Powered by Deep Web Technologies
Note: This page contains sample records for the topic "acid dl dolomitic" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


1

A Comparative Study of Dolomite Dissolution in Simple Organic Acids and Chelating Agents  

E-Print Network [OSTI]

Acid treatments have predominantly been conducted using HCl for its availability, high rock dissolving power and soluble reaction products. At high temperatures, rapid spending of the acid with carbonates prevents deeper penetration distance...

Adenuga, Olusegun O

2013-05-03T23:59:59.000Z

2

Reaction of Calcite and Dolomite with In-Situ Gelled Acids, Organic Acids, and Environmentally Friendly Chelating Agent (GLDA)  

E-Print Network [OSTI]

the viscosity of HCl-formic acids studied in chapter 4. 2.1 Rotating Disk Apparatu s The rotating disk reactor system (RDR) is used for primarily two important applications in the oil and gas industry. First, RDR is used to conduct corrosion tests... corrosion inhibitors, and type of metal tubular on the corrosion rate can be determined using the RDR. The RDR can also be used also to conduct a kinetics/diffusion study at the designated pressure and temperature. The availability of the fundamental...

Rabie, Ahmed 1978-

2012-11-16T23:59:59.000Z

3

The effects of calcitic and dolomitic limestone rates and particle sizes on soil chemical changes, plant nutrient concentration, and yields of corn and Coastal bermudagrass on two acid Texas soils  

E-Print Network [OSTI]

Directed by Dr. Warren B. Anderson Two, 4, snd 6 tons/ acre of calcitic and dolomitic limestone in three particle size ranges were disked into a Katy fine sandy loam prior to planting corn. Identical treatments were broadcast on a Boy loamy fine sand... neutralized soil acidity faster than did the dolomitic source. All calcitic limestone treatments significantly increased Ca in the surface 6 inches of soil. The 4- and 6-ton/acre rates of fine, and the 6-ton/acre rate of medium calcitic limestone...

Haby, Vincent A

2012-06-07T23:59:59.000Z

4

Experimental deformation of natural and synthetic dolomite  

E-Print Network [OSTI]

Natural and hot isostatically pressed dolomite aggregates were experimentally deformed at effective pressures of Pe = 50 ?? 400 MPa, temperatures of 400 ?? 850??C, and strain rates of ?& = 1.2x10-4 s-1 to 1.2x10-7 s-1. Coarse- and fine...

Davis, Nathan Ernest

2005-11-01T23:59:59.000Z

5

DL-36361 UC-414 I  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

DL-36361 DL-36361 UC-414 I * Discovery of the Most Distant Supernovae and the Quest for L l Gerson Goldhaber and Saul Perlmutter Lawrence Berkeley Laboratory and Center for Particle Astrophysics University of California, Berkeley, CA 94720 Silvia Gabi, Ariel Goobar, Alex Kim, Mathew Kim, and Reynald Pain Lawrence Berkeley Laboratory, University of California Berkeley, CA 94720 Carl Pennypacker and Ivan Small Lawrence Berkeley Laboratory and Space Sciences Laboratory University of California, Berkeley, CA 94720 Brian Boyle, Richard Ellis, and Richard McMahon Institute of Astronomy, Cambridge, United Kingdom and Peter Bunclarlc, Dave Carter, and Roberto Terlevich Royal Greenwich Observatory, Cambridge, United Kingdom May 1994 T h i s work w a s supported in part by the U.S. Department of Energy under Contract No. DE-AC03-76SF00098,

6

Sala Dolomite-Catalysed Conversion of Tar from Biomass Pyrolysis  

Science Journals Connector (OSTI)

Dolomite from the Swedish Sala quarry has been examined as a possible catalyst for cracking and steam reforming of tar produced during pyrolysis of biomass.

K. Sjöström; G. Taralas; L. Liinanki

1988-01-01T23:59:59.000Z

7

Aggregation of n-octanoyl-dl-cysteine in aqueous solvent systems  

E-Print Network [OSTI]

indicated the predominant sites of interaction of thymine with the micellar n-octanoyl-dl-cysteine. At the lower pH ranges of 6. 0 and 7. 5 thymine primarily interacts with protons close to the sulfhydryl group of the surfactant while at the higher p... concentration Deoxyribonucleic acid n-Octanoyl-dl-cysteine Tetrahydrofuran Nuclear magnetic resonance Surfactant concentration Observed chemical shift of surfactant Micellar chemical shift of surfactant Monomeric chemical shift of surfactant Monomeric...

Shelley, Ralph Ray

2012-06-07T23:59:59.000Z

8

Shallow meteoric alteration and burial diagenesis of massive dolomite in the Castle Reef Formation, northwest Montana  

E-Print Network [OSTI]

Precambrian (750 + 25 Ma; Mudge, et al. , 1968) and very Late Cretaceous to early Tertiary (Mudge, 1972). Any formation or recrystallization of dolomite by hydrothermal fluids must have occurred before the Jurassic since pre-Jurassic dolomite overgrowths... Precambrian (750 + 25 Ma; Mudge, et al. , 1968) and very Late Cretaceous to early Tertiary (Mudge, 1972). Any formation or recrystallization of dolomite by hydrothermal fluids must have occurred before the Jurassic since pre-Jurassic dolomite overgrowths...

Whitsitt, Philip Mark

2012-06-07T23:59:59.000Z

9

Hydrothermal Dolomites in the Early Albian (Cretaceous) Platform Carbonates  

E-Print Network [OSTI]

Hydrothermal Dolomites in the Early Albian (Cretaceous) Platform Carbonates (NW Spain): Nature carbonates de la plate-forme albienne précoce (Crétacé; NO de l'Espagne): nature et origine des dolomies et trouvent dans les carbonates albiens, déposés dans le bassin Basque-Cantabrique suite à une subsidence

Paris-Sud XI, Université de

10

The Ranero Hydrothermal Dolomites (Albian, Karrantza Valley, Northwest Spain)  

E-Print Network [OSTI]

The Ranero Hydrothermal Dolomites (Albian, Karrantza Valley, Northwest Spain): Implications Recherche Développement, Carbonate Sedimentology Group, avenue Larribau s/n, 64018 Pau Cedex - France e'Espagne) sont présentées dans cette étude. Les corps dolomitiques sont encaissés dans des carbonates de

Paris-Sud XI, Université de

11

An integrated approach to evaluating the suitability of the Potosi Dolomite as a carbon sequestration target  

Science Journals Connector (OSTI)

...The Eminence is a relatively light-colored, fine- to medium-grained dolomite that contains abundant chert, quartz grains...thick to massively bedded, gray to light brown, fine- to medium-crystalline dolomite characterized by vugs lined with dolomite...

Hannes E. Leetaru; Valeri Smith; Yasmin Adushita; Jared T. Freiburg

12

Biomass Gasification in Fluidized Bed:? Where To Locate the Dolomite To Improve Gasification?  

Science Journals Connector (OSTI)

Figure 5 Steam content in the flue gas vs relative amount of dolomite used for two different locations of the dolomite and for two gasifying agents; (a) gasification with H2O + O2 mixtures, GR = 0.86?1.16, ... Figure 6 Low heating value of the flue gas for two locations of the dolomite and for two gasifying agents; (a) gasification with H2O + O2 mixtures, GR = 0.86?1.16, ... Figure 7 Gas yield for two locations of the dolomite and for two gasifying agents; (a) gasification with H2O + O2 mixtures; GR = 0.86?1.16, ...

José Corella; María-Pilar Aznar; Javier Gil; Miguel A. Caballero

1999-10-28T23:59:59.000Z

13

The Effects of Initial Condition of Fracture Surfaces, Acid Spending, and Type on Conductivity of Acid Fracture  

E-Print Network [OSTI]

. Another area of interest is the variation of conductivity along the fracture due to acid spending. We also investigated the contact time, acid system type, and treatment temperature effects on conductivity using San Andres dolomite cores. The results...

Almomen, Ali Mansour

2013-07-24T23:59:59.000Z

14

Glacioeustatic Transgressive Reflux: Stratiform Dolomite in Pennsylvanian Bioherms of the Western Orogrande Basin, New Mexico  

Science Journals Connector (OSTI)

...mound rocks from the Virgilian Panther Seep Formation, Hembrillo Canyon...suggesting that, in general, car-bon in the dolomites was derived...alteration of dolomite: A review: Car-bonates and Evaporites, v...Simo, T., eds., Advances in Car-bonate Sequence Stratigraphy...

Gerilyn S. Soreghan; Michael H. Engel; Roger A. Furley; Katherine A. Giles

15

Biomass Gasification:? Produced Gas Upgrading by In-Bed Use of Dolomite  

Science Journals Connector (OSTI)

When some calcined dolomite (OCa·OMg) is used in the bed of a biomass gasifier of fluidized bed type the raw gas produced is cleaner than when only silica sand is used in it as fluidizing medium. In-bed dolomite changes the product distribution at the ...

Ana Olivares; María P. Aznar; Miguel A. Caballero; Javier Gil; Eva Francés; José Corella

1997-12-01T23:59:59.000Z

16

Geochemistry and origin of regional dolomites: Annual progress report, July 26, 1987-March 15, 1988  

SciTech Connect (OSTI)

This progress report covers accomplishments over the past year. Over the past year we have continued to maintain a group of excellent graduate students working on petrology of dolomites and closely allied topics. The research topics include: (1) U-Th-Pb systematics in Burlington-Keokuk carbonates;(2) solid inclusions and non-carbonate phases in dolomites of the Burlington-Keokuk FMS;(3) Porosity and permeability in dolomites of Burlington-Keokuk FMS;(4) X-ray microprobe analysis of trace elements using synchroton radiation;(5) Dolomitization of Devonian reef complexes Canning basin western Australia;(6) Quantitative modeling of major and trace elements and isotopes during carbonate diagenesis;(7) Modeling of regional fluid flow;and (8) Stable isotope geochemistry and cathode luminescence of crinoids from the Burlington-Keokuk FMS.

Hanson, G.N.; Meyers, W.J.

1988-03-01T23:59:59.000Z

17

Note on the genesis of brucite in contact metamorphism of dolomite  

Science Journals Connector (OSTI)

Consideration of available thermodynamic data and the published results of direct experiments relating to (1) formation. of periclase from dolomite and (2) hydration of periclase to brucite, permits the following...

Professor Dr. Francis J. Turner

1965-01-01T23:59:59.000Z

18

A dolomite preheater-economizer for use of the exhaust gas heat of rotary kilns  

Science Journals Connector (OSTI)

In the Seversk Dolomite Combine a prototype of a preheater-economizer for utilization of the heat of the ... exhaust gases at the inlet to the preheater-economizer of 550–600°C and passage through...

G. S. Rasput'ko; V. V. Churilov; V. I. Rogovskii; Ya. N. Rudnitskii…

19

Abu Dhabi sabkha, Persian Gulf, revisited: Application of strontium isotopes to test an early dolomitization model  

SciTech Connect (OSTI)

A study of brines and diagenetically altered minerals from coastal sabkha of Abu Dhabi, Persian Gulf, was undertaken to test the flood recharge-evaporative pumping model for early dolomitization using strontium isotopes as a tracer. The {sup 87}Sr/{sup 86}Sr ratio of the sabkha brines defines a pattern of both horizontal and vertical mixing of coastal seawater and continental ground water consistent with a previously proposed model. The {sup 87}Sr/{sup 86}Sr ratio of the diagenetic dolomites indicates early dolomitization by marine recharge waters. The {sup 87}Sr/{sup 86}Sr ratio of gypsum from the dolomitization area (1.4 to 4.4 km from high-tide mark) and seaward reflects precipitation from marine brines, but more landward (6 to 9 km), gypsum and anhydrite record a continental signal in the minerals suggests a paragenetic evaporative sequence (dolomite {yields} gypsum {yields} anhydrite). The dolomitizing fluid is evaporated seawater that recharges the sabkha aquifer during supratidal flooding and is afterward pumped upward through the saturated zone by evaporative processes.

Mueller, D.W.; McKenzie, J.A. (Swiss Federal Institute of Technology, Zuerick (Switzerland)); Mueller, P.A. (Univ. of Florida, Gainesville (USA))

1990-07-01T23:59:59.000Z

20

Acidizing Dolomite Reservoirs Using HCL Acid Prepared with Seawater: Problems and Solutions  

E-Print Network [OSTI]

Collection PI N itro g en Overburden Pump P I Oil Refill Oil Collection Fluid Waste B rin e P isto n D I P isto n A cid P isto n Syringe Pump 9 Figure 2: Cross-section view of core holder. Corefloods testing initial... 230 250 270 290 0 1 2 3 4 5 6 7 8 [ C a ] 2 + a n d [ M g ] 2 + , m g / L P r e s s u r e D r o p A c r o s s C o r e , P S I PV DI Water Run at 77°F: [Ca] 2+ , [Mg] 2+ , and Pressure Data Pressure Drop Across Core Calcium Concentration...

Arensman, Dennis G

2014-04-28T23:59:59.000Z

Note: This page contains sample records for the topic "acid dl dolomitic" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


21

Ground-water flow modeling of the Culebra dolomite  

SciTech Connect (OSTI)

This hydrogeologic modeling study has been performed as part of the regional hydrologic characterization of the Waste Isolation Pilot Plant (WIPP) site in southeastern New Mexico. The study has produced an estimation of the transmissivity and Darcy-velocity distributions in the Culebra Dolomite Member of the Permian Rustler Formation at the WIPP site. The results of this study are intended to support Sandia National Laboratories performance-assessment calculations. The three-dimensional finite-difference code SWIFT II was employed for the numerical modeling, using a variable-fluid-density and single-porosity formulation. The spatial scale of the model, 21.3 km by 30.6 km, was chosen to allow simulation of regional-scale pumping tests conducted at the H-3 and H-11 hydropads and the WIPP-13 borehole, which are located south, southeast, and northwest, respectively, of the center of the WIPP site. The modeled area includes and extends beyond the controlled area defined by the WIPP-site boundaries. The work performed in this study consisted of modeling the hydrogeology of the Culebra in two stages: steady-state modeling to develop the best estimate of the undisturbed head distribution (i.e., of the hydraulic conditions before excavation of the WIPP shafts, which began in 1981) and superimposed transient modeling of local hydrologic response to excavation of the four WIPP shafts at the center of the WIPP site, as well as to various well tests. The transient modeling used the calculated steady-state freshwater heads as initial conditions. 144 refs., 98 figs., 23 tabs.

LaVenue, A.M.; Cauffman, T.L.; Pickens, J.F. (INTERA, Inc., Austin, TX (USA))

1990-10-01T23:59:59.000Z

22

Formation of diagenetic dolomite in coastal sabkha along Arabian (Persian) Gulf  

SciTech Connect (OSTI)

Aragonitic intertidal sediments are being dolomitized in the subsurface supratidal environment of a sabkha along the south shore of the Arabian (Persian) Gulf as a result of the percolation of wind-driven marine-derived brines. The development of abundant diagenetic dolomite results from a optimum combination of high mMg/sup 2 +//mCa/sup 2 +/ ratio fluids, a rapid flow rate which is related to the flooding frequency and sediment permeability, and a shoreline configuration that maintains the proper conditions for a sufficient length of time. Most diagenetic dolomite forms at the expense of primary aragonite according to the reaction: Mg/sup 2 +/ + 2CaCO/sub 3/(arag) ..-->.. CaMg(CO/sub 3/)/sub 2/ + Ca/sup 2 +/. Dolomite forms under the following conditions: (a) chloride concentration between 3.25 and 3.75 mCl/sup -//Kg; (b) mMg/sup 2 +//mCa/sup 2 +/ greater than about 6; (c) pH between 6.3 and 6.9; (d) minimum P/sub CO2/ of 10/sup -2/ to 10/sup -3/ atm; (e) temperature between 25 and 40/sup 0/C; (f) saturation with respect to gypsum; and (g) reducing environment in association with hydrogen sulfide. Other recent dolomite occurrences in the Bahamas, Florida, and Bonaire are significantly different in terms of stratigraphy, degree of lithification, and evaporite mineral association from those in the Arabian Gulf.

Patterson, R.J. (Univ. of Petroleum and Minerals, Dhahran, Saudi Arabia); Kinsman, D.J.J.

1982-01-01T23:59:59.000Z

23

Hydrothermal dolomites in SW Sardinia (Italy): evidence for a widespread late-Variscan fluid flow event  

E-Print Network [OSTI]

Hydrothermal dolomites in SW Sardinia (Italy): evidence for a widespread late-Variscan fluid flow, the Cambrian carbonates underwent ductile deformation and greenschist facies metamorphism. The same is true-temperature metamorphic rocks within the overlying nappes. It is assumed that a late-Variscan hydrothermal event, which

Boni, Maria

24

Calcined Dolomite, Magnesite, and Calcite for Cleaning Hot Gas from a Fluidized Bed Biomass Gasifier with Steam:? Life and Usefulness  

Science Journals Connector (OSTI)

Calcined Dolomite, Magnesite, and Calcite for Cleaning Hot Gas from a Fluidized Bed Biomass Gasifier with Steam:? Life and Usefulness ... About the temperature effect, at low (800 °C) and medium (840 °C) temperatures, the calcite is soon deactivated. ...

Jesús Delgado; María P. Aznar; José Corella

1996-10-08T23:59:59.000Z

25

Core analyses for selected samples from the Culebra Dolomite at the Waste Isolation Pilot Plant site  

SciTech Connect (OSTI)

Two groups of core samples from the Culebra Dolomite Member of the Rustler Formation at and near the Waste Isolation Pilot Plant were analyzed to provide estimates of hydrologic parameters for use in flow-and-transport modeling. Whole-core and core-plug samples were analyzed by helium porosimetry, resaturation and porosimetry, mercury-intrusion porosimetry, electrical-resistivity techniques, and gas-permeability methods. 33 refs., 25 figs., 10 tabs.

Kelley, V.A.; Saulnier, G.J. Jr. (INTERA, Inc., Austin, TX (USA))

1990-11-01T23:59:59.000Z

26

acid  

Office of Legacy Management (LM)

Acid/Pueblo Canyon, New Mexico, Site is Acid/Pueblo Canyon, New Mexico, Site is located near the town of Los Alamos, New Mexico, approximately 25 miles northwest of Santa Fe and 60 miles north-northeast of Albuquerque. The site is accessible from Canyon Road, which runs just south of the former waste treatment plant. The plant was situated on a mesa that forms the south rim of Acid Canyon. Acid Canyon is a small tributary near the head

27

acid  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Acid/Pueblo Canyon, New Mexico, Site. Acid/Pueblo Canyon, New Mexico, Site. This site is managed by the U.S. Department of Energy Office of Legacy Management. Site Description and History The Acid/Pueblo Canyon, New Mexico, Site is located near the town of Los Alamos, New Mexico, approximately 25 miles northwest of Santa Fe and 60 miles north-northeast of Albuquerque. The site is accessible from Canyon Road, which runs just south

28

Note on Evaluation of AWG Port Utilization Probabilities dl(1, j), j = 1, D, D -1, and  

E-Print Network [OSTI]

1 Note on Evaluation of AWG Port Utilization Probabilities dl(1, j), j = 1, D, D - 1, and dl(1, 1, D - 1 In this appendix we evaluate dl(1, j) for j = 1, D, D-1, i.e., the output port j is not a direct neighbor of sender port D, and note that the dl(1, j) are the same for these AWG ports j. We

Reisslein, Martin

29

Isotope (?13C and ?18O) compositions of dolomites from the Permian evaporitic sequences of the Eastern Russian Plate: Evidence from the Syukeevo gypsum deposit  

Science Journals Connector (OSTI)

Carbon and oxygen isotope compositions has been studied in dolomites of the Syukeevo gypsum deposit located in the Eastern Russian Plate. Values of ?13C in the dolomites vary from 0.3 to 6.6 ‰; ?18O, from 28.0 to...

R. Kh. Sungatullin; V. N. Kuleshov; R. I. Kadyrov

2014-09-01T23:59:59.000Z

30

Variations in Mg/Ca as a control on distribution of strontium concentrations and delta/sup 18/O in upper Tertiary dolomites from Bahamas  

SciTech Connect (OSTI)

Strontium concentrations and delta/sup 18/O are commonly used to infer the gross composition of dolomitizing waters, yet the bases for such inferences are not firmly established. A new approach to calibrating these 2 parameters is suggested from analyses of a section of upper Tertiary dolomites from the Bahamas. In an interval of dolomite, 120 m (394 ft) from a core taken on San Salvador Island, mole % MgCO/sub 3/ is correlated positively with delta/sup 18/O, and negatively with strontium. Strontium substitutes mainly for calcium, thus the negative correlation with mole % MgCO/sub 3/. Dolomites are enriched between 3 to 7% in delta/sup 18/O as compared with coprecipitated calcite, and thus the positive correlation. These two covariations indicate the need to consider the stoichiometric coefficient of dolomites, and to normalize strontium concentrations and delta/sup 18/O with their respective stoichiometric coefficients before inferring their relationship with fluid composition.

Swart, P.K.; Dawans, J.M.

1984-04-01T23:59:59.000Z

31

Benefits and costs of tourism and outdoor recreation in the Natural Park of the Ampezzo Dolomites (Veneto-Italy)  

E-Print Network [OSTI]

1 Benefits and costs of tourism and outdoor recreation in the Natural Park of the Ampezzo Dolomites economy. The Alps Agreement too, with particular regard to Tourism Protocol has underlined that tourism development has to be sustainable. Therefore, we need to know tourism and outdoor recreation benefits

Tempesta, Tiziano

32

Interpretations of Tracer Tests Performed in the Culebra Dolomite at the Waste Isolation Pilot Plant Site  

SciTech Connect (OSTI)

This report provides (1) an overview of all tracer testing conducted in the Culebra Dolomite Member of the Rustler Formation at the Waste Isolation Pilot Plant (WPP) site, (2) a detailed description of the important information about the 1995-96 tracer tests and the current interpretations of the data, and (3) a summary of the knowledge gained to date through tracer testing in the Culebra. Tracer tests have been used to identify transport processes occurring within the Culebra and quantify relevant parameters for use in performance assessment of the WIPP. The data, especially those from the tests performed in 1995-96, provide valuable insight into transport processes within the Culebra. Interpretations of the tracer tests in combination with geologic information, hydraulic-test information, and laboratory studies have resulted in a greatly improved conceptual model of transport processes within the Culebra. At locations where the transmissivity of the Culebra is low (< 4 x 10{sup -6} m{sup 2}/s), we conceptualize the Culebra as a single-porosity medium in which advection occurs largely through the primary porosity of the dolomite matrix. At locations where the transmissivity of the Culebra is high (> 4 x 10{sup -6} m{sup 2}/s), we conceptualize the Culebra as a heterogeneous, layered, fractured medium in which advection occurs largely through fractures and solutes diffuse between fractures and matrix at multiple rates. The variations in diffusion rate can be attributed to both variations in fracture spacing (or the spacing of advective pathways) and matrix heterogeneity. Flow and transport appear to be concentrated in the lower Culebra. At all locations, diffusion is the dominant transport process in the portions of the matrix that tracer does not access by flow.

MEIGS,LUCY C.; BEAUHEIM,RICHARD L.; JONES,TOYA L.

2000-08-01T23:59:59.000Z

33

Laboratory column experiments for radionuclide adsorption studies of the Culebra dolomite member of the Rustler Formation  

SciTech Connect (OSTI)

Radionuclide transport experiments were carried out using intact cores obtained from the Culebra member of the Rustler Formation inside the Waste Isolation Pilot Plant, Air Intake Shaft. Twenty-seven separate tests are reported here and include experiments with {sup 3}H, {sup 22}Na, {sup 241}Am, {sup 239}Np, {sup 228}Th, {sup 232}U and {sup 241}Pu, and two brine types, AIS and ERDA 6. The {sup 3}H was bound as water and provides a measure of advection, dispersion, and water self-diffusion. The other tracers were injected as dissolved ions at concentrations below solubility limits, except for americium. The objective of the intact rock column flow experiments is to demonstrate and quantify transport retardation coefficients, (R) for the actinides Pu, Am, U, Th and Np, in intact core samples of the Culebra Dolomite. The measured R values are used to estimate partition coefficients, (kd) for the solute species. Those kd values may be compared to values obtained from empirical and mechanistic adsorption batch experiments, to provide predictions of actinide retardation in the Culebra. Three parameters that may influence actinide R values were varied in the experiments; core, brine and flow rate. Testing five separate core samples from four different core borings provided an indication of sample variability. While most testing was performed with Culebra brine, limited tests were carried out with a Salado brine to evaluate the effect of intrusion of those lower waters. Varying flow rate provided an indication of rate dependent solute interactions such as sorption kinetics.

Lucero, D.A.; Heath, C.E. [Sandia National Labs., Albuquerque, NM (United States); Brown, G.O. [Oklahoma State Univ., Stillwater, OK (United States). Biosystems and Agricultural Engineering Dept.

1998-04-01T23:59:59.000Z

34

Conceptual model for transport processes in the Culebra Dolomite Member, Rustler Formation  

SciTech Connect (OSTI)

The Culebra Dolomite Member of the Rustler Formation represents a possible pathway for contaminants from the Waste Isolation Pilot Plant underground repository to the accessible environment. The geologic character of the Culebra is consistent with a double-porosity, multiple-rate model for transport in which the medium is conceptualized as consisting of advective porosity, where solutes are carried by the groundwater flow, and fracture-bounded zones of diffusive porosity, where solutes move through slow advection or diffusion. As the advective travel length or travel time increases, the nature of transport within a double-porosity medium changes. This behavior is important for chemical sorption, because the specific surface area per unit mass of the diffusive porosity is much greater than in the advective porosity. Culebra transport experiments conducted at two different length scales show behavior consistent with a multiple-rate, double-porosity conceptual model for Culebra transport. Tracer tests conducted on intact core samples from the Culebra show no evidence of significant diffusion, suggesting that at the core scale the Culebra can be modeled as a single-porosity medium where only the advective porosity participates in transport. Field tracer tests conducted in the Culebra show strong double-porosity behavior that is best explained using a multiple-rate model.

Holt, R.M. [Holt Hydrogeology, Placitas, NM (United States)] [Holt Hydrogeology, Placitas, NM (United States)

1997-08-01T23:59:59.000Z

35

Chemical and radiochemical characteristics of groundwater in the Culebra Dolomite, southeastern New Mexico  

SciTech Connect (OSTI)

The nation's first geologic repository for radioactive waste is being excavated in southeastern New Mexico at the Waste Isolation Pilot Plant (WIPP). Post-closure radioactive release scenarios from WIPP often involve hydrologic transport of radionuclides through the overlying Rustler Formation, in the Culebra Dolomite Member. The Environmental Evaluation Group (EEG) has conducted an investigation of the chemistry of culebra groundwater. Analysis revealed the following: salinities in Culebra groundwater generally increase from west to east; a Na-Cl type water dominates over most of the sampled area with a Ca-SO/sub 4/ type occurring in the southern to southwestern area; exclusive of the low-salinity southern area, most wells located on the same general flow path have similar ion ratios; dissolved uranium content in Culebra groundwater is relatively high, with marked disequilibrium between U-238 and U-234 activities; Ra-226 and Ra-228 are sometimes present in relatively large amounts; Th-228 was detected in samples from 5 wells; and Cs-137 was detected in several samples. 39 refs., 21 figs., 2 tabs.

Chapmen, J.B.

1988-03-01T23:59:59.000Z

36

MR-Trackable Intramyocardial Injection Catheter P.V. Karmarkar,1* D.L. Kraitchman,1  

E-Print Network [OSTI]

MR-Trackable Intramyocardial Injection Catheter P.V. Karmarkar,1* D.L. Kraitchman,1 I. Izbudak,1 L.V. Hofmann,1 L.C. Amado,2 D. Fritzges,1 R. Young,3 M. Pittenger,3 J.W.M. Bulte,1 and E. Atalar1 ventricular remodeling. MRI can be effectively used to differentiate in- farcted from healthy myocardium. MR

Atalar, Ergin

37

Kinetics of on Goethite: A Pressure Relaxation Study. P. G. GROSSL*, MJ. EICK, D.L.  

E-Print Network [OSTI]

I Kinetics of on Goethite: A Pressure Relaxation Study. P. G. GROSSL*, MJ. EICK, D.L. SPARKS, and C the adsorption/desorption of the oxyanions, chromate and arsenate, on goethite (a-FeOOH). Experimental conditions included equilibration of a 10 g L-l goethite (surface area 52 m2 g-l) suspension with initial total

Sparks, Donald L.

38

u.s. Dl1PARUIFNT OF ENERGY EERE PROJECT MAN AGEMENT CENTER NEPA DETERMINATION  

Broader source: Energy.gov (indexed) [DOE]

Dl1PARUIFNT OF ENERGY Dl1PARUIFNT OF ENERGY EERE PROJECT MAN AGEMENT CENTER NEPA DETERMINATION Page I of2 STATE: TX RECIPIENT:E1 Paso, TX PROJECT PV Solar Demonstration Project ARRA-EECBG-City of EI Paso, TX TITLE: Funding Opportunity Announcement Number Procurement Instrument Number NEPA Control Number CID Number DE-FOA-OOOOO13 DE-EEOOOO964 GFQ-0000964-OO3 G0964 Based on my review orlhe information concerning the proposed action, as NEPA Compliance Officer (authoriJ'£d under DOE Order 451.IA), I have made the rollowing determination: ex, EA, EIS APPENDIX AND NUMBER: Description: 85.16 Solar photovoltalc systems The installation, modification, operation, and removal of commercially available solar pholovoltaic systems located on a building or other structure (such as rooftop, parking lot or facility, and mounted to

39

Voltage Dependent Carrier Collection in CdTe Solar Cells D.L. Btzner1  

E-Print Network [OSTI]

Voltage Dependent Carrier Collection in CdTe Solar Cells D.L. Bätzner1 , Guido Agostinelli2 , A to 1000nm, i.e. the band edge region of CdTe. Region I is further divided in a `blue' part between 300 nm III is as well subdivided in region IIIa from about 800 nm to the band gap of CdTe (~850 nm

Romeo, Alessandro

40

Depositional facies, textural characteristics, and reservoir properties of dolomites in Frobisher-Alida interval in southwest North Dakota  

SciTech Connect (OSTI)

The Mississippian Frobisher-Alida interval is an upward-shoaling cycle that began with open-marine sedimentation and culminated with the deposition of a widespread sabkha-salina evaporite. This cycle is the most prolific oil-producing interval in the North Dakota portion of the Williston basin. Most Frobisher-Alida production in the southern Williston basin is from dolomite reservoirs. The six major facies defined in this paper are lithologic suites that represent sediments and precipitates deposited in similar environments. 20 figures, 5 tables.

Petty, D.M.

1988-10-01T23:59:59.000Z

Note: This page contains sample records for the topic "acid dl dolomitic" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


41

Geochemical and optical characterization of diagenetic and hydrothermal dolomite from the Bonneterre formation within the Southeastern Missouri Lead-Zinc District  

E-Print Network [OSTI]

core, b. single high Fe rim, c. single outer dark rim 73 41 MS-1-1044. 0 Color cathodoluminescence, 200X. . 74 42 MS-1-1044. 0 Ferrous iron staining of dolomite by potassium ferricyanide, uncrossed nicols, 200X. . . , 74 43 MS-1-1044. 0 Linescan... rim 3, e. single rim 4. . . . . . . . . . . . . . . . 76 LIST OF FIGURES (continued) ~Fi ure ~Pa e 46 MS-4-983. 0 a. Ferrous iron staining of dolomite by potassium ferricyanide, uncrossed nicols, 220X. . . . . . 77 47 NS-4-983. 0b Plane light...

Borkowski, Richard Michael

1983-01-01T23:59:59.000Z

42

U.S. Dl1PARl'MENT OF ENERGY EERE PROJECT MAN AG EMENT CENTER  

Broader source: Energy.gov (indexed) [DOE]

r-.u..~ r-.u..~ , U.S. Dl1PARl'MENT OF ENERGY EERE PROJECT MAN AG EMENT CENTER NEPA DEl'ElU.,nNAl'ION RECIPIENT:WA Dept. of Commerce PROJECT TITLE: Washington State Ferries Biodiesel Project· Phase II Page 1 of3 STATE: WA Funding Opportunity Announcement Number ProcuR'mentlnstrument Number NEPA Control Number em Number DE-FOA-OOOOO52 EEOOOO139 GF0-0000139-039 EE139 Based on my review orlhe Information concerning the propostd action, as NEPA Compliance Officer (authorized under DOE Order 45I.1A), I have made tbe rollowing determination: ex, EA, EIS APPENDIX AND NUMBER: Description: B5.22 Alternative fuel vehicle fueling stations The installation, modification, operation, and removal of alternative fuel vehicle fueling stations (such as for compressed

43

ANALYTICAL DATA SHEET ANALYTICAL DEPT. - HEALTH Al\rD SAFETY DlVlSlON  

Office of Legacy Management (LM)

em IVIL, u-3 em IVIL, u-3 1' 1L, I -' I ANALYTICAL DATA SHEET ANALYTICAL DEPT. - HEALTH Al\rD SAFETY DlVlSlON 1956 1. H.# fL22 Industrial Hygiene or Medical Dept. Sample Nor& 3 Date Collected- 5117 by --Route to CES CES r Location IQJKER-PEMJNS Co- Type of Sample-waternalyzed for F Alpha Remarks -&I GG -- u - Beta Samples of water discharged to river during Steam clean- No, Ra ing of equipment. Oil PH Be Th Sample No. Hour Sample Description (RT Please analyze for gm/U/gal. BP-1 P- RO-Kneader BP-2 K- N-Kneader BP-3 Omera Feeder - __-- .___ -- i ___- ------I - 1 I . ----.--- - ------ .-___ _- I I - 3" - 1 ' : i ' Nt! w-d Analytical Chemistry Section: - Date Received 5-21-56 bY %b. Date Reported 5-2 Z-56 by&b. Method of Analysis Fluorimeter

44

EERE PROJECT MANAGEMENT CDITER Nl!PA Dl!Tl!Rl\llNATION  

Broader source: Energy.gov (indexed) [DOE]

... ... ~ . u.s DEPAR lENT OFl!NERG' EERE PROJECT MANAGEMENT CDITER Nl!PA Dl!Tl!Rl\llNATION Page 1 of2 RECIPIENT:Stanford University STATE: CA PROJECf TITLE: In·Situ X·Ray Analysis of Rapid Thermal Processing for Thin·FiI Solar Cells: Closing the Gap between Production and Laboratory Efficiency Funding Opportunity Announcement Number DE·FOA-0000654 Procurement Instrument Number DE·EE0005951 NEPA Control Number em Number GFQ-0005951·001 G05951 Based on my review of the information concerning the proposed action, as NEPA Compliance Officer (authorized under DOE Order 4SI.IA), I have made the following determination: CX, EA, EIS APP~:NDIX AND NUMBER: Description: A9 Information gathering, analysis, and dissemination 81.31 Installation or

45

Dl!PARThlENT OF ENERGY EERE PROJECT \1A~AGEMENT CENTER  

Broader source: Energy.gov (indexed) [DOE]

~"'-'~' ~"'-'~' u.s. Dl!PARThlENT OF ENERGY EERE PROJECT \1A~AGEMENT CENTER NEPA DETEIU.llNATION Page 1 of2 REel PIENT:County of Somerset STATE: NJ PROJECT TITl.E : Somerset County Renewable Energy Initiative Funding Opportunity Announcement Number Procurement Instrument Number NEPA Control Number CID Number DE-EEOOO3199 GFOOOO3199-001 G03199 BaSC'd on my review o!tbe information concerning the proposed action, as NEPA Compliance Officrr (authorized under DOE Order 451.1A), I have made the following detenninatioo: ex, EA, [IS APPENDIX AND NUMBER: Description: 85.16 Solar photovoltaic systems The installation, modification , operation, and removal of commercially available solar photoyoltaic systems located on a building or other structure (such as rooftop. parking lot Of facility

46

Rvision par r-ensembles de bases de connaissances en DL-LiteR S. Benferhat1  

E-Print Network [OSTI]

2 E. Würbel3 1 Université d'Artois - Nord de France, CRIL-CNRS UMR 8188. 2 Université d- vision" for revising DL-Lite knowledge bases. Such stra- tegy of revision is based on inconsistency

Paris-Sud XI, Université de

47

Some Factors Affecting the Utilization of Phosphoric Acid in Soils by Plants in Pot Experiments.  

E-Print Network [OSTI]

TEXAS AGRICULTURAL EXPERIMENT STATION A. B. CONNER, Director College Station, Texas BULLETIN NO. 647 APRIL, 1944 SOME FACTORS AFFECTING THE UTILIZATION OF PHOSPHORIC ACID IN SOILS BY PLANTS IN POT EXPERIMENTS G. S. FRAPS and J. F. FUDGE...] The relations between the quantities of phosphoric acid re- moved by corn and milo or kafir and the composition and other characteristics of Texas soils was ascertained from the data of 375 pot experiments. acid acid crol nhn! =---, Wit pho; tota DL...

Fudge, J. F. (Joseph Franklin); Fraps, G. S. (George Stronach)

1944-01-01T23:59:59.000Z

48

ANALYTICAL DATA SHEET ANALYTICAL DEPT. - HEALTH AhD SAFETY DlVlSlDN  

Office of Legacy Management (LM)

ANALYTICAL DEPT. - HEALTH AhD SAFETY DlVlSlDN I -. . Industrial Hygiene or Medical Dept. 1956 I. H.# 984 Sample Nos. l2 Date Collected- o/2g by&- Route to J" Location SSi4.X CUiTn! CXJitP. Type of Sample&-dust Analyzed for F Alpha x Remarks P~UXC~JGIi.' ON. 14lCI11~ U Beta - IIoll0Wi.n~ slucs - NO, Ra Oil PH Be Th Sample No. 7573p Hour Sample Description 1355 CZ Orxxator sets slul: into place, closes shield over machine S starts &ill. oil coolant flows through hollow drill ____ 3 is rebounded back through an openiq covers 1 cor.lp N9 8775 Analytical Chemistry Section: Date Received 7-2-66 by hb Date Reported 74X& bY IIR Method of Analysis Alpha sdntillation cam 2 % ' CJly Counting Data: BKGD .27 c/min GE0 4o% /min 1 I c- d/ill/M 3

49

DEPXRTMEKT OF ENV]RO~:MENTAL F'ROTECTION DlVklOh OF  

Office of Legacy Management (LM)

. * . * @.+<, .-- v 7, -e -5 u i' ;. - - : ,.:,, 4-.1M-4. a". : ' - l-1 &dp d 3-m 3jPr5Py DEPXRTMEKT OF ENV]RO~:MENTAL F'ROTECTION DlVklOh OF ~NVIR0N~Eh~A.L OUR' tiIn - . BUREAU OF R&DllmcN t=ROTE~lOH ' 1 ,_ jBD 5cOTCH ROAD. ~R~%~obi. fd. 1. 08628 .' - ._ -_ _ . . : S=_srterrjer 27, 1977 - ,. _ :.- ,_..I \ L . x=- a-. JEC): f' eust C--l L-9 ,c:c- -*r 2ze E&f&y _3=iz=Et=g cr;i\' ==Siq ' ---res"LE;, c2iiIps - de- ~-z7~~to3, Bew --d Jersey DE540 3ez' -- . w- Tecsk: i 25, 1577, A&=!= --t' -jD,r= of

50

DEPARTMENT OF ENERGY EERE PROJECT MANAGEMENT CENTER N1!PA Dl!1'ElU.llNATION  

Broader source: Energy.gov (indexed) [DOE]

N1!PA Dl!1'ElU.llNATION N1!PA Dl!1'ElU.llNATION RECIPIENT:City of Perth Amboy PROJECT TITLE : Municipal Complex Solar Power Project Page 1 of2 STATE: NJ Funding Opportunity Announl::ement Number Procurement Instrument Number NEPA Control Number elD Number Congressionally Directed Project DE· EEOOO3172 GF0-0003172..Q01 EE3172 Based on my review of the information concerning the proposed action, as N[PA Compliance Officer (authoro.ed under DOE Order451.1A),1 have made tbe following determination: ex, EA, EIS APPENDIX AND NUMBER: Description: 8 5.1 Adions to oonserve energy, demonstrate potential energy conservation, and promote energy-efficiency that do not increase the indoor concentratIOns of potentially harmful substances. These actions may involve financial and technical

51

Recrystallization in CdTe/CdS A. Romeo, D.L. Batzner, H. Zogg, A.N. Tiwari*  

E-Print Network [OSTI]

Recrystallization in CdTe/CdS A. Romeo, D.L. BaÃ?tzner, H. Zogg, A.N. Tiwari* Thin Film Physics with HVE and CBD grown CdS window layers. q 2000 Elsevier Science S.A. All rights reserved. Keywords: Cd and to different deposition techniques of the window layer. Chemi- cal bath deposition (CBD) grown CdS is preferred

Romeo, Alessandro

52

Column Experiments for Radionuclide Adsorption Studies of the Culebra Dolomite: Retardation Parameter Estimation for Non-Eluted Actinide Species  

SciTech Connect (OSTI)

The U.S. Department of Energy (DOE) has been developing a nuclear waste disposal facility, the Waste Isolation Pilot Plant (WIPP), located approximately 42 km east of Carlsbad, New Mexico. The WIPP is designed to demonstrate the safe disposal of transuranic wastes produced by the defense nuclear-weapons program. Performance assessment analyses (U.S. DOE, 1996) indicate that human intrusion by inadvertent and intermittent drilling for resources provide the only credible mechanisms for significant releases of radionuclides horn the disposal system. These releases may occur by five mechanisms: (1) cuttings, (2) cavings, (3) spallings, (4) direct brine releases, and (5) long-term brine releases. The first four mechanisms could result in immediate release of contaminant to the accessible environment. For the last mechanism, migration pathways through the permeable layers of rock above the Salado are important, and major emphasis is placed on the Culebra Member of the Rustler Formation because this is the most transmissive geologic layer in the disposal system. For reasons of initial quantity, half-life, and specific radioactivity, certain isotopes of Th, U, Am, and Pu would dominate calculated releases from the WIPP. In order to help quanti~ parameters for the calculated releases, radionuclide transport experiments have been carried out using five intact-core columns obtained from the Culebra dolomite member of the Rustler Formation within the Waste Isolation Pilot Plant (WIPP) site in southeastern New Mexico. This report deals primarily with results of mathematical analyses related to the retardation of %J%, 24%, and 24'Am in two of these cores (B-Core - VPX26-11A and C-Core - VPX28-6C). All B-Core transport experiments were done using Culebra-simukmt brine relevant to the core recovery location (the WIPP air-intake shaft - AIS). Most experiments with C-Core were done with AIS brine with some admixture of a brine composition (ERDA-6) that simulated deeper formation brines. No significant changes in transport behavior were observed for changes in brine. Hydraulic characteristics (i.e., apparent porosity and apparent dispersion coefficient) for the cores were obtained via experiments using conservative tracer `Na. Elution experiments carried out over periods of a few days with tracers `*U and %Np indicated that these tracers were weakly retarded as indicated by delayed elution of these species. Elution experiments with tracers `%, 24'Pu, and 24'Ani were performed, but no elution of any of these species was observed in any flow experiment to date, including experiments of up to two years duration. However, B-Core was subjected to tomographic analysis from which a retardation factor can be inferred for%. Moreover, the fact of non- elution for 24*Pu and 24'Am after more than two years brine flow through C-Core can be coupled with the minimum detectable activity for each of these species to compute minimum retardation factors in C-Core. The retardation factors for all three species can then be coupled with the apparent hydraulic characteristics to estimate an apparent minimum solutionhock distribution coefficient, &, for each actinide. The specific radionuclide isotopes used in these experiments were chosen to facilitate analysis. Even though these isotopes are not necessarily the same as those that are most important to WIPP performance, they are isotopes of the same elements, and . their chemical and transport properties are therefore identical to those of isotopes in the WIPP inventory. The retardation factors and & values deduced from experimental results strongly support the contention that sorption in the Culebra provides an effective barrier to release of Th, Pu, and Am during the regulatory period.

Brown, G.O.; Lucero, D.A.; Perkins, W.G.

1999-01-01T23:59:59.000Z

53

U.S. DEPARTIl1ENT OF ENERGY EERE PROJECT MANAGEMENT CENTER NEPA Dl!TFR1ITNATION  

Broader source: Energy.gov (indexed) [DOE]

ENT OF ENERGY ENT OF ENERGY EERE PROJECT MANAGEMENT CENTER NEPA Dl!TFR1ITNATION RECIPIENT:Colorado School of Mines Page 1 on STATE: CO PROJECT TITLE: Time-lapse Joint Inversion of GEOphysical Data and its Application to Geothermal Prospecting GEODE Funding Opportunity Announcement Number DOE DE-FOA-OOOO522 Procurement Instrument Number OE-EEOOO5513 NEPA Control Number em Number GFO-o005513-Q01 0 Based on my review ofthe information concerning the proposed action, as NEPA Compliance Officer (authorized under DOE Order 451.IA), 1 have made the following determination: ex, EA, EIS APPENDIX AND NUMBER: Description: A9 1nformation ga thering, a nalysis, a nd d issem ination Information gathering (including, but not limited to, literature surveys, inventories, site visils, and audits), data analysis

54

PMC·Fr.. U.S. Dl?PARThIENT OFFNFRGY EERE PROJECT MANAGEMENT CE~TER  

Broader source: Energy.gov (indexed) [DOE]

Fr.. Fr.. U.S. Dl?PARThIENT OFFNFRGY EERE PROJECT MANAGEMENT CE~TER Nl!PA DF=llNATION RECIPIENT:Oregon Stale University-NNMREC PROJECT TITLE : Pacific Marine Energy Center FY2012 Funding Page 1 of3 STATE: OR Funding Opportunity Announcement Number Procurement Instrument Number NEPA Control Number CID Number G098030 DE-FG36-08GOI8179 GFO-GOI8179-004 G018179 Based on my review of the information concerning the proposed action, as NEPA Compliance Officer (authorized under DOE Order 451. 1A), I have made the following determination: ex, EA, EIS APPENDIX AND NUMBER: Description: A9 Inform ation gathering, analys is, and disseminatlon A1 1 Technical advice and assistance to organizations Information gathering (including, but not limited to, literature surveys, inventories, site visits, and

55

RECIPIENT:QDOE U.S. Dl1PARTlIIENT OF ENERGY EERE PROJECT MANAGEMENT CENTER  

Broader source: Energy.gov (indexed) [DOE]

QDOE QDOE U.S. Dl1PARTlIIENT OF ENERGY EERE PROJECT MANAGEMENT CENTER Nl!PA DETERMINATION Page 1 of2 STATE: OR PROJECT TITL.E : SEP ARRA - Deployment of Innovative Energy Efficiency and Renewable Energy - Agriculture - Dufur & HanncrCantrell Funding Opportunity Announcement Number Pro<:uremeniinstruml.'nt Number NEPA Control Number elD Number OE-FOA-OOOOOS2 EEOOOO140 GF0-0000140-001 EE140 Based on my review of the Information concerning the proposed action, as NEPA Compliance Officer (authorized under DOE Order 4SUA), I have made the following determination: ex, EA, EIS APPENDIX AND NUMBER: De~cription: 85.1 Actions to conserve energy. demonstrate potential energy oonservalion, and promote energy-efficiency that do not increase the indoor concentrations o

56

DEPARThIENT OF ENERGY EERE PROJECT MANAGEMENT CENTER NEPA Dl!1'FIt1.fiNATION  

Broader source: Energy.gov (indexed) [DOE]

DEPARThIENT OF ENERGY DEPARThIENT OF ENERGY EERE PROJECT MANAGEMENT CENTER NEPA Dl!1'FIt1.fiNATION RECIPIENT:Biomass Energy Resource Center PROJECf TITLE: Biomass Energy Resource Center - Core and Program Support Page 1 of2 STATE: VT Funding Opportunity Annoum:emenl Number Procu~ment Instrument Number NEPA Control Number CID Number COP DE-FG36-06G086103,AOO4 GFO-G086103-003 0 Based on my review oflhl' information concerning the proposed action, as NEPA Compliance Officer (aulhoru.ed under DOE Order 451.1A), I bne made the following determination: ex, EA, EIS APPF..NDIX AND NUMBER: Description: A9 Information gathering (including, but not limited 10, literature surveys, inventories, audits), data analysis (including computer modeling), document preparation (such as conceptual design or feasibility studies, analytical energy supply and

57

Cryogenic friction behavior of PTFE based solid lubricant composites N.L. McCook, D.L. Burris, P.L. Dickrell and W.G. Sawyer*  

E-Print Network [OSTI]

Cryogenic friction behavior of PTFE based solid lubricant composites N.L. McCook, D.L. Burris, P life [4,5], ability to operate from cryogenic temperature (4 K) to 500 K, and their relative that operate at cryogenic temperatures, there is a paucity of data available for friction coeffi- cients

Sawyer, Wallace

58

The feedback phase instability in the HBT-EP tokamak D.L. Nadle, C. Cates, H. Dahi, M.E. Mauel,  

E-Print Network [OSTI]

The feedback phase instability in the HBT-EP tokamak D.L. Nadle, C. Cates, H. Dahi, M.E. Mauel, D of a performance limiting feedback phase instability in the HBT-EP toka- mak are reported. The phase instability instability limits feedback performance in HBT-EP by decreasing the feedback loop's phase accuracy as gain

Mauel, Michael E.

59

Kinetics of Adsorption of Selenate and Selonite at the Goethite/Water InterfAce. p.e. ZHANG* and D.L. SPARKS.  

E-Print Network [OSTI]

Kinetics of Adsorption of Selenate and Selonite at the Goethite/Water InterfAce. p.e. ZHANG* and D.L. SPARKS. Univ. of Delaware. Mechanisms and kinetics of SeO, and Se~ at the goethite/water interface were

Sparks, Donald L.

60

Numerical simulation of ground-water flow in the Culebra dolomite at the Waste Isolation Pilot Plant (WIPP) site: Second interim report  

SciTech Connect (OSTI)

This hydrogeologic modeling study has been performed as part of the regional hydrologic characterization of the Waste Isolation Pilot Plant (WIPP) Site in southeastern New Mexico. The study resulted in an estimation of the transmissivity distrubution, hydraulic potentials, flow field, and fluid densities in the Culebra Dolomite Member of the Permian Rustler Formation at the WIPP site. The three-dimensional finite-difference code SWIFT-II was employed for the numerical modeling, using variable-fluid-density and a single-porosity formulation. The modeled area includes and extends beyond the WIPP controlled zone (Zone 3). The work performed consisted of modeling the hydrogeology of the Culebra using two approaches: (1) steady-state modeling to develop the best estimate of the undisturbed head distribution, i.e., of the situation before sinking if the WIPP shafts, which began in 1981; and (2) superimposed transient modeling of local hydrologic responses to excavation of the three WIPP shafts at the center of the WIPP site, as well as to various well tests. Boundary conditions (prescribed constant fluid pressures and densities) were estimated using hydraulic-head and fluid-density data obtained from about 40 wells at and near the WIPP site. The transient modeling used the calculated steady-state freshwater heads as initial conditions. 107 refs., 112 figs., 22 tabs.

LaVenue, A.M.; Haug, A.; Kelley, V.A.

1988-03-01T23:59:59.000Z

Note: This page contains sample records for the topic "acid dl dolomitic" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


61

SULFURIC ACID REMOVAL PROCESS EVALUATION: SHORT-TERM RESULTS  

SciTech Connect (OSTI)

The objective of this project is to demonstrate the use of alkaline reagents injected into the furnace of coal-fired boilers as a means of controlling sulfuric acid emissions. Sulfuric acid controls are becoming of increasing interest to utilities with coal-fired units for a number of reasons. Sulfuric acid is a Toxic Release Inventory species, a precursor to acid aerosol/condensable emissions, and can cause a variety of plant operation problems such as air heater plugging and fouling, back-end corrosion, and plume opacity. These issues will likely be exacerbated with the retrofit of SCR for NOX control on some coal-fired plants, as SCR catalysts are known to further oxidize a portion of the flue gas SO{sub 2} to SO{sub 3}. The project is testing the effectiveness of furnace injection of four different calcium- and/or magnesium-based alkaline sorbents on full-scale utility boilers. These reagents have been tested during four one- to two-week tests conducted on two FirstEnergy Bruce Mansfield Plant units. One of the sorbents tested was a magnesium hydroxide slurry produced from a wet flue gas desulfurization system waste stream, from a system that employs a Thiosorbic{reg_sign} Lime scrubbing process. The other three sorbents are available commercially and include dolomite, pressure-hydrated dolomitic lime, and commercial magnesium hydroxide. The dolomite reagent was injected as a dry powder through out-of-service burners, while the other three reagents were injected as slurries through air-atomizing nozzles into the front wall of upper furnace, either across from the nose of the furnace or across from the pendant superheater tubes. After completing the four one- to two-week tests, the most promising sorbents were selected for longer-term (approximately 25-day) full-scale tests. The longer-term tests are being conducted to confirm the effectiveness of the sorbents tested over extended operation and to determine balance-of-plant impacts. This reports presents the results of the short-term tests; the long-term test results will be reported in a later document. The short-term test results showed that three of the four reagents tested, dolomite powder, commercial magnesium hydroxide slurry, and byproduct magnesium hydroxide slurry, were able to achieve 90% or greater removal of sulfuric acid compared to baseline levels. The molar ratio of alkali to flue gas sulfuric acid content (under baseline conditions) required to achieve 90% sulfuric acid removal was lowest for the byproduct magnesium hydroxide slurry. However, this result may be confounded because this was the only one of the three slurries tested with injection near the top of the furnace across from the pendant superheater platens. Injection at the higher level was demonstrated to be advantageous for this reagent over injection lower in the furnace, where the other slurries were tested.

Gary M. Blythe; Richard McMillan

2002-03-04T23:59:59.000Z

62

SULFURIC ACID REMOVAL PROCESS EVALUATION: SHORT-TERM RESULTS  

SciTech Connect (OSTI)

The objective of this project is to demonstrate the use of alkaline reagents injected into the furnace of coal-fired boilers as a means of controlling sulfuric acid emissions. Sulfuric acid controls are becoming of increasing interest to utilities with coal-fired units for a number of reasons. Sulfuric acid is a Toxic Release Inventory species, a precursor to acid aerosol/condensable emissions, and can cause a variety of plant operation problems such as air heater plugging and fouling, back-end corrosion, and plume opacity. These issues will likely be exacerbated with the retrofit of SCR for NO{sub x} control on some coal-fired plants, as SCR catalysts are known to further oxidize a portion of the flue gas SO{sub 2} to SO{sub 3}. The project is testing the effectiveness of furnace injection of four different calcium- and/or magnesium-based alkaline sorbents on full-scale utility boilers. These reagents have been tested during four one- to two-week tests conducted on two First Energy Bruce Mansfield Plant units. One of the sorbents tested was a magnesium hydroxide slurry produced from a wet flue gas desulfurization system waste stream, from a system that employs a Thiosorbic{reg_sign} Lime scrubbing process. The other three sorbents are available commercially and include dolomite, pressure-hydrated dolomitic lime, and commercial magnesium hydroxide. The dolomite reagent was injected as a dry powder through out-of-service burners, while the other three reagents were injected as slurries through air-atomizing nozzles into the front wall of upper furnace, either across from the nose of the furnace or across from the pendant superheater tubes. After completing the four one- to two-week tests, the most promising sorbents were selected for longer-term (approximately 25-day) full-scale tests. The longer-term tests are being conducted to confirm the effectiveness of the sorbents tested over extended operation and to determine balance-of-plant impacts. This reports presents the results of the short-term tests; the long-term test results will be reported in a later document. The short-term test results showed that three of the four reagents tested, dolomite powder, commercial magnesium hydroxide slurry, and byproduct magnesium hydroxide slurry, were able to achieve 90% or greater removal of sulfuric acid compared to baseline levels. The molar ratio of alkali to flue gas sulfuric acid content (under baseline conditions) required to achieve 90% sulfuric acid removal was lowest for the byproduct magnesium hydroxide slurry. However, this result may be confounded because this was the only one of the three slurries tested with injection near the top of the furnace across from the pendant superheater platens. Injection at the higher level was demonstrated to be advantageous for this reagent over injection lower in the furnace, where the other slurries were tested.

Gary M. Blythe; Richard McMillan

2002-02-04T23:59:59.000Z

63

DEVELOPMENT OF HIGH EFFICIENCY FLEXIBLE CdTe SOLAR CELLS A.Romeo, M. Arnold, D.L. Btzner, H. Zogg and A.N. Tiwari*  

E-Print Network [OSTI]

to the solar panel that can be adapted to any kind of shape and is easy to deploy in space. In the last yearsDEVELOPMENT OF HIGH EFFICIENCY FLEXIBLE CdTe SOLAR CELLS A.Romeo, M. Arnold, D.L. Bätzner, H. Zogg Telephone: +44-1509-227031 E-mail: a.n.tiwari@lboro.ac.uk ABSTRACT: Polycrystalline thin film solar cells

Romeo, Alessandro

64

Interpretation of data obtained from non-destructive and destructive post-test analyses of an intact-core column of culebra dolomite  

SciTech Connect (OSTI)

The U.S. Department of Energy (DOE) has been developing a nuclear waste disposal facility, the Waste Isolation Pilot Plant (WIPP), located approximately 42 km east of Carlsbad, New Mexico. The WIPP is designed to demonstrate the safe disposal of transuranic wastes produced by the defense nuclear-weapons program. Pefiormance assessment analyses (U.S. DOE, 1996) indicate that human intrusion by inadvertent and intermittent drilling for resources provide the only credible mechanisms for significant releases of radionuclides horn the disposal system. These releases may occur by five mechanisms: (1) cuttings, (2) cavings, (3) spallings, (4) direct brine releases, and (5) long- term brine releases. The first four mechanisms could result in immediate release of contaminant to the accessible environment. For the last mechanisq migration pathways through the permeable layers of rock above the Salado are important, and major emphasis is placed on the Culebra Member of the Rustler Formation because this is the most transmissive geologic layer in the disposal system. For reasons of initial quantity, half-life, and specific radioactivity, certain isotopes of T~ U, Am, and Pu would dominate calculated releases from the WIPP. In order to help quantifi parameters for the calculated releases, radionuclide transport experiments have been carried out using five intact-core columns obtained from the Culebra dolomite member of the Rustler Formation within the Waste Isolation Pilot Pknt (WIPP) site in southeastern New Mexico. This report deals primarily with results of analyses for 241Pu and 241Am distributions developed during transport experiments in one of these cores. All intact-core column transport experiments were done using Culebra-simukmt brine relevant to the core recovery location (the WIPP air-intake shaft - AK). Hydraulic characteristics (i.e., apparent porosity and apparent dispersion coefficient) for intact-core columns were obtained via experiments using conservative tracer `Na. Elution experiments carried out over periods of a few days with tracers `2U and `?Np indicated that these tracers were weakly retarded as indicated by delayed elution of these species. Elution experiments with tracers 24% and 24*Arn were performed, but no elution of either species was observed in any flow experiment to date, including experiments of many months' duration. In order to quanti~ retardation of the non-eluted species 24*Pu and 241Arn afler a period of brine flow, non-destructive and destructive analyses of an intact-core column were carried out to determine distribution of these actinides in the rock. Analytical results indicate that the majority of the 241Am is present very near the top (injection) surface of the core (possibly as a precipitate), and that the majority of the 241Pu is dispersed with a very high apparent retardation value. The 24]Pu distribution is interpreted using a single-porosity advection-dispersion model, and an approximate retardation value is reported for this actinide. The specific radionuclide isotopes used in these experiments were chosen to facilitate analysis. Even though these isotopes are not necessarily the same as those that are most important to WIPP performance, they are isotopes of the same elements, and their chemical and transport properties are therefore identical to those of isotopes in the inventory.

Lucero, Daniel L.; Perkins, W. George

1998-09-01T23:59:59.000Z

65

SULFURIC ACID REMOVAL PROCESS EVALUATION: LONG-TERM RESULTS  

SciTech Connect (OSTI)

The objective of this project is to demonstrate the use of alkaline reagents injected into the furnace of coal-fired boilers as a means of controlling sulfuric acid emissions. The project is being co-funded by the U.S. DOE National Energy Technology Laboratory, under Cooperative Agreement DE-FC26-99FT40718, along with EPRI, the American Electric Power Company (AEP), FirstEnergy Corp., the Tennessee Valley Authority, and Dravo Lime, Inc. Sulfuric acid controls are becoming of increasing interest to power generators with coal-fired units for a number of reasons. Sulfuric acid is a Toxic Release Inventory species and can cause a variety of plant operation problems such as air heater plugging and fouling, back-end corrosion, and plume opacity. These issues will likely be exacerbated with the retrofit of selective catalytic reduction (SCR) for NO{sub x} control on many coal-fired plants, as SCR catalysts are known to further oxidize a portion of the flue gas SO{sub 2} to SO{sub 3}. The project previously tested the effectiveness of furnace injection of four different calcium-and/or magnesium-based alkaline sorbents on full-scale utility boilers. These reagents were tested during four one- to two-week tests conducted on two FirstEnergy Bruce Mansfield Plant (BMP) units. One of the sorbents tested was a magnesium hydroxide byproduct slurry produced from a modified Thiosorbic{reg_sign} Lime wet flue gas desulfurization system. The other three sorbents are available commercially and include dolomite, pressure-hydrated dolomitic lime, and commercial magnesium hydroxide. The dolomite reagent was injected as a dry powder through out-of-service burners, while the other three reagents were injected as slurries through air-atomizing nozzles inserted through the front wall of the upper furnace, either across from the nose of the furnace or across from the pendant superheater tubes. After completing the four one- to two-week tests, the most promising sorbents were selected for longer-term (approximately 25-day) full-scale tests on two different units. The longer-term tests were conducted to confirm the effectiveness of the sorbents tested over extended operation on two different boilers, and to determine balance-of-plant impacts. The first long-term test was conducted on FirstEnergy's BMP, Unit 3, and the second test was conducted on AEP's Gavin Plant, Unit 1. The Gavin Plant testing provided an opportunity to evaluate the effects of sorbent injected into the furnace on SO{sub 3} formed across an operating SCR reactor. This report presents the results from those long-term tests. The tests determined the effectiveness of injecting commercially available magnesium hydroxide slurry (Gavin Plant) and byproduct magnesium hydroxide slurry (both Gavin Plant and BMP) for sulfuric acid control. The results show that injecting either slurry could achieve up to 70 to 75% overall sulfuric acid removal. At BMP, this overall removal was limited by the need to maintain acceptable electrostatic precipitator (ESP) particulate control performance. At Gavin Plant, the overall sulfuric acid removal was limited because the furnace injected sorbent was less effective at removing SO{sub 3} formed across the SCR system installed on the unit for NOX control than at removing SO{sub 3} formed in the furnace. The long-term tests also determined balance-of-plant impacts from slurry injection during the two tests. These include impacts on boiler back-end temperatures and pressure drops, SCR catalyst properties, ESP performance, removal of other flue gas species, and flue gas opacity. For the most part the balance-of-plant impacts were neutral to positive, although adverse effects on ESP performance became an issue during the BMP test.

Gary M. Blythe; Richard McMillan

2002-07-03T23:59:59.000Z

66

Dilute Acid Hydrolysis of Oligomers in Hydrothermal Pretreatment Hydrolyzate into Monomers with High Yields  

E-Print Network [OSTI]

Klass DL. 1998. Biomass for renewable energy, fuels, andNational Renewable Energy Laboratory.2003, Biomass feedstockKlass DL. 1998. Biomass for Renewable Energy, Fuels and

Tsai, Yueh-Du

2012-01-01T23:59:59.000Z

67

U.S. DI!PARThlENT OF ENERGY EERE PROJECT MANAGEMENT CENTER Nl!PA Dl1TImfiNATION  

Broader source: Energy.gov (indexed) [DOE]

PARThlENT OF ENERGY PARThlENT OF ENERGY EERE PROJECT MANAGEMENT CENTER Nl!PA Dl1TImfiNATION RECIPIENT: BeIi Geospace, Inc Page 1 of2 STATE: TX PROJECT TITLE: Geothermal Technology Advancement for Rapid Development of Resources in the U.S. Funding OpportunUy Announcement Number Procurement Instrument Number NEPA Control Number em Number DE·FQA'()()()()S22 OE-EEOOO5515 GF0-0005515-001 G05515 Bued on my review oftbe information concerning the proposro action, as NEPA Compliance Officer (authorized under DOE Ordtr 4SI.IA), I have made the following determination: ex, EA, EIS APPENDIX AND NUMBER: Description : A9 Information gathering, analysis, and dissemination Information gathering (induding, but not limited to, literature surveys, inventories, site visits. and audits), data analysis

68

173. NICKEL SORPTION KINETICS ON THE CLAY FRACTION OF A SOIL. D.R. Roberts and D.L. Sparks, Department of Plant and Soil Sciences, University of Delaware, Newark,  

E-Print Network [OSTI]

173. NICKEL SORPTION KINETICS ON THE CLAY FRACTION OF A SOIL. D.R. Roberts and D.L. Sparks the fate of heavy metal contaminants in the soil environment. Past studies of heavy metal sorption kinetics. This study exannines Ni(II) sorption and desorption kinetics on the clay fraction (

Sparks, Donald L.

69

Electric Equipment of the Dolomites Railway  

Science Journals Connector (OSTI)

... current at 2700 volts is adopted. This is done by the use of only one substation situated near Cortina, a little more than half-way from the power terminus. The ... the power terminus. The conversion of the alternating to direct current is done at the substation by means of two mercury arc rectifiers each of 11,000 kilowatts capacity at 3000 ...

1932-01-02T23:59:59.000Z

70

Fatty acid analogs  

DOE Patents [OSTI]

In one aspect, a radioactively labeled analog of a fatty acid which is capable of being taken up by mammalian tissue and which exhibits an in vivo beta-oxidation rate below that with a corresponding radioactively labeled fatty acid.

Elmaleh, David R. (Newton Center, MA); Livni, Eli (Brookline, MA)

1985-01-01T23:59:59.000Z

71

Nucleic acid detection compositions  

DOE Patents [OSTI]

The present invention relates to means for the detection and characterization of nucleic acid sequences, as well as variations in nucleic acid sequences. The present invention also relates to methods for forming a nucleic acid cleavage structure on a target sequence and cleaving the nucleic acid cleavage structure in a site-specific manner. The structure-specific nuclease activity of a variety of enzymes is used to cleave the target-dependent cleavage structure, thereby indicating the presence of specific nucleic acid sequences or specific variations thereof.

Prudent, James R. (Madison, WI); Hall, Jeff G. (Madison, WI); Lyamichev, Victor I. (Madison, WI); Brow, Mary Ann (Madison, WI); Dahlberg, James L. (Madison, WI)

2008-08-05T23:59:59.000Z

72

Cleavage of nucleic acids  

DOE Patents [OSTI]

The present invention relates to means for the detection and characterization of nucleic acid sequences, as well as variations in nucleic acid sequences. The present invention also relates to methods for forming a nucleic acid cleavage structure on a target sequence and cleaving the nucleic acid cleavage structure in a site-specific manner. The structure-specific nuclease activity of a variety of enzymes is used to cleave the target-dependent cleavage structure, thereby indicating the presence of specific nucleic acid sequences or specific variations thereof.

Prudent, James R. (Madison, WI); Hall, Jeff G. (Madison, WI); Lyamichev, Victor L. (Madison, WI); Brow, Mary Ann D. (Madison, WI); Dahlberg, James E. (Madison, WI)

2007-12-11T23:59:59.000Z

73

Mann, C.P., Stix, J., Vallance, J.W., and Richer, M., 2004, Subaqueous intracaldera volcanism, Ilopango Caldera, El Salvador, Central America, in Rose, W.I., Bommer, J.J., Lpez, D.L., Carr, M.J., and Major, J.J., eds., Natural hazards in El Salvador: Boul  

E-Print Network [OSTI]

, Ilopango Caldera, El Salvador, Central America, in Rose, W.I., Bommer, J.J., López, D.L., Carr, M.J., and Major, J.J., eds., Natural hazards in El Salvador: Boulder, Colorado, Geological Society of America of America Special Paper 375 2004 Subaqueous intracaldera volcanism, Ilopango Caldera, El Salvador, Central

Long, Bernard

74

STANDARD OPERATING PROCEDURE ACIDS CONTAINING PHOSPHOROUS  

E-Print Network [OSTI]

12.1 STANDARD OPERATING PROCEDURE for ACIDS CONTAINING PHOSPHOROUS Location(s): ___________________________________________________ Chemical(s): Hypophosphorous acid, methylphosphonic acid, phosphonic acid, phosphoric acid, phosphorous

Pawlowski, Wojtek

75

Microorganisms for producing organic acids  

DOE Patents [OSTI]

Organic acid-producing microorganisms and methods of using same. The organic acid-producing microorganisms comprise modifications that reduce or ablate AcsA activity or AcsA homolog activity. The modifications increase tolerance of the microorganisms to such organic acids as 3-hydroxypropionic acid, acrylic acid, propionic acid, lactic acid, and others. Further modifications to the microorganisms increase production of such organic acids as 3-hydroxypropionic acid, lactate, and others. Methods of producing such organic acids as 3-hydroxypropionic acid, lactate, and others with the modified microorganisms are provided. Methods of using acsA or homologs thereof as counter-selectable markers are also provided.

Pfleger, Brian Frederick; Begemann, Matthew Brett

2014-09-30T23:59:59.000Z

76

Separation Nanotechnology of Diethylenetriaminepentaacetic Acid...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Nanotechnology of Diethylenetriaminepentaacetic Acid Bonded Magnetic Nanoparticles for Spent Nuclear Fuel. Separation Nanotechnology of Diethylenetriaminepentaacetic Acid Bonded...

77

Reversible Acid Gas Capture  

SciTech Connect (OSTI)

Pacific Northwest National Laboratory scientist David Heldebrant demonstrates how a new process called reversible acid gas capture works to pull carbon dioxide out of power plant emissions.

Dave Heldebrant

2009-08-01T23:59:59.000Z

78

Reversible Acid Gas Capture  

ScienceCinema (OSTI)

Pacific Northwest National Laboratory scientist David Heldebrant demonstrates how a new process called reversible acid gas capture works to pull carbon dioxide out of power plant emissions.

Dave Heldebrant

2012-12-31T23:59:59.000Z

79

Controlling acid rain  

E-Print Network [OSTI]

High concentrations of sulfuric and nitric acid in raTn fn the northeastern USA are caused by the large scale combustion of fossil fuels within this region. Average precipitation acidity is pH 4.2, but spatial and temporal ...

Fay, James A.

1983-01-01T23:59:59.000Z

80

E-Print Network 3.0 - acid-induced stress resistance Sample Search...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

stress sensing, as described by the fractional change in resistance per unit... for the resistance away from the ... Source: Chung, Deborah D.L. - Department of Mechanical and...

Note: This page contains sample records for the topic "acid dl dolomitic" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


81

Chlorophyll and acid rain  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Chlorophyll and acid rain Chlorophyll and acid rain Name: beachbum Status: N/A Age: N/A Location: N/A Country: N/A Date: Around 1993 Question: A while ago I read an article that stated that after a plant received acid rain, there seemed to be less of chlorophyll a and b in the plant. I was wondering where does the chlorophyll go and what is the actual process (cell structure affected?). Replies: I think that less chlorophyll being present would be more likely a result of less being produced. Plant cell constantly turn over cell material, it will also constantly produce more. So if one compares a plant not exposed to acid rain (presumably producing a normal amount of chlorophyll and the exposed plant then one sees that the exposed plant has less chlorophyll than the unexposed plant. I do not think I can answer the rest of your question.

82

Nucleic Acid Softwars  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Nucleic Acid Software Nucleic Acid Software FR3D, a software for finding local and composite recurrent structural motifs in RNA 3D structures. Sarver, M., Zirbel, C.L., Stombaugh, J., Mokdad, A. and Leontis, N.B. (2008) FR3D: finding local and composite recurrent structural motifs in RNA 3D structures. J Math Biol, 56, 215-252. RNAView, a program for quickly generating a display of RNA/DNA secondary structures with tertiary interactions. Yang, H., Jossinet, F., Leontis, N., Chen, L., Westbrook, J., Berman, H.M. and Westhof, E. (2003) Tools for the automatic identification and classification of RNA base pairs. Nucleic Acids Res, 31, 3450-3460. RNAMLview, a program to display and/or edit RNAView 2-dimensional diagrams. 3DNA, a software package for the analysis, rebuilding and visualization of three-dimensional nucleic acid structures.

83

Reactivity of Acid Generators  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Reactivity of Acid Generators for Chemically Amplified Resists with Reactivity of Acid Generators for Chemically Amplified Resists with Low-Energy Electrons Atsuro Nakano, Takahiro Kozawa, Seiichi Tagawa, Tomasz Szreder, James F. Wishart, Toshiyuki Kai and Tsutomu Shimokawa Jpn. J. Appl. Phys., 45, L197-L200 (2006). [Find paper at the Japanese Journal of Applied Physics] Abstract: In chemically amplified resists for ionizing radiations such as electron beams and extreme ultraviolet (EUV), low-energy electrons play an important role in the pattern formation processes. The reactivity of acid generators with low-energy electrons was evaluated using solvated electrons in tetrahydrofuran, which were generated by a pulsed electron beam. The rate constants of acid generators with the solvated electrons ranged from 0.6 to 1.9 x 1011 M-1s-1

84

(Acid rain workshop)  

SciTech Connect (OSTI)

The traveler presented a paper entitled Susceptibility of Asian Ecosystems to Soil-Mediated Acid Rain Damage'' at the Second Workshop on Acid Rain in Asia. The workshop was organized by the Asian Institute of Technology (Bangkok, Thailand), Argonne National Laboratory (Argonne, Illinois), and Resource Management Associates (Madison, Wisconsin) and was sponsored by the US Department of Energy, the United Nations Environment Program, the United Nations Economic and Social Commission for Asia and the Pacific, and the World Bank. Papers presented on the first day discussed how the experience gained with acid rain in North America and Europe might be applied to the Asian situation. Papers describing energy use projections, sulfur emissions, and effects of acid rain in several Asian countries were presented on the second day. The remaining time was allotted to discussion, planning, and writing plans for a future research program.

Turner, R.S.

1990-12-05T23:59:59.000Z

85

Fatty Acid Carcass Mapping  

E-Print Network [OSTI]

FATTY ACID CARCASS MAPPING A Thesis by STACEY NICOLE TURK Submitted to the Office of Graduate Studies of Texas A&M University in partial fulfillment of the requirements for the degree of MASTER OF SCIENCE May 2008... Major Subject: Animal Science FATTY ACID CARCASS MAPPING A Thesis by STACEY NICOLE TURK Submitted to the Office of Graduate Studies of Texas A&M University in partial fulfillment of the requirements for the degree of MASTER OF SCIENCE...

Turk, Stacey N.

2010-01-14T23:59:59.000Z

86

The utilization of tricarboxylic acid cycle acids and the uptake of succinic acid by Neurospora crassa  

E-Print Network [OSTI]

THE UTILIZATION OF TRICARBOXYLIC ACID CYCLE ACIDS AND THE UPTAKE OF SUCCINIC ACID BY NEUROSPORA CRASSA A Thesis by PATTI LYNN GILLILAND Submitted to the Graduate College of Texas A&M University in partial fulfillment of the requirement... for the degree of MASTER OF SCIENCE August 1978 Ma) or Subject: Microbiology THE UTILIZATION OF TRICARBOXYLIC ACID CYCLE ACIDS AND THE UPTAKE OF SUCCINIC ACID BY NEUROSPORA CRASSA A Thesis by PATTI LYNN GILLILAND Approved as to style and content by...

Gilliland, Patti Lynn

2012-06-07T23:59:59.000Z

87

Microsoft Word - mitchell-dl.doc  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Characterizing Particle Size, Water Path and Photon Characterizing Particle Size, Water Path and Photon Tunneling in Ice and Water Clouds David L. Mitchell Atmospheric Sciences Division Desert Research Institute Reno, Nevada Robert P. d'Entremont Satellite Meteorology Group Atmospheric and Environmental Research, Inc. Lexington, Massachusetts Abstract Global information of ice water path (IWP) in ice clouds is urgently needed for testing of global climate models (GCMs) and other applications, but satellite retrievals of IWP are still in the developing stages, and tend to have large uncertainties (e.g. factor of 3 or more). Results of a new retrieval method are presented here that may have relatively low uncertainties, using several thermal-radiance channels. Recent research indicates that ice-cloud radiative properties depend on more than effective diameter

88

CM200DL-Final.doc  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

CM200 CM200 Core Status: new users must complete 2 trouble free training sessions and pass the drivers test to work independently during Core sessions. Flex Status: core users must complete 5 trouble free sessions to work during Flex sessions. To reserve a CM200 session, go to www/ncem.lbl.gov, click on "Microscope Scheduling", use proposal number and password to log in. You may only sign up for one Core session at a time. To cancel a session, email your request to the technical staff in charge of the microscope. CORE LICENSE TEST Safety  Understand emergency shut down procedure  Know emergency contact numbers  Know where LN protective equipment is  Find updated operating instruction and notice (?) Instrument Preparation  Check V7 closed and SSC on and in cooling

89

TEAM0.5DL.doc  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

0.5 0.5 Core Status: new users must complete 2 training sessions and pass a sample exchange exam to work independently during Core sessions (regular work hours). Flex Status: core users must complete 5 Core sessions and pass a driving test to work during Flex sessions (evening and weekend hours). All TEAM 0.5 scheduling must be coordinated through Peter Ercius at Percius@lbl.gov. You may be assigned only two sessions per month. CORE LICENSE Safety  Understand emergency shut-down procedure  Demonstrate handling of the column valves  Point out where emergency contact numbers are posted  Know how to contact NCEM staff for support Instrument preparation  Show how to check basic vacuum functionality and target pressure values  (Gun: 1, Liner: 18-20 and Octagon: < 10)

90

Focus Sheet | Hydrofluoric Acid Health hazards of hydrofluoric acid  

E-Print Network [OSTI]

Focus Sheet | Hydrofluoric Acid Health hazards of hydrofluoric acid Hydrofluoric acid (HF characterized by weight loss, brittle bones, anemia, and general ill health. Safe use If possible, avoid working to exposures. #12;Focus Sheet | Hydrofluoric Acid Environmental Health and Safety Environmental Programs Office

Wilcock, William

91

Optical high acidity sensor  

DOE Patents [OSTI]

An apparatus and method for determining acid concentrations in solutions having acid concentrations of from about 0.1 Molar to about 16 Molar is disclosed. The apparatus includes a chamber for interrogation of the sample solution, a fiber optic light source for passing light transversely through the chamber, a fiber optic collector for receiving the collimated light after transmission through the chamber, a coating of an acid resistant polymeric composition upon at least one fiber end or lens, the polymeric composition in contact with the sample solution within the chamber and having a detectable response to acid concentrations within the range of from about 0.1 Molar to about 16 Molar, a measurer for the response of the polymeric composition in contact with the sample solution, and, a comparer of the measured response to predetermined standards whereby the acid molarity of the sample solution within the chamber can be determined. Preferably, a first lens is attached to the end of the fiber optic light source, the first lens adapted to collimate light from the fiber optic light source, and a second lens is attached to the end of the fiber optic collector for focusing the collimated light after transmission through the chamber.

Jorgensen, Betty S. (Jemez Springs, NM); Nekimken, Howard L. (Los Alamos, NM); Carey, W. Patrick (Lynnwood, WA); O'Rourke, Patrick E. (Martinez, GA)

1997-01-01T23:59:59.000Z

92

Nucleic Acid Tools  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Nucleic Acid Tools Nucleic Acid Tools RNA 3D Motif Atlas, a representative collection of RNA 3D internal and hairpin loop motifs. Petrov, A.I., Zirbel, C.L., Leontis, N.B. (2013) Automated classification of RNA 3D motifs and the RNA 3D motif atlas. RNA. Non-redundant List of RNA-containing 3D structures. Leontis, N.B., & Zirbel, C.L. (2012) In Leontis, N. B., Westhof. E. (ed.), RNA 3D structure analysis and prediction. Springer Berlin Heidelberg Vol. 27, pp. 281-298. RNA Base Triple Atlas, a collection of motifs consisting of two RNA basepairs. Abu Almakarem, A.S., Petrov, A.I., Stombaugh, J., Zirbel, C.L. and Leontis, N.B. (2012) Comprehensive survey and geometric classification of base triples in RNA structures. Nucleic Acids Res, 40, 1407-1423. R3D Align, an application for detailed nucleotide to nucleotide

93

A Direct, Biomass-Based Synthesis of Benzoic Acid: Formic Acid-Mediated Deoxygenation of the Glucose-Derived Materials Quinic Acid and Shikimic Acid  

SciTech Connect (OSTI)

An alternative biomass-based route to benzoic acid from the renewable starting materials quinic acid and shikimic acid is described. Benzoic acid is obtained selectively using a highly efficient, one-step formic acid-mediated deoxygenation method.

Arceo, Elena; Ellman, Jonathan; Bergman, Robert

2010-05-03T23:59:59.000Z

94

Synthesis of acid addition salt of delta-aminolevulinic acid from 5-bromo levulinic acid esters  

DOE Patents [OSTI]

A process of preparing an acid addition salt of delta-aminolevulinc acid comprising: a) dissolving a lower alkyl 5-bromolevulinate and hexamethylenetetramine in a solvent selected from the group consisting of water, ethyl acetate, chloroform, acetone, ethanol, tetrahydrofuran and acetonitrile, to form a quaternary ammonium salt of the lower alkyl 5-bromolevulinate; and b) hydrolyzing the quaternary ammonium salt with an inorganic acid to form an acid addition salt of delta-aminolevulinic acid.

Moens, Luc (Lakewood, CO)

2003-06-24T23:59:59.000Z

95

Acidizing of Sandstone Reservoirs Using HF and Organic Acids  

E-Print Network [OSTI]

Mud acid, which is composed of HCl and HF, is commonly used to remove the formation damage in sandstone reservoirs. However, many problems are associated with HCl, especially at high temperatures. Formic-HF acids have served as an alternative...

Yang, Fei

2012-10-19T23:59:59.000Z

96

Acid Placement in Acid Jetting Treatments in Long Horizontal Wells  

E-Print Network [OSTI]

In the Middle East, extended reach horizontal wells (on the order of 25,000 feet of horizontal displacement) are commonly acid stimulated by jetting acid out of drill pipe. The acid is jetted onto the face of the openhole wellbore as the drill pipe...

Sasongko, Hari

2012-07-16T23:59:59.000Z

97

Acid placement and coverage in the acid jetting process  

E-Print Network [OSTI]

Many open-hole acid treatments are being conducted by pumping acid through jetting ports placed at the end of coiled tubing or drill pipe. The filter-cake on the bore-hole is broken by the jet; the acid-soluble material is dissolved, creating...

Mikhailov, Miroslav I.

2009-05-15T23:59:59.000Z

98

Pantothenic acid biosynthesis in zymomonas  

DOE Patents [OSTI]

Zymomonas is unable to synthesize pantothenic acid and requires this essential vitamin in growth medium. Zymomonas strains transformed with an operon for expression of 2-dehydropantoate reductase and aspartate 1-decarboxylase were able to grow in medium lacking pantothenic acid. These strains may be used for ethanol production without pantothenic acid supplementation in seed culture and fermentation media.

Tao, Luan; Tomb, Jean-Francois; Viitanen, Paul V.

2014-07-01T23:59:59.000Z

99

Carboxylic acid sorption regeneration process  

DOE Patents [OSTI]

Carboxylic acids are sorbed from aqueous feedstocks into an organic liquid phase or onto a solid adsorbent. The acids are freed from the sorbent phase by treating it with aqueous alkylamine thus forming an alkylammonium carboxylate which is dewatered and decomposed to the desired carboxylic acid and the alkylamine.

King, C. Judson (Kensington, CA); Poole, Loree J. (Baton Rouge, LA)

1995-01-01T23:59:59.000Z

100

Carboxylic acid sorption regeneration process  

DOE Patents [OSTI]

Carboxylic acids are sorbed from aqueous feedstocks into an organic liquid phase or onto a solid adsorbent. The acids are freed from the sorbent phase by treating it with aqueous alkylamine thus forming an alkylammonium carboxylate which is dewatered and decomposed to the desired carboxylic acid and the alkylamine. 10 figs.

King, C.J.; Poole, L.J.

1995-05-02T23:59:59.000Z

Note: This page contains sample records for the topic "acid dl dolomitic" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


101

Nucleic acid detection methods  

DOE Patents [OSTI]

The invention relates to methods for rapidly determining the sequence and/or length a target sequence. The target sequence may be a series of known or unknown repeat sequences which are hybridized to an array of probes. The hybridized array is digested with a single-strand nuclease and free 3{prime}-hydroxyl groups extended with a nucleic acid polymerase. Nuclease cleaved heteroduplexes can be easily distinguish from nuclease uncleaved heteroduplexes by differential labeling. Probes and target can be differentially labeled with detectable labels. Matched target can be detected by cleaving resulting loops from the hybridized target and creating free 3-hydroxyl groups. These groups are recognized and extended by polymerases added into the reaction system which also adds or releases one label into solution. Analysis of the resulting products using either solid phase or solution. These methods can be used to detect characteristic nucleic acid sequences, to determine target sequence and to screen for genetic defects and disorders. Assays can be conducted on solid surfaces allowing for multiple reactions to be conducted in parallel and, if desired, automated. 18 figs.

Smith, C.L.; Yaar, R.; Szafranski, P.; Cantor, C.R.

1998-05-19T23:59:59.000Z

102

Acidic gas capture by diamines  

DOE Patents [OSTI]

Compositions and methods related to the removal of acidic gas. In particular, the present disclosure relates to a composition and method for the removal of acidic gas from a gas mixture using a solvent comprising a diamine (e.g., piperazine) and carbon dioxide. One example of a method may involve a method for removing acidic gas comprising contacting a gas mixture having an acidic gas with a solvent, wherein the solvent comprises piperazine in an amount of from about 4 to about 20 moles/kg of water, and carbon dioxide in an amount of from about 0.3 to about 0.9 moles per mole of piperazine.

Rochelle, Gary (Austin, TX); Hilliard, Marcus (Missouri City, TX)

2011-05-10T23:59:59.000Z

103

Separation of americium and europium from solutions of nitric and perchloric acid using dipicolinic acid diamides  

Science Journals Connector (OSTI)

Extraction of nitric acid, perchloric acid, americium, and europium with dialkyldiarylamides of 2,6-pyridinecarboxylic (dipicolinic) acid in polar fluorinated solvents (diluents) was analysed. Among the extrac...

M.Yu. Alyapyshev; V. A. Babain; I. V. Smirnov…

2006-01-01T23:59:59.000Z

104

Separation of americium and europium from solutions of nitric and perchloric acid using dipicolinic acid diamides  

Science Journals Connector (OSTI)

Extraction of nitric acid, perchloric acid, americium, and europium with dialkyldiarylamides of 2,6-pyridinecarboxylic (dipicolinic) acid in polar fluorinated solvents (diluents) was analysed. Among the extrac...

M. Yu. Alyapyshev; V. A. Babain; I. V. Smirnov…

2006-12-01T23:59:59.000Z

105

Ethylene Production from Linolenic Acid  

Science Journals Connector (OSTI)

... and Mapson1 have shown that linolenic 1 J acid may serve as a precursor of ethylene. The possi -bility that the ... . The possi -bility that the ethylene that is evolved from plants arises from linolenic acid was investigated by determining the relationship ...

F. B. ABELES

1966-04-02T23:59:59.000Z

106

Photochemical Studies on Xanthurenic Acid  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Photochemical Studies on Xanthurenic Acid Photochemical Studies on Xanthurenic Acid J. E. Roberts, J. F. Wishart, L. Martinez, C. F. Chignell Photochem.Photobiol. 72, 467-471 (2000) Abstract: The tryptophan metabolite xanthurenic acid has been isolated from aged human cataractous lenses. The photophysical properties of xanthurenic acid were examined to determine if it is a potential chromophore for age-related cataractogenesis. We found that xanthurenic acid produces singlet oxygen (F*= 0.17; CD3OD) with the same efficiency as the lenticular chromophore N-formyl kynurenine and quenches singlet oxygen at a rate similar to other tryptophan metabolites (2.1 x 107 M-1 s-1; CD3OD) found in the eye. As the mechanisms of induction of cataracts may also involve redox reactions, the interactions of hydrated electrons (e-aq), the azide radical

107

Treatment of acid mine wastewaters  

SciTech Connect (OSTI)

Acid mine drainage often results from the oxidation sulfide minerals to form sulfuric acid. As a consequence, high concentrations of metals in the both the suspended and dissolved state result from the low pH water. This paper discusses several of the more common treatment methods for acid mine drainage including the use of chemical precipitation agents, pH correction agents, filtration methods, and biodegradation methods. Advanced treatment technologies are also briefly described and include microfiltration, reverse osmosis, ion exchange, and electrodialysis.

Hayward, D.; Barnard, R.

1993-06-01T23:59:59.000Z

108

Naphthenic acid corrosion literature survey  

SciTech Connect (OSTI)

Naphthenic acid corrosion is a growing concern for refineries processing crudes containing high levels of naphthenic acid. Due to this concern initiatives in place to better understand the mechanism of corrosion for mitigating the corrosion. During the 1996 Fall Corrosion Group, organized existing literature relevant to the literature search. Committee Week, NACE International many refineries have and evaluate methods T-8 Refining Industry a task group, T-8-22, to perform a review and compilation of naphthenic acid corrosion. This paper provides a summary of the literature research.

Babaian-Kibala, E. [Nalco/Exxon Energy Chemicals, Sugar Land, TX (United States); Nugent, M.J. [Tosco Refining Co., Linden, NJ (United States)

1999-11-01T23:59:59.000Z

109

Asphaltene damage in matrix acidizing  

E-Print Network [OSTI]

This work addresses the problem of asphaltene deposition that occurs during acid treatments of oil reservoirs. Asphaltenes are present to some degree in most hydrocarbons. Due to the molecular weight of the components these asphaltenes are more...

Hinojosa, Roberto Antonio

2012-06-07T23:59:59.000Z

110

Factors controlling naphthenic acid corrosion  

SciTech Connect (OSTI)

A laboratory study was conducted to elucidate the influence of chemical and physical parameters on corrosion of type 1018 carbon steel (CS, UNS G10180) and 5% Cr-0.5% Mo steel in oils containing naphthenic acids (NAs) for application to crude oil refinery systems. Effects of test duration, temperature, and acid concentration were assessed for a range of single acids of varying carbon numbers and for NA mixtures in mineral oil (MO) and in heavy vacuum gas oil (HGVO). In addition, a limited study of the effect of hydrogen sulfide (H{sub 2}S) addition to the acid-oil mixture was conducted. Use of the total acid number (TAN) as a measure of corrosiveness of a crude oil was discredited further. For the same TAN value, molecular size and structure of the acid were shown to have an important influence. Tests conducted in HGVO showed lower corrosion rates than in MO, suggesting inhibition caused by S species in the oil or the steric hindrance of naphtheno-aromatic acids. In oil containing the mixture of NAs, the corrosion rate of type 1018 CS was lower than that for 5% Cr-0.5% Mo steel. The 0.1% H{sub 2}S that passed through the acid-oil mixtures had an inhibiting effect on corrosion. Predicting corrosiveness of a crude oil from the measurement of TAN, distribution of NA composition, and S content and form was particularly challenging. The simple tests used were informative, but further work will be required to establish a standard test method that can provide an adequate ranking of crudes.

Turnbull, A. [National Physical Lab., Teddington (United Kingdom); Slavcheva, E. [Bulgarian Academy of Sciences, Sofia (Bulgaria); Shone, B. [Ty Isa, Nr Mold (United Kingdom)

1998-11-01T23:59:59.000Z

111

Method for production of petroselinic acid and OMEGA12 hexadecanoic acid in transgenic plants  

DOE Patents [OSTI]

The present invention relates to a process for producing lipids containing the fatty acid, petroselinic acid, in plants. The production of petroselinic acid is accomplished by genetically transforming plants which do not normally accumulate petroselinic acid with a gene for a {omega}12 desaturase from another species which does normally accumulate petroselinic acid. 19 figs.

Ohlrogge, J.B.; Cahoon, E.B.; Shanklin, J.; Somerville, C.R.

1995-07-04T23:59:59.000Z

112

Method for production of petroselinic acid and OMEGA12 hexadecanoic acid in transgenic plants  

DOE Patents [OSTI]

The present invention relates to a process for producing lipids containing the fatty acid petroselinic acid in plants. The production of petroselinic acid is accomplished by genetically transforming plants which do not normally accumulate petroselinic acid with a gene for a .omega.12 desaturase from another species which does normally accumulate petroselinic acid.

Ohlrogge, John B. (Okemos, MI); Cahoon, Edgar B. (Lansing, MI); Shanklin, John (Upton, NY); Somerville, Christopher R. (Okemos, MI)

1995-01-01T23:59:59.000Z

113

Sandstone Acidizing Using Chelating Agents and their Interaction with Clays  

E-Print Network [OSTI]

Sandstone acidizing has been carried out with mud acid which combines hydrochloric acid and hydrofluoric acid at various ratios. The application of mud acid in sandstone formations has presented quite a large number of difficulties like corrosion...

George, Noble Thekkemelathethil 1987-

2013-01-09T23:59:59.000Z

114

New syntheses of aminoalkylphosphonic acids  

E-Print Network [OSTI]

NEW SYNTHESES OF AMINOALKYLPHOSPHON1C ACIDS A Thesis by John Frederick DeBardeleben, Jr. Su'bmitted to the Graduate School of the Agricultural and Mechanical College of Texas in partial fulfillment of the requirements for the degree of MASTER... OF SCIENCE August 196$ Major Subject: Chemistry NEW SYNTHESES OF AMINOALKYLPHOSPHONIC ACIDS A Thesis BY John Frederick DeBardeleben, Jr. Approved as to style and content hy: (Chairman of Committee) iJ C wc+'. A-c-~-' & (Head of Department...

DeBardeleben, John Frederick

2012-06-07T23:59:59.000Z

115

Acute health effects in a community after a release of hydrofluoric acid  

SciTech Connect (OSTI)

{approximately} 3,000 persons were evacuated from a Texas community after 24,036 kg (53,000 lb) of caustic hydrofluoric acid (HF) were released from a nearby petrochemical plant. Emergency room and hospital records of 939 persons who were seen at two area hospitals were reviewed. Most persons who presented at the emergency rooms were female (56%) or black (60%), and their mean age was 33.9 y. The most frequently reported symptoms were eye irritation (41.5%), burning throat (21%), headache (20.6%), and shortness of breath (19.4%). Physical examination results were normal for 49% of the cases; however, irritation of the eyes, nose, throat, skin, and lungs were noted on other exams. Decreased pulmonary function was demonstrated by pulmonary function tests (forced expiratory volume in the first second, less than 80% of predicted value, 42.3%); hypoxemia (pO2 less than 80 mm Hg, 17.4%) and hypocalcemia (less than 8.5 mg/dl, 16.3%) were also noted. Ninety-four (10%) of the cases were hospitalized, and more than 83% of all cases were discharged with a primary diagnosis of HF exposure. There are several reports of individuals who are acutely and chronically exposed to HF; however, we are unaware of other published reports that describe exposure of a community to HF. This incident represented a unique opportunity to study the immediate health impact on a community of residents who were exposed to a hazardous materials release. Results of this analysis suggest that (a) initial health problems should be followed up, (b) any long-term health effects of HF exposure must be assessed, and (c) the health impact on the population at risk should be determined.

Wing, J.S.; Brender, J.D.; Sanderson, L.M.; Perrotta, D.M.; Beauchamp, R.A. (Center for Chronic Disease Prevention and Health Promotion, Centers for Disease Control, Atlanta, GA (USA))

1991-05-01T23:59:59.000Z

116

Kinetic Study on the Acid-Catalyzed Hydrolysis of Cellulose to Levulinic Acid  

Science Journals Connector (OSTI)

A variety of interesting bulk chemicals is accessible by the acid-catalyzed hydrolysis of cellulose. An interesting example is levulinic acid, a versatile precursor for fuel additives, polymers, and resins. A detailed kinetic study on the acid-catalyzed ...

B. Girisuta; L. P. B. M. Janssen; H. J. Heeres

2007-02-13T23:59:59.000Z

117

Genes from Pseudomonas sp. Strain BS Involved in the Conversion of l-2-Amino-?2-Thiazolin-4-Carbonic Acid to l-Cysteine  

Science Journals Connector (OSTI)

...purified intermediate by two-dimensional 1H nuclear magnetic resonance indicated that the intermediate...amidohydrolase from Pseudomonas sp. strain BS, which is able to convert dl-ATC to...l-cysteine synthesis from dl-ATC in strain BS. The 2.6-kb insert DNA fragment in...

Toshikazu Shiba; Kohji Takeda; Misako Yajima; Makoto Tadano

2002-05-01T23:59:59.000Z

118

Acid Catalysis in Modern Organic  

E-Print Network [OSTI]

catalyst for organic synthesis". That is the starting sentence of this book by Yamamoto and Ishihara, which follows their earlier book "Lewis Acids in Organic Synthesis (2000)", and covers the new developments book that should be available in every well-equipped chemistry library. It will certainly be helpful

Snyder, Scott A.

119

E-Print Network 3.0 - acid linoleic acid Sample Search Results  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

FAs (linolenic, linoleic) - - monounsaturated FAs (oleic acid) - olive, canola - hydrogenation... Biol 458 Lecture 6 & 7 Fatty Acids 1 A. Introduction to acyl lipids...

120

The composition and diagenesis of the Upper Queen Formation (Guadalupian, Permian) at Concho Bluff North and Concho Bluff Queen Fields, Upton and Crane Counties, Texas  

E-Print Network [OSTI]

) potassium feldspar overgrowths, and (4) pore-filling anhydrite, dolomite, and halite cements during an early diagenetic phase. Subsequent dissolution of the anhydrite, dolomite, and halite by acidic pore-waters created high porosities (mean=15/o...) and permeabilities (mean&0. 1 md). Fluids and gases used in enhanced recovery techniques will follow pathways created by dissolution of the anhydrite, dolomite, and halite cements within the sandflat facies. However, caution must be used with fluids that can...

McKone, Charles Joseph

2012-06-07T23:59:59.000Z

Note: This page contains sample records for the topic "acid dl dolomitic" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


121

Enzymes of the shikimic acid pathway encoded in the genome of a basal metazoan, Nematostella vectensis, have microbial origins  

Science Journals Connector (OSTI)

...VDQHIKGLQAMGAEVRVEHGYVQAQVPRLKGARLFTDMVTVTGTENLMMAACLAQGETVI 182 Query 181 ENAAMEAEIDDLVCMLRKMGAQIDKNRDTKTWFITGVSSLHGADHGVVPDRIVAGTYAVA 240 ENAA E E+ DL L MGAQI T I GV +LHGA H ++PDRI GTY A Sbjct 183 ENAAREPEVVDLANCLVAMGAQI-SGAGTDVIRIRGVDALHGATHRIMPDRIETGTYLCA 241 Query 241 AVMTGGELTLT-LGPCPVPALMGCVLTCLRAAGAEVMELAEGIRVRGGRRPRSVSITTSP...

Antonio Starcevic; Shamima Akthar; Walter C. Dunlap; J. Malcolm Shick; Daslav Hranueli; John Cullum; Paul F. Long

2008-01-01T23:59:59.000Z

122

Recovery of mercury from acid waste residues  

DOE Patents [OSTI]

Mercury can be recovered from nitric acid-containing fluids by reacting the fluid with aluminum metal to produce mercury metal, and then quenching the reactivity of the nitric acid prior to nitration of the mercury metal.

Greenhalgh, Wilbur O. (Richland, WA)

1989-01-01T23:59:59.000Z

123

Studies On Advanced Lead-Acid Batteries.  

E-Print Network [OSTI]

??Subsequent to the studies on precursor lead-acid systems by Daniel, Grove and Sindesten, practical lead-acid batteries began with the research and inventions of Raymond Gaston… (more)

Martha, Surendra Kumar

2005-01-01T23:59:59.000Z

124

Modeling of Acid Fracturing in Carbonate Reservoirs  

E-Print Network [OSTI]

The acid fracturing process is a thermal, hydraulic, mechanical, and geochemical (THMG)-coupled phenomena in which the behavior of these variables are interrelated. To model the flow behavior of an acid into a fracture, mass and momentum balance...

Al Jawad, Murtada s

2014-06-05T23:59:59.000Z

125

Recovery of mercury from acid waste residues  

DOE Patents [OSTI]

Mercury can be recovered from nitric acid-containing fluids by reacting the fluid with aluminum metal to produce mercury metal, and thence quenching the reactivity of the nitric acid prior to nitration of the mercury metal. 1 fig.

Greenhalgh, W.O.

1987-02-27T23:59:59.000Z

126

Synthesis of Biodiesel via Acid Catalysis  

Science Journals Connector (OSTI)

Synthesis of Biodiesel via Acid Catalysis ... Biodiesel is synthesized via the transesterification of lipid feedstocks with low molecular weight alcohols. ... Nonetheless, acid-catalyzed processes could produce biodiesel from low-cost feedstocks, lowering production costs. ...

Edgar Lotero; Yijun Liu; Dora E. Lopez; Kaewta Suwannakarn; David A. Bruce; James G. Goodwin, Jr.

2005-01-25T23:59:59.000Z

127

Chemical Additive Selection in Matrix Acidizing  

E-Print Network [OSTI]

critical detail of weak acid chemistry. One concern when using any acid in oilfield operations is the corrosion of well tubulars. Thus operators often choose to pump corrosion inhibitor, a chemical additive electrostatically attracted... in oilfield operations, each of which protects well tubulars using the same mechanism: by impeding the acid?s ability to diffuse to the tubing surface. Because of the unique attraction of corrosion inhibitor to the metal surface, and the corrosion inhibitor...

Weidner, Jason 1981-

2011-05-09T23:59:59.000Z

128

Reactions Between Water Soluble Organic Acids and Nitrates in...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Between Water Soluble Organic Acids and Nitrates in Atmospheric Aerosols: Recycling of Nitric Acid and Formation of Reactions Between Water Soluble Organic Acids and Nitrates in...

129

Sandia National Laboratories: Due Diligence on Lead Acid Battery...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Due Diligence on Lead Acid Battery Recycling March 23, 2011 Lead Acid Batteries on secondary containment pallet Lead Acid Batteries on secondary containment pallet In 2004, the US...

130

Hydrogen-Bond Acidic Polymers for Chemical Vapor Sensing. | EMSL  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Acidic Polymers for Chemical Vapor Sensing. Hydrogen-Bond Acidic Polymers for Chemical Vapor Sensing. Abstract: A review with 171 references. Hydrogen-bond acidic polymers for...

131

Unnatural reactive amino acid genetic code additions  

DOE Patents [OSTI]

This invention provides compositions and methods for producing translational components that expand the number of genetically encoded amino acids in eukaryotic cells. The components include orthogonal tRNAs, orthogonal aminoacyl-tRNA synthetases, orthogonal pairs of tRNAs/synthetases and unnatural amino acids. Proteins and methods of producing proteins with unnatural amino acids in eukaryotic cells are also provided.

Deiters, Alexander; Cropp, T. Ashton; Chin, Jason W.; Anderson, J. Christopher; Schultz, Peter G.

2014-08-26T23:59:59.000Z

132

Thermal Stability Of Formohydroxamic Acid  

SciTech Connect (OSTI)

The thermal stability of formohydroxamic acid (FHA) was evaluated to address the potential for exothermic decomposition during storage and its use in the uranium extraction process. Accelerating rate calorimetry showed rapid decomposition at a temperature above 65 {degree}?C; although, the rate of pressure rise was greater than two orders of magnitude less than the lower bound for materials which have no explosive properties with respect to transportation. FHA solutions in water and nitric acid did not reach runaway conditions until 150 {degree}?C. Analysis by differential scanning calorimetry showed that FHA melted at 67 {degree}?C and thermally decomposed at 90 {degree}?C with an enthalpy of -1924 J/g. The energics of the FHA thermal decomposition are comparable to those measured for aqueous solutions of hydroxylamine nitrate. Solid FHA should be stored in a location where the temperature does not exceed 20-25 {degree}?C. As a best practice, the solid material should be stored in a climate-controlled environment such as a refrigerator or freezer. FHA solutions in water are not susceptible to degradation by acid hydrolysis and are the preferred way to handle FHA prior to use.

Fondeur, F. F.; Rudisill, T. S.

2011-10-21T23:59:59.000Z

133

Radioiodinated fatty acid analogs for myocardial imaging  

SciTech Connect (OSTI)

Fatty acids are the preferred substrate for the normoxic heart. About sixty percent of the energy required by the myocardium is provided by fatty acid [beta]-oxidation. Many scientists have focused on the alterations in fatty acid metabolism in the ischemic heart for the development of radiolabelled fatty acids for functional imaging of the heart. Three main categories of compounds were synthesized: tetrazoles (1 and 2), glycidic and [alpha]-methylene acids (3-5), and analogs of oleic acid (6,7 and 7A). The tetrazole group has a similar pKa and size to that of a carboxyl group; however, such fatty acid analogs cannot undergo normal fatty acid metabolism. Glycidic and [alpha]-methylene analogs are potential irreversible inhibitors of fatty acid metabolism. Oleic acid analogs were investigated to assess the affect of stereochemical consequences on biodistribution. The key intermediates in the synthesis of the target compounds were [omega]-nitrophenyl alkylcarboxylic acids and alcohols, which were made using a variety of cross-coupling reactions. The Wittig reaction, which was used in the synthesis of tetrazole 1 and glycidic acid 3, gave low yields of the cross-coupled products. The remaining target compounds were synthesized by condensation of appropriate RCu (CN) ZnI and substituted benzyl bromides or by Pd[sup II] catalyzed cross-coupling of substituted arylhalides with suitable alkynes. The latter two reactions produced much higher yields of the desired products. All of the target compounds were radiolabeled with [sup 125]I by various Cu(I) catalyzed radioiodine exchange procedures and were then subjected to tissue biodistribution (TD) studies in rats. Except for the 15-(4-iodophenyl)-2-methylene-pentadecanoic acid (5), all of the fatty acid analogs failed to surpass clinically-used 15-(4-iodophenyl)pentadecanoic acid (IPPA) in their ability to be taken up and retained by the rat myocardium.

Ruyan, M.K.

1993-01-01T23:59:59.000Z

134

Acid Fracture and Fracture Conductivity Study of Field Rock Samples  

E-Print Network [OSTI]

Acid fracturing is a well stimulation strategy designed to increase the productivity of a producing well. The parameters of acid fracturing and the effects of acid interaction on specific rock samples can be studied experimentally. Acid injection...

Underwood, Jarrod

2013-11-15T23:59:59.000Z

135

Micro-electro-mechanical systems phosphoric acid fuel cell  

DOE Patents [OSTI]

A phosphoric acid fuel cell system comprising a porous electrolyte support, a phosphoric acid electrolyte in the porous electrolyte support, a cathode electrode contacting the phosphoric acid electrolyte, and an anode electrode contacting the phosphoric acid electrolyte.

Sopchak, David A. (Livermore, CA); Morse, Jeffrey D. (Martinez, CA); Upadhye, Ravindra S. (Pleasanton, CA); Kotovsky, Jack (Oakland, CA); Graff, Robert T. (Modesto, CA)

2010-12-21T23:59:59.000Z

136

Micro-electro-mechanical systems phosphoric acid fuel cell  

DOE Patents [OSTI]

A phosphoric acid fuel cell system comprising a porous electrolyte support, a phosphoric acid electrolyte in the porous electrolyte support, a cathode electrode contacting the phosphoric acid electrolyte, and an anode electrode contacting the phosphoric acid electrolyte.

Sopchak, David A. (Livermore, CA); Morse, Jeffrey D. (Martinez, CA); Upadhye, Ravindra S. (Pleasanton, CA); Kotovsky, Jack (Oakland, CA); Graff, Robert T. (Modesto, CA)

2010-08-17T23:59:59.000Z

137

Common amino acid domain among endopolygalacturonases of ascomycete fungi.  

Science Journals Connector (OSTI)

...How- ever, amino acid compositions of homogeneous PGs appear...Mugnier (Rhone-Poulenc Agrochemical Co., France). C. lindemuthianum...Pharmacia). Amino acid composition. Amino acid analysis was...chromatography. amino acid compositions of the three purified materials...

J P Keon; G Waksman

1990-08-01T23:59:59.000Z

138

dlCC Opt: Optimization Software for Renewable Energy Projects...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

indicators of project opportunities. Many existing programs require the user to enter the size (kW) of the renewable energy system in order to start calculations. However,...

139

DL-940 1/08 Animal Health Diagnostic Center  

E-Print Network [OSTI]

These are instructions for collecting specimens for Campylobacter fetus culture fluorescent antibody and Tritrichomonas with protective sheath 5. Sterile rubber bulb (return to lab for credit to your account) Needed but not supplied by the AHDC 6. Syringe (3cc) and needle Procedures 1. Attach rubber bulb to collection catheter 2

Keinan, Alon

140

SSC-DL Version 1.0 SIRTF Science Center  

E-Print Network [OSTI]

-SED 6741 Code walk-through fixes/updates to "LoadIrsaPtgMetaData" perl subroutine. 6735 New module-masked pixels are NaN'd in final mips24 BCD products.. 6710 Update GenSBPHFsForCampaign.pl following comments from code walk-thru.. 6679 Update w_po

Masci, Frank

Note: This page contains sample records for the topic "acid dl dolomitic" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


141

18 Modeling high-performance HBTs D.L. Pulfrey  

E-Print Network [OSTI]

an acceptable base resistance. A short base width leads directly to an improved cut-off frequency, fT , which, when coupled with the lower base resistance, leads to an improved oscillation frequency, fmax. These consideration is also given to the incorporation of the compact model for JC into a large-signal equivalent

Pulfrey, David L.

142

Acid-catalytic decomposition of peracetic acid in the liquid phase  

SciTech Connect (OSTI)

This paper elucidates the kinetic relationships of peracetic acid (PAA) decomposition in the presence of mineral acids and their heterogeneous analogs, polystyrene-di-vinylbenzene cation-exchangers, differing in physicochemical and morphological parameters. It is shown that the thermal decomposition of PAA in acetic acid is an acid-catalyzed reaction. The controlling step of the reaction is protonation of the substrate with formation of an active intermediate form. Sulfonated cation-exchangers are twice as effective as sulfuric acid in this process. Polystyrene-divinylbenzene sulfonated cation-exchangers can be used with success as acid catalysts in oxidation processes involving PAA, because of their high effectiveness, stability, and availability.

Kharchuk, V.G.; Kolenko, I.P.; Petrov, L.A.

1985-12-01T23:59:59.000Z

143

Self-assembling multimeric nucleic acid constructs  

DOE Patents [OSTI]

The invention is directed to constructs and compositions containing multimeric forms of nucleic acid. Multimeric nucleic acids comprise single-stranded nucleic acids attached via biotin to streptavidin and bound with a functional group. These constructs can be utilized in vivo to treat or identify diseased tissue or cells. Repeated administrations of multimeric nucleic acid compositions produce a rapid and specific amplification of nucleic acid constructs and their attached functional groups. For treatment purposes, functional groups may be toxins, radioisotopes, genes or enzymes. Diagnostically, labeled multimeric constructs may be used to identify specific targets in vivo or in vitro. Multimeric nucleic acids may also be used in nanotechnology and to create self-assembling polymeric aggregates such as membranes of defined porosity, microcircuits and many other products.

Cantor, Charles R. (Boston, MA); Niemeyer, Christof M. (Bremen, DE); Smith, Cassandra L. (Boston, MA); Sano, Takeshi (Boston, MA); Hnatowich, Donald J. (Brookline, MA); Rusckowski, Mary (Southborough, MA)

1996-01-01T23:59:59.000Z

144

Self-assembling multimeric nucleic acid constructs  

DOE Patents [OSTI]

The invention is directed to constructs and compositions containing multimeric forms of nucleic acid. Multimeric nucleic acids comprise single-stranded nucleic acids attached via biotin to streptavidin and bound with a functional group. These constructs can be utilized in vivo to treat or identify diseased tissue or cells. Repeated administrations of multimeric nucleic acid compositions produce a rapid and specific amplification of nucleic acid constructs and their attached functional groups. For treatment purposes, functional groups may be toxins, radioisotopes, genes or enzymes. Diagnostically, labeled multimeric constructs may be used to identify specific targets in vivo or in vitro. Multimeric nucleic acids may also be used in nanotechnology and to create self-assembling polymeric aggregates such as membranes of defined porosity, microcircuits and many other products.

Cantor, Charles R. (Boston, MA); Niemeyer, Christof M. (Bremen, DE); Smith, Cassandra L. (Boston, MA); Sano, Takeshi (Boston, MA); Hnatowich, Donald J. (Brookline, MA); Rusckowski, Mary (Southborough, MA)

1999-10-12T23:59:59.000Z

145

Testing of organic acids in engine coolants  

SciTech Connect (OSTI)

The effectiveness of 30 organic acids as inhibitors in engine coolants is reported. Tests include glassware corrosion of coupled and uncoupled metals. FORD galvanostatic and cyclic polarization electrochemistry for aluminum pitting, and reserve alkalinity (RA) measurements. Details of each test are discussed as well as some general conclusions. For example, benzoic acid inhibits coupled metals well but is ineffective on cast iron when uncoupled. In benzoic acid inhibits coupled metals well but is ineffective on cast iron when uncoupled. In general, the organic acids provide little RA when titrated to a pH of 5.5, titration to a pH of 4.5 can result in precipitation of the acid. Trends with respect to acid chain length are reported also.

Weir, T.W. [ARCO Chemical Co., Newtown Square, PA (United States)

1999-08-01T23:59:59.000Z

146

Waste acid recycling via diffusion dialysis  

SciTech Connect (OSTI)

Inorganic acids are commonly used for surface cleaning and finishing of metals. The acids become unuseable due to contamination with metals or diluted and weakened. Diffusion dialysis has become a way to recover the useable acid and allow separation of the metals for recovery and sale to refineries. This technique is made possible by the use of membranes that are strong enough to withstand low ph and have long service life.

Steffani, C.

1995-05-26T23:59:59.000Z

147

Organic Phosphoric Acid of the Soil.  

E-Print Network [OSTI]

TEXAS AGRICULTURAL EXPERIMENT STATIONS BULLETIN NO. +6CT /36 CHEMICAL SECTION, FEBRUARY, 191 1 I TECHNICAL BULLETIN Organic Phosphoric Acid of the Soil BY G. S. FRAPS, Chemist POSTOFFICE College Station, Brazos County, 'Texas. ,\\ustin... . ................................................ introduction 5 .............................. hmmonia-Soluble Phosphoric Acid 5 ................ Solubility of Phosphates in Ammonia 6 I Fixation of Phosphoric Acid from Ammonia .......... 7 Effect of Ratio of Soil to Solvent in Extraction of Phos- I I...

Fraps, G. S. (George Stronach)

1911-01-01T23:59:59.000Z

148

Carboxylic acid accelerated formation of diesters  

DOE Patents [OSTI]

This invention pertains to accelerating the rate of formation of 1,1-dicarboxylic esters from the reaction of an aldehyde with a carboxylic acid anhydride or a ketene in the presence of a non-iodide containing a strong Bronsted acid catalyst by the addition of a carboxylic acid at about one bar pressure and between about 0 and 80 C in the substantial absence of a hydrogenation or carbonylation catalyst.

Tustin, G.C.; Dickson, T.J.

1998-04-28T23:59:59.000Z

149

Acid Doped Membranes for High Temperature PEMFC  

Broader source: Energy.gov [DOE]

Presentation on Acid Doped Membranes for High Temperature PEMFC to the High Temperature Membrane Working Group, May 25, 2004 in Philadelphia, PA.

150

Biomedical Application of Hyaluronic Acid Nanoparticles  

E-Print Network [OSTI]

Hyaluronic acid (HA) is a naturally occurring biodegradable polymer with a variety of applications in medicine including tissue engineering, dermatological fillers, and viscosupplementation for osteoarthritis treatment. ...

Fakhari, Amir

2012-05-31T23:59:59.000Z

151

Nucleic Acid Standards - Program List  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

List of Programs and References List of Programs and References CEHS M. A. El Hassan & C. R. Calladine (1995). ``The Assessment of the Geometry of Dinucleotide Steps in Double-Helical DNA: A New Local Calculation Scheme.'' J. Mol. Biol. 251, 648-664. X. J. Lu, M. A. El Hassan & C. A. Hunter (1997). ``Structure and Conformation of Helical Nucleic Acids: Analysis Program (SCHNAaP).''J. Mol. Biol. 273, 668-680. CompDNA (Please refer to Dr. Andrey A. Gorin: agor@sbnmr1.ski.mskcc.org OR Dr. Victor B. Zhurkin: zhurkin@lmmb.nci.nih.gov) A. A. Gorin, V. B. Zhurkin & W. K. Olson (1995). ``B-DNA Twisting Correlates with Base-pair Morphology.'' J. Mol. Biol. 247, 34-48. K. M. Kosikov, A. A. Gorin, V. B. Zhurkin & W. K. Olson (1999). ``DNA Stretching and Compression: Large-scale Simulations of Double Helical

152

Nucleic Acid Standards - Refinement Parameters  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Refinement Parameters Refinement Parameters The DNA/RNA topology and parameter files for X-PLOR are shown below. These were tested with DNA structures and with protein-DNA complexes. X-PLOR topology file X-PLOR parameter files: X-PLOR parameter file For the refinement of high resolution structures (< 1.7 Angstroms) the parameter file with distinct bond distances and bond angles for both C2'-endo and C3'-endo conformations should be considered: X-PLOR parameter file for high resolution structures "New Parameters for the Refinement of Nucleic Acid Containing Structures." Gary Parkinson, Jaroslav Vojtechovsky, Lester Clowney, Axel Brunger*, and Helen M. Berman. (1996) Acta Cryst. D 52, 57-64 Rutgers University, Department of Chemistry, Piscataway, NJ 08855-0939; *The Howard Hughes Medical Institute and Departments of Molecular and

153

E-Print Network 3.0 - acid eicosapentaenoic acid Sample Search...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Sample search results for: acid eicosapentaenoic acid Page: << < 1 2 3 4 5 > >> 1 Fish or Fish Oil in the Diet and Heart Attacks MAURICE E. STANSBY Summary: . Further...

154

E-Print Network 3.0 - acids eicosapentaenoic acid Sample Search...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Sample search results for: acids eicosapentaenoic acid Page: << < 1 2 3 4 5 > >> 1 Fish or Fish Oil in the Diet and Heart Attacks MAURICE E. STANSBY Summary: . Further...

155

Organic acid-tolerant microorganisms and uses thereof for producing organic acids  

DOE Patents [OSTI]

Organic acid-tolerant microorganisms and methods of using same. The organic acid-tolerant microorganisms comprise modifications that reduce or ablate AcsA activity or AcsA homolog activity. The modifications increase tolerance of the microorganisms to such organic acids as 3-hydroxypropionic acid (3HP), acrylic acid, and propionic acid. Further modifications to the microorganisms such as increasing expression of malonyl-CoA reductase and/or acetyl-CoA carboxylase provide or increase the ability of the microorganisms to produce 3HP. Methods of generating an organic acid with the modified microorganisms are provided. Methods of using acsA or homologs thereof as counter-selectable markers include replacing acsA or homologs thereof in cells with genes of interest and selecting for the cells comprising the genes of interest with amounts of organic acids effective to inhibit growth of cells harboring acsA or the homologs.

Pfleger, Brian Frederick; Begemann, Matthew Brett

2014-05-06T23:59:59.000Z

156

Catalytic transformations of cellulose and its derived carbohydrates into 5-hydroxymethylfurfural, levulinic acid, and lactic acid  

Science Journals Connector (OSTI)

The catalytic transformation of cellulose into key building-block or platform chemicals such as 5-hydoxymethylfurfural (HMF), levulinic acid, and lactic acid under mild conditions, has attracted much attention...

Weiping Deng; Qinghong Zhang; Ye Wang

2014-12-01T23:59:59.000Z

157

Yeast display evolution of a kinetically efficient 13-amino acid substrate for lipoic acid ligase  

E-Print Network [OSTI]

Escherichia coli lipoic acid ligase (LplA) catalyzes ATP-dependent covalent ligation of lipoic acid onto specific lysine side chains of three acceptor proteins involved in oxidative metabolism. Our lab has shown that LplA ...

Puthenveetil, Sujiet

158

2006 DOE Hydrogen Program Poly (p-phenylene Sulfonic Acid)s with...  

Broader source: Energy.gov (indexed) [DOE]

2006 DOE Hydrogen Program Poly (p-phenylene Sulfonic Acid)s with Frozen-in Free Volume for use in High Temperature Fuel Cells 2006 DOE Hydrogen Program Poly (p-phenylene Sulfonic...

159

The Arabidopsis hrl1 mutation reveals novel overlapping roles for salicylic acid, jasmonic acid and ethylene  

E-Print Network [OSTI]

and ethylene signalling in cell death and defence against pathogens Sendil K. Devadas1 , Alexander Enyedi2 molecules: salicylic acid (SA), jasmonic acid (JA) and ethylene (ET). The hrl1 (hypersensitive response

Raina, Ramesh

160

Effect of dietary cysteine, methionine, and sterculic acid on fatty acid distribution in rat adipose tissue  

E-Print Network [OSTI]

EFFECT OF DIETARY CYSTEINE, MFTHIONINE, AND STERCULIC ACID ON FATTY ACID DISTRIBUTION IN RAT ADIPOSE TISSUE A Thesis By MARY FRANCES BROTZE Submitted to the Graduate College of the Texas A(M University in partial fulfillment... of the requirements for the degree of MASTER OF SCIENCE January 1968 Major Subject: BIOCHEMISTRY EFFECT OF DIETARY CYSTEINE, METHIONINE, AND STERCULIC ACID ON FATTY ACID DISTRIBUTION IN RAT ADIPOSE TISSUE A Thesis MAaY FRANCES BRC ~ '!E Approved as to style...

Brotze, Mary Frances

2012-06-07T23:59:59.000Z

Note: This page contains sample records for the topic "acid dl dolomitic" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


161

Further Investigation of Fluoboric Acid in Sandstone Acidizing Using ^(11)B and ^(19)F NMR  

E-Print Network [OSTI]

Although fluoboric acid (HBF_(4)) has long been known as one of the low-damaging acid treatments for clayey sandstone formations, little is known of its chemistry which could explain the mixed results of fluoboric acid in actual field application. A...

Pituckchon, Arpajit

2014-05-01T23:59:59.000Z

162

Effect of defaunation and amino acid supplementation on growth and amino acid balance in growing sheep  

E-Print Network [OSTI]

, and the wool growth. The supplementation with protected amino acids may increase the growth rate and may lead and the addition of protected methionine and lysine on animal growth and amino acids digestibility in the body week for 9 weeks. Amino acids were determined in feed, blood, wool and feces in order to calculate

Paris-Sud XI, Université de

163

Nitrates and Prussic Acid in Forages  

E-Print Network [OSTI]

When nitrates and prussic acid accumulate in forage, the feed may not be safe for livestock consumption. Learn the symptoms of nitrate and prussic acid poisoning and which plants are most likely to pose a risk to livestock. Also learn sampling...

Provin, Tony; Pitt, John L.

2003-01-06T23:59:59.000Z

164

Naphthenic acid corrosion by Venezuelan crudes  

SciTech Connect (OSTI)

Venezuelan crudes can contain levels of naphthenic acids that cause corrosion in distillation units designed for sweet crudes. This naphthenic acid corrosion can be mitigated in several ways, the most common of which is selective alloying. This paper will provide information from field experience on how various refineries worldwide have upgraded materials to run Venezuelan crudes in a cost effective way.

Hopkinson, B.E.; Penuela, L.E. [Lagoven, S.A., Judibana (Venezuela). Amuay Refinery

1997-09-01T23:59:59.000Z

165

Naphthenic acid corrosion in crude distillation units  

SciTech Connect (OSTI)

This paper summarizes corrosion experience in crude distillation units processing highly naphthenic California crude oils. Correlations have been developed relating corrosion rates to temperature and total acid number. There is a threshold acid number in the range of 1.5 to 2 mg KOH/g below which corrosion is minimal. High concentrations of hydrogen sulfide may raise this threshold value.

Piehl, R.L.

1988-01-01T23:59:59.000Z

166

Arginine and Conjugated Linoleic Acid Reduce Fat Mass in Rats  

E-Print Network [OSTI]

????????????????????.. 3 Nitric oxide (NO)????????????????????... 3 NOS synthesis by iNOS and obesity?????????????. 4 Stearoyl CoA desaturase?????????????????? 5 Conjugated linoleic acid?????????????????? 5 MATERIALS... on a liquid scintillation counter. 12 Fatty acid analysis Fatty acid composition in liver and plasma was determined using a fatty acid methylation procedure (FAME). Fatty acids were extracted using Folch et al (38) methods. Methylation...

Nall, Jennifer L.

2010-10-12T23:59:59.000Z

167

Experimental Study of Acid Fracture Conductivity of Austin Chalk Formation  

E-Print Network [OSTI]

Acid fracture conductivity and the effect of key variables in the etching process during acid fracturing can be assessed at the laboratory scale. This is accomplished by using an experimental apparatus that simulates acid injection fluxes comparable...

Nino Penaloza, Andrea

2013-05-01T23:59:59.000Z

168

Experimental High Velocity Acid Jetting in Limestone Carbonates  

E-Print Network [OSTI]

Acid jetting is a well stimulation technique that is used in carbonate reservoirs. It typically involves injecting acid down hole at high flow rates through small orifices which cause high velocities of acid to strike the borehole wall...

Holland, Christopher

2014-04-30T23:59:59.000Z

169

Investigations of amino acid-based surfactants at liquid interfaces  

E-Print Network [OSTI]

Herein are presented collective studies of amino acid-based surfactants, also known as lipoamino acids, at liquid interfaces. Chapter III describes an investigation of domain morphology of N-Stearoylglutamic acid (N-SGA) Langmuir monolayers...

Yang, Dengliang

2005-11-01T23:59:59.000Z

170

Naphthenic acid corrosion in refinery settings  

SciTech Connect (OSTI)

Naphthenic acid corrosion has been a problem in the refining industry for many years. Recently interest in this problem has grown because crudes that contain naphthenic acid are being recovered from areas which were not known to produce this type of crude, such as china, India, and Africa. New techniques for identifying naphthenic acid corrosion and chemical treatments for preventing this attack are presented. Refinery case studies include stream analysis, failure analysis, and inhibitor use. Laboratory tests to show the effect of hydrogen sulfide and phosphorus-based inhibitors are discussed.

Babaian-Kibala, E. (Nalco Chemical Co., Sugar Land, TX (United States)); Craig, H.L. Jr. (Mobil Research and Development Corp., Paulsboro, NJ (United States)); Rusk, G.L. (Mobil Oil Co., Torrance, CA (United States)); Blanchard, K.V.; Rose, T.J.; Uehlein, B.L. (Nalco Chemical Co., Paulsboro, NJ (United States)); Quinter, R.C. (Sun Co., Newtown Square, PA (United States)); Summers, M.A. (Sun Co., Marcus Hook, PA (United States))

1993-04-01T23:59:59.000Z

171

Experimental Investigation for the Effects of the Core Geometry on the Optimum Acid Flux in Carbonate Acidizing  

E-Print Network [OSTI]

Previous matrix acidizing experimental research showed that there exists an optimum acid interstitial velocity (Vi-opt) that results in the minimum volume of acid used while providing the best stimulation results. There are already several...

Jin, Xiao

2013-11-21T23:59:59.000Z

172

Aerobic Heterotrophic Bacteria Indigenous to pH 2.8 Acid Mine Water: Microscopic Examination of Acid Streamers  

Science Journals Connector (OSTI)

...streamers" found in acid coal mine drainage consist of bacteria...than one species. Acidic coal mine drainage is characterized...of 11 states that comprise Appalachia and includes numerous other coal mining areas ofthe world. The acidic...

Patrick R. Dugan; Carol B. MacMillan; Robert M. Pfister

1970-03-01T23:59:59.000Z

173

Studying Cellulose Fiber Structure by SEM, XRD, NMR and Acid...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Studying Cellulose Fiber Structure by SEM, XRD, NMR and Acid Hydrolysis. Abstract: Cotton linters were partially hydrolyzed in dilute acid and the morphology of remaining...

174

adenylic acid: Topics by E-print Network  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

preservation A Rauramaa A Tommila J Ltd, Espoo Reseach Centre, PO Box 44, 02271 Espoo, Finland Formic acid is known to improve silage hygienic quality. Formic acid based...

175

acid rain program: Topics by E-print Network  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

preservation A Rauramaa A Tommila J Ltd, Espoo Reseach Centre, PO Box 44, 02271 Espoo, Finland Formic acid is known to improve silage hygienic quality. Formic acid based...

176

Formation of iron complexs from trifluoroacetic acid based liquid...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

of iron complexs from trifluoroacetic acid based liquid chromatography mobile phases as interference ions in liquid Formation of iron complexs from trifluoroacetic acid based...

177

Copper isotope fractionation in acid mine drainage. | EMSL  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Copper isotope fractionation in acid mine drainage. Copper isotope fractionation in acid mine drainage. Abstract: We surveyed the Cu isotopic composition of primary minerals and...

178

Hydrogen-bond acidic functionalized carbon nanotubes (CNTs) with...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Hydrogen-bond acidic functionalized carbon nanotubes (CNTs) with covalently-bound hexafluoroisopropanol groups. Hydrogen-bond acidic functionalized carbon nanotubes (CNTs) with...

179

AVTA: 2010 Honda Civic HEV with Experimental Ultra Lead Acid...  

Broader source: Energy.gov (indexed) [DOE]

2010 Honda Civic HEV with Experimental Ultra Lead Acid Battery Testing Results AVTA: 2010 Honda Civic HEV with Experimental Ultra Lead Acid Battery Testing Results The Vehicle...

180

Effects of Continuous Triiodothyronine Infusion on Citric Acid...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Continuous Triiodothyronine Infusion on Citric Acid Cycle in the Normal Immature Swine Heart under Extracorporeal Effects of Continuous Triiodothyronine Infusion on Citric Acid...

Note: This page contains sample records for the topic "acid dl dolomitic" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


181

Acid Initiation of Ammonia-Borane Dehydrogenation for Hydrogen...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Acid Initiation of Ammonia-Borane Dehydrogenation for Hydrogen Storage. Acid Initiation of Ammonia-Borane Dehydrogenation for Hydrogen Storage. Abstract: An abstract for this...

182

Fraud in the acid rain debate  

SciTech Connect (OSTI)

Electric utility executives, according to the author, and millions of other Americans are the victims of a gigantic fraud being carried on in the name of controlling acid rain. This fraud, states the author, involves the distorted, dire image of acidity in nature being created by environmental groups, politicians and others - to gain public sympathy for their legislative goals. The alleged fraud involves the very nature of the legislation being promoted as a low-cost cure for acid rain. On the basis of scientific evidence to date there is no assurance it will reduce acidity by any appreciable amount, but on the other hand it most certainly will cost users of electricity hundreds of billions of dollars in new costs. What has already happened to the nuclear industry is also meant for coal.

Bagge, C.

1984-06-01T23:59:59.000Z

183

Ascorbic Acid and Cancer: A Review  

Science Journals Connector (OSTI)

...groups, together with the formation of hydrogen bonds, offer a probable explanation...and Landeau, B. R. Ascorbic acid economy in surgical patients. Ann. N. Y...Culver, P. L. Horseradish peroxidase/ hydrogen peroxide-catalyzed oxidation of the...

Ewan Cameron; Linus Pauling; and Brian Leibovitz

1979-03-01T23:59:59.000Z

184

Lactic acid fermentation of crude sorghum extract  

SciTech Connect (OSTI)

Crude extract from sweet sorghum supplemented with vetch juice was utilized as the carbohydrate source for fermentative production of lactic acid. Fermentation of media containing 7% (w/v) total sugar was completed in 60-80 hours by Lactobacillus plantarum, product yield averaging 85%. Maximum acid production rates were dependent on pH, initial substrate distribution, and concentration, the rates varying from 2 to 5 g/liter per hour. Under limited medium supplementation the lactic acid yield was lowered to 67%. The fermented ammoniated product contained over eight times as much equivalent crude protein (N x 6.25) as the original medium. Unstructured kinetic models were developed for cell growth, lactic acid formation, and substrate consumption in batch fermentation. With the provision of experimentally determined kinetic parameters, the proposed models accurately described the fermentation process. 15 references.

Samuel, W.A.; Lee, Y.Y.; Anthony, W.B.

1980-04-01T23:59:59.000Z

185

A Direct, Biomass-Based Synthesis of Benzoic Acid: Formic Acid-Mediated Deoxygenation of the Glucose-Derived Materials Quinic Acid and Shikimic Acid  

E-Print Network [OSTI]

R.G.B and J.A.E. ). Keywords: biomass · carboxylic acids ·10.1002/cssc.201000111 A Direct, Biomass-Based Synthesis ofaro- matic compounds from biomass resources could provide a

2010-01-01T23:59:59.000Z

186

Heterogeneous Reactions of Epoxides in Acidic Media  

E-Print Network [OSTI]

on sulfuric acid using Ion drift-Chemical Ionization Mass Spectrometry (ID-CIMS) showed an irreversible uptake of epoxides at room temperature resulting in the formation of less volatile products like diols, organosulfates and acetals. However, at lower...

Lal, Vinita

2012-02-14T23:59:59.000Z

187

Ascorbic Acid and Cancer: A Review  

Science Journals Connector (OSTI)

...skinned individuals resident in areas of high solar intensity, such as the southern United States, South Africa, and Australia. Experimentally, the...Effects of Ascorbic Acid Ascorbate and Energy Production. Cytochromes P-450 and b5are...

Ewan Cameron; Linus Pauling; and Brian Leibovitz

1979-03-01T23:59:59.000Z

188

PREDICTING TEMPERATURE BEHAVIOR IN CARBONATE ACIDIZING TREATMENTS  

E-Print Network [OSTI]

PREDICTING TEMPERATURE BEHAVIOR IN CARBONATE ACIDIZING TREATMENTS A Thesis by XUEHAO TAN Submitted to the Office of Graduate Studies of Texas A&M University in partial fulfillment of the requirements for the degree... of MASTER OF SCIENCE May 2009 Major Subject: Petroleum Engineering PREDICTING TEMPERATURE BEHAVIOR IN CARBONATE ACIDIZING TREATMENTS A Thesis by XUEHAO TAN Submitted to the Office of Graduate Studies of Texas A&M University...

Tan, Xuehao

2010-01-16T23:59:59.000Z

189

Primer on lead-acid storage batteries  

SciTech Connect (OSTI)

This handbook was developed to help DOE facility contractors prevent accidents caused during operation and maintenance of lead-acid storage batteries. Major types of lead-acid storage batteries are discussed as well as their operation, application, selection, maintenance, and disposal (storage, transportation, as well). Safety hazards and precautions are discussed in the section on battery maintenance. References to industry standards are included for selection, maintenance, and disposal.

NONE

1995-09-01T23:59:59.000Z

190

Amplification of trace amounts of nucleic acids  

DOE Patents [OSTI]

Methods of reducing background during amplification of small amounts of nucleic acids employ careful analysis of sources of low level contamination. Ultraviolet light can be used to reduce nucleic acid contaminants in reagents and equipment. "Primer-dimer" background can be reduced by judicious design of primers. We have shown clean signal-to-noise with as little as starting material as one single human cell (.about.6 picogram), E. coli cell (.about.5 femtogram) or Prochlorococcus cell (.about.3 femtogram).

Church, George M. (Brookline, MA); Zhang, Kun (Brighton, MA)

2008-06-17T23:59:59.000Z

191

Biologically produced acid precipitable polymeric lignin  

DOE Patents [OSTI]

A water soluble, acid precipitable polymeric degraded lignin (APPL), having a molecular weight of at least 12,000 daltons, and comprising, by percentage of total weight, at least three times the number of phenolic hydroxyl groups and carboxylic acid groups present in native lignin. The APPL may be modified by chemical oxidation and reduction to increase its phenolic hydroxyl content and reduce the number of its antioxidant inhibitory side chains, thereby improving antioxidant properties.

Crawford, Don L. (Moscow, ID); Pometto, III, Anthony L. (Moscow, ID)

1984-01-01T23:59:59.000Z

192

Catalytic oxidative conversion of cellulosic biomass to formic acid and acetic acid with exceptionally high yields  

Science Journals Connector (OSTI)

Abstract Direct conversion of raw biomass materials to fine chemicals is of great significance from both economic and ecological perspectives. In this paper, we report that a Keggin-type vanadium-substituted phosphomolybdic acid catalyst, namely H4PVMo11O40, is capable of converting various biomass-derived substrates to formic acid and acetic acid with high selectivity in a water medium and oxygen atmosphere. Under optimized reaction conditions, \\{H4PVMo11O40\\} gave an exceptionally high yield of formic acid (67.8%) from cellulose, far exceeding the values achieved in previous catalytic systems. Our study demonstrates that heteropoly acids are generally effective catalysts for biomass conversion due to their strong acidities, whereas the composition of metal addenda atoms in the catalysts has crucial influence on the reaction pathway and the product selectivity.

Jizhe Zhang; Miao Sun; Xin Liu; Yu Han

2014-01-01T23:59:59.000Z

193

The inability of rats to synthesize linoleic acid from cis-2-octenoic acid  

E-Print Network [OSTI]

THE INABILITY OF RATS TO SYNTHESI2E LINOLEIC ACID FROM CIS-2-OCTENOIC ACID A Thesis Robert Eugene Anderson Submitted to the Graduate College of the Texas A g: M University in partia1 fulfillment of the requirerents for the degree of MASTER... OF SCIENCE January 1965 Major Subjeot: Bioohemistry THE INABILITY OF RATS TQ SYNTHESIEE LINOLEIC ACID FROM CIS-2E)CTENOIC ACID A Thesis Robert, Eugene Anderson Approved as to style and content by: Chair n of Committee)~ (Head of Depart~ant, Member...

Anderson, Robert Eugene

2012-06-07T23:59:59.000Z

194

E-Print Network 3.0 - acids amino acids Sample Search Results  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

State University Collection: Biology and Medicine 77 CHE 427627 THE ORGANIC CHEMISTRY OF BIOLOGICAL MOLECULES Summary: macromolecules: carbohydrates, amino acids, nucleic...

195

E-Print Network 3.0 - acid amino acid Sample Search Results  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

State University Collection: Biology and Medicine 77 CHE 427627 THE ORGANIC CHEMISTRY OF BIOLOGICAL MOLECULES Summary: macromolecules: carbohydrates, amino acids, nucleic...

196

E-Print Network 3.0 - acid docosahexaenoic acid Sample Search...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

SAGE-Hindawi Access to Research International Journal of Alzheimer's Disease Summary: APP secretion 19. 2.2. Fatty Acids on Membrane Physical Properties and APP Processing. Fatty...

197

E-Print Network 3.0 - acid-amino acid conjugates Sample Search...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

amino acids is reported with the incorporation of one example into a ... Source: Beal, Peter A. - Department of Chemistry, University of Utah Collection: Chemistry 13 An...

198

Correlation between Fibroin Amino Acid Sequence and Physical Silk Properties*  

E-Print Network [OSTI]

moth (Ephe- stia kuehniella), and Indian meal moth (Plodia inter- punctella). The amino acid repeats

Â?urovec, Michal

199

Transcription factor-based biosensors for detecting dicarboxylic acids  

DOE Patents [OSTI]

The invention provides methods and compositions for detecting dicarboxylic acids using a transcription factor biosensor.

Dietrich, Jeffrey; Keasling, Jay

2014-02-18T23:59:59.000Z

200

Purification Or Organic Acids Using Anion Exchange Chromatography.  

DOE Patents [OSTI]

Disclosed is a cost-effective method for purifying and acidifying carboxylic acids, including organic acids and amino acids. The method involves removing impurities by allowing the anionic form of the carboxylic acid to bind to an anion exchange column and washing the column. The carboxylic anion is displaced as carboxylic acid by washing the resin with a strong inorganic anion. This method is effective in removing organic carboxylic acids and amino acids from a variety of industrial sources, including fermentation broths, hydrolysates, and waste streams.

Ponnampalam; Elankovan (Okemos, MI)

2001-09-04T23:59:59.000Z

Note: This page contains sample records for the topic "acid dl dolomitic" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


201

Synergy of Lewis and Brønsted Acids on Catalytic Hydrothermal Decomposition of Hexose to Levulinic Acid  

Science Journals Connector (OSTI)

Levulinic acid (LA), an important platform chemical, is regarded as one of top 12 block chemicals. ... Phosphate standard concentrate (85%), glucose (99%), and levulinic acid (99%) were purchased from Aladdin Chemistry Co., Ltd. ... Fructose, chromium(III) chloride hexahydrate, and 5-HMF (purities of these chemicals ? 98%) were purchased from J&K Chemica, Ltd. ...

Fan Yang; Jie Fu; Jing Mo; Xiuyang Lu

2013-10-15T23:59:59.000Z

202

Acid Diversion in Carbonate Reservoirs Using Polymer-Based In-Situ Gelled Acids  

E-Print Network [OSTI]

Diversion in carbonates is more difficult than in sandstones because of the ability of acid to significantly increase the permeability in carbonates as it reacts in the pore spaces and flow channels of matrix. In-situ gelled acids that are based...

Gomaa, Ahmed Mohamed Mohamed

2012-07-16T23:59:59.000Z

203

Nucleic Acid Standards - Standard Ref. Frame  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Standard Reference Standard Reference Standard Reference Frame Supplemental Information Ideal Geometries X-PLOR Parameters Valence Geometries RNA Ontology Consortium mmCIF Resources PDBML Resources A Standard Reference Frame for the Description of Nucleic Acid Base-pair Geometry A common point of reference is needed to describe the three-dimensional arrangements of bases and base pairs in nucleic acid structures. [1]. For example, parts of a structure, which appear "normal" according to one computational scheme, may be highly unusual according to another and vice versa. It is thus difficult to carry out comprehensive comparisons of nucleic acid structures and to pinpoint unique conformational features in individual structures. In order to resolve these issues, a group of

204

Water and UV degradable lactic acid polymers  

DOE Patents [OSTI]

A water and UV light degradable copolymer of monomers of lactic acid and a modifying monomer were selected from the class consisting of ethylene and polyethylene glycols, propylene and polypropylene glycols, P-dioxanone, 1,5 dioxepan-2-one, 1,4 -oxathialan-2-one, 1,4-dioxide and mixtures. These copolymers are useful for waste disposal and agricultural purposes. Also disclosed is a water degradable blend of polylactic acid or modified polylactic acid and high molecular weight polyethylene oxide where the high molecular weight polyethylene oxide is present in the range of from about 2% by weight to about 50% by weight, suitable for films. A method of applying an active material selected from the class of seeds, seedlings, pesticides, herbicides, fertilizers and mixtures to an agricultural site is also disclosed.

Bonsignore, P.V.; Coleman, R.D.

1994-11-01T23:59:59.000Z

205

Water and UV degradable lactic acid polymers  

DOE Patents [OSTI]

A water and UV light degradable copolymer of monomers of lactic acid and a modifying monomer selected from the class consisting of ethylene and polyethylene glycols, propylene and polypropylene glycols, P-dioxanone, 1,5 dioxepan-2-one, 1,4 -oxathialan-2-one, 1,4-dioxide and mixtures thereof. These copolymers are useful for waste disposal and agricultural purposes. Also disclosed is a water degradable blend of polylactic acid or modified polylactic acid and high molecular weight polyethylene oxide wherein the high molecular weight polyethylene oxide is present in the range of from about 2% by weight to about 50% by weight, suitable for films. A method of applying an active material selected from the class of seeds, seedlings, pesticides, herbicides, fertilizers and mixtures thereof to an agricultural site is also disclosed.

Bonsignore, Patrick V. (Joliet, IL); Coleman, Robert D. (Wheaton, IL)

1994-01-01T23:59:59.000Z

206

Water and UV degradable lactic acid polymers  

DOE Patents [OSTI]

A water and UV light degradable copolymer is described made from monomers of lactic acid and a modifying monomer selected from the class consisting of ethylene glycol, propylene glycol, P-dioxanone, 1,5 dioxepan-2-one, 1,4-oxathialan-2-one, 1,4-dioxide and mixtures thereof. These copolymers are useful for waste disposal and agricultural purposes. Also disclosed is a water degradable blend of polylactic acid or modified polylactic acid and high molecular weight polyethylene oxide wherein the high molecular weight polyethylene oxide is present in the range of from about 2 by weight to about 50% by weight, suitable for films. A method of applying an active material selected from the class of seeds, seedlings, pesticides, herbicides, fertilizers and mixtures thereof to an agricultural site is also disclosed.

Bonsignore, P.V.; Coleman, R.D.

1996-10-08T23:59:59.000Z

207

Water and UV degradable lactic acid polymers  

DOE Patents [OSTI]

A water and UV light degradable copolymer of monomers of lactic acid and a modifying monomer selected from the class consisting of ethylene glycol, propylene glycol, P-dioxanone, 1,5 dioxepan-2-one, 1,4-oxathialan-2-one, 1,4-dioxide and mixtures thereof. These copolymers are useful for waste disposal and agricultural purposes. Also disclosed is a water degradable blend of polylactic acid or modified polylactic acid and high molecular weight polyethylene oxide wherein the high molecular weight polyethylene oxide is present in the range of from about 2 by weight to about 50% by weight, suitable for films. A method of applying an active material selected from the class of seeds, seedlings, pesticides, herbicides, fertilizers and mixtures thereof to an agricultural site is also disclosed.

Bonsignore, Patrick V. (Joliet, IL); Coleman, Robert D. (Wheaton, IL)

1996-01-01T23:59:59.000Z

208

Photoenhanced anaerobic digestion of organic acids  

DOE Patents [OSTI]

A process is described for rapid conversion of organic acids and alcohols anaerobic digesters into hydrogen and carbon dioxide, the optimal precursor substrates for production of methane. The process includes addition of photosynthetic bacteria to the digester and exposure of the bacteria to radiant energy (e.g., solar energy). The process also increases the pH stability of the digester to prevent failure of the digester. Preferred substrates for photosynthetic bacteria are the organic acid and alcohol waste products of fermentative bacteria. In mixed culture with methanogenic bacteria or in defined co-culture with non-aceticlastic methanogenic bacteria, photosynthetic bacteria are capable of facilitating the conversion or organic acids and alcohols into methane with low levels of light energy input.

Weaver, Paul F. (Golden, CO)

1990-01-01T23:59:59.000Z

209

E-Print Network 3.0 - acid analysis including Sample Search Results  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

predict the relative acid strength of a set... section. Findings Our analysis led to the identification of four distinct mental models of acid and acid... models of acid and acid...

210

Relative reactivities of solid benzoic acids  

E-Print Network [OSTI]

was always the acid salt, (RBZA) HK. For the reaction, RBZAH + Z R'BZAK, where R g R', the products were those predicted from Hammett o-constants for R and R'. Observations on the mode of reaction and free energy changes are given. The desirability... reaction series chosen was that. one most directly related to the Hammett substituent constants; namely, the reactions of various m- or p- monosubstituted benzoic acids with m- or p-monosubstituted potas- sium benzoate salts. CHAPTER Il RES ULTS...

Warwas, Edwin James

2012-06-07T23:59:59.000Z

211

Acid mine water aeration and treatment system  

DOE Patents [OSTI]

An in-line system is provided for treating acid mine drainage which basically comprises the combination of a jet pump (or pumps) and a static mixer. The jet pump entrains air into the acid waste water using a Venturi effect so as to provide aeration of the waste water while further aeration is provided by the helical vanes of the static mixer. A neutralizing agent is injected into the suction chamber of the jet pump and the static mixer is formed by plural sections offset by 90 degrees.

Ackman, Terry E. (Finleyville, PA); Place, John M. (Bethel Park, PA)

1987-01-01T23:59:59.000Z

212

Effect of Conjugated Linoleic Acid or Oleic Acid Addition on Fatty Acid Composition Profiles of Poultry Meat  

E-Print Network [OSTI]

on the omega-6 fatty acid accumulation in broiler chicken breast and thigh meat. Eight broilers from each treatment were processed at 4 and 6 weeks of age, respectively. Regarding the diets containing five different fat sources, broiler chickens fed CLA...

Shin, Dae Keun

2011-08-08T23:59:59.000Z

213

A method to attenuate U(VI) mobility in acidic waste plumes using humic acids  

SciTech Connect (OSTI)

Acidic uranium (U) contaminated plumes have resulted from acid-extraction of plutonium during the Cold War and from U mining and milling operations. A sustainable method for in-situ immobilization of U under acidic conditions is not yet available. Here, we propose to use humic acids (HAs) for in-situ U immobilization in acidic waste plumes. Our laboratory batch experiments show that HA can adsorb onto aquifer sediments rapidly, strongly and practically irreversibly. Adding HA greatly enhanced U adsorption capacity to sediments at pH below 5.0. Our column experiments using historically contaminated sediments from the Savannah River Site under slow flow rates (120 and 12 m/y) show that desorption of U and HA were non-detectable over 100 pore-volumes of leaching with simulated acidic groundwaters. Upon HA-treatment, 99% of the contaminant [U] was immobilized at pH < 4.5, compared to 5% and 58% immobilized in the control columns at pH 3.5 and 4.5, respectively. These results demonstrated that HA-treatment is a promising in-situ remediation method for acidic U waste plumes. As a remediation reagent, HAs are resistant to biodegradation, cost effective, nontoxic, and easily introducible to the subsurface.

Wan, J.; Dong, W.; Tokunaga, T.K.

2011-02-01T23:59:59.000Z

214

Preparation of Some Substituted Terephthalic Acids  

E-Print Network [OSTI]

, with the dilithiation of 2,5-dibromotoluene with t-BuLi at ­78 8C, followed by reaction with dry ice and subsequent acid (3) is esterified,[9] then side-chain brominated with NBS, to produce dimethyl 2

Benin, Vladimir

215

Acid dyes removal using low cost adsorbents  

Science Journals Connector (OSTI)

Dyestuff production units and dyeing units have always had pressing need techniques that allow economical pre-treatment for colour in the effluent. The effectiveness of adsorption for dye removal from wastewaters has made it an ideal alternative to other expensive treatment options. Removal of acid green

A.H. Aydin; Y. Bulut; O. Yavuz

2004-01-01T23:59:59.000Z

216

Heterogeneous organic acid uptake on soot surfaces  

E-Print Network [OSTI]

observed the interaction between a number of carboxylic acids and soot from different fuel sources and formation mechanisms. A low pressure fast flow reactor was used to control the contact between the solid phase soot and gas phase organics, while chemical...

Levitt, Nicholas Paul

2009-05-15T23:59:59.000Z

217

Peer review plan muddies acid rain talks  

Science Journals Connector (OSTI)

Bilateral U.S./Canadian talks on an acid rain treaty are being buffeted by bitter winds of national politics and uncertain science. The latest ill wind to blow north, as far as the Canadians are concerned, is the U.S. plan to have peer reviewed all ...

1982-05-10T23:59:59.000Z

218

MFR PAPER 1339 Phosphonoacetic Acid Inhibition of  

E-Print Network [OSTI]

phosphonoace- tic acid (PAA), functions specifically by inhibiting the herpesvirus coded DNA dependent DNA polymerase in its process of replicating virus DNA (Mao and Robishaw, [975). In tissue culture systems, PAA and Overby, 1975). In all cases, the effec- tive tissue culture dose of PAA which inhibited herpesvirus

219

Corrosion free phosphoric acid fuel cell  

DOE Patents [OSTI]

A phosphoric acid fuel cell with an electrolyte fuel system which supplies electrolyte via a wick disposed adjacent a cathode to an absorbent matrix which transports the electrolyte to portions of the cathode and an anode which overlaps the cathode on all sides to prevent corrosion within the cell.

Wright, Maynard K. (Bethel Park, PA)

1990-01-01T23:59:59.000Z

220

Detection of nucleic acid sequences by invader-directed cleavage  

DOE Patents [OSTI]

The present invention relates to means for the detection and characterization of nucleic acid sequences, as well as variations in nucleic acid sequences. The present invention also relates to methods for forming a nucleic acid cleavage structure on a target sequence and cleaving the nucleic acid cleavage structure in a site-specific manner. The 5' nuclease activity of a variety of enzymes is used to cleave the target-dependent cleavage structure, thereby indicating the presence of specific nucleic acid sequences or specific variations thereof. The present invention further relates to methods and devices for the separation of nucleic acid molecules based by charge.

Brow, Mary Ann D. (Madison, WI); Hall, Jeff Steven Grotelueschen (Madison, WI); Lyamichev, Victor (Madison, WI); Olive, David Michael (Madison, WI); Prudent, James Robert (Madison, WI)

1999-01-01T23:59:59.000Z

Note: This page contains sample records for the topic "acid dl dolomitic" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


221

Producing a trimethylpentanoic acid using hybrid polyketide synthases  

DOE Patents [OSTI]

The present invention provides for a polyketide synthase (PKS) capable of synthesizing trimethylpentanoic acid. The present invention also provides for a host cell comprising the PKS and when cultured produces the trimethylpentanoic acid. The present invention also provides for a method of producing the trimethylpentanoic acid, comprising: providing a host cell of the present invention, and culturing said host cell in a suitable culture medium such that the trimethylpentanoic acid is produced, optionally isolating the trimethylpentanoic acid, and optionally, reducing the isolated trimethylpentanoic acid into a trimethylpentanol or an iso-octane.

Katz, Leonard; Fortman, Jeffrey L; Keasling, Jay D

2014-10-07T23:59:59.000Z

222

Investigating the Effect of Oil Saturation on Acid Propagation during Matrix Acidization of Carbonate Rocks  

E-Print Network [OSTI]

The existence of an optimum injection rate for wormhole propagation, and face dissolution at low injection rates during matrix acidizing are well established. However, little has been documented that describes how the presence of residual oil...

Kumar, Rahul Pradeep

2014-01-02T23:59:59.000Z

223

Effects of Acid Additives on Spent Acid Flowback through Carbonate Cores  

E-Print Network [OSTI]

Matrix acidizing is a well stimulation technique used to remove formation damage in the near wellbore region. But it comes with an associated set of challenges such as corrosion of the tubulars and iron precipitation in the formation. To counter...

Nasir, Ehsaan Ahmad

2012-07-16T23:59:59.000Z

224

Modeling Acid Transport and Non-Uniform Etching in a Stochastic Domain in Acid Fracturing  

E-Print Network [OSTI]

Success of acid fracturing depends on uneven etching along the fracture surfaces caused by heterogeneities such as variations in local mineralogy and variations in leakoff behavior. The heterogeneities tend to create channeling characteristics...

Mou, Jianye

2010-10-12T23:59:59.000Z

225

A study of the distribution of fatty acids in the system: cottonseed oil-oleic acid-isopropanol-water  

E-Print Network [OSTI]

A STDDY OF THI' DISTBIRliTION OF FATTY ACIDS IN THE SYSTEM: COTTONSFED OIL - OLEIC ACID - ISOPBOPANOL - YlATEB A Thesis Frank E. Lomb January 1948 Approval as to style and content recommended: Head ' t Te epartm nt of hem cal Engineer ng A... STUDY OF THE DISTHIBUTION OF FATTY ACIDS IN THE SYSTEM: COTTONSEED OIL - OLEIC ACID - ISOFHOPANOL - WATER A Thesis By Frank E. Lamb January 1948 A STUDY QF TNE DISTRIBUTION OF FATTY ACIDS IN TRE SYSTEM: COTTONSEED OII, - OIEIC ACID - ISOPROPANOL...

Lamb, Frank E

2012-06-07T23:59:59.000Z

226

A First Look at Yeast Fatty Acid Synthase  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

A First Look at Yeast Fatty Acid Synthase Print A First Look at Yeast Fatty Acid Synthase Print Fatty acids are the major constituents of eukaryotic and bacterial cellular membranes. They are used for functionally important post-translational protein modifications, and chains of fatty acids are the main storage compartments of an organism's chemical energy. Fatty acid synthesis is carried out by fatty acid sythase (FAS), which catalyzes cycles of multistep chemical reactions that are essentially the same in all organisms. FAS uses one acetyl-coenzyme A (CoA) and seven malonyl-CoA molecules to synthesize the 16-carbon palmitic acid, the most abundant fatty acid in eukaryotes. Now, for the first time, a group of researchers has determined the atomic structure of yeast Saccharomyces cerevisiae FAS derived from two crystals of the enzyme, using data collected at ALS Beamlines 8.2.1 and 8.2.2, as well as other synchrotron facilities.

227

Acid-catalyzed dehydrogenation of amine-boranes  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Acid-catalyzed dehydrogenation of amine-boranes Acid-catalyzed dehydrogenation of amine-boranes Acid-catalyzed dehydrogenation of amine-boranes A method of dehydrogenating an amine-borane using an acid-catalyzed reaction. June 25, 2013 Acid-catalyzed dehydrogenation of amine-boranes A method of dehydrogenating an amine-borane using an acid-catalyzed reaction. Available for thumbnail of Feynman Center (505) 665-9090 Email Acid-catalyzed dehydrogenation of amine-boranes A method of dehydrogenating an amine-borane using an acid-catalyzed reaction. The method generates hydrogen and produces a solid polymeric product. The method of dehydrogenating amine-boranes may be used to generate hydrogen for power generation sources such as fuel cells. U.S. Patent No.: 7,645,902 (DOE S-104,909) Patent Application Filing Date: June 22, 2006

228

A First Look at Yeast Fatty Acid Synthase  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

A First Look at Yeast Fatty Acid Synthase Print A First Look at Yeast Fatty Acid Synthase Print Fatty acids are the major constituents of eukaryotic and bacterial cellular membranes. They are used for functionally important post-translational protein modifications, and chains of fatty acids are the main storage compartments of an organism's chemical energy. Fatty acid synthesis is carried out by fatty acid sythase (FAS), which catalyzes cycles of multistep chemical reactions that are essentially the same in all organisms. FAS uses one acetyl-coenzyme A (CoA) and seven malonyl-CoA molecules to synthesize the 16-carbon palmitic acid, the most abundant fatty acid in eukaryotes. Now, for the first time, a group of researchers has determined the atomic structure of yeast Saccharomyces cerevisiae FAS derived from two crystals of the enzyme, using data collected at ALS Beamlines 8.2.1 and 8.2.2, as well as other synchrotron facilities.

229

Mid-ultraviolet Light-Emitting Diode Detects Dipicolinic Acid  

Science Journals Connector (OSTI)

Dipicolinic acid (DPA, 2,6-pyridinedicarboxylic acid) is a substance uniquely present in bacterial spores such as that from anthrax (B. anthracis). It is known that DPA can be...

Li, Qingyang; Dasgupta, Purnendu K; Temkin, Henryk; Crawford, M H; Fischer, A J; Allerman, A A; Bogart, K H A; Lee, S R

2004-01-01T23:59:59.000Z

230

TRL Acid and Solvent Wet Processing Rules and Guidelines  

E-Print Network [OSTI]

: General rules and guidelines for wet chemical processing in TRL. Author: KFlo hood and when transporting or handling chemicals. An acid-proof apron, sleeveTRL Acid and Solvent Wet Processing Rules and Guidelines Purpose

Reif, Rafael

231

Development and testing of an advanced acid fracture conductivity apparatus  

E-Print Network [OSTI]

wells. Acid fracturing is a standard practice to increase the production rate and to improve ultimate recovery in carbonate reservoirs. There have been successful cases in most carbonate reservoirs around the world. However acid fracture performance...

Zou, ChunLei

2006-08-16T23:59:59.000Z

232

Choline for neutralizing naphthenic acid in fuel and lubricating oils  

SciTech Connect (OSTI)

A method is described of neutralizing at least a portion of the naphthenic acids present in fuel and lubricating oils which contain naphthenic acids which comprises treating these oils with a neutralizing amount of choline.

Ries, D.G.; Roof, G.L.

1986-07-15T23:59:59.000Z

233

Identification of petroleum acids in Liaohe super-heavy oil  

Science Journals Connector (OSTI)

In this study, petroleum acids were extracted from the super-heavy oil of Liaohe oilfield, North-east China, by using acetic acid, and their structural components and properties were investigated by using FT-I...

Bencheng Wu; Jianhua Zhu

2009-12-01T23:59:59.000Z

234

Integrated 3D Acid Fracturing Model for Carbonate Reservoir Stimulation  

E-Print Network [OSTI]

in integrating fracture propagation, acid transport and dissolution, and well performance models in a seamless fashion for acid fracturing design. In this new approach, the fracture geometry data of a hydraulic fracture is first obtained from commercial models...

Wu, Xi

2014-06-23T23:59:59.000Z

235

High Temperature Fuel Cell (Phosphoric Acid) Manufacturing R...  

Broader source: Energy.gov (indexed) [DOE]

Fuel Cell (Phosphoric Acid) Manufacturing R&D High Temperature Fuel Cell (Phosphoric Acid) Manufacturing R&D Presented at the NREL Hydrogen and Fuel Cell Manufacturing R&D Workshop...

236

Nucleic acid based fluorescent sensor for copper detection  

DOE Patents [OSTI]

A nucleic acid enzyme responsive to copper, comprising an oligonucleotide comprising a nucleotide sequence of SEQ ID NO:1, wherein the nucleic acid enzyme is not self-cleaving.

Lu, Yi; Liu, Juewen

2013-04-02T23:59:59.000Z

237

Conversion of carboxylate salts to carboxylic acids via reactive distillation.  

E-Print Network [OSTI]

??The purpose of this study is to convert carboxylate salts (e.g. calcium acetate, propionate, and butyrate) into carboxylic acids (e.g., acetic, propionic, and butyric acids).… (more)

Williamson, Shelly Ann

2012-01-01T23:59:59.000Z

238

Influence of boric acid additive size on green lubricant performance  

Science Journals Connector (OSTI)

...towards green manufacturing processes, there...boric acid powder additives with canola oil...change present manufacturing process lines...powder-based lubricant additives As conceptually...of boric acid additive size on green...towards green manufacturing processes, there...

2010-01-01T23:59:59.000Z

239

The Effect of Heterogeneity on Matrix Acidizing of Carbonate Rocks  

E-Print Network [OSTI]

In matrix acidizing, the goal is to dissolve minerals in the rock to increase well productivity. This is accomplished by injecting an application-specific solution of acid into the formation at a pressure between the pore pressure and fracture...

Keys, Ryan S.

2010-07-14T23:59:59.000Z

240

Kinetic evaluation of the esterification of fatty acids to biodiesel  

Science Journals Connector (OSTI)

The free fatty acids of cotton seed oil were processed with methanol and ethanol into the corresponding alkyl fatty esters in the presence of diluted sulfuric acid. The products characterized as biodiesels pre...

Frederico A. D. Araújo; Sonia V. Pereira…

2012-10-01T23:59:59.000Z

Note: This page contains sample records for the topic "acid dl dolomitic" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


241

The determination of potential acidity in overburden sediments  

E-Print Network [OSTI]

Weathered Overburden Samples. Determination of Total Sulfur by LECO. Determination of Non-Sulfate Sulfur by LECO. Pyritic Iron Using the ASTM Method Potential Acidity Using a Rapid Oxidation Technique - Original Method. Potential Acidity Using a Rapid... the Sample. The Addition of Excess H 02. Catalysing the Decomposition of Excess H202. Leaching the Oxidized Sample with CaC12. Comparison of Potential Acidity Methods. F and T Tests. Potential Acidity of Weathered vs. Unweathered Samples. Total S...

O'Shay, Tracey Ann

2012-06-07T23:59:59.000Z

242

The biodegradation of organic acids by a heterogeneous bacterial culture  

E-Print Network [OSTI]

- tion of fatty acids results in multiple cleavage of the molecules to form shorter chain acids. It has been found (1I) that ethanoic and butanoic are the principle volatile acids present during digestion of sewage sludge while propanoic and pentanoic... was developed from a heterogeneous culture found in a sewage plant effluent. The culture was developed in a bench scale continuous flow activated. sludge reactor, and individual studies were made in a bench scale aerated batch reactor. The acids used were...

Tyer, Bobby Ray

1968-01-01T23:59:59.000Z

243

Nucleic Acid Standards - Sugar and Phosphate Constituents  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Sugar and Phosphate Constituents Sugar and Phosphate Constituents The following tables contain the complete references for the structures used in a statistical survey of well-refined mononucleoside, mononucleotide, dinucleoside monophosphate, and trinucleoside diphosphate crystal structures found in the Cambridge Structural Database and the Nucleic Acid Database that appeared in The Journal of the American Chemical Society (Anke Gelbin, Bohdan Schneider, Lester Clowney, Shu-Hsin Hsieh, Wilma K. Olson, and Helen M. Berman. "Geometric Parameters in Nucleic Acids: Sugar Phosphate Constituents" (1996) 118, 519-529.) Table 1: References for Mononucleoside and Mononucleotide Structures Table 2: References for Dinucleoside Monophosphate and Trinucleoside Diphosphate Structures The following tables are summaries of the bond lengths, angles, and torsion

244

Improved Processes to Remove Naphthenic Acids  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Improved Processes to Remove Naphthenic Acids Improved Processes to Remove Naphthenic Acids Final Technical Report (From October 1, 2002 to September 30, 2005) Principle Authors Aihua Zhang, Qisheng Ma, Kangshi Wang, Yongchun Tang (co-PI), William A. Goddard (PI), Date Report was issued: December 9, 2005 DOE Award number: DE-FC26-02NT15383 Name and Address of Submitting Organization California Institute of Technology 1200 East California Blvd., Pasadena, CA91125 Disclaimer This report was prepared as an account of work sponsored by an agency of the United States Government. Neither the United States Government nor any agency thereof, nor any of their employees, makes any warranty, express or implied, or assumes any legal liability or responsibility for the accuracy, completeness, or usefulness of any

245

Critical review of naphthenic acid corrosion  

SciTech Connect (OSTI)

Naphthenic acid corrosion continues to be a reliability issue in refinery distillation units. A review of the subject is presented herein with special focus on field and laboratory data and on areas where research is needed. The review shows that several parameters are known to affect the corrosion process and their individual effect on crude corrosivity are somewhat understood. However, their combined effect is still subject to much controversy. The determination of a critical factor--naphthenic acid content--is still not standardized. It is shown herein that, by arranging the literature findings into three groups (1) furnace tubes and transfer lines, (2) vacuum column and (3) side cut piping, a better agreement of the literature data is achieved.

Tebbal, S. [SET Labs., Inc., Stafford, TX (United States)

1999-11-01T23:59:59.000Z

246

Sulfate and acid resistant concrete and mortar  

DOE Patents [OSTI]

The present invention relates to concrete, mortar and other hardenable mixtures comprising cement and fly ash for use in construction and other applications, which hardenable mixtures demonstrate significant levels of acid and sulfate resistance while maintaining acceptable compressive strength properties. The acid and sulfate hardenable mixtures of the invention containing fly ash comprise cementitious materials and a fine aggregate. The cementitous materials may comprise fly ash as well as cement. The fine aggregate may comprise fly ash as well as sand. The total amount of fly ash in the hardenable mixture ranges from about 60% to about 120% of the total amount of cement, by weight, whether the fly ash is included as a cementious material, fine aggregate, or an additive, or any combination of the foregoing. In specific examples, mortar containing 50% fly ash and 50% cement in cementitious materials demonstrated superior properties of corrosion resistance. 6 figs.

Liskowitz, J.W.; Wecharatana, M.; Jaturapitakkul, C.; Cerkanowicz, A.E.

1998-06-30T23:59:59.000Z

247

Sulfate and acid resistant concrete and mortar  

DOE Patents [OSTI]

The present invention relates to concrete, mortar and other hardenable mixtures comprising cement and fly ash for use in construction and other applications, which hardenable mixtures demonstrate significant levels of acid and sulfate resistance while maintaining acceptable compressive strength properties. The acid and sulfate hardenable mixtures of the invention containing fly ash comprise cementitious materials and a fine aggregate. The cementitous materials may comprise fly ash as well as cement. The fine aggregate may comprise fly ash as well as sand. The total amount of fly ash in the hardenable mixture ranges from about 60% to about 120% of the total amount of cement, by weight, whether the fly ash is included as a cementious material, fine aggregate, or an additive, or any combination of the foregoing. In specific examples, mortar containing 50% fly ash and 50% cement in cementitious materials demonstrated superior properties of corrosion resistance.

Liskowitz, John W. (Belle Mead, NJ); Wecharatana, Methi (Parsippany, NJ); Jaturapitakkul, Chai (Bangkok, TH); Cerkanowicz, deceased, Anthony E. (late of Livingston, NJ)

1998-01-01T23:59:59.000Z

248

Reference electrode for strong oxidizing acid solutions  

DOE Patents [OSTI]

A reference electrode for the measurement of the oxidation-reduction potentials of solutions is especially suitable for oxidizing solutions such as highly concentrated and fuming nitric acids, the solutions of nitrogen oxides, N.sub.2 O.sub.4 and N.sub.2 O.sub.5, in nitric acids. The reference electrode is fabricated of entirely inert materials, has a half cell of Pt/Ce(IV)/Ce(III)/70 wt. % HNO.sub.3, and includes a double-junction design with an intermediate solution of 70 wt. % HNO.sub.3. The liquid junctions are made from Corning No. 7930 glass for low resistance and negligible solution leakage.

Rigdon, Lester P. (Livermore, CA); Harrar, Jackson E. (Castro Valley, CA); Bullock, Sr., Jack C. (Pleasanton, CA); McGuire, Raymond R. (Brentwood, CA)

1990-01-01T23:59:59.000Z

249

Lightweight, durable lead-acid batteries  

DOE Patents [OSTI]

A lightweight, durable lead-acid battery is disclosed. Alternative electrode materials and configurations are used to reduce weight, to increase material utilization and to extend service life. The electrode can include a current collector having a buffer layer in contact with the current collector and an electrochemically active material in contact with the buffer layer. In one form, the buffer layer includes a carbide, and the current collector includes carbon fibers having the buffer layer. The buffer layer can include a carbide and/or a noble metal selected from of gold, silver, tantalum, platinum, palladium and rhodium. When the electrode is to be used in a lead-acid battery, the electrochemically active material is selected from metallic lead (for a negative electrode) or lead peroxide (for a positive electrode).

Lara-Curzio, Edgar (Lenoir City, TN); An, Ke (Knoxville, TX); Kiggans, Jr., James O. (Oak Ridge, TN); Dudney, Nancy J. (Knoxville, TN); Contescu, Cristian I. (Knoxville, TN); Baker, Frederick S. (Oak Ridge, TN); Armstrong, Beth L. (Clinton, TN)

2011-09-13T23:59:59.000Z

250

Lightweight, durable lead-acid batteries  

SciTech Connect (OSTI)

A lightweight, durable lead-acid battery is disclosed. Alternative electrode materials and configurations are used to reduce weight, to increase material utilization and to extend service life. The electrode can include a current collector having a buffer layer in contact with the current collector and an electrochemically active material in contact with the buffer layer. In one form, the buffer layer includes a carbide, and the current collector includes carbon fibers having the buffer layer. The buffer layer can include a carbide and/or a noble metal selected from of gold, silver, tantalum, platinum, palladium and rhodium. When the electrode is to be used in a lead-acid battery, the electrochemically active material is selected from metallic lead (for a negative electrode) or lead peroxide (for a positive electrode).

Lara-Curzio, Edgar; An, Ke; Kiggans, Jr., James O; Dudney, Nancy J; Contescu, Cristian I; Baker, Frederick S; Armstrong, Beth L

2013-05-21T23:59:59.000Z

251

Nucleic acids, compositions and uses thereof  

DOE Patents [OSTI]

The subject invention provides at least one nucleic acid sequence encoding an aldouronate-utilization regulon isolated from Paenibacillus sp. strain JDR-2, a bacterium which efficiently utilizes xylan and metabolizes aldouronates (methylglucuronoxylosaccharides). The subject invention also provides a means for providing a coordinately regulated process in which xylan depolymerization and product assimilation are coupled in Paenibacillus sp. strain JDR-2 to provide a favorable system for the conversion of lignocellulosic biomass to biobased products. Additionally, the nucleic acid sequences encoding the aldouronate-utilization regulon can be used to transform other bacteria to form organisms capable of producing a desired product (e.g., ethanol, 1-butanol, acetoin, 2,3-butanediol, 1,3-propanediol, succinate, lactate, acetate, malate or alanine) from lignocellulosic biomass.

Preston, III, James F. (Micanopy, FL); Chow, Virginia (Gainesville, FL); Nong, Guang (Gainesville, FL); Rice, John D. (Gainesville, FL); St. John, Franz J. (Baltimore, MD)

2012-02-21T23:59:59.000Z

252

Nucleic acid compositions and the encoding proteins  

SciTech Connect (OSTI)

The subject invention provides at least one nucleic acid sequence encoding an aldouronate-utilization regulon isolated from Paenibacillus sp. strain JDR-2, a bacterium which efficiently utilizes xylan and metabolizes aldouronates (methylglucuronoxylosaccharides). The subject invention also provides a means for providing a coordinately regulated process in which xylan depolymerization and product assimilation are coupled in Paenibacillus sp. strain JDR-2 to provide a favorable system for the conversion of lignocellulosic biomass to biobased products. Additionally, the nucleic acid sequences encoding the aldouronate-utilization regulon can be used to transform other bacteria to form organisms capable of producing a desired product (e.g., ethanol, 1-butanol, acetoin, 2,3-butanediol, 1,3-propanediol, succinate, lactate, acetate, malate or alanine) from lignocellulosic biomass.

Preston, III, James F.; Chow, Virginia; Nong, Guang; Rice, John D.; St. John, Franz J.

2014-09-02T23:59:59.000Z

253

E-Print Network 3.0 - acid alkyl esters Sample Search Results  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Nitric Acid 34. Sulfuric acid... .5 will not be accepted through this program. Heavy metal, toxic, acidic (without solvents) and basic wastes should... . Mercaptans 4. ......

254

E-Print Network 3.0 - acid improves hypertriglyceridemia Sample...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

contain unusual fatty acids that are valuable... p. 1 Lipid signals: jasmonic acid & green leaf volatiles i. Jasmonic acid and jasmonates... agronomic species i) diffent...

255

E-Print Network 3.0 - acid promotes detoxification Sample Search...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Bile acid Detoxification, Synthesis... acid transport, synthesis and detoxification. The LCA-induced altered enzymes and transporter... ;Regulation of bile acid detoxification and...

256

E-Print Network 3.0 - acid operational experiences Sample Search...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

acetic acid, propionic acid, butyric acid, valeric ... Source: Manning, Sturt - Cornell Tree-Ring Laboratory, Cornell University Collection: Environmental Sciences and Ecology 34...

257

E-Print Network 3.0 - acid requirements based Sample Search Results  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

(Eichhornia crassipes) to levulinic acid (LA) through an acid-catalysed hydrolysis reaction. LA has been... OHOH OH Diphenolic acid O CH3 Methyltetrahydrofuran O O OHNH2 ......

258

E-Print Network 3.0 - aminocyclopropane carboxylic acid Sample...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

acid, which primarily loses the ele... -methylaziridinecarboxylic acid via an internal SN2 pathway, rather than protonated vinylglycine. Protonated amino acids... readily expel...

259

E-Print Network 3.0 - ammonia acetic acid Sample Search Results  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

fluminic acid, or hydrogen. NITRIC ACID with: acetic... with: water, carbon dioxide, carbon tetrachloride, and other chlorinated hydrocarbons. ACETIC ACID with......

260

E-Print Network 3.0 - aromatic sulfonic acids Sample Search Results  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

examples: Methane sulfonic... acid Ethane sulfonic acid 1-Propane sulfonic acid 1-Butane ... Source: Wikswo, John - Department of Physics and Astronomy, Vanderbilt University...

Note: This page contains sample records for the topic "acid dl dolomitic" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


261

Naphthenic acid corrosion in the refinery  

SciTech Connect (OSTI)

Field tests and laboratory studies of refinery process streams are presented. The effects of temperature, velocity and physical state were studied with respect to alloy selection for corrosion resistant service. The amount of molybdenum in the austenitic stainless steel alloys is the dominant factor in conferring corrosion resistance. The Naphthenic Acid Corrosion Index (NACI) is useful in assessing the severity of corrosion under a variety of circumstances.

Craig, H.L. Jr. [Mobil Research and Development Corp., Paulsboro, NJ (United States)

1995-11-01T23:59:59.000Z

262

Alkaline earth cation extraction from acid solution  

DOE Patents [OSTI]

An extractant medium for extracting alkaline earth cations from an aqueous acidic sample solution is described as are a method and apparatus for using the same. The separation medium is free of diluent, free-flowing and particulate, and comprises a Crown ether that is a 4,4'(5')[C.sub.4 -C.sub.8 -alkylcyclohexano]18-Crown-6 dispersed on an inert substrate material.

Dietz, Mark (Elmhurst, IL); Horwitz, E. Philip (Naperville, IL)

2003-01-01T23:59:59.000Z

263

The Effect of Supercritical Fluids on Solid Acid Catalyst Alkylation  

Science Journals Connector (OSTI)

Box 1625, Idaho Falls, Idaho 83415-2208, and Marathon-Ashland Petroleum LLC, P.O. ... The liquid acid processes present serious safety and environmental concerns in both the transport and storage of concentrated liquid acids and the disposal of acid?oil sludges. ...

Daniel M. Ginosar; David N. Thompson; Kyle Coates; David J. Zalewski

2002-05-15T23:59:59.000Z

264

The Fixation of Phosphoric Acid by the Soil  

E-Print Network [OSTI]

KAS AtiRICULTURAL EXPERIMENT STATION AGRICULTURAL AND MECHANICAL COLLEGE OF TEXAS W. B. BII BULLETIN NO. 304 eddent CEMBER, 1922 'ION OF PHOSPI ACID BY THE SOIL B. YOUNGBLOOD, DIRECTOR, COLLEGE STATION, BRAZOS COUNTY, TEXA STATION STAFF... ............................................... '7 ............................................... ;t of Acid 7' ........................................... of Ignition 8 ........................................ on by Minerals 10 ...................... on of Phosphoric Acid of Fertilizers 11...

Fraps, G. S. (George Stronach)

1922-01-01T23:59:59.000Z

265

How is ferulic acid transported into the Golgi apparatus? Lignin  

E-Print Network [OSTI]

How is ferulic acid transported into the Golgi apparatus? Lignin polymerization is also influenced]. These ferulic acid residues are thought to initiate lignin polymerization. It is not known how ferulic acid in the cell wall field, but also creates novel opportunities for the manipulation of lignin in crop plants

266

Process for the extraction of strontium from acidic solutions  

DOE Patents [OSTI]

The invention is a process for selectively extracting strontium values from aqueous nitric acid waste solutions containing these and other fission product values. The extractant solution is a macrocyclic polyether in an aliphatic hydrocarbon diluent containing a phase modifier. The process will selectively extract strontium values from nitric acid solutions which are up to 6 molar in nitric acid. 4 figs.

Horwitz, E.P.; Dietz, M.L.

1994-09-06T23:59:59.000Z

267

Production of carboxylic acid and salt co-products  

DOE Patents [OSTI]

This invention provide processes for producing carboxylic acid product, along with useful salts. The carboxylic acid product that is produced according to this invention is preferably a C.sub.2-C.sub.12 carboxylic acid. Among the salts produced in the process of the invention are ammonium salts.

Hanchar, Robert J.; Kleff, Susanne; Guettler, Michael V.

2014-09-09T23:59:59.000Z

268

EGVII endoglucanase and nucleic acids encoding the same  

DOE Patents [OSTI]

The present invention provides a novel endoglucanase nucleic acid sequence, designated egl7, and the corresponding EGVII amino acid sequence. The invention also provides expression vectors and host cells comprising a nucleic acid sequence encoding EGVII, recombinant EGVII proteins and methods for producing the same.

Dunn-Coleman, Nigel; Goedegebuur, Frits; Ward, Michael; Yao, Jian

2014-02-25T23:59:59.000Z

269

Process for the extraction of strontium from acidic solutions  

DOE Patents [OSTI]

The invention is a process for selectively extracting strontium values from aqueous nitric acid waste solutions containing these and other fission product values. The extractant solution is a macrocyclic polyether in an aliphatic hydrocarbon diluent containing a phase modifier. The process will selectively extract strontium values from nitric acid solutions which are up to 6 molar in nitric acid.

Horwitz, E.P.; Dietz, M.L.

1993-01-01T23:59:59.000Z

270

Naphthenic acid corrosion in synthetic fuels production  

SciTech Connect (OSTI)

Serious corrosion damage to carbon steel piping in a fractionation unit associated with synthetic fuels production has been ascribed to the presence of naphthenic acids. Investigation of the problem revealed total acids numbers (TAN) ranging from 8--12mg KOH/g in the feed to the unit. Damage typically occurred in the temperature range 180--240 C and manifested as localized pitting, preferential weld corrosion, general wall thinning and end-grain attack. Filming amine corrosion inhibitors designed for refinery overhead systems have been proven ineffective and high temperature phosphate-based inhibitors could not be used due to potential catalyst poisoning in downstream refinery units. Coupon exposures indicated corrosion rates in the order of 2 mm/y on carbon steel in a reboiler line as well as pitting to austenitic stainless steel type UNS S30403. Line replacement in austenitic stainless steel UNS S31603 has been proven effective. The performance of this alloy is mainly ascribed to its molybdenum content. The absence of sulfur in the feed to the unit is also contributing to the alloy performance despite the extremely high total acid numbers.

Bruyn, H.I. de [Mossgas Ltd., Mossel Bay (South Africa)

1998-12-31T23:59:59.000Z

271

Spatial prediction of caves in San Andres dolomite, Yates field, west Texas  

SciTech Connect (OSTI)

Persistent speculation that caves played a key role in the high flow rates of many early wells in the Yates field (203 wells potentialed for more than 10,000 BOPD each, 26 wells for more than 80,000 BOPD each) has raised questions of why the caves exist, how many there are, and how to incorporate them into reservoir management practice. This paper describes the use of probability theory to answer these questions.

Nosal, E.A.; Carlson, J.L.; Craig, D.H.

1988-02-01T23:59:59.000Z

272

Association of Dolomite and Anhydrite in the Recent Sediments of the Persian Gulf  

Science Journals Connector (OSTI)

... forming part of a programme of research on the Recent sediments of the Trucial Coast, Persian ...PersianGulf ...

R. CURTIS; G. EVANS; D. J. J. KINSMAN; D. J. SHEARMAN

1963-02-16T23:59:59.000Z

273

Calcined Dolomite: Alternative to Lime for Minimizing Undesirable Element Leachability from Fly Ash  

Science Journals Connector (OSTI)

In contrast, for the TCD-treated sample, the principal peaks for several newly formed minerals, including hydrocalumite (3CaO·Al2O3·Ca(OH)2·12H2O) (or hydrotalcite), portlandite (Ca(OH)2), and ettringite (3CaO·Al2O3·3CaSO4·32H2O), were found. ... H hydrocalumite (or hydrotalcite); M mullite; E ettringite; P portlandite; Q quartz; K kalinite; C calcite; He hematite; Ge gehlenite hydrate; G gypsum. ... There was also a small peak for ettringite present. ...

Qinghai Guo; Eric J. Reardon

2012-06-14T23:59:59.000Z

274

Sphalerite mineralization in deep lying dolomites of Upper Arbuckle age, west central Kansas  

Science Journals Connector (OSTI)

...line with thistypeof reason- ing,asareother,butlesspronounced,abruptshiftsin streamdirection,along the Arkansas, Cimmaron and CanadianRivers. Oil and Gas ProductionTrends.--The regionalN 52 E trend of the AldrichPool (Fig. 7) is consideredsignificant...

David Le Count Evans

275

Chemical exchange between seawater and nonstoichiometric dolomite: an experimental investigation in a flow-through system  

E-Print Network [OSTI]

the composition of the pore fluid to be monitored as reactions occur. Average flow rates are contmlled by the volume of fluid sample removed and the time interval between samples. Cylindrical cores (4. 5 cm O. D. x 10. 2 cm) or chips of Burlington... time. The seawater evolved primarily by losing Mg and gaining Ca; however, examination of the solids by X-ray diffraction, mass spectrometry, and cathodoluminescence petrography could not detect the changes in the solid. Dissolution...

Richards, Jennifer Ann

1989-01-01T23:59:59.000Z

276

The effects of solvent mixtures on the gel permeation chromatography of alkanes, fatty acids, and fatty acid esters  

E-Print Network [OSTI]

THE EFFECTS OF SOLVENT MIXTURES ON THE GEL PERMEATION CHROMATOGRAPHY OF ALKANES, FATTY ACIDS, AND FATTY ACID ESTERS A Thesis PATRICK LEE BOLTON Submitted to the Graduate College of Texas A&M University in partial fulfillment... of the requirements for the degree of MASTER OF SCIENCE December 1985 Major Subject: Chemistry THE EFFECTS OP SOLVENT MIXTURES ON THE GEL PERMEATION CHROMATOGRAPHY OF ALKANES, FATTY ACIDS, AND FATTY ACID ESTERS A Thesis by PATRICK LEE BOLTON Approved...

Bolton, Patrick Lee

1985-01-01T23:59:59.000Z

277

Type II Diacylglycerol Acyltransferase from Claviceps purpurea with Ricinoleic Acid, a Hydroxyl Fatty Acid of Industrial Importance, as Preferred Substrate  

Science Journals Connector (OSTI)

...total fatty acids in sclerotium oil (2). Ricinoleic acid, a...CpDGAT2 cDNA were obtained using a Marathon cDNA amplification kit (BD...purified from Ricinus communis oil according to Donaldson (11...fatty acids in the sclerotium oil of this fungus (2). DGAT2...

Ioannis Mavraganis; Dauenpen Meesapyodsuk; Patricia Vrinten; Mark Smith; Xiao Qiu

2009-12-18T23:59:59.000Z

278

Dosage de la lignine insoluble en milieu acide : influence du prtraitement par hydrolyse acide sur la lignine Kla-  

E-Print Network [OSTI]

Dosage de la lignine insoluble en milieu acide : influence du prétraitement par hydrolyse acide sur la lignine Kla- son de bois et de paille Bernard MONTIES LN.R.A., Laboratoire de Chimie biologique et la lignine insoluble dans l'acide sulfurique concentré, lignine Klason, est décrit : il comporte une

Paris-Sud XI, Université de

279

Rate dependent finite deformation stressstrain behavior of an ethylene methacrylic acid copolymer and an ethylene methacrylic acid butyl  

E-Print Network [OSTI]

Rate dependent finite deformation stress­strain behavior of an ethylene methacrylic acid copolymer and an ethylene methacrylic acid butyl acrylate copolymer S. Deschanel a,*, B.P. Greviskes a , K. Bertoldi a , S dependence a b s t r a c t The large strain deformation behaviors of an ethylene methacrylic acid (EMAA

280

Acetic Acid Production by Clostridium thermoaceticum in pH-Controlled Batch Fermentations at Acidic pH  

Science Journals Connector (OSTI)

...and the conversion efficiencies to acetic acid and...neutral pH. The highest acetic acid concentrations...acetic acid, and efficiency of converting glucose...the CO2 was of the highest purity attainable...valve completely and venting for 90 s, closing...ii) A glass furnace tube was packed...

Robert D. Schwartz; Frederick A. Keller Jr.

1982-06-01T23:59:59.000Z

Note: This page contains sample records for the topic "acid dl dolomitic" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


281

Phosphatidic acid: an emerging plant lipid second messenger  

Science Journals Connector (OSTI)

Evidence is accumulating that phosphatidic acid is a second messenger. Its level increases within minutes of a wide variety of stress treatments including ethylene, wounding, pathogen elicitors, osmotic and oxidative stress, and abscisic acid. Enhanced signal levels are rapidly attenuated by phosphorylating phosphatidic acid to diacylglycerol pyrophosphate. Phosphatidic acid is the product of two signalling pathways, those of phospholipases C and D, the former in combination with diacylglycerol kinase. Families of these genes are now being cloned from plants. Several downstream targets of phosphatidic acid have been identified, including protein kinases and ion channels.

Teun Munnik

2001-01-01T23:59:59.000Z

282

Continuous-flow free acid monitoring method and system  

DOE Patents [OSTI]

A free acid monitoring method and apparatus is provided for continuously measuring the excess acid present in a process stream. The disclosed monitoring system and method is based on the relationship of the partial pressure ratio of water and acid in equilibrium with an acid solution at constant temperature. A portion of the process stream is pumped into and flows through the monitor under the influence of gravity and back to the process stream. A continuous flowing sample is vaporized at a constant temperature and the vapor is subsequently condensed. Conductivity measurements of the condensate produces a nonlinear response function from which the free acid molarity of the sample process stream is determined.

Strain, J.E.; Ross, H.H.

1980-01-11T23:59:59.000Z

283

Naphthenic acids as antiwear additives for jet fuels  

SciTech Connect (OSTI)

One of the ways in which the antiwear properties of jet fuels can be improved is the use of lubricity agents, otherwise known as antiwear additives. Among the various compounds that have antiwear properties in these fuels, naphthenic, acids merit special attention. These are alicyclic carboxylic acids, in most cases monobasic, with five- and six-membered carbon rings; they have the general formula R(CH{sub 2}){sub n}COOH, where R is a naphthene radical. Natural naphthenic acids consist mainly of acids of the cyclopentane series, beginning with the simplest, in particular cyclopentylacetic acid. The lower naphthenic acids are monocyclic; the higher acids, beginning with C{sub 13}, are bicyclic and polycyclic. Naphthenic acids of the cyclohexane series are encountered less frequently; they may be found, for example, in Baku, California, and Sakhalin crudes. The most widely used method for obtaining naphthenic acids is the treatment of light distillates, lube distillates, and diesel fuels. The standard GOST 13302-77 establishes several grades of naphthenic acids, depending on the raw material and the production technology. This work was aimed at the utilization of wastes containing naphthenic acids, with subsequent use as jet fuel additives.

Deineko, P.S.; Vasil`eva, E.N.; Popova, O.V.; Bashkatova, S.T.

1995-05-01T23:59:59.000Z

284

Interaction of Uranium(VI) with Phthalic Acid  

SciTech Connect (OSTI)

Phthalic acid, a ubiquitous organic compound found in soil, water, and in domestic and nuclear wastes can affect the mobility and bioavailability of metals and radionuclides. We examined the complexation of uranium with phthalic acid by potentiometric titration, electrospray ionization-mass spectroscopy (ESI-MS), and extended X-ray absorption fine structure (EXAFS) analysis. Potentiometric titration of a 1:1 U/phthalic acid indicated uranyl ion bonding with both carboxylate groups of phthalic acid; above pH 5 the uranyl ion underwent hydrolysis with one hydroxyl group coordinated to the inner-sphere of uranium. In the presence of excess phthalic acid, ESI-MS analysis revealed the formation of both 1:1 and 1:2 U/phthalic acid complexes. EXAFS studies confirmed the mononuclear biligand 1:2 U/phthalic acid complex as the predominant form. These results show that phthalates can form soluble stable complexes with uranium and may affect its mobility.

Vazquez, G.; Dodge, C; Francis, A

2008-01-01T23:59:59.000Z

285

Processes to remove acid forming gases from exhaust gases  

DOE Patents [OSTI]

The present invention relates to a process for reducing the concentration of NO in a gas, which process comprises: (A) contacting a gas sample containing NO with a gaseous oxidizing agent to oxidize the NO to NO[sub 2]; (B) contacting the gas sample of step (A) comprising NO[sub 2] with an aqueous reagent of bisulfite/sulfite and a compound selected from urea, sulfamic acid, hydrazinium ion, hydrazoic acid, nitroaniline, sulfanilamide, sulfanilic acid, mercaptopropanoic acid, mercaptosuccinic acid, cysteine or combinations thereof at between about 0 and 100 C at a pH of between about 1 and 7 for between about 0.01 and 60 sec; and (C) optionally contacting the reaction product of step (A) with conventional chemical reagents to reduce the concentrations of the organic products of the reaction in step (B) to environmentally acceptable levels. Urea or sulfamic acid are preferred, especially sulfamic acid, and step (C) is not necessary or performed. 16 figs.

Chang, S.G.

1994-09-20T23:59:59.000Z

286

Limestone/adipic acid FGD and stack opacity reduction pilot plant tests at Big Rivers  

SciTech Connect (OSTI)

Big Rivers Electric Corporation (BREC) contracted Peabody Process Systems, Inc. (PPSI) to install a flue gas cleaning (FGC) pilot plant at the BREC R.D. Green Station Unit No. 2 located at Sebree, KY. A six month test program was completed demonstrating technology for: alternatives to using lime as an alkali; methods for improving cake dewatering; identification of the causes of high stack opacity; and methods for the reduction of high stack opacity. This paper presents highlights extracted from the reports submitted by PPSI to BREC on this test program. BREC was primarily interested in reduction of operating costs, if possible, by using an alkali less expensive than lime, and by improving the poor dewatering characteristic inherent in a dolomitic lime system. BREC was also within compliance for particulate emissions and opacity in the duct after the dry electrostatic precipitator, but not in compliance with the stack opacity regulation, and therefore wanted to investigate methods for stack opacity reduction.

Laslo, D.; Bakke, E.; Chisholm, E.

1984-01-01T23:59:59.000Z

287

Effect of Hydrolysis on the Properties of a New Viscoelastic Surfactant-Based Acid  

E-Print Network [OSTI]

Viscoelastic surfactants (VES) have been widely used in acidizing and acid fracturing. They are used as diversion agents during matrix acid treatments and leakoff control agents during acid fracturing. At high temperatures, viscoelastic surfactants...

He, Zhenhua

2013-08-07T23:59:59.000Z

288

E-Print Network 3.0 - acid-base equilibrium Sample Search Results  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Principles of Environmental Engineering Date Topic Reading Summary: Acid-Base Chemistry 86-195 28 Acid-Base Chemistry 31 Acid Base Chemistry Sept. 2 Acid-Base Chemistry...

289

Constructing and engineering fatty acid metabolic pathways for the production of fuels and chemicals  

E-Print Network [OSTI]

0 fatty acids in transgenic canola by overexpression of Ch0 fatty acids in transgenic canola by overexpression of Ch

Steen, Eric James

2010-01-01T23:59:59.000Z

290

Investigating fatty acid biosynthesis within the algal chloroplast using Chlamydomonas reinhardtii as a model  

E-Print Network [OSTI]

0 fatty acids in transgenic canola by overexpression of Ch0 fatty acids in transgenic canola by overexpression of Ch

Blatti, Jillian L.

2012-01-01T23:59:59.000Z

291

E-Print Network 3.0 - active lewis acid Sample Search Results  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

levulinic acid. Proceeding... chemicals: kinetic study on the decomposition of 5-hydroxymethylfurfural into levulinic acid. ... Source: Groningen, Rijksuniversiteit - Centre for...

292

Phosphoric acid impurities in phosphoric acid fuel cell electrolytes. 2: Effects on the oxygen reduction reaction at platinum electrodes  

SciTech Connect (OSTI)

The effects of phosphorus acid additions on the oxygen reduction reaction at platinum electrodes in concentrated phosphoric acid were studied. The oxygen reduction currents decreased, and the Tafel slopes became more negative upon the addition of small concentrations of phosphorus acid. In addition,the phosphorus acid oxidation current tended to complete with the oxygen reduction current. These effects became more pronounced at higher phosphorus acid concentrations and at higher temperatures. Upon the addition of phosphorus acid the number of electrons involved in the oxygen reduction reaction decreased from a value close to four to a value approaching two, suggesting promotion of a two-electron reduction to peroxide. Therefore, in studies of the electrochemical reduction of oxygen in hot concentrated phosphoric acid or in fuel cell systems using hot concentrated phosphoric acid as electrolyte, it is recommended that precautions be taken against the inadvertent formation of the phosphorus acid. The removal of phosphorus acid from concentrated phosphoric acid by repeated potential cycling at 100 mV/s between + 0.5 and +1.50 V (vs. dynamic hydrogen electrode) was demonstrated.

Sugishima, Noboru; Hinatsu, J.T.; Foulkes, F.R. (Univ. of Toronto, Ontario (Canada). Dept. of Chemical Engineering and Applied Chemistry)

1994-12-01T23:59:59.000Z

293

Nucleic acid amplification using modular branched primers  

DOE Patents [OSTI]

Methods and compositions expand the options for making primers for use in amplifying nucleic acid segments. The invention eliminates the step of custom synthesis of primers for Polymerase Chain Reactions (PCR). Instead of being custom-synthesized, a primer is replaced by a combination of several oligonucleotide modules selected from a pre-synthesized library. A modular combination of just a few oligonucleotides essentially mimics the performance of a conventional, custom-made primer by matching the sequence of the priming site in the template. Each oligonucleotide module has a segment that matches one of the stretches within the priming site.

Ulanovsky, Levy (Westmont, IL)

2001-01-01T23:59:59.000Z

294

Solvent extraction of rare-earth metals by carboxylic acids  

SciTech Connect (OSTI)

The solvent extraction of the trivalent lanthanides and yttrium from nitrate media by solutions of carboxylic acids in xylene has been studied. Commercially available carboxylic acids such as Versatic 10 and naphthenic acids were used, as well as model compounds of known structure, such as 2-ethylhexanoic and 3-cyclohexylpropanoic acids. In a few cases, extraction of the metals from sulphate and chloride solutions was also investigated. The dependence of the extraction properties of the carboxylic acids on the atomic number of the lanthanide shows a definite relationship to the steric bulk of the carboxylic acid molecule quantified by means of the steric parameter, E{sub s}{prime} of the substituent alkyl group. The stoichiometries of the extracted complexes for representative light (La), middle (Gd) and heavy (Lu) rare-earth metals were investigated by the slope-analysis technique for a sterically hindered acid (Versatic 10 acid; -E{prime}{sub s} = 3.83) and an acid with low steric hindrance (3-cyclohexylpropanoic acid; -E{prime}{sub s} = 0.28). 14 refs., 13 figs., 3 tabs.

Preez, A.C. du; Preston, J.S. [Mintek, Randburg (South Africa)

1992-04-01T23:59:59.000Z

295

Nucleic Acid Standards - Standard Ref. Frame  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

A Standard Reference Frame for the Description A Standard Reference Frame for the Description of Nucleic Acid Base-pair Geometry Supplementary Material The report is available at Journal of Molecular Biology (2001) 313: 229 - 237 and The Nucleic Acid Cartesian coordinates for A, C, G, T, and U in the optimized reference frame Adenine, Cytosine, Guanine, Thymine, Uracil Standard chemical structures taken from Clowney et al. (1996), J. Am. Chem. Soc., 118, 509-518). These data do not include C1' atoms, which are placed here in the least-squares plane of the base atoms, with the purine C1'-N9 bond length and C1'-N9-C4 valence angle set respectively to 1.46 Å and 126.5° and the pyrimidine C1'-N1 bond and C1-N1-C2 angle to 1.47 Å and 118.1°. These distances and angles are based on the average glycosyl

296

in amino-acid concentration enhanced amino-acid and glucose utilization for lipogenesis, with no  

E-Print Network [OSTI]

. In contrast, insulin decreased lipid secretion measured by glycerol (-35%) and glucose incor- poration increased glycerol incorporation (+35%) into cellular lipids and consequently lipogenesis. Insulin increased more strongly amino-acid and glucose incorporation into cellular lipids, the glu- cose incorporation

Boyer, Edmond

297

Evalutaion of Multi-Stage Sandstone Acidizing Uging an Organic Mud Acid and a Clay Stabalizer  

E-Print Network [OSTI]

and clay particles. The purpose of this study is to present and evaluate multi-stage acid injection into the Bandera sandstone cores to remove formation damage. In this study, coreflood experiments were conducted on Bandera sandstone cores (1.5 in. x 6 in...

Sakipour, Armin

2013-05-29T23:59:59.000Z

298

DOE - Office of Legacy Management -- Acid Pueblo Canyon - NM 03  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Acid Pueblo Canyon - NM 03 Acid Pueblo Canyon - NM 03 FUSRAP Considered Sites Acid/Pueblo Canyon, NM Alternate Name(s): Radioactive Liquid Waste Treatment Plant (TA-45) Acid/Pueblo and Los Alamos Canyon NM.03-3 Location: Canyons in the Pajarito Plateau Region in Los Alamos County, Los Alamos, NM NM.03-3 Historical Operations: Late 1943 or early 1944, head of the south fork of Acid Canyon received untreated liquid waste containing tritium and isotopes of strontium, cesium, uranium, plutonium, and americium discharged from main acid sewer lines and subsequently from the TA-3 plutonium treatment plant. NM.03-3 Eligibility Determination: Radiological Survey(s): Verification Surveys NM.03-5 NM.03-6 Site Status: Certified- Certification Basis and Federal Register Notice NM.03-2

299

Newer method for analyzing naphthenic acids in petroleum  

SciTech Connect (OSTI)

The naphthenic acids in petroleum are considered a class of biological markers. Their potential use in source correlation and as indicator of biodegradation have been reported in the past. Their presence in waste water at refineries may also cause corrosion problems and fish toxicity. Due to their highly complicated nature, detailed characterization of the acids has been difficult and time consuming. This talk will describe a relatively simple approach in characterizing the acids based on their group types. The acids were first separated from petroleum followed by mass spectrometric determinations. Two newer methods were developed to analyze the acid components, namely Chemical Ionization with NF{sub 3} as reagent gas and negative ion Fast Atom Bombardment. The geochemical interpretation based on acid distribution will be demonstrated with a set of well understood crude oil samples.

Fan, T.P. (Shell Development Co., Houston, TX (United States))

1990-08-01T23:59:59.000Z

300

The iron powder test for naphthenic acid corrosion studies  

SciTech Connect (OSTI)

In the course of an ongoing investigation into the phenomenon of naphthenic acid corrosion, a new test method has evolved and is currently being further developed to substitute the total acid number (TAN or neutralization number) as an indicator for naphthenic acid corrosion potential. It can also be used to complement conventional autoclave corrosion tests in high temperature environments, which are based on weight loss of steel coupons. In this new method an oil sample reacts with pure iron powder within an autoclave heated to the testing temperature. The result is based on the amount of dissolved iron found in the oil sample. The oil sample can dissolve an amount of iron for a given time at a given temperature, depending on the naphthenic acid corrosion, since these acids react with iron to produce oil soluble iron naphthenates. This paper describes the method, compares it with conventional crude corrosiveness testing, and proposes it as a new way of measuring naphthenic acid corrosion potential.

Hau, J.L.; Yepez, O.; Specht, M.I.; Lorenzo, R. [PDVSA-Intevep, Caracas (Venezuela)

1999-11-01T23:59:59.000Z

Note: This page contains sample records for the topic "acid dl dolomitic" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


301

Investigating the Effects of Core Length on Pore Volume to Breakthrough (PVBT) Behavior in Carbonate Core Samples during Matrix Acidizing with Hydrochloric Acid  

E-Print Network [OSTI]

Most literature contains Hydrochloric acid (HCl) carbonate acidizing experiments performed on short (2 - 6 inch) cores. These cores do not accurately represent reservoir conditions, as spent acid is not propagated for any appreciable distance along...

Nour, Mohamed

2014-05-06T23:59:59.000Z

302

An Improved Model for Sandstone Acidizing and Study of the Effect of Mineralogy and Temperature on Sandstone Acidizing Treatments and Simulation  

E-Print Network [OSTI]

Sandstone acidizing is a complex operation because the acidizing fluid reacts with a variety of minerals present in the formation that results in a wide range of reaction products. The hydrofluoric acid (HF) reaction rate differs widely from mineral...

Agarwal, Amit Kumar

2013-01-14T23:59:59.000Z

303

Study of Acid Response of Qatar Carbonate Rocks  

E-Print Network [OSTI]

STUDY OF ACID RESPONSE OF QATAR CARBONATE ROCKS A Thesis by ZHAOHONG WANG Submitted to the Office of Graduate Studies of Texas A&M University in partial fulfillment of the requirements for the degree of MASTER OF SCIENCE... December 2011 Major Subject: Petroleum Engineering Study of Acid Response of Qatar Carbonate Rocks Copyright 2011 Zhaohong Wang STUDY OF ACID RESPONSE OF QATAR CARBONATE ROCKS A Thesis...

Wang, Zhaohong

2012-02-14T23:59:59.000Z

304

Phosphate ester inhibitors solve naphthenic acid corrosion problems  

SciTech Connect (OSTI)

Crude oils containing naphthenic acids can cause a variety of corrosion problems in any of several process areas. But because of the complexity of naphthenic acid corrosion, no routine technique is available for predicting corrosion from this source. Certain high-temperature corrosion inhibitors with a general phosphate ester structure have shown good mitigation of naphthenic acid corrosion in commercial applications. A description of two such cases will help refiners know what to look for to prevent similar occurrences in their plants.

Babaian-Kibala, E. (Nalco Chemical Co., Sugar Land, TX (United States))

1994-02-28T23:59:59.000Z

305

Process for the recovery of strontium from acid solutions  

DOE Patents [OSTI]

The invention is a process for selectively extracting strontium and technetium values from aqueous nitric acid waste solutions containing these and other fission product values. The extractant is a macrocyclic polyether in a diluent which is insoluble in water, but which will itself dissolve a small amount of water. The process will extract strontium and technetium values from nitric acid solutions which are up to 6 molar in nitric acid. 5 figs.

Horwitz, E.P.; Dietz, M.L.

1992-03-31T23:59:59.000Z

306

The reaction of cesium hydroxide with 4-phenylvaleric acid  

E-Print Network [OSTI]

Alkali Metal Hycroxide Solutions Used in Potentio- metric and Spectrophotometric Titrations with 4-Phenylvaleric Acid 17 Samples for Nuclear Magnetic Resonance Spectra 18 Concentration of 4-Phenylvaleric Acid in Carbon Tetrachloride for Infrared.... Similarly, nuclear magnetic resonance techniques may be used to determine whether any TT-bonding involving the phenyl ring of 4- phenylvaleric acid occurs during its reaction with cesium hydroxide. If any such bonding to the n-electrons of the ring occurs...

Caughfield, Arvie Jeane

2012-06-07T23:59:59.000Z

307

A First Look at Yeast Fatty Acid Synthase  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

A First Look at Yeast Fatty Acid A First Look at Yeast Fatty Acid Synthase A First Look at Yeast Fatty Acid Synthase Print Wednesday, 28 November 2007 00:00 Fatty acids are the major constituents of eukaryotic and bacterial cellular membranes. They are used for functionally important post-translational protein modifications, and chains of fatty acids are the main storage compartments of an organism's chemical energy. Fatty acid synthesis is carried out by fatty acid sythase (FAS), which catalyzes cycles of multistep chemical reactions that are essentially the same in all organisms. FAS uses one acetyl-coenzyme A (CoA) and seven malonyl-CoA molecules to synthesize the 16-carbon palmitic acid, the most abundant fatty acid in eukaryotes. Now, for the first time, a group of researchers has determined the atomic structure of yeast Saccharomyces cerevisiae FAS derived from two crystals of the enzyme, using data collected at ALS Beamlines 8.2.1 and 8.2.2, as well as other synchrotron facilities.

308

Production of Biofuels from High-Acid-Value Waste Oils  

Science Journals Connector (OSTI)

Production of Biofuels from High-Acid-Value Waste Oils ... (1) Biofuel is derived from a renewable, domestic resource, thereby relieving reliance on petroleum fuel imports. ...

Junming Xu; Guomin Xiao; Yonghong Zhou; Jianchun Jiang

2011-08-27T23:59:59.000Z

309

Regulating for the long term: SMCRA and acid mine drainage  

SciTech Connect (OSTI)

With the passage of the Surface Mining Control and Reclamation Act of 1977 (SMCRA), regulators and industry representatives expected to solve the problem of pollution of the Nation`s waterways caused by acidic discharges from coal mines. Eighteen years after the passage of SMCRA, hard issues of predicting, regulating and treating acid mine drainage remain. Acid mine drainage is most common in the coal seams of the Midwest and Appalachia: Pennsylvania, West Virginia, Maryland, Ohio, Illinois, and Tennessee. This article discusses regulation of coal mines and acid mine drainage for the long term.

Shea, C.W.

1995-12-31T23:59:59.000Z

310

E-Print Network 3.0 - acid glycosaminoglycan mucopolysaccharide...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

used: HA, hyaluronic acid; hexosa- minidase, 3-IV-acetyl ... Source: Geiger, Benjamin - Department of Molecular Cell Biology, Weizmann Institute of Science Collection:...

311

Recombinant microorganisms for increased production of organic acids  

DOE Patents [OSTI]

Disclosed are recombinant microorganisms for producing organic acids. The recombinant microorganisms express a polypeptide that has the enzymatic activity of an enzyme that is utilized in the pentose phosphate cycle. The recombinant microorganism may include recombinant Actinobacillus succinogenes that has been transformed to express a Zwischenferment (Zwf) gene. The recombinant microorganisms may be useful in fermentation processes for producing organic acids such as succinic acid and lactic acid. Also disclosed are novel plasmids that are useful for transforming microorganisms to produce recombinant microorganisms that express enzymes such as Zwf.

Yi, Jian; Kleff, Susanne; Guettler, Michael V

2013-04-30T23:59:59.000Z

312

Recombinant microorganisms for increased production of organic acids  

DOE Patents [OSTI]

Disclosed are recombinant microorganisms for producing organic acids. The recombinant microorganisms express a polypeptide that has the enzymatic activity of an enzyme that is utilized in the pentose phosphate cycle. The recombinant microorganism may include recombinant Actinobacillus succinogenes that has been transformed to express a Zwischenferment (Zwf) gene. The recombinant microorganisms may be useful in fermentation processes for producing organic acids such as succinic acid and lactic acid. Also disclosed are novel plasmids that are useful for transforming microorganisms to produce recombinant microorganisms that express enzymes such as Zwf.

Yi, Jian (East Lansing, MI); Kleff, Susanne (East Lansing, MI); Guettler, Michael V. (Holt, MI)

2012-02-21T23:59:59.000Z

313

Amino acid treatment enhances protein recovery from sediment...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

treatment enhances protein recovery from sediment and soils for metaproteomic studies . Amino acid treatment enhances protein recovery from sediment and soils for metaproteomic...

314

Dissociative Binding of Carboxylic Acid Ligand on Nanoceria Surface...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Abstract: Carboxylic acid is a common ligand anchoring group to functionalize nanoparticle surfaces. Its binding structures and mechanisms as a function of the oxidation...

315

Membrane Stresses Induced by Overproduction of Free Fatty Acids...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

coli. Abstract: Microbially produced fatty acids are potential precursors to high energy density biofuels, including alkanes and alkyl ethyl esters by either catalytic...

316

amino acid conjugates: Topics by E-print Network  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

the measured distributions. Guang Wu; Shaomin Yan 71 Amino acid classes and the protein folding problem Condensed Matter (arXiv) Summary: We present and implement a...

317

The corrosion of aluminum in boric acid solutions  

E-Print Network [OSTI]

vs. Time of at 40oC . vs. Time of 40 C . 34 ~ ~ ~ 35 3S Aluminum in Boric ~ ~ ~ 24S Aluminum in Boric Corrosion Rate Acid Solutions vs. Time of at 50oC . 2S Aluminum in Boric 36 Corrosion Rate Acid Solutions vs. Time of at 50oC 3S... Solutions vs. Time of 3S Aluminum in Boric at 70oC 40 Corrosion Rate Acid Solutions vs. Time of at 70oC 24S Aluminum in Boric ~ ~ ~ . a ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ /+1 14. Corrosion Rate Acid Solutions vs. Time of at 90cC 2S Aluminum in Boric 42 15...

Bass, Henry Kinsolving

2012-06-07T23:59:59.000Z

318

A novel recycling process using the treated citric acid wastewater as ingredients water for citric acid production  

Science Journals Connector (OSTI)

Abstract In this study, an integrated process coupling citric acid and methane fermentations was proposed to solve severe wastewater pollution problem in cassava-based citric acid production. The accumulation patterns of the potential and major inhibitors in this process, including organic compounds, volatile fatty acids (VFAs), total ions and pigments were investigated. Both simulation and experimental results indicated that these inhibitors could reach their equilibrium levels after 3–7 fermentation runs when reutilizing the treated citric acid wastewater. As a result, the proposed citric acid fermentation process by recycling the wastewater treated in methane fermentation could be stably operated for more than 15 runs, which could save a large amount of fresh water and relieve the severe wastewater pollution in citric acid production potentially.

Hong-Jian Zhang; Jian-Hua Zhang; Jian Xu; Lei Tang; Zhong-Gui Mao

2014-01-01T23:59:59.000Z

319

Interaction of divalent cations with triethylenetetraminehexaacetic acid  

Science Journals Connector (OSTI)

Further studies of the interactions of divalent metal ions with triethylenetetraminehexaacetic acid (TTHA) have revealed that mononuclear, binuclear, and protonated mononuclear complexes are formed in solution with Zn(II), Cd(II), Hg(II) and Pb(II) iions. Equilibrium constants are reported for the various complex species formed, and possible structures for the mononuclear are reported for the various complex species formed, and possible structures for the mononuclear species are suggested. Other reports describing the nature of the complexes formed by this ligand with divalent metal ions are confirmed in that the binuclear complexes are resistant to hydrolysis in alkaline solution, and that the symmetrical binuclear complex is considered the most likely structure.

Austin Yingst; Arthur E. Martell

1971-01-01T23:59:59.000Z

320

Naphthenic acid corrosion and its control  

SciTech Connect (OSTI)

This paper first presents a brief description of naphthenic acid corrosion and the main factors which influence its onset and severity. After a brief discussion of traditional control methods, it proceeds to a discussion of chemical inhibition, which is a relatively new control technique. Chemical inhibitors can be divided into two broad classifications: phosphorus-based and non-phosphorus-based. Three types of phosphorus-based inhibitors have been reported: amine-neutralized phosphate esters, alkaline earth phosphonate phenate sulfide plus trialkyl phosphate, and thiazolines plus di and tri-alkyl phosphates. Non-phosphorus based inhibitors include: thiazolines, organic polysulfides, and sulfonated alkyl phenols. A description of each inhibitor and its effectiveness in the laboratory and field is presented.

Zetlmeisl, M.J. [Petrolite Corp., St. Louis, MO (United States)

1996-08-01T23:59:59.000Z

Note: This page contains sample records for the topic "acid dl dolomitic" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


321

Corrosion of carbons in acid electrolytes  

SciTech Connect (OSTI)

The stability of the electrode materials used in hot phosphoric acid fuel cells, in particular the conductive carbon electrocatalyst support, is a continuing concern. The Tafel slope of the carbon corrosion reaction appears to be indicative of the degree of disorder on the carbon surface--the larger the Tafel slope, the greater the degree of disorder. The effect of heat-treatment was found to depend on the structure of the parent carbon. Differences in the electrochemical behavior of samples of heattreated Vulcan XC-72R were correlated with the structural properties of the carbon produced, as reflected by lattice parameters. Changes in BET surface areas and lattice parameters as well as in electrochemical behavior showed evidence that the addition of boron resulted in ''graphitization'' that was not achieved by heat-treatment alone.

Stonehart, P.; MacDonald, J.

1983-08-01T23:59:59.000Z

322

Active Phosphoric Acid and Its Relation to the Needs of the Soil for Phosphoric Acid in Pot Experiments.  

E-Print Network [OSTI]

. K/5 nitric acid, measured with a flask. Place in ter bath previously heated to 40" C. Digest five hours, shak- ?very half hour. Filter on a large'double folded filter. When cola, take 1800 c.c. for the estimation of phosphoric acid and potael... and silica. The filtrate was measured ancl its vol- ume recorded. The soil on the filter paper was washed back into the bottle with 2000 c.c. N,'5 nitric acid, and again digested. Fonr treatments in all were made with the acid, The quantity of phosphorjc...

Fraps, G. S. (George Stronach)

1909-01-01T23:59:59.000Z

323

EFFECTS OF NITRIC ACID ON CRITICALITY SAFETY ANALYSIS  

SciTech Connect (OSTI)

As nitric acid molarity is increased, there are two competing phenomena affecting the reactivity of the system. First, there is interaction between each of the 10 wells in the basket-like insert. As the molarity of the nitric acid solution is increased (it moves from 100% water to 100% HNO{sub 3}), the hydrogen atom density decreases by about 80%. However, it remains a relatively efficient moderator. The moderating ratio of nitric acid is about 90% that of water. As the media between the wells is changed from 100% water to 100% nitric acid, the density of the media increases by 50%. A higher density typically leads to a better reflector. However, when the macroscopic scattering cross sections are considered, nitric acid is a much worse reflector than water. The effectiveness of nitric acid as a reflector is about 40% that of water. Since the media between the wells become a worse reflector and still remains an effective moderator, interaction between the wells increases. This phenomenon will cause reactivity to increase as nitric acid molarity increases. The seond phenomenon is due to the moderating ratio changing in the high concentration fissile-nitric acid solution in the 10 wells. Since the wells contain relatively small volumes of high concentration solutions, a small decrease in moderating power has a large effect on reactivity. This is due to the fact that neutrons are more likely to escape the high concentration fissile solution before causing another fission event. The result of this phenomenon is that as nitric acid molarity increases, reactivity decreases. Recent studies have shown that the second phenomenon is indeed the dominating force in determining reactivity changes in relation to nitric acid molarity changes. When considering the system as a whole, as nitric acid molarity increases, reactivity decreases.

Williamson, B.

2011-08-18T23:59:59.000Z

324

Production of levulinic acid from glucosamine by dilute-acid catalyzed hydrothermal process  

Science Journals Connector (OSTI)

Abstract Glucosamine is a basic unit of the chitin/chitosan structure, which is derived from crustacean (e.g. crab, shrimp) and insect shells. In this study, the production of levulinic acid (LA) from glucosamine via dilute-acid-catalyzed hydrothermal hydrolysis was investigated. Among the reaction conditions, reaction temperature, reaction time, and substrate concentration were more effective than catalyst concentration. The optimal conditions for LA production, as determined by the response-surface methodology (RSM), were as follows: 188 °C reaction temperature, 4 wt% catalyst concentration, 49 min reaction time, 120 g/L substrate concentration. Under these conditions, the LA yield was 30.3 g/L (25.3 wt%), while the 5-HMF concentration was zero. These results might provide basic knowledge essential to the production of valuable chemicals derivable from renewable marine resources and utilizable as fuel additives and polymer building blocks.

Gwi-Taek Jeong

2014-01-01T23:59:59.000Z

325

Behavior of copper in acidic sulfate solution: Comparison with acidic chloride  

SciTech Connect (OSTI)

The anodic polarization behavior of copper in a 0.1 M sulfuric acid (H{sub 2}SO{sub 4}) + 1 M sodium sulfate (Na{sub 2}SO{sub 4}) solution (pH = 2.0) was studied at room temperature under quiescent and stirred conditions. The behavior was compared with aqueous equilibria via construction of a potential-vs-pH (E-pH) diagram for the copper-sulfate-water (Cu-SO{sub 4}{sup 2}-H{sub 2}O) system. Interpretation of the behavior was aided by comparison with aqueous equilibria and polarization studies of copper in a 0.2 M hydrochloric acid (HCl) + 1 M sodium chloride (NaCl) solution(pH = 0.8). The initial anodic dissolution region in the acidic sulfate solution exhibited Tafel behavior with a slope consistent with formation of cupric ions (Cu{sup 2+}) whose rate of formation was charge-transfer controlled. At higher potentials, limiting current density (i{sub L}) behavior was observed under E-pH conditions that were consistent with formation of a film of copper sulfate pentahydrate (CuSO{sub 4} {degree} 5H{sub 2}O). Comparison of experimental i{sub L} values with those predicted by mass transport-controlled processes, using estimates of the diffusion layer thickness obtained from the mass transfer-influenced region of apparent Tafel behavior in the acidic chloride solution, were in sufficient agreement to indicate i{sub L} was controlled by the rate of dissolution of the CuSO{sub 4} {degree} 5H{sub 2}O film via transport of Cu{sup 2+} from the film-electrolyte interface into the bulk solution.

Tromans, D.; Silva, J.C. [Univ. of British Columbia, Vancouver, British Columbia (Canada). Dept. of Metals and Materials Engineering

1997-03-01T23:59:59.000Z

326

Abc Amino Acids: Design, Synthesis, and Properties of New Photoelastic Amino Acids  

SciTech Connect (OSTI)

Photoisomerizable amino acids provide a direct avenue to the experimental manipulation of bioactive polypeptides, potentially allowing real-time, remote control of biological systems and enabling useful applications in nanobiotechnology. Herein, we report a new class of photoisomerizable amino acids intended to cause pronounced expansion and contraction in the polypeptide backbone, i.e., to be photoelastic. These compounds, termed Abc amino acids, employ a photoisomerizable azobiphenyl chromophore to control the relative disposition of aminomethyl and carboxyl substituents. Molecular modeling of nine Abc isomers led to the identification of one with particularly attractive properties, including the ability to induce contractions up to 13A in the backbone upon transa?cis photoisomerization. This isomer, designated mpAbc, has substituents at meta and para positions on the inner (azo-linked) and outer rings, respectively. An efficient synthesis of Fmoc-protected mpAbc was executed in which the biaryl components were formed via Suzuki couplings and the azo linkage was formed via amine/nitroso condensation; protected forms of three other Abc isomers were prepared similarly. A decapeptide incorporating mpAbc was synthesized by conventional solid-phase methods and displayed characteristic azobenzene photochemical behavior with optimal conversion to the cis isomer at 360 nm and a thermal cisa?trans half life of 100 min. at 80 AoC.

Standaert, Robert F [ORNL; Park, Dr Seung Bum [Seoul National University

2006-01-01T23:59:59.000Z

327

Original article Ethanol and acetic-acid tolerance  

E-Print Network [OSTI]

Original article Ethanol and acetic-acid tolerance in Indian geographical populations of Drosophila clines of ethanol toler- ance (1.5-4.2%) and acetic-acid tolerance (2.9-4.9%) were observed in adult individuals of 4 geographical populations of Drosophila immigrans. Thus, both ethanol and acetic

Paris-Sud XI, Université de

328

Original article Ethanol and acetic-acid tolerances  

E-Print Network [OSTI]

Original article Ethanol and acetic-acid tolerances in Drosophila melanogaster: similar maternal) Summary - Ethanol and acetic-acid tolerances were studied in a cross between 2 geo- graphic races disappeared in the F2. Further investigations demonstrated that for ethanol tolerance, the large difference

Paris-Sud XI, Université de

329

Stimulation of Carbonate Reservoirs Using a New Emulsified Acid System  

E-Print Network [OSTI]

The scope of work can be divided into; the measurement of the rheological properties of a new emulsified acid system that can be suitable for high temperature applications, a study of the performance of the new emulsified acid in stimulating both...

Sayed, Mohammed Ali Ibrahim

2013-05-15T23:59:59.000Z

330

Ancient insights into uric acid metabolism in primates  

E-Print Network [OSTI]

such as gout and hypertension have plagued us for centu- ries. The prevalence of gout in the United States has, a key enzyme that metabolizes uric acid, leaving us vulnerable to diseases such as gout rise to the well-known joint pain associated with gout. Elevated uric acid levels have also been

Chang, Belinda

331

Solvent extraction studies of holmium with acidic extractants  

SciTech Connect (OSTI)

Liquid-liquid extraction studies of holmium with 2-ethylhexyl phosphoric acid mono-2-ethylhexyl ester, naphthenic, and Versatic 10 acids have been carried out. The nature of the extracted species and the extraction equilibrium constants of these systems have been determined from aqueous nitrate solution. The extraction mechanism and complexation models have been proposed. 11 refs., 8 figs.

Gaikwad, A.G.; Damodaran, A.D. (CSIR, Trivandrum (India))

1993-03-01T23:59:59.000Z

332

Evaporative Hydrochloric Acid Recovery: Something Old, Something New...  

E-Print Network [OSTI]

. If zinc is present from the pickling of galvanizing racks or stripping of parts, the zinc concentration will range from as low as zinc chloride solution remains. In the evaporative process of the Hydrochloric Acid Recovery System, the waste acid is pumped through a pre-filter into the evaporator section oftI1e recovery system. This solution is heated by means...

Cullivan, B.

333

Boron-containing amino carboxylic acid compounds and uses thereof  

DOE Patents [OSTI]

Novel compounds which are useful for boron neutron capture therapy (BNCT) are disclosed. The compounds comprise a stable boron-containing group and an aminocycloalkane carboxylic acid group or a boronated acyclic hydrocarbon-linked amino carboxylic acid. Methods for synthesis of the compounds and for use of the compounds in BNCT are disclosed.

Kabalka, George W. (Knoxville, TN); Srivastava, Rajiv R. (Knoxