tracks, and on-the-road. These results provide benchmark data that researchers can use to develop technology models and guide future research and development. This report gives an overall analysis of stop-start technology. This research was conducted by Idaho National Laboratory.

  20. Freezing a Droplet to Stop the Ice | U.S. DOE Office of Science (SC)

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Freezing a Droplet to Stop the Ice Advanced Scientific Computing Research (ASCR) ASCR Home About Research Facilities Science Highlights Benefits of ASCR Funding Opportunities Advanced Scientific Computing Advisory Committee (ASCAC) Community Resources Contact Information Advanced Scientific Computing Research U.S. Department of Energy SC-21/Germantown Building 1000 Independence Ave., SW Washington, DC 20585 P: (301) 903-7486 F: (301) 903-4846 E: Email Us More Information » 08.01.15 Freezing a

  1. Administrative Management Records | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Administrative Management Records Administrative Management Records This schedule covers those administrative management activities not covered by other Administrative Schedules PDF icon Administrative Management Records More Documents & Publications ADMINISTRATIVE RECORDS SCHEDULE 23: RECORDS COMMON TO MOST OFFICES ADMINISTRATIVE RECORDS SCHEDULE 12: COMMUNICATIONS RECORDS ADM 12

  2. Australia | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    Australia | National Nuclear Security Administration Facebook Twitter Youtube Flickr RSS People Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy...

  3. testmenu | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    testmenu | National Nuclear Security Administration Facebook Twitter Youtube Flickr RSS People Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy...

  4. budget | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    Management and Budget The organization provides timely, cost-effective, and efficient administrative and financial support for NNSA headquarters staff. The major functions of the ...

  5. sba | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    Jobs Our Jobs Working at NNSA Blog Home sba sba SBA recognizes Pantex as a leader Small Business Administration Region VI SBA District Director Calvin Davis and Regional...

  6. DNDO | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    Department of Energy National Nuclear Security Administration (NNSA) helicopter may be seen flying at low altitudes around the California Bay Area from September 1 - 6, 2015. The

  7. Assistant Administrator for Energy Analysis

    Broader source: Energy.gov [DOE]

    The U.S. Energy Information Administration (EIA) collects, analyzes and disseminates independent and impartial energy information to promote sound policymaking, efficient markets and public...

  8. NSTec | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    | National Nuclear Security Administration Facebook Twitter Youtube Flickr RSS People Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy Emergency...

  9. Savannah | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    | National Nuclear Security Administration Facebook Twitter Youtube Flickr RSS People Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy Emergency...

  10. green | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    | National Nuclear Security Administration Facebook Twitter Youtube Flickr RSS People Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy Emergency...

  11. China | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    China NNSA Deputy Administrator Creedon Travels to China United States and China Continue Partnership for the Peaceful Uses of Nuclear Technology United States and China Mark 10th ...

  12. fleet | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    fleet | National Nuclear Security Administration Facebook Twitter Youtube Flickr RSS People Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy...

  13. VPP | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    VPP | National Nuclear Security Administration Facebook Twitter Youtube Flickr RSS People Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy...

  14. ors | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    ors | National Nuclear Security Administration Facebook Twitter Youtube Flickr RSS People Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy...

  15. emt | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    emt | National Nuclear Security Administration Facebook Twitter Youtube Flickr RSS People Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy...

  16. cielo | National Nuclear Security Administration

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    cielo | National Nuclear Security Administration Facebook Twitter Youtube Flickr RSS People Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy...

  17. IT | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    IT | National Nuclear Security Administration Facebook Twitter Youtube Flickr RSS People Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy Emergency...

  18. OSIO | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    OSIO | National Nuclear Security Administration Facebook Twitter Youtube Flickr RSS People Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy...

  19. OCPC | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    OCPC | National Nuclear Security Administration Facebook Twitter Youtube Flickr RSS People Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy...

  20. performance | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    performance | National Nuclear Security Administration Facebook Twitter Youtube Flickr RSS People Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy...

  1. oversight | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    oversight | National Nuclear Security Administration Facebook Twitter Youtube Flickr RSS People Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy...

  2. policy | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    policy | National Nuclear Security Administration Facebook Twitter Youtube Flickr RSS People Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy...

  3. sites | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    sites | National Nuclear Security Administration Facebook Twitter Youtube Flickr RSS People Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy...

  4. AMP | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    AMP | National Nuclear Security Administration Facebook Twitter Youtube Flickr RSS People Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy...

  5. fors | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    fors | National Nuclear Security Administration Facebook Twitter Youtube Flickr RSS People Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy...

  6. airport | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    airport | National Nuclear Security Administration Facebook Twitter Youtube Flickr RSS People Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy...

  7. Uzbekistan | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    Uzbekistan | National Nuclear Security Administration Facebook Twitter Youtube Flickr RSS People Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy...

  8. removal | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    removal | National Nuclear Security Administration Facebook Twitter Youtube Flickr RSS People Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy...

  9. foal | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    foal | National Nuclear Security Administration Facebook Twitter Youtube Flickr RSS People Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy...

  10. Romania | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    Romania | National Nuclear Security Administration Facebook Twitter Youtube Flickr RSS People Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy...

  11. Korea | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    Korea | National Nuclear Security Administration Facebook Twitter Youtube Flickr RSS People Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy...

  12. ap | National Nuclear Security Administration

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    ap | National Nuclear Security Administration Facebook Twitter Youtube Flickr RSS People Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy Emergency...

  13. UPF | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    UPF | National Nuclear Security Administration Facebook Twitter Youtube Flickr RSS People Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy...

  14. exports | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    exports | National Nuclear Security Administration Facebook Twitter Youtube Flickr RSS People Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy...

  15. eota | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    eota | National Nuclear Security Administration Facebook Twitter Youtube Flickr RSS People Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy...

  16. dhs | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    dhs | National Nuclear Security Administration Facebook Twitter Youtube Flickr RSS People Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy...

  17. governance | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    governance | National Nuclear Security Administration Facebook Twitter Youtube Flickr RSS People Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy...

  18. CFR | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    CFR | National Nuclear Security Administration Facebook Twitter Youtube Flickr RSS People Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy...

  19. exportation | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    exportation | National Nuclear Security Administration Facebook Twitter Youtube Flickr RSS People Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy...

  20. nr | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    nr | National Nuclear Security Administration Facebook Twitter Youtube Flickr RSS People Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy Emergency...

  1. cyber | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    cyber | National Nuclear Security Administration Facebook Twitter Youtube Flickr RSS People Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy...

  2. NMIP | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    NMIP | National Nuclear Security Administration Facebook Twitter Youtube Flickr RSS People Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy...

  3. forrestal | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    forrestal | National Nuclear Security Administration Facebook Twitter Youtube Flickr RSS People Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy...

  4. associates | National Nuclear Security Administration

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    associates | National Nuclear Security Administration Facebook Twitter Youtube Flickr RSS People Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy...

  5. tajikistan | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    tajikistan | National Nuclear Security Administration Facebook Twitter Youtube Flickr RSS People Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy...

  6. IND | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    IND | National Nuclear Security Administration Facebook Twitter Youtube Flickr RSS People Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy...

  7. Links | National Nuclear Security Administration

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Links | National Nuclear Security Administration Facebook Twitter Youtube Flickr RSS People Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy...

  8. noc | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    noc | National Nuclear Security Administration Facebook Twitter Youtube Flickr RSS People Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy...

  9. energy | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    energy | National Nuclear Security Administration Facebook Twitter Youtube Flickr RSS ... Apply for Our Jobs Our Jobs Working at NNSA Blog Home energy energy Researchers 3D print ...

  10. Jamaica | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    Jamaica Jamaica NNSA Removes U.S.-Origin HEU from Jamaica, Makes the Caribbean HEU Free WASHINGTON, D.C. - The Department of Energy's National Nuclear Security Administration...

  11. SSIP | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    - The National Nuclear Security Administration (NNSA) today announced the recipients of the 2014 Bradley A. Peterson Federal and Contractor Security Professional of the Year Awards...

  12. DNS | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    - The National Nuclear Security Administration (NNSA) today announced the recipients of the 2014 Bradley A. Peterson Federal and Contractor Security Professional of the Year Awards...

  13. contractor | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    - The National Nuclear Security Administration (NNSA) today announced the recipients of the 2014 Bradley A. Peterson Federal and Contractor Security Professional of the Year Awards...

  14. NMSSUP | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    - The National Nuclear Security Administration (NNSA) today announced the recipients of the 2014 Bradley A. Peterson Federal and Contractor Security Professional of the Year Awards...

  15. SSAC | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    SSAC NNSA and IAEA Hold the 20th International Training Course on Nuclear Material Accounting and Control Washington, D.C. - The National Nuclear Security Administration (NNSA)...

  16. ONAC | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    ONAC NNSA and IAEA Hold the 20th International Training Course on Nuclear Material Accounting and Control Washington, D.C. - The National Nuclear Security Administration (NNSA)...

  17. Search | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    small business administration Smithsonian snl SNL Los Alamos National Laboratory snm solar solar energy solar power Source Physics Experiment South Carolina South Korea SPE-4...

  18. Budget | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    7 budget for NNSA are available here. National Nuclear Security Administration Highlights FY'17 Budget Request Budget Request Reflects Commitment to Maintain a Safe, Secure, and...

  19. Development Administration By Alice Buck

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ... fill key staff positions in Planning and Analysis, Administration, Laboratory and Field ... mandates: the first involved the creation of a national plan for energy research, ...

  20. counterproliferation | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    Security Administration (NNSA) released its report on NNSA's efforts to prevent nuclear proliferation and terrorism, Prevent, Counter, and Respond-A Strategic Plan to Reduce Global

  1. grant | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    - The Department of Energy's National Nuclear Security Administration ( NNSA Hosts Cybersecurity Consortium Members Following White House Announcement of 25 Million in Grants to...

  2. sliderphotos | National Nuclear Security Administration

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    sliderphotos | National Nuclear Security Administration Facebook Twitter Youtube Flickr RSS People Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy...

  3. ITC | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    ITC | National Nuclear Security Administration Facebook Twitter Youtube Flickr RSS People Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy...

  4. internships | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    internships | National Nuclear Security Administration Facebook Twitter Youtube Flickr RSS People Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy...

  5. dnn | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    National Nuclear Security Administration (DOENNSA) and the U.K. Department of Energy and Climate Change concluded a workshop at Wilton Park, Shaping the future of nuclear...

  6. gms | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    National Nuclear Security Administration (DOENNSA) and the U.K. Department of Energy and Climate Change concluded a workshop at Wilton Park, NNSA Provides Tajikistan Specialized...

  7. radiation | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    National Nuclear Security Administration (DOENNSA) and the U.K. Department of Energy and Climate Change concluded a workshop at Wilton Park, NNSA to Conduct Aerial Radiological...

  8. Engineering | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    Engineering The Sandia Field Office's Engineering office performs oversight and contract administration activities for the facilities, projects and environmental programs at Sandia National Laboratories

  9. laos | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    stakeholder organizations attended the event. WASHINGTON - The U.S. Department of Energy's National Nuclear Security Administration (DOENNSA) sponsored the Fundamentals of Nuclear

  10. rsl | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    Conduct Aerial Radiation Monitoring Survey over Boston April 17-20 BOSTON - The National Nuclear Security Administration (NNSA) will measure naturally occurring background...

  11. hydrogen | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    hydrogen | National Nuclear Security Administration Facebook Twitter Youtube Flickr RSS People Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy...

  12. Method and apparatus to debug an integrated circuit chip via synchronous clock stop and scan

    DOE Patents [OSTI]

    Bellofatto, Ralph E.; Ellavsky, Matthew R.; Gara, Alan G.; Giampapa, Mark E.; Gooding, Thomas M.; Haring, Rudolf A.; Hehenberger, Lance G.; Ohmacht, Martin

    2012-03-20

    An apparatus and method for evaluating a state of an electronic or integrated circuit (IC), each IC including one or more processor elements for controlling operations of IC sub-units, and each the IC supporting multiple frequency clock domains. The method comprises: generating a synchronized set of enable signals in correspondence with one or more IC sub-units for starting operation of one or more IC sub-units according to a determined timing configuration; counting, in response to one signal of the synchronized set of enable signals, a number of main processor IC clock cycles; and, upon attaining a desired clock cycle number, generating a stop signal for each unique frequency clock domain to synchronously stop a functional clock for each respective frequency clock domain; and, upon synchronously stopping all on-chip functional clocks on all frequency clock domains in a deterministic fashion, scanning out data values at a desired IC chip state. The apparatus and methodology enables construction of a cycle-by-cycle view of any part of the state of a running IC chip, using a combination of on-chip circuitry and software.

  13. Reaction-in-flight neutrons as a test of stopping power in degenerate plasmas

    SciTech Connect (OSTI)

    Hayes, A. C.; Jungman, Gerard; Schulz, A. E.; Boswell, M.; Fowler, M. M.; Grim, G.; Klein, A.; Rundberg, R. S.; Wilhelmy, J. B.; Wilson, D.; Cerjan, C.; Schneider, D.; Sepke, S. M.; Tonchev, A.; Yeamans, C.

    2015-08-06

    We present the first measurements of reaction-in-flight (RIF) neutrons in an inertial confinement fusion system. The experiments were carried out at the National Ignition Facility, using both Low Foot and High Foot drives and cryogenic plastic capsules. In both cases, the high-energy RIF (En > 15 MeV) component of the neutron spectrum was found to be about 10–4 of the total. The majority of the RIF neutrons were produced in the dense cold fuel surrounding the burning hotspot of the capsule, and the data are consistent with a compressed cold fuel that is moderately to strongly coupled (Γ~ 0.6) and electron degenerate (θFermie~ 4). The production of RIF neutrons is controlled by the stopping power in the plasma. Thus, the current RIF measurements provide a unique test of stopping power models in an experimentally unexplored plasma regime. In conclusion, we find that the measured RIF data strongly constrain stopping models in warm dense plasma conditions, and some models are ruled out by our analysis of these experiments.

  14. Reaction-in-flight neutrons as a test of stopping power in degenerate plasmas

    DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

    Hayes, A. C.; Jungman, Gerard; Schulz, A. E.; Boswell, M.; Fowler, M. M.; Grim, G.; Klein, A.; Rundberg, R. S.; Wilhelmy, J. B.; Wilson, D.; et al

    2015-08-06

    We present the first measurements of reaction-in-flight (RIF) neutrons in an inertial confinement fusion system. The experiments were carried out at the National Ignition Facility, using both Low Foot and High Foot drives and cryogenic plastic capsules. In both cases, the high-energy RIF (En > 15 MeV) component of the neutron spectrum was found to be about 10–4 of the total. The majority of the RIF neutrons were produced in the dense cold fuel surrounding the burning hotspot of the capsule, and the data are consistent with a compressed cold fuel that is moderately to strongly coupled (Γ~ 0.6) andmore » electron degenerate (θFermi/θe~ 4). The production of RIF neutrons is controlled by the stopping power in the plasma. Thus, the current RIF measurements provide a unique test of stopping power models in an experimentally unexplored plasma regime. In conclusion, we find that the measured RIF data strongly constrain stopping models in warm dense plasma conditions, and some models are ruled out by our analysis of these experiments.« less

  15. The Federal Energy Administration | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    The Federal Energy Administration The Federal Energy Administration The Federal Energy Administration - written by Roger Anders Washington, D.C.: U.S. Department of Energy, ...

  16. small business administration | National Nuclear Security Administrati...

    National Nuclear Security Administration (NNSA)

    administration small business administration SBA recognizes Pantex as a leader Small Business Administration Region VI SBA District Director Calvin Davis and Regional...

  17. Center of Excellence | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    NNSA Deputy Administrator Creedon Travels to China In March, National Nuclear Security Administration (NNSA) Principal Deputy Administrator Madelyn Creedon traveled to China to ...

  18. Chapter 42 - Contract Administration | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    2 - Contract Administration Chapter 42 - Contract Administration 42.2 Documentation and Approval of Federally Funded International Travel PDF icon 42.1IndirectCostRateAdministr...

  19. Federal Highway Administration | Open Energy Information

    Open Energy Info (EERE)

    Administration Jump to: navigation, search Logo: Federal Highway Administration Name: Federal Highway Administration Abbreviation: FHWA Address: 1200 New Jersey Ave, SE Place:...

  20. Webtrends Archives by Fiscal Year - Business Administration ...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Business Administration Webtrends Archives by Fiscal Year - Business Administration From the EERE Web Statistics Archive: Office of Business Administration (later renamed to ...

  1. Stopping power for a charged particle moving through three-dimensional nonideal finite-temperature electron gases

    SciTech Connect (OSTI)

    Zhang Ya; Song Yuanhong; Wang Younian [School of Physics and Optoelectronic Technology, Dalian University of Technology, Dalian 116024 (China)

    2011-07-15

    We investigate the interaction of a charged particle with nonideal 3D electron gases by using the quantum hydrodynamic (QHD) theory. The stopping power for a nonideal electron gas at a finite-temperature has been theoretically analyzed and numerically calculated. In our calculation, the impact of nonideality and temperature on stopping power is stressed and clearly presented. The QHD dielectric function is obtained and compared to random-phase approximation result. It is shown that the QHD theory can properly describe the stopping power for higher particle velocities greater than the Bohr velocity.

  2. Electronic Comment Form | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    Electronic Comment Form Draft site-wide environmental impact statement for the continued operation of the DOE/NNSA Nevada National Security Site and off-site locations in the State of Nevada. DOE/NNSA will accept comments until December 2, 2011 Name * E-mail (optional) Organization Comment * Leave this field blank Submit

  3. Ukraine | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    Ukraine NNSA deputy administrator travels to Ukraine Earlier this month, Deputy Administrator for Defense Nuclear Nonproliferation Anne Harrington traveled to Ukraine to celebrate the 20th anniversary of the Science and Technology Center in Ukraine (STCU) and visit the Neutron Source Facility at the Kharkiv Institute of Physics and Technology. The U

  4. sitemap | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    Home sitemap Front page Front page of National Nuclear Security Administration Main menu People Mission Powering the Nuclear Navy Concern for the Environment Protection of People Naval Nuclear Propulsion Plants Management and Administration Public Affairs More About NNSA's Naval Reactors Office Emergency Response Counterterrorism Recapitalizing Our Infrastructure Preventing Proliferation Managing the Stockpile Dismantlement and Disposition Stockpile Stewardship Program Quarterly Experiments

  5. NNSA Personnel Appointments Announced Administrator Gordon Submits...

    National Nuclear Security Administration (NNSA)

    Personnel Appointments Announced Administrator Gordon Submits Organizational Plan to Congress | National Nuclear Security Administration Facebook Twitter Youtube Flickr RSS People...

  6. Independent Oversight Review, National Nuclear Security Administration...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Nuclear Security Administration Production Office - February 2014 Independent Oversight Review, National Nuclear Security Administration Production Office - February 2014 February ...

  7. National Nuclear Security Administration | National Nuclear Security...

    National Nuclear Security Administration (NNSA)

    National Nuclear Security Administration | National Nuclear Security Administration Facebook Twitter Youtube Flickr RSS People Mission Managing the Stockpile Preventing...

  8. ADMINISTRATIVE RECORDS SCHEDULE 1: PERSONNEL RECORDS (Revision...

    Broader source: Energy.gov (indexed) [DOE]

    programs, job vacancies, unemployment compensation, recruitment and employee health ADM 10.pdf More Documents & Publications Administrative Records Schedule 1 ADMINISTRATIVE...

  9. MEMORANDUM FOR THE ADMINISTRATOR, NATIONAL NUCLEAR SECURITY ADMINISTRATION

    Energy Savers [EERE]

    December 10, 2004 MEMORANDUM FOR THE ADMINISTRATOR, NATIONAL NUCLEAR SECURITY ADMINISTRATION THE DIRECTOR, OFFICE OF MANAGEMENT, BUDGET AND EVALUATION/CHIEF FINANCIAL OFFICER FROM: William S. Maharay r Deputy Inspector General for Audit Services Office of Inspector General SUBJECT: Federal Managers' Financial Integrity Act Audit Report Audit Report No.: OAS-L-05-01 We reviewed selected aspects of the Department of Energy's (Department) implementation of the Federal Managers' Financial Integrity

  10. HIV/AIDS Information Resources from the National Library of Medicine-STOP

    SciTech Connect (OSTI)

    Templin-Branner, W. and N. Dancy

    2010-06-15

    The HIV/AIDS Information Resources from the National Library of Medicine training is designed specifically for the UNCFSP HBCU Screening, Testing, Outreach, and Prevention (STOP) HIV/AIDS Program project members to provide valuable health information resources from the National Library of Medicine and other reliable sources to increase awareness of the wealth of treatment information and educational materials that are available on the Internet and to improve prevention and treatment education for their clients. These resources will also meet the needs of community-based organizations

  11. WorldWideScience provides a one-stop search engine to mine global

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    scientific databases in the deep web | U.S. DOE Office of Science (SC) WorldWideScience provides a one-stop search engine to mine global scientific databases in the deep web News News Home Featured Articles Science Headlines 2016 2015 2014 2013 2012 2011 2010 2009 2008 2007 2006 2005 Science Highlights Presentations & Testimony News Archives Communications and Public Affairs Contact Information Office of Science U.S. Department of Energy 1000 Independence Ave., SW Washington, DC 20585

  12. DOE/SC-ARM-09-023 Ordering ARM Data One-Stop Shopping: Getting the

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    23 Ordering ARM Data One-Stop Shopping: Getting the Data You Need From the ARM Data Archive, www.archive.arm.gov, users can select routine data by browsing in the new ARM Data Discovery Tool-the first interface listed on the page. This tool features pre-selected sorts and search logic to help you find atmospheric and climate data faster. As each selection is made, only ARM data meeting the criteria remain visible, leading to the datastream that best suits your needs. When data are ordered, the

  13. Nonproliferation | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    ... to detect nuclear explosions near and far NNSA Deputy Administrator Creedon Travels to China DNN Sentinel Newsletter Volume II, No. 1 (March 2016) Volume I, No. 3 (November 2015) ...

  14. Reading File Bonneville Power Administration

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Reading File Bonneville Power Administration P.O. Box 3621 Portland, Oregon 97208-3621 POWER SERVICES In reply refer to: PG-5 Ms. Renata Kurschner Director, Generation Resource...

  15. ENERGY RESEARCH AND DEVELOPMENT ADMINISTRATION

    Office of Legacy Management (LM)

    .' :h I : ' ENERGY RESEARCH AND DEVELOPMENT ADMINISTRATION WASHINGTON, D.C. 20545 October ... ThcNa andCo,activlties-,are.easily-understandable-in terms of high energy neutron ...

  16. containers | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    National Nuclear Security Administration (DOENNSA) and the U.K. Department of Energy and Climate Change concluded a workshop at Wilton Park, About This Site Budget IG Web Policy...

  17. NSDD | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    National Nuclear Security Administration (DOENNSA) and the U.K. Department of Energy and Climate Change concluded a workshop at Wilton Park, About This Site Budget IG Web Policy...

  18. NA 1 - Immediate Office of the Administrator | National Nuclear Security

    National Nuclear Security Administration (NNSA)

    Administration - Immediate Office of the Administrator

  19. NA 10 - Deputy Administrator for Defense Programs | National Nuclear

    National Nuclear Security Administration (NNSA)

    Security Administration 0 - Deputy Administrator for Defense Programs

  20. NA 40 - Associate Administrator for Emergency Operations | National Nuclear

    National Nuclear Security Administration (NNSA)

    Security Administration 40 - Associate Administrator for Emergency Operations

  1. National Aeronautic and Space Administration | National Nuclear Security

    National Nuclear Security Administration (NNSA)

    Administration National Aeronautic and Space Administration

  2. contracts | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    contracts NNSA Demonstrates its Commitment to Small Business The National Nuclear Security Administration (NNSA) recently selected three small businesses for its new Information Technology (IT) Infrastructure and Cyber Security Support Blanket Purchase Agreement. The contract covers a wide spectrum of IT and Cyber Security support for NNSA's Office of... NNSA Makes Up to $200 Million in Awards to Five Small Business Teams for Enterprise-Wide Management, Organizational and Administrative Support

  3. heu | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    heu NNSA deputy administrator travels to Ukraine Earlier this month, Deputy Administrator for Defense Nuclear Nonproliferation Anne Harrington traveled to Ukraine to celebrate the 20th anniversary of the Science and Technology Center in Ukraine (STCU) and visit the Neutron Source Facility at the Kharkiv Institute of Physics and Technology. The U... NNSA keeps the promises borne out of the Nuclear Security Summit On Thursday and Friday President Obama will host his fourth and final Nuclear

  4. Budget | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    Budget Full details of the President's FY17 budget for NNSA are available here. National Nuclear Security Administration Highlights FY'17 Budget Request Budget Request Reflects Commitment to Maintain a Safe, Secure, and Effective Nuclear Deterrent; Prevent, Counter, and Respond to Global Nuclear Dangers; and Effectively Power the Nuclear Navy Feb. 9, 2016 (WASHINGTON) - The U.S. Department of Energy's (DOE) National Nuclear Security Administration (NNSA) today released details of its portion of

  5. Japan | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    Japan Fukushima: Five Years Later After the March 11, 2011, Japan earthquake, tsunami, and ensuing nuclear reactor accident, the United States sent Department of Energy (DOE) National Nuclear Security Administration (NNSA) emergency response teams. The NNSA teams included nuclear experts in predictive modeling, monitoring, sample... U.S-, Japan Exchange Best Practices on Nuclear Emergency Response Washington D.C.--The Department of Energy's (DOE) National Nuclear Security Administration (NNSA)

  6. In-Cab Air Quality of Trucks Air Conditioned and Kept in Electrified Truck Stop

    SciTech Connect (OSTI)

    Lee, Doh-Won; Zietsman, Josias; Farzaneh, Mohamadreza; Li, Wen-Whai; Olvera, Hector; Storey, John Morse; Kranendonk, Laura

    2009-01-01

    At night, long-haul truck drivers rest inside the cabins of their vehicles. Therefore, the in-cab air quality while air conditioning (A/C) is being provided can be a great concern to the drivers health. The effect of using different A/C methods [truck's A/C, auxiliary power unit (APU), and truck stop electrification (TSE) unit] on in-cab air quality of a heavy-duty diesel vehicle was investigated at an electrified truck stop in the El Paso, Texas, area. The research team measured the in-cabin and the ambient air quality adjacent to the parked diesel truck as well as emissions from the truck and an APU while it was providing A/C. The measured results were compared and analyzed. On the basis of these results, it was concluded that the TSE unit provided better in-cab air quality while supplying A/C. Furthermore, the truck and APU exhaust emissions were measured, and fuel consumption of the truck (while idling) and the APU (during operation) were compared. The results led to the finding that emissions from the APU were less than those from the truck's engine idling, but the APU consumed more fuel than the engine while providing A/C under given conditions.

  7. TWRS information locator database system administrator`s manual

    SciTech Connect (OSTI)

    Knutson, B.J., Westinghouse Hanford

    1996-09-13

    This document is a guide for use by the Tank Waste Remediation System (TWRS) Information Locator Database (ILD) System Administrator. The TWRS ILD System is an inventory of information used in the TWRS Systems Engineering process to represent the TWRS Technical Baseline. The inventory is maintained in the form of a relational database developed in Paradox 4.5.

  8. Mentoring Program | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    Mentoring Program Learning doesn't stop with a college or post-graduate degree. It is a key part of individual career development and is central to NNSA's efforts to build a highly-skilled workforce ready to meet the challenges of a changing world. Learning doesn't stop with a college or post-graduate degree. It is a key part of individual career development and is central to NNSA's efforts to build a highly-skilled workforce ready to meet the challenges of a changing world. Mentoring is a

  9. Career Growth | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    NNSA Career Growth Learning doesn't stop with a college or post-graduate degree. It is a key part of individual career development and is central to NNSA's efforts to build a highly-skilled workforce ready to meet the challenges of a changing world. Learning doesn't stop with a college or post-graduate degree. It is a key part of individual career development and is central to NNSA's efforts to build a highly-skilled workforce ready to meet the challenges of a changing world. NNSA is investing

  10. Career Paths | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    Career Paths Learning doesn't stop with a college or post-graduate degree. It is a key part of individual career development and is central to NNSA's efforts to build a highly-skilled workforce ready to meet the challenges of a changing world. Learning doesn't stop with a college or post-graduate degree. It is a key part of individual career development and is central to NNSA's efforts to build a highly-skilled workforce ready to meet the challenges of a changing world. NNSA executives listened

  11. InTeach | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    InTeach Learning doesn't stop with a college or post-graduate degree. It is a key part of individual career development and is central to NNSA's efforts to build a highly-skilled workforce ready to meet the challenges of a changing world. Learning doesn't stop with a college or post-graduate degree. It is a key part of individual career development and is central to NNSA's efforts to build a highly-skilled workforce ready to meet the challenges of a changing world. NNSA employees have a wealth

  12. Stopping Power of Different Ions in Si Measured with a Bulk Sample Method and Bayesian Inference Data Analysis

    SciTech Connect (OSTI)

    Barradas, N. P.; Alves, E.; Siketic, Z.; Radovic, I. Bogdanovic

    2009-03-10

    The accuracy of ion beam analysis experiments depends critically on the stopping power values available. While for H and He ions accuracies normally better than 5% are achieved by usual interpolative schemes such as SRIM, for heavier ions the accuracy is worse. One of the main reasons is that the experimental data bases are very sparse, even for important materials such as Si. New measurements are therefore needed. Measurement of stopping power is often made with transmission in thin films, with the usual problems of film thickness homogeneity. We have previously developed an alternative method based on measuring bulk spectra, and fitting the yield by treating the stopping power as a fit parameter in a Bayesian inference Markov chain Monte Carlo procedure included in the standard IBA code NDF. We report on improvements of the method and on its application to the determination of the stopping power of {sup 7}Li in Si. To validate the method, we also apply it to the stopping of {sup 4}He in Si, which is known with 2% accuracy.

  13. National Nuclear Security Administration | Department of Energy

    Office of Environmental Management (EM)

    Administration National Nuclear Security Administration PDF icon National Nuclear Security Administration More Documents & Publications Global Threat Reduction Initiative U.S. Global Threat Reduction Initiative/U.S.-Origin Nuclear Fuel Removals EIS-0249: Record of Decision (September 1996)

  14. Categorical Exclusion Determinations: Western Area Power Administration |

    Energy Savers [EERE]

    Department of Energy Administration Categorical Exclusion Determinations: Western Area Power Administration Categorical Exclusion Determinations issued by Western Area Power Administration. DOCUMENTS AVAILABLE FOR DOWNLOAD No downloads found for this office.

  15. sfo | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    sfo Sandia National Laboratory Sandia Field Office Contact the Field Office Contract Administration & Business Management Emergency Information Facilities & Projects Nuclear Operations Environment, Safety & Health Public Affairs Safeguards & Security Performance and Quality Assurance Programs NEPA Reading Room... Sandia National Laboratories

  16. computing | National Nuclear Security Administration

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    computing NNSA Announces Procurement of Penguin Computing Clusters to Support Stockpile Stewardship at National Labs The National Nuclear Security Administration's (NNSA's) Lawrence Livermore National Laboratory today announced the awarding of a subcontract to Penguin Computing - a leading developer of high-performance Linux cluster computing systems based in Silicon Valley - to bolster computing for stockpile

  17. lllnl | National Nuclear Security Administration

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    lllnl NNSA Announces Procurement of Penguin Computing Clusters to Support Stockpile Stewardship at National Labs The National Nuclear Security Administration's (NNSA's) Lawrence Livermore National Laboratory today announced the awarding of a subcontract to Penguin Computing - a leading developer of high-performance Linux cluster computing systems based in Silicon Valley - to bolster computing for stockpile

  18. NSDD | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    NSDD NNSA Co-Hosts Nuclear Security Summit Workshop on Maritime Security with UK WASHINGTON - This week, the Department of Energy's National Nuclear Security Administration (DOE/NNSA) and the U.K. Department of Energy and Climate Change concluded a workshop at Wilton Park, United Kingdom, on the growing challenge of securing the global maritime supply chain. In

  19. USACE | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    USACE Design-Build Contract Awarded for Electrical Substation at Los Alamos National Laboratory LOS ALAMOS, NM - Under an interagency agreement with the Department of Energy's National Nuclear Security Administration (DOE/NNSA), the U.S. Army Corps of Engineers (USACE) has awarded a design-build contract at Los Alamos National Laboratory (LANL) to Gardner Zemke Mechanical

  20. Utah | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    Utah Gamma Shield Thunder Exercise Concludes National Nuclear Security Administration (NNSA) and the FBI announced today the completion of the Gamma Shield Thunder counterterrorism table-top exercise at LDS Hospital. The exercise is part of NNSA's Silent Thunder table-top series, which is aimed at giving federal, state and local

  1. containers | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    containers NNSA Co-Hosts Nuclear Security Summit Workshop on Maritime Security with UK WASHINGTON - This week, the Department of Energy's National Nuclear Security Administration (DOE/NNSA) and the U.K. Department of Energy and Climate Change concluded a workshop at Wilton Park, United Kingdom, on the growing challenge of securing the global maritime supply chain. In

  2. hepf | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    hepf Construction on Pantex High Explosives Pressing Facility Reaches 85% Mark WASHINGTON, D.C. - Work on the National Nuclear Security Administration's (NNSA) High Explosives Pressing Facility at its Pantex Plant, located near Amarillo, Texas, this month passed the 85 percent construction completion mark and is on schedule and under budget. The new 45,000 square-foot state-

  3. npcr | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    npcr NNSA Delivers Annual Reports to Congress on Progress for Stockpile Stewardship and Nuclear Nonproliferation WASHINGTON, D.C.-The Department of Energy's National Nuclear Security Administration (DOE/NNSA) today released the annual reports outlining the strategic direction for two of its vital and enduring missions-maintaining a safe, secure and effective nuclear deterrent and reducing the threat of

  4. visit | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    visit NNSA Hosts NPT Parties at Los Alamos and Sandia National Laboratories WASHINGTON D.C. - On March 25-27, 2015, the National Nuclear Security Administration (NNSA) hosted representatives from 11 States Parties to the Treaty on the Non-Proliferation of Nuclear Weapons (NPT) and one representative from the United Nations Office for Disarmament Affairs. The

  5. Armenia | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    Armenia Armenia Secures Dangerous Radioactive Sources in Cooperation with NNSA The Department of Energy's National Nuclear Security Administration (NNSA) joined the Republic of Armenia today to announce the safe and secure removal of three unused radioactive sources from two locations in Yerevan, Armenia. The successful completion of the radioactive source recovery campaign

  6. CFC | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    CFC NNSA thanks CFC key workers for a job well done In a late March ceremony, NNSA Principal Deputy Administrator Madelyn Creedon thanked key workers in NNSA's most recent season of giving in the largest and most successful workplace fundraising campaign in the world, the 2015 Combined Federal Campaign (CFC). Largely due to the efforts of 14 people...

  7. BUILDER | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    BUILDER NNSA Achieves Major Milestone in BUILDER Implementation WASHINGTON, D.C. - The Department of Energy's National Nuclear Security Administration (DOE/NNSA) achieved a major milestone in improving the management of the Nuclear Security Enterprise's infrastructure through the successful migration of all current information on building

  8. JCPOA | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    JCPOA NNSA Delivers Annual Reports to Congress on Progress for Stockpile Stewardship and Nuclear Nonproliferation WASHINGTON, D.C.-The Department of Energy's National Nuclear Security Administration (DOE/NNSA) today released the annual reports outlining the strategic direction for two of its vital and enduring missions-maintaining a safe, secure and effective nuclear deterrent and reducing the threat

  9. MIS | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    MIS NNSA's G2 Management Information System Wins Association for Enterprise Information's (AFEI) "Excellence in Enterprise Information Award" The G2 team and the 2015 Association for Enterprise Information's (AFEI) Excellence in Enterprise Information Award. (WASHINGTON, D.C) - The National Nuclear Security Administration (NNSA) has received the 2015 Association for Enterprise Information's (AFEI) Excellence in Enterprise Information

  10. Massachusetts | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    Massachusetts NNSA to conduct Aerial Radiation Assessment Survey over Boston area BOSTON - On April 12 through April 15, the U.S. Department of Energy's National Nuclear Security Administration's (NNSA) will conduct low-altitude helicopter flights around Boston to measure naturally occurring background radiation. Officials from NNSA announced that the

  11. MSI | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    Home MSI NNSA's Minority Serving Institutions Internship Program On Thursday, July 16, NNSA Administrator Klotz had a brown bag lunch with the 14 high school and college students participating in NNSA's Minority Serving Institutions' (MSI) Internship Program assigned to NNSA headquarters. The MSI Internship Program targets students who are majoring in...

  12. NNSA Administrator honors nonproliferation research leader | National

    National Nuclear Security Administration (NNSA)

    Nuclear Security Administration Administrator honors nonproliferation research leader Monday, May 16, 2016 - 11:41am NNSA Administrator Lt. Gen. Frank G. Klotz (Ret.), right, presents the agency's Distinguished Service Gold Medal Award to Assistant Deputy Administrator for Nonproliferation Research and Development Dr. Rhys Williams. Last week DOE Under Secretary for Nuclear Security and NNSA Administrator Lt. Gen. Frank G. Klotz (Ret.) presented the agency's Assistant Deputy Administrator

  13. Resonant formation of {Lambda}(1405) by stopped-K{sup -} absorption in the deuteron

    SciTech Connect (OSTI)

    Esmaili, Jafar; Akaishi, Yoshinori; Yamazaki, Toshimitsu

    2011-05-15

    To solve the current debate on the position of the quasibound K{sup -}p state, namely, ''{Lambda}(1405) or {Lambda}*(1420),'' we propose to measure the T{sub 21}=T{sub {Sigma}{pi}<-K}-bar{sub N} {Sigma}{pi} invariant-mass spectrum in stopped-K{sup -} absorption in the deuteron, since the spectrum, reflecting the soft and hard deuteron momentum distribution, is expected to have a narrow quasifree component with an upper edge of M=1430 MeV/c{sup 2}, followed by a significant 'high-momentum' tail toward the lower mass region, where a resonant formation of {Lambda}(1405) of any mass and width in a wide range will be clearly revealed. We introduce a 'deviation' spectrum as defined by DEV = OBS (observed or calculated) / QF (nonresonant quasifree), in which the resonant component can be seen as an isolated peak free from the QF shape.

  14. Southeastern Power Administration 2011 Annual Report | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    1 Annual Report Southeastern Power Administration 2011 Annual Report This report reflects ... More Documents & Publications Southeastern Power Administration 2010 Annual Report ...

  15. Southeastern Power Administration 2009 Annual Report | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    9 Annual Report Southeastern Power Administration 2009 Annual Report This past year, ... More Documents & Publications Southeastern Power Administration 2008 Annual Report ...

  16. Obama Administration Announces Billions in Lending Authority...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    and to Modernize the Grid Obama Administration Announces Billions in Lending ... reliably," said Secretary Chu. "This administration has set a goal of doubling renewable ...

  17. Southeastern Power Administration 2013 Annual Report | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    3 Annual Report Southeastern Power Administration 2013 Annual Report This report reflects ... More Documents & Publications Southeastern Power Administration 2010 Annual Report ...

  18. Southeastern Power Administration 2010 Annual Report | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    0 Annual Report Southeastern Power Administration 2010 Annual Report This past year, ... More Documents & Publications Southeastern Power Administration 2008 Annual Report ...

  19. Southeastern Power Administration | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Southeastern Power Administration Southeastern Power Administration Power Operations Click to view a map of SEPA power operations. Latest Rate Schedules October 1, 2015 KP-AP-1-C ...

  20. Southeastern Power Administration 2012 Annual Report | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    2 Annual Report Southeastern Power Administration 2012 Annual Report This report reflects ... More Documents & Publications Southeastern Power Administration 2010 Annual Report ...

  1. Southeastern Power Administration 2008 Annual Report | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    8 Annual Report Southeastern Power Administration 2008 Annual Report This past year, ... More Documents & Publications Southeastern Power Administration 2010 Annual Report ...

  2. Western Area Power Administration Borrowing Authority, Recovery...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Western Area Power Administration Borrowing Authority, Recovery Act Western Area Power Administration Borrowing Authority, Recovery Act PDF icon Microsoft Word - PSRP May 15 2009 ...

  3. Southeastern Power Administration 2007 Annual Report | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    7 Annual Report Southeastern Power Administration 2007 Annual Report This past year, ... More Documents & Publications Southeastern Power Administration 2010 Annual Report ...

  4. National Nuclear Security Administration | National Nuclear Security

    National Nuclear Security Administration (NNSA)

    Administration Rights / Workforce Statistics National Nuclear Security Administration FY15 Year End Report Semi Annual Report FY14 Year End Report Semi Annual Report

  5. Public Utilities Specialist (Contracts- Senior Contract Administrator)

    Broader source: Energy.gov [DOE]

    This position is located in the Contract Administration group of the Contract Management and Administration (KSC) organization, Customer Support Services (KS), Chief Operating Officer (K),...

  6. Kathleen Carlson Appointed Interim Acting Deputy Administrator...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Kathleen Carlson Appointed Interim Acting Deputy Administrator for Defense Programs | National Nuclear Security Administration Facebook Twitter Youtube Flickr RSS People Mission...

  7. SPECIAL REVIEW The National Nuclear Security Administration's...

    Broader source: Energy.gov (indexed) [DOE]

    FOR THE ADMINISTRATOR, NATIONAL NUCLEAR SECURITY ADMINISTRATION FROM: Rickey R. Hass Deputy Inspector General for Audits and Inspections Office of Inspector General...

  8. Idaho Administrator's Memorandum on Transfer Processing Policies...

    Open Energy Info (EERE)

    Administrator's Memorandum on Transfer Processing Policies and Procedures Jump to: navigation, search OpenEI Reference LibraryAdd to library Memorandum: Idaho Administrator's...

  9. THE FEDERAL ENERGY ADMINISTRATION By Roger Anders

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ... and Production Act, required the Federal Energy Administration to improve data collection by the creation of an assistant administrator for energy information and analysis. ...

  10. Management & Administration Reports | Department of Energy

    Broader source: Energy.gov (indexed) [DOE]

    Management Alert: OAS-RA-12-01 Western Area Power Administration's Control and Administration of American Recovery and Reinvestment Act Borrowing Authority October 28, 2011...

  11. National Oceanic and Atmospheric Administration (NOAA) | Open...

    Open Energy Info (EERE)

    National Oceanic and Atmospheric Administration (NOAA) Jump to: navigation, search Logo: National Oceanic and Atmospheric Administration (NOAA) Name: National Oceanic and...

  12. Western Area Power Administration | Open Energy Information

    Open Energy Info (EERE)

    Western Area Power Administration Jump to: navigation, search Name: Western Area Power Administration Place: Colorado Phone Number: 720-962-7000 Website: ww2.wapa.govsites...

  13. Administration Building demolition completed under budget

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Administration Building demolition completed under budget Administration Building demolition completed under budget Project activities started in April 2009 and was completed five...

  14. Harold Washington Social Security Administration (SSA) Center...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Harold Washington Social Security Administration (SSA) Center Water Conservation and Green Energy Harold Washington Social Security Administration (SSA) Center Water Conservation ...

  15. Administrative Contacts | Stanford Synchrotron Radiation Lightsource

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Administrative Contacts Business and Administration Stephanie Carlson SSRL Business Manager x2033 Natalie Cramar SSRL Financial Planner Budgets, Proposals, Financial planning,...

  16. Comments of the Bonneville Power Administration | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    the Bonneville Power Administration Comments of the Bonneville Power Administration BPA appreciates the opportunity to provide comments and information and submits the following...

  17. Hawaii Administrative Rules | Open Energy Information

    Open Energy Info (EERE)

    Not provided DOI Not Provided Check for DOI availability: http:crossref.org Online Internet link for Hawaii Administrative Rules Citation Hawaii Administrative Rules (2014)....

  18. Nevada Administrative Code | Open Energy Information

    Open Energy Info (EERE)

    Not provided DOI Not Provided Check for DOI availability: http:crossref.org Online Internet link for Nevada Administrative Code Citation Nevada Administrative Code (2014)....

  19. Oregon Administrative Rules | Open Energy Information

    Open Energy Info (EERE)

    Not provided DOI Not Provided Check for DOI availability: http:crossref.org Online Internet link for Oregon Administrative Rules Citation Oregon Administrative Rules (2014)....

  20. Arizona Administrative Code | Open Energy Information

    Open Energy Info (EERE)

    Arizona Administrative Code Jump to: navigation, search OpenEI Reference LibraryAdd to library Legal Document- RegulationRegulation: Arizona Administrative CodeLegal Abstract This...

  1. The Maritime Administration's Energy and Emissions Program -...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Maritime Administration PDF icon 2002deergore1.pdf More Documents & Publications Recent Diesel Engine Emission Mitigation Activities of the Maritime Administration Energy ...

  2. The Maritime Administration's Energy and Emissions Program -...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Maritime Administration PDF icon 2002deergore2.pdf More Documents & Publications Recent Diesel Engine Emission Mitigation Activities of the Maritime Administration Energy ...

  3. MailedForm.pptx

    National Nuclear Security Administration (NNSA)

    Businesses using high-activity radioactive sources (Cesium-137, Cobalt-60, Americium-241, ... to: Kristina Hatcher, U.S. Department of Energy, 1000 Independence Ave., S.W., ...

  4. This report is mandatory under the Federal Energy Administration...

    U.S. Energy Information Administration (EIA) Indexed Site

    ... Contracting Manufacturer Name Contact Name Address Phone E-Mail 2.3 Subsidiary or Business ... Dollars Dollars Dollars Dollars (1) Value of Total Shipments (from b.4 in whole ) ...

  5. U. S. DEPARTMENT OF ENERGY ENERGY INFORMATION ADMINISTRATION

    U.S. Energy Information Administration (EIA) Indexed Site

    9659. Mail forms to: Oil & Gas Survey U.S. Department of Energy Ben Franklin Station ... for volumes andor prices, and revise the report(s) for the appropriate prior period(s). ...

  6. fmd | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    Home fmd Nonproliferation Working in close collaboration with DOE laboratories, DNN develops and tests new technologies to advance U.S. capabilities to monitor nonproliferation and arms control treaty and agreement implementation, provides unique training and capacity-building programs, and engages internationally to... Analysis of Surplus Weapons-Grade Plutonium Disposition Options The Administration remains firmly committed to disposing of surplus weapon-grade plutonium. However, through an

  7. npo | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    npo NNSA NPO M&O Contract Placement Team receives DOE 2015 Secretary's Achievement Award The National Nuclear Security Administration's (NNSA) Production Office (NPO) Management and Operating (M&O) Contract Placement team recently received the 2014 Secretary of Energy Achievement Award for their efforts in fostering innovation through efficient procurement strategy. Through... Pantex, Y-12 celebrate 'One Team, Better Together' Thousands of employees at the Pantex Plant and the Y-12

  8. SOUTHWESTERN POWER ADMINISTRATION ANNUAL REPORT

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    ADMINISTRATION ANNUAL REPORT 20 10 This page inTenTionally lefT blank. S o u t h w e S t e r n p o w e r a d m i n i S t r at i o n pa g e 1 2010 a n n u a l r e p o r t Table of conTenTs Letter to the Secretary ------------------------------------------------------------------------------------- 3 Southwestern System Map ------------------------------------------------------------------------------- 4 About Southwestern

  9. NPT | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    NPT NNSA Labs host U.S. and Nuclear Non-Proliferation Treaty (NPT) Non-Nuclear Weapon State Representatives NNSA Principal Deputy Administrator Madelyn Creedon with SNL Director and President Jill Hruby welcome Department of State Representatives and seven NPT Non-Nuclear Weapon State Representatives for 2nd NPT Transparency Visit. WASHINGTON - On October 26 and 27, 2015, Los Alamos National... NNSA Hosts NPT Parties at Los Alamos and Sandia National Laboratories WASHINGTON D.C. - On March

  10. ODP | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    ODP NNSA Physicist Named One of Ebony's Power 100 Dr. Njema Frazier walked the red carpet at the Ebony Power 100 event in Los Angeles Dec. 2. Dr. Njema Frazier is a physicist in the NNSA's Office of Defense Programs, leading scientific and technical efforts to ensure that the United States maintains a credible nuclear deterrent... NNSA releases Stockpile Stewardship Program quarterly experiments summary WASHIGTON, DC. - The National Nuclear Security Administration today released its current

  11. Programs | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    Programs The SFO Sandia Field Office's Programs office is responsible for oversight and contract administration activities in support of mission execution policy areas at Sandia National Laboratories. These programs Oversight responsibilities include: oversight in support of NNSA Nuclear Weapon Defense Programs (NA-10) at SNL; oversight and coordination of all classified and unclassified Inter-Agency Work packages; oversight and coordination of all Non-NNSA DOE programs; oversight and

  12. SSMP | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    SSMP NNSA Delivers Annual Reports to Congress on Progress for Stockpile Stewardship and Nuclear Nonproliferation WASHINGTON, D.C.-The Department of Energy's National Nuclear Security Administration (DOE/NNSA) today released the annual reports outlining the strategic direction for two of its vital and enduring missions-maintaining a safe, secure and effective nuclear deterrent and reducing the threat of... NNSA Releases Annual Stockpile Stewardship & Management Plan Annual Report Provides

  13. Switzerland | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    Switzerland United States Collaborates with Switzerland to Remove Last Remaining Separated Plutonium (WASHINGTON, D.C.) - The Department of Energy's National Nuclear Security Administration (NNSA), working in collaboration with the Government of Switzerland, announced that approximately 20 kilograms of separated plutonium have been transported from Switzerland to the United States. The... Last HEU Removed from Switzerland under NNSA Collaboration WASHINGTON, D.C. - The Department of Energy's

  14. ams | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    ams NNSA to Participate in Aerial Radiation Training Exercise in Philadelphia, Pennsylvania (WASHINGTON, D.C.) - On March 21 through March 24, the Department of Energy's National Nuclear Security Administration (NNSA) will participate in a federal and state/local training exercise in Philadelphia that will also include the Philadelphia Police Department and the Departments of Defense,... DC Survey 2013 DC Background Survey (.zip) NNSA to Conduct Aerial Radiation Monitoring Survey over Boston

  15. boston | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    boston NNSA to conduct Aerial Radiation Assessment Survey over Boston area BOSTON - On April 12 through April 15, the U.S. Department of Energy's National Nuclear Security Administration's (NNSA) will conduct low-altitude helicopter flights around Boston to measure naturally occurring background radiation. Officials from NNSA announced that the... NNSA to conduct Aerial Radiation Assessment Survey over Boston Harbor BOSTON- A helicopter may be seen flying at low altitudes around Boston Harbor

  16. dnn | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    dnn Dedication of Radioactive Source Storage Facilities in Tajikistan (Dushanbe, Tajikistan) - On May 11, the United States' Embassy of Tajikistan, the Department of Energy/National Nuclear Security Administration (DOE/NNSA), the United Kingdom's Department of Energy and Climate Change (DECC), and the Government of Tajikistan dedicated two... NNSA Researchers Advance Technology for Remote Reactor Monitoring NNSA's Defense Nuclear Nonproliferation Research and Development Program drives the

  17. gms | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    gms NNSA Co-Hosts Nuclear Security Summit Workshop on Maritime Security with UK WASHINGTON - This week, the Department of Energy's National Nuclear Security Administration (DOE/NNSA) and the U.K. Department of Energy and Climate Change concluded a workshop at Wilton Park, United Kingdom, on the growing challenge of securing the global maritime supply chain. In... NNSA Provides Tajikistan Specialized Vehicles to Transport Radiological Materials NNSA Program Manager Nick Cavellero, right, and NRSA

  18. helicopter | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    helicopter NNSA to conduct Aerial Radiation Assessment Survey over Boston area BOSTON - On April 12 through April 15, the U.S. Department of Energy's National Nuclear Security Administration's (NNSA) will conduct low-altitude helicopter flights around Boston to measure naturally occurring background radiation. Officials from NNSA announced that the... Department of Energy's chief risk officer visits Nevada National Security Site Earlier this month, Associate Deputy Secretary John MacWilliams

  19. infrastructure | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    infrastructure NNSA Achieves Major Milestone in BUILDER Implementation WASHINGTON, D.C. - The Department of Energy's National Nuclear Security Administration (DOE/NNSA) achieved a major milestone in improving the management of the Nuclear Security Enterprise's infrastructure through the successful migration of all current information on building... Extended Life Program asks 'How do you make your buildings last?' The challenge is this: Preserve two key processing facilities at Y-12 National

  20. lep | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    lep NNSA Delivers Annual Reports to Congress on Progress for Stockpile Stewardship and Nuclear Nonproliferation WASHINGTON, D.C.-The Department of Energy's National Nuclear Security Administration (DOE/NNSA) today released the annual reports outlining the strategic direction for two of its vital and enduring missions-maintaining a safe, secure and effective nuclear deterrent and reducing the threat of... NNSA Honors SRS Employees for Excellence Don Zecha, center, representative of the Savannah

  1. radiation | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    radiation NNSA to conduct Aerial Radiation Assessment Survey over Boston area BOSTON - On April 12 through April 15, the U.S. Department of Energy's National Nuclear Security Administration's (NNSA) will conduct low-altitude helicopter flights around Boston to measure naturally occurring background radiation. Officials from NNSA announced that the... NNSA to Participate in Aerial Radiation Training Exercise in Philadelphia, Pennsylvania (WASHINGTON, D.C.) - On March 21 through March 24, the

  2. russia | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    russia NNSA Partnership Successfully Removes All Remaining HEU from Uzbekistan WASHINGTON, DC - Today, the Department of Energy's National Nuclear Security Administration (DOE/NNSA) announced the successful return of the final 5 kilograms (approximately 11 pounds) of highly enriched uranium (HEU) spent fuel from the IIN-3M "Foton" research reactor in Tashkent, Uzbekistan to... US, Kazakhstan Cooperate to Eliminate Highly Enriched Uranium WASHINGTON D.C - The Department of Energy's

  3. Kazakhstan | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    Kazakhstan NNSA Hosts International Nuclear Forensics Workshop with Participants from Eight Countries WASHINGTON, D.C. - During May 11-22, the National Nuclear Security Administration's (NNSA) Nuclear Smuggling Detection and Deterrence program held a hands-on nuclear forensics course at the Pacific Northwest National Laboratory (PNNL) in Richland, Washington. The "International Training Course on... US, Kazakhstan Cooperate to Eliminate Highly Enriched Uranium WASHINGTON D.C - The

  4. National Nuclear Security Administration Overview

    Office of Environmental Management (EM)

    1, 2011 - Page 1 National Transportation Stakeholders Forum Denver, Colorado May 11, 2011 Ahmad Al-Daouk Manager, National Security Department (NSD) National Nuclear Security Administration (NNSA) Service Center - Albuquerque, NM May 11, 2011 - Page 2 National Transportation Stakeholders Forum (NTSF) * Introduction * NNSA Certifying Official Role * Offsite Source Recovery Project * Waste Shipments * Nuclear Materials Management Planning * Summary May 11, 2011 - Page 3 NNSA Plays a Critical Role:

  5. Links | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    Links NNSA HQ National Nuclear Security Administration Advanced Simulation & Computing NNSA Graduate Program NNSA Small Business Program Office of Defense Nuclear Nonproliferation Field Offices NNSA Albuquerque Complex Kansas City Field Office Livermore Field Office Los Alamos Field Office Naval Reactors Idaho Branch Office Nevada Field Office Sandia Field Office DOE Oak Ridge Sites Oak Ridge Office Oak Ridge National Laboratory UCOR Oak Ridge Institute for Science and Education Oak Ridge

  6. MOX | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    MOX Mixed Oxide (MOX) Fuel Fabrication Facility Documents related to the project: Plutonium Disposition Study Options Independent Assessment Phase 1 Report, April 13, 2015 Plutonium Disposition Study Options Independent Assessment Phase 2 Report, August 20, 2015 Final Report of the Plutonium Disposition Red Team, August 13, 2015 Commentary on... Analysis of Surplus Weapons-Grade Plutonium Disposition Options The Administration remains firmly committed to disposing of surplus weapon-grade

  7. PUNT | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    PUNT U.S. and China Continue Cooperative Partnership to Advance Safe, Secure Civil Nuclear Energy for Clean Energy Future DOE/NNSA Hosts 11th U.S.-China Peaceful Uses of Nuclear Technology Meeting at Savannah River National Laboratory in Aiken, South Carolina (Aiken, South Carolina) - On May 10-11, 2016 the U.S. Department of Energy's (DOE) National Nuclear Security Administration (NNSA) and the China... United States and China Continue Partnership for the Peaceful Uses of Nuclear Technology

  8. explosives | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    Home explosives NNSA Conducts Fifth Experiment aimed to Improve U.S. Ability to Detect Foreign Nuclear Explosions WASHINGTON, D.C. - On April 26, the Department of Energy's National Nuclear Security Administration (DOE/NNSA) conducted the fifth experimental conventional explosion as part of its Source Physics Experiment (SPE) series. The SPE series, conducted at the Nevada National Security Site,... The Hurt-Locker School NNSA's Los Alamos National Laboratory (LANL) puts world-class science to

  9. molybdenum | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    molybdenum DOE/NNSA Successfully Establishes Uranium Lease and Takeback Program to Support Critical Medical Isotope Production In January 2016, the U.S. Department of Energy's National Nuclear Security Administration (DOE/NNSA) successfully established the Uranium Lease and Take-Back (ULTB) program, as directed in the American Medical Isotopes Production Act of 2012, to support the commercial production of the medical... NNSA's work aids in fight against cancer World Cancer Day encourages

  10. wind | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    wind Wind farm generating more renewable energy than expected for Pantex The Texas Panhandle has some of the world's best winds for creating renewable energy, and the Wind Farm at the Pantex Plant is taking advantage of those winds, generating up to 60% of the energy needs of the plant in an inaugural program, mandated by the White House. Back in 2013,... NNSA chief visits New Mexico laboratories NNSA Administrator Lt. Gen. Frank Klotz (Ret.) visited NNSA's New Mexico laboratories last week. At

  11. Federal Emergency Management Information System (FEMIS) system administration guide. Version 1.4

    SciTech Connect (OSTI)

    Arp, J.A.; Burnett, R.A.; Downing, T.R.

    1997-11-21

    The Federal Emergency Management Information System (FEMIS) is an emergency management planning and analysis tool that was developed by the Pacific Northwest National Laboratory (PNNL) under the direction of the US Army Chemical Biological Defense Command. The FEMIS System Administration Guide defines FEMIS hardware and software requirements and gives instructions for installing the FEMIS software package. This document also contains information on the following: software installation for the FEMIS data servers, communication server, mail server, and the emergency management workstations; distribution media loading and FEMIS installation validation and troubleshooting; and system management of FEMIS users, login privileges, and usage. The system administration utilities (tools), available in the FEMIS client software, are described for user accounts and site profile. This document also describes the installation and use of system and database administration utilities that will assist in keeping the FEMIS system running in an operational environment. The FEMIS system is designed for a single Chemical Stockpile Emergency Preparedness Program (CSEPP) site that has multiple Emergency Operations Centers (EOCs). Each EOC has personal computers (PCs) that emergency planners and operations personnel use to do their jobs. These PCs are connected via a local area network (LAN) to servers that provide EOC-wide services. Each EOC is interconnected to other EOCs via telecommunications links.

  12. Independent Oversight Review, Bonneville Power Administration Safety

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Management Program - March 2014 | Department of Energy Review, Bonneville Power Administration Safety Management Program - March 2014 Independent Oversight Review, Bonneville Power Administration Safety Management Program - March 2014 March 2014 Oversight Review of the Bonneville Power Administration Safety Management Program Bonneville Power Administration management requested that the U.S. Department of Energy Office of Enforcement and Oversight (Independent Oversight), within the Office

  13. Energy Information Administration/Petroleum Marketing Annual

    U.S. Energy Information Administration (EIA) Indexed Site

    . . . . . . . . . . . . . . . . - 49 392 Energy Information AdministrationPetroleum Marketing Annual 1998 Kerosene refiners . . . . . . . . . . . . . . . . . . . . . . . . . . ....

  14. Energy Information Administration/Petroleum Marketing Annual

    U.S. Energy Information Administration (EIA) Indexed Site

    . . . . . . . . . . . . . . . . - 49 392 Energy Information AdministrationPetroleum Marketing Annual 1999 Kerosene refiners . . . . . . . . . . . . . . . . . . . . . . . . . . ....

  15. Administrative Records Schedule 1 | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Administrative Records Schedule 1 Administrative Records Schedule 1 ADM-1 covers records of the Department and its contractors. The records include, employee concerns programs, labor agreements and negotiations, labor relations, academic and outreach programs, apprenticeship programs, job vacancies, unemployment compensation, recruitment and employee health PDF icon Administrative Records Schedule 1 More Documents & Publications ADMINISTRATIVE RECORDS SCHEDULE 1: PERSONNEL RECORDS

  16. Administrative Records Schedule: Communication Records | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Administrative Records Schedule: Communication Records Administrative Records Schedule: Communication Records The principal records documenting communication function PDF icon Administrative Records Schedule: Communication Records More Documents & Publications ADMINISTRATIVE RECORDS SCHEDULE 12: COMMUNICATIONS RECORDS ADM 12 PDF Communications Records

  17. NNSA Administrator to Depart | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Administrator to Depart NNSA Administrator to Depart January 4, 2007 - 9:59am Addthis WASHINGTON, DC - Secretary of Energy Samuel Bodman today announced the resignation of Ambassador Linton Brooks, Administrator of the National Nuclear Security Administration. Energy Secretary Samuel Bodman released the following statement today: "During my tenure at the Department, and even before, there have been a number of management issues involving the National Nuclear Security Administration, the

  18. Administrative Records Schedules | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Administrative Records Schedules Administrative Records Schedules Administrative Records Schedules NOTE: Most of the files below are in PDF, you will need Acrobat® Reader(tm) to view these files. SCHEDULE TITLE DATE LAST CHANGED AUTHORIZATION NUMBER Administrative Records Schedules Compiled - (Schedules 1 & 2) (pdf) 01/06/15 --- 1 Personnel Records - Superseded - See Compiled (pdf) 09/15/10 N1-434-98-4 2 Payroll & Pay Administration Records - Superseded - See Compiled (pdf) 09/15/10

  19. Madelyn Creedon | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    Madelyn Creedon NNSA Principal Deputy Administrator Our Leadership Madelyn Creedon was confirmed by the Senate on Wednesday, July 23, 2014, as the Department of Energy's (DOE) Principal Deputy Administrator for the National Nuclear Security Administration (NNSA). As NNSA's Principal Deputy Administrator, Ms. Creedon will support NNSA Administrator Frank Klotz in the management and operation of the NNSA, as well as policy matters across the DOE and NNSA enterprise in support of President Obama's

  20. Randall M. Hendrickson | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    Randall M. Hendrickson Associate Administrator for Management and Budget Our Leadership Randall Hendrickson is a member of the Senior Executive Service and serves as the Associate Administrator for Management and Budget in the National Nuclear Security Administration (NNSA). He is the Senior Career official leading and managing the budget and administrative staffs responsible for enterprise-wide systems and policies at NNSA. His organization guides and assists the Administrator in all aspects of

  1. Southwestern Power Administration - Evaluate our site

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Evaluate Our Site Please use this form to submit questions or to provide feedback on our Web site, including any difficulty you may have experienced accessing information. The feedback you submit will be used solely to respond to your question, request, or comment, and to provide you with our response. If you would like to be contacted by telephone, please include a number where you can be reached in the Comments section. For more information, please see our Privacy Notice E-mail Address*:

  2. charity | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    charity NNSA thanks CFC key workers for a job well done In a late March ceremony, NNSA Principal Deputy Administrator Madelyn Creedon thanked key workers in NNSA's most recent season of giving in the largest and most successful workplace fundraising campaign in the world, the 2015 Combined Federal Campaign (CFC). Largely due to the efforts of 14 people... Pantex/Y-12 donate $1.1M to local United Way campaigns United Way contributions at the Pantex Plant and the Y-12 National Security Complex

  3. Newsletters | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    Newsletters U.S. Department of Energy / U.S. Nuclear Regulatory Commission Nuclear Materials Management & Safeguards System Newsletters NMMSS is sponsored by the National Nuclear Security Administration's (NNSA) Office of Materials Integration within the U.S. Department of Energy and the U.S. Nuclear Regulatory Commission Attachment Size November 2015 616.94 KB July 2015 441.12 KB March 2015 739.06 KB December 2014 397.5 KB October 2014 330.08 KB July 2014 1.29 MB April 2014 761.67 KB

  4. ENERGY RESEARCH AND DEVELOPMENT ADMINISTRATION

    Office of Legacy Management (LM)

    .' :h I : ' ENERGY RESEARCH AND DEVELOPMENT ADMINISTRATION WASHINGTON, D.C. 20545 October 24, 1975 :~.. ,. Memo to Piles' CARNEGIE-MELLON S~C&RCCYCLOTRON On October 23, 1975, W. J. McCool (HQOS), E. K. Loop (HQ-OS), R. E. Allen (HQ-OS), J. Pingel (CH), B. 3. Davis (CH), R. Drucker (CR-BAO) and I met at Germantown to discuss the clean-up of radio- activity at the Saxonburg accelerator site. After discussion, we concluded acceptable criteria would include removal of all material necessary to

  5. PP-36 Bonneville Power Administration | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Bonneville Power Administration PP-36 Bonneville Power Administration Presidential Permit authorizing Bonneville Power Administration to construct, operate, and maintain electric ...

  6. PP-10 Bonneville Power Administrator | Department of Energy

    Energy Savers [EERE]

    Bonneville Power Administrator PP-10 Bonneville Power Administrator Presidential permit authorizing Bonneville Power Administrator to construct, operate, and maintain electric ...

  7. Search for Stopped Gluinos in pp collisions at sqrt s = 7 TeV

    SciTech Connect (OSTI)

    Khachatryan, Vardan; et al.

    2011-01-01

    The results of the first search for long-lived gluinos produced in 7 TeV pp collisions at the CERN Large Hadron Collider are presented. The search looks for evidence of long-lived particles that stop in the CMS detector and decay in the quiescent periods between beam crossings. In a dataset with a peak instantaneous luminosity of 10^{32} cm^{-2} s^{-1}, an integrated luminosity of 10 inverse picobarns, and a search interval corresponding to 62 hours of LHC operation, no significant excess above background was observed. Limits at the 95% confidence level on gluino pair production over 13 orders of magnitude of gluino lifetime are set. For a mass difference between the gluino and the neutralino greater than 100 GeV/c^2, and assuming a branching ratio for gluino to gluon+neutralino of 100%, gluinos of mass less than 370 GeV/c^2 are excluded for lifetimes from 10 microseconds to 1000 s.

  8. Administrative Order Requiring Compliance and Assessing Civil Penalty |

    Office of Environmental Management (EM)

    Administrative Management Records Administrative Management Records This schedule covers those administrative management activities not covered by other Administrative Schedules PDF icon Administrative Management Records More Documents & Publications ADMINISTRATIVE RECORDS SCHEDULE 23: RECORDS COMMON TO MOST OFFICES ADMINISTRATIVE RECORDS SCHEDULE 12: COMMUNICATIONS RECORDS ADM 12

    Chief Human Capital Officer (HC-1) » Administrative Management Staff (HC-1.5) Administrative Management

  9. 2015 HEDLP Awards | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    5 HEDLP Awards Institution PI Title Harvard College Jacobsen, Stein From Z to Planets: Phase II Princeton University Fisch, Nathaniel Fundamental Issues in the Interaction of Intense Lasers with Plasma Massachusetts Institute of Technology Petrasso, Richard Studying Hydrodynamics, Kinetic/multi-ion Effects, and Charged-Particle Stopping in HED Plasmas and ICF Implosions at Omega, Omega-EP and at the NIF University of California, Los Angeles Joshi, Chand Development of a Broadband (40-80 KV),

  10. Sandia National Laboratories: Contact Us

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Contact Us Contact Us New Mexico California Sandia National Laboratories, New Mexico P.O. Box 5800 Albuquerque, NM 87185-(mail stop)* Non-mail deliveries: 1515 Eubank SE Albuquerque, NM 87123 Sandia National Laboratories, California P.O. Box 969 Livermore, CA 94551-0969 Non-mail deliveries: 7011 East Avenue Livermore, CA 94550 * All mail must contain an appropriate mail stop to ensure delivery. For employee mail stops, reference our Employee Locator. Contact Information General Inquiries New

  11. Administration - Combustion Energy Frontier Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Administration Administration Chung K. Law Chung K. Law Director, CEFRC Emily A. Carter Emily A. Carter Co-Director, CEFRC Chih-Jen Sung Chih-Jen Sung Associate Director (Acting),...

  12. Federal Energy Administration Act | Open Energy Information

    Open Energy Info (EERE)

    Federal Energy Administration Act Jump to: navigation, search OpenEI Reference LibraryAdd to library Legal Document- StatuteStatute: Federal Energy Administration ActLegal Abstract...

  13. Recent Administrative Change 12-4-14

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    The purpose of the administrative change is to provide the EK pay plan with continuous locality pay coverage as a result of an administrative change to the EK pay plan legislation.

  14. Chapter 02 - Administrative Control of Funds

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    . Administrative Control of Funds 2-1 CHAPTER 2 ADMINISTRATIVE CONTROL OF FUNDS 1. INTRODUCTION. a. BackgroundAuthority. Title 31, section 1514, of the United States Code (31 ...

  15. ADMINISTRATIVE RECORDS SCHEDULE 12: COMMUNICATIONS RECORDS |...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    The principal records documenting communication functions include messenger service ... ADM 12 PDF Communications Records Administrative Records Schedule: Communication Records

  16. Southwestern Power Administration One West Third Street

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Power Administration One West Third Street Tulsa OK 74103-3502 918 595 6600 Fax 918 595 6656 www.swpa.gov An Agency of the United States Department of Energy Southwestern Power Administration Strategic Plan March 2013 Administrator's Message The Southwestern Power Administration powers the future, all day, every day, as we have for 70 years, through times of abundant water, and through times of drought; despite floods, ice storms, and tornadoes. We have consistently fulfilled our commitment to

  17. U.S. SMALL BUSINESS ADMINISTRATION

    Energy Savers [EERE]

    SMALL BUSINESS ADMINISTRATION WASHINGTON, DC 20416 MEMORANDUM From: A. John Shoraka, Associate Administrator, Office of Government Contracting and Business Development, Small Business Administration To: Hon. Anne Rung, Administrator, Office of Federal Procurement Policy, Office of Management and Budget Date: March 28, 2016 Subject: Procedures to Support Contracting Officer Verification of Women-Owned Small Business Awards during Temporary System Shutdown Reference: (a) 13 CFR 127.301 and (b) FAR

  18. Energy Information Administration/Petroleum Marketing Annual

    U.S. Energy Information Administration (EIA) Indexed Site

    . . . . . . . . . . . . . . June 1994 400 Energy Information AdministrationPetroleum Marketing Annual 1999 Changes to the 1994 Petroleum Marketing Monthly. . . . . . . . . . . . ....

  19. Office of Administrative Operations (GC-90)

    Broader source: Energy.gov [DOE]

    John D. (Dan) Bullington, Director of Administrative Operations 202-586-7364dan.bullington@hq.doe.gov

  20. W-88 | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    | National Nuclear Security Administration Facebook Twitter Youtube Flickr RSS People Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy...

  1. A History of the Southeastern Power Administration

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Southeastern Power Administration 1990-2010 SERVING SOUTHEAST the Distribu teD by us Department of energy southeastern Power Administration 2012 A History of the Southeastern Power Administration 1990-2010 SERVING SOUTHEAST the ii Project contribu tors Sponsor us Department of energy, southeastern Power Administration Contracting Agency us Army corps of engineers, Mobile District Author Patricia stallings, brockington and Associates, inc. Design and Editing john cason and Alicia sullivan,

  2. non-proliferation | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    ...proliferation | National Nuclear Security Administration Facebook Twitter Youtube Flickr RSS People Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear ...

  3. Republic of Korea | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    Republic of Korea Statement on Signing of the Administrative Arrangement to the Agreement for Cooperation between the United States and Republic of Korea Concerning Peaceful Uses of Nuclear Energy (WASHINGTON, D.C.)-Today, Administrator Frank Klotz of the U.S. Department of Energy's National Nuclear Security Administration and Chairman Un Chul Lee of the Republic of Korea's (ROK) Nuclear Safety and Security Commission reached agreement on the terms of the Administrative Arrangement to the

  4. All Office Administrative/ Professional Government All Other

    U.S. Energy Information Administration (EIA) Indexed Site

    Buildings Energy Consumption Survey All Office Administrative Professional Government All Other Office All Buildings... 4,645 824 442 84...

  5. All Office Administrative/ Professional Government All Other

    U.S. Energy Information Administration (EIA) Indexed Site

    Buildings Energy Consumption Survey All Office Administrative Professional Government All Other Office All Buildings... 64,783 12,208...

  6. Proliferation Detection | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    Proliferation Detection | National Nuclear Security Administration Facebook Twitter Youtube Flickr RSS People Mission Managing the Stockpile Preventing Proliferation Powering the ...

  7. ADMINISTRATIVE RECORDS SCHEDULE 17: CARTOGRAPHIC, AERIAL PHOTOGRAPHIC...

    Energy Savers [EERE]

    7: CARTOGRAPHIC, AERIAL PHOTOGRAPHIC, ARCHITECTURAL, ENGINEERING, AND FACILITY MANAGEMENT RECORDS ADMINISTRATIVE RECORDS SCHEDULE 17: CARTOGRAPHIC, AERIAL PHOTOGRAPHIC,...

  8. Research Reactor Conversion | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    Reactor Conversion | National Nuclear Security Administration Facebook Twitter Youtube Flickr RSS People Mission Managing the Stockpile Preventing Proliferation Powering the...

  9. Categorical Exclusion Determinations: Southeastern Power Administration |

    Energy Savers [EERE]

    Department of Energy Southeastern Power Administration Categorical Exclusion Determinations: Southeastern Power Administration Categorical Exclusion Determinations issued by Southeastern Power Administration. DOCUMENTS AVAILABLE FOR DOWNLOAD August 3, 2009 CX-000478: Categorical Exclusion Determination Proposed rate adjustment for the Jim Woodruff System CX(s) Applied: B4.3 Date: 08/03/2009 Location(s): Panhandle, Florida Office(s): Southeastern Power Administration

  10. ADMINISTRATIVE RECORDS SCHEDULE 5: BUDGET PREPARATION, PRESENTATION...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    5: BUDGET PREPARATION, PRESENTATION, AND APPORTIONMENT ADMINISTRATIVE RECORDS SCHEDULE 5: BUDGET PREPARATION, PRESENTATION, AND APPORTIONMENT Budget and apportionment records ...

  11. ADMINISTRATIVE RECORDS SCHEDULE 5: BUDGET PREPARATION, PRESENTATION...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    5: BUDGET PREPARATION, PRESENTATION, AND APPORTIONMENT RECORDS ADMINISTRATIVE RECORDS SCHEDULE 5: BUDGET PREPARATION, PRESENTATION, AND APPORTIONMENT RECORDS Budget and ...

  12. May 2014 | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    May 2014 Charles E. Messick receives the Administrator's Gold Award Friday, May 30, 2014 - 2:30pm Charles E. Messick receives the Administrator's Gold Award upon his retirement after more than 40 years of public service. From left to right: Anne Harrington, Deputy Administrator for Defense Nuclear Nonproliferation; Charles E Messick, Susan Messick, and Frank Klotz, DOE Undersecretary for Nuclear Security and NNSA Administrator. NNSA Blog NSC completes last part to facilitate relocation

  13. 123 agreement | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    123 agreement Statement on Signing of the Administrative Arrangement to the Agreement for Cooperation between the United States and Republic of Korea Concerning Peaceful Uses of Nuclear Energy (WASHINGTON, D.C.)-Today, Administrator Frank Klotz of the U.S. Department of Energy's National Nuclear Security Administration and Chairman Un Chul Lee of the Republic of Korea's (ROK) Nuclear Safety and Security Commission reached agreement on the terms of the Administrative Arrangement to the... United

  14. General Services Administration Photovoltaics Project in Sacramento,

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    California | Department of Energy General Services Administration Photovoltaics Project in Sacramento, California General Services Administration Photovoltaics Project in Sacramento, California Document describes a request for proposal issued for the General Services Administration photovoltaic (PV) project. PDF icon gsa_sacramento_pv_rfp.pdf More Documents & Publications NASA Enhanced Use Lease DOE Princeton Plasma Physics Laboratory Purchase Power Agreement Request for Proposal

  15. ADMINISTRATIVE RECORDS SCHEDULE 1: PERSONNEL RECORDS (Superseded) |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy : PERSONNEL RECORDS (Superseded) ADMINISTRATIVE RECORDS SCHEDULE 1: PERSONNEL RECORDS (Superseded) The records include, employee concerns programs, labor agreements and negotiations, labor relations, academic and outreach programs, apprenticeship programs, job vacancies, unemployment compensation, recruitment and employee health PDF icon Administrative Records Schedule 1-Personnel Records.pdf More Documents & Publications ADMINISTRATIVE RECORDS SCHEDULE 2: PAYROLL

  16. gold medal | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    gold medal NNSA Administrator honors nonproliferation research leader Last week DOE Under Secretary for Nuclear Security and NNSA Administrator Lt. Gen. Frank G. Klotz (Ret.) presented the agency's Assistant Deputy Administrator for Nonproliferation Research and Development (R&D) Dr. Rhys Williams with the Distinguished Service Gold Medal Award at a

  17. Our Operations | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    Operations Infrastructure and Operations NNSA's missions require a secure production and laboratory infrastructure meeting immediate and long term needs. The Associate Administrator for Infrastructure and Operations develops and executes NNSA's infrastructure investment, maintenance, and operations programs and policies. Administration Programs Management and Budget The organization provides timely, cost-effective, and efficient administrative and financial support for NNSA headquarters staff.

  18. Deborah Wilber | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    Deborah Wilber Associate Administrator for Emergency Operations Deborah Wilber Deborah Wilber is the Associate Administrator for the Office of Emergency Operations, National Nuclear Security Administration (NNSA). In this role, she is responsible for emergency management policy and execution of emergency management support, to include the Continuity of Operations and Government programs, the Headquarters and Alternate Emergency Operations Centers, and the Emergency Communications Network across

  19. Power Subscription Strategy: Administrator`s Record of Decision.

    SciTech Connect (OSTI)

    United States. Bonneville Power Administration

    1998-12-01

    The Bonneville Power Administration (BPA) has decided to adopt a Power Subscription Strategy for entering into new power sales contracts with its Pacific Northwest customers. The Strategy equitably distributes the electric power generated by the Federal Columbia River Power System (FCRPS) within the framework of existing law. The Power Subscription Strategy addresses the availability of power; describes power products; lays out strategies for pricing, including risk management; and discusses contract elements. In proceeding with this Subscription Strategy, BPA is guided by and committed to the Fish and Wildlife funding Principles for the BPA announced by the Vice President of the US in September 1998. This Record of Decision (ROD) addresses the issues raised by commenters who responded to BPA`s Power Subscription Strategy Proposal during and after the comment period that began with the release of the Proposal on September 18, 1998. The ROD is organized in approximately the same way as the Proposal and the Power Subscription Strategy that BPA developed based on the comments received. Abbreviations of party names used in citations appear in the section just preceding this introduction; a list of all the commenters follows the text of the ROD.

  20. Theoretical studies on the stopping power of deuterium-tritium mixed with uranium plasmas for α particles

    SciTech Connect (OSTI)

    Wang, Zhigang; Fu, Zhen-Guo; Zhang, Ping

    2014-10-15

    The stopping power of a compressed and highly ionized deuterium-tritium (DT) and uranium (U) plasma for α particles at very high temperatures (T = 5 keV) is examined theoretically with the dimensional continuation method. We show that with increasing density of U, both the magnitude and width of the resonance peak in the stopping power (as a function of the α particle energy), increases because of the ions, while the penetration distance of the α particles decreases. A simple relation of decreasing penetration distance as a function of plasma density is observed, which may be useful for inertial confinement fusion experiments. Moreover, by comparing the results with the case of a DT plasma mixed with beryllium, we find that the effect of a higher Z plasma is stronger, with regard to energy loss as well as the penetration distance of α particles, than that of a lower Z plasma.

  1. A New Active DPF System for "Stop and Go" Duty-Cycle Vehicles | Department

    Broader source: Energy.gov (indexed) [DOE]

    of Energy 2004 Diesel Engine Emissions Reduction (DEER) Conference Presentation: Aaqius and Aaqius PDF icon 2004_deer_seguelong1.pdf More Documents & Publications The ExoClean Filter System for Stop and Go Vehicles Combination of Diesel fuel system architectures and Ceria-based fuel-borne catalysts for improvement and simplification of the Diesel Particulate Filter System in serial applications Diesel Particulate Filters: Market Introducution in Europe

  2. Better Buildings Neighborhood Program Business Models Guide: Program Administrator Description

    Broader source: Energy.gov [DOE]

    Better Buildings Neighborhood Program Business Models Guide: Program Administrator Business Models, Program Administrator Description.

  3. NA 15 - Assistant Deputy Administrator for Secure Transportation | National

    National Nuclear Security Administration (NNSA)

    Nuclear Security Administration NA 15 - Assistant Deputy Administrator for Secure Transportation

  4. NA 20 - Deputy Administrator for Defense Nuclear Nonproliferation |

    National Nuclear Security Administration (NNSA)

    National Nuclear Security Administration 20 - Deputy Administrator for Defense Nuclear Nonproliferation

  5. NA 50 - Associate Administrator for Safety, Infrastructure and Operations

    National Nuclear Security Administration (NNSA)

    | National Nuclear Security Administration 50 - Associate Administrator for Safety, Infrastructure and Operations FY15

  6. NA 70 - Associate Administrator for Defense Nuclear Security | National

    National Nuclear Security Administration (NNSA)

    Nuclear Security Administration 70 - Associate Administrator for Defense Nuclear Security

  7. NA APM - Associate Administrator for Acquisition & Project Management |

    National Nuclear Security Administration (NNSA)

    National Nuclear Security Administration APM - Associate Administrator for Acquisition & Project Management

  8. NA MB - Associate Administrator for Management & Budget | National Nuclear

    National Nuclear Security Administration (NNSA)

    Security Administration MB - Associate Administrator for Management & Budget

  9. Running against hunger | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    Running against hunger Wednesday, December 18, 2013 - 2:15pm Pantex Security Police Officers Byron Logan and Randy Stokes completed their annual Run Against Hunger last week. The two officers ran and biked approximately 50 miles Friday to raise awareness of the problem of hunger in the Texas Panhandle and to raise money for the High Plains Food Bank. On the route, Logan and Stokes stopped talk to the students from Highland Park High School in Amarillo, Texas, about the importance of getting

  10. Dose calculations using MARS for Bremsstrahlung beam stops and collimators in APS beamline stations.

    SciTech Connect (OSTI)

    Dooling, J.; Accelerator Systems Division

    2010-11-01

    The Monte Carlo radiation transport code MARS is used to model the generation of gas bremsstrahlung (GB) radiation from 7-GeV electrons which scatter from residual gas atoms in undulator straight sections within the Advanced Photon Source (APS) storage ring. Additionally, MARS is employed to model the interactions of the GB radiation with components along the x-ray beamlines and then determine the expected radiation dose-rates that result. In this manner, MARS can be used to assess the adequacy of existing shielding or the specifications for new shielding when required. The GB radiation generated in the 'thin-target' of an ID straight section will consist only of photons in a 1/E-distribution up to the full energy of the stored electron beam. Using this analytical model, the predicted GB power for a typical APS 15.38-m insertion device (ID) straight section is 4.59 x 10{sup -7} W/nTorr/mA, assuming a background gas composed of air (Z{sub eff} = 7.31) at room temperature (293K). The total GB power provides a useful benchmark for comparisons between analytical and numerical approaches. We find good agreement between MARS and analytical estimates for total GB power. The extended straight section 'target' creates a radial profile of GB, which is highly peaked centered on the electron beam. The GB distribution reflects the size of the electron beam that creates the radiation. Optimizing the performance of MARS in terms of CPU time per incident trajectory requires the use of a relatively short, high-density gas target (air); in this report, the target density is {rho}L = 2.89 x 10{sup -2} g/cm{sup 2} over a length of 24 cm. MARS results are compared with the contact dose levels reported in TB-20, which used EGS4 for radiation transport simulations. Maximum dose-rates in 1 cc of tissue phantom form the initial basis for comparison. MARS and EGS4 results are approximately the same for maximum 1-cc dose-rates and attenuation in the photon-dominated regions; for thicker targets, however, the dose-rate no longer depends only on photon attenuation, as photoneutrons (PNs) begin to dominate. The GB radiation-induced photoneutron measurements from four different metals (Fe, Cu, W, and Pb) are compared with MARS predictions. The simulated dose-rates for beamline 6-ID are approximately 3-5 times larger than the measured values, whereas those for beamline 11-ID are much closer. Given the uncertainty in local values of pressure and Z, the degree of agreement between MARS and the PN measurements is good. MARS simulations of GB-induced radiation in and around the FOE show the importance of using actual pressure and gas composition (Z{sub eff}) to obtain accurate PN dose. For a beam current of 300 mA, extrapolating pressure data measured in previously published studies predicts an average background gas pressure of 27 nTorr. An average atomic number of Z{sub eff} = 4.0 is obtained from the same studies. In addition, models of copper masks presently in use at the APS are included. Simulations show that inclusion of exit masks make significant differences in both the radiation spatial distribution within the FOE, as well as the peak intensity. Two studies have been conducted with MARS to assess shielding requirements. First, dose levels in contact with the outside wall of the FOE are examined when GB radiation strikes Pb or W beam stops of varying transverse size within the FOE. Four separate phantom regions are utilized to measure the dose, two at beam elevation and two at the horizontal beam position. The first two phantoms are used for scoring FOE dose along the outside and back walls, horizontally; the second two collect dose on the roof and vertically on the back wall. In all cases, the beam stop depth is maintained at 30 cm. Inclusion of front end (FE) exit masks typically cause a 1-2 order-of-magnitude increase in the dose-rates relative to the case with no masks. Masks place secondary bremsstrahlung sources inside the FOE, and therefore they must be shielded appropriately. The MARS model does not fully account for all shielding present

  11. User Research Administration | Stanford Synchrotron Radiation Lightsource

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Research Administration SSRL User Research Administration Services, Proposal Submission, Experiment Scheduling & Logistics Lisa Dunn SSRL SMB User Research Administration Manager (SSRL Crystallography/Bio SAXS Proposals, Scheduling) Tel: (650) 926-2087 Fax: (650) 926-3600 Cathy Knotts Manager, SSRL User Services Tel: (650) 926-3191 Joint SSRL/LCLS User Registration, Safety Training, Check-In, On-Boarding Services Sacha Hanigan SLAC Visitor, User, Employee (VUE) Center Manager Tel: (650)

  12. Independent Oversight Review, National Nuclear Security Administration

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Production Office - February 2014 | Department of Energy Nuclear Security Administration Production Office - February 2014 Independent Oversight Review, National Nuclear Security Administration Production Office - February 2014 February 2014 Review of the National Nuclear Security Administration Production Office Readiness Review Program The U.S. Department of Energy (DOE) Office of Enforcement and Oversight (Independent Oversight), within the Office of Health, Safety and Security, conducted

  13. National Oceanic and Atmospheric Administration, Honolulu, Hawaii |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy Oceanic and Atmospheric Administration, Honolulu, Hawaii National Oceanic and Atmospheric Administration, Honolulu, Hawaii Photo of a Staff Residence at the Pacific Tsunami Warning Center in Hawaii The staff residences at the Pacific Tsunami Warning Center in Hawaii now have solar water heating systems funded by the Federal Energy Management Program (FEMP). The Center is part of the Department of Commerce's National Oceanic and Atmospheric Administration (DOC-NOAA). New

  14. Western Area Power Administration Transmission Infrastructure Program

    Energy Savers [EERE]

    Department of Energy Western Area Power Administration Borrowing Authority, Recovery Act Western Area Power Administration Borrowing Authority, Recovery Act PDF icon Microsoft Word - PSRP May 15 2009 _WAPA Borrowing Authority_ Final.docx More Documents & Publications WAPA Recovery Act Implementation Appropriation Microsoft Word - PSRP Updates 6-25-10_v2 Bonneville Power Administration Program Specific Recovery Plan

    TIP Program Overview Craig Knoell, Program Manager November 2009 TIP

  15. Jeffrey Harrell | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    Jeffrey Harrell Manager - Sandia Field Office Our Leadership Jeffrey P. Harrell, Colonel, United States Air Force (retired), is the Manager for the Department of Energy's National Nuclear Security Administration (NNSA) Sandia Field Office (SFO). As Manager, he is responsible for the overall administration of the Sandia National Laboratories (SNL) Contract (~$2.5B/year), the day-to-day administration of the SFO, and oversight of Laboratory operations. The mission of the Sandia National

  16. Anne Harrington | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    Anne Harrington Deputy Administrator for Defense Nuclear Nonproliferation Anne Harrington Anne Harrington was sworn in as Deputy Administrator for Defense Nuclear Nonproliferation for the National Nuclear Security Administration in October 2010. Previously, Ms. Harrington was the Director of the U.S. National Academy of Sciences Committee on International Security and Arms Control (CISAC) a position she held from March 2005 to October 2010. While at CISAC, she managed several key studies on a

  17. February 2016 | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    February 2016 NNSA administrator shows NM congressional delegation the Albuquerque Complex to make case for new facility Friday, February 26, 2016 - 1:42pm WASHINGTON, DC - Lt. Gen. Frank Klotz (Ret.), Administrator of the Department of Energy's National Nuclear Security Administration, hosted two members of the New Mexico congressional delegation on Feb. 18 for a tour of the aging facilities occupied by 1,200 NNSA employees at the Albuquerque Complex on Kirtland Air Force Base in New Mexico.

  18. Geoff Beausoleil | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    Geoff Beausoleil Manager - NNSA Production Office Our Leadership Geoffrey L. (Geoff) Beausoleil is the Manager for the National Nuclear Security Administration (NNSA) Production Office (NPO). In this capacity, he is responsible for the overall administration of the Management and Operating Contract for the Pantex and Y12 Plants, the day-to-day administration of the NPO, and oversight of Plant operations. The mission of the Y12 and Pantex Plants is to maintain the nuclear weapons stockpile;

  19. nuclear smuggling | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    nuclear smuggling NNSA Deputy Administrator Creedon Travels to China In March, National Nuclear Security Administration (NNSA) Principal Deputy Administrator Madelyn Creedon traveled to China to participate in activities related to NNSA's cooperative engagement with various Chinese ministries on nuclear security. Creedon was accompanied by Principal Assistant... Apex Gold discussion fosters international cooperation in run-up to 2016 Nuclear Security Summit Participants in Apex Gold at Lawrence

  20. DEMO Project Goals | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    DEMO Project Goals | National Nuclear Security Administration Facebook Twitter Youtube ... and responsiveness of the position classification system to managers; Increase the ...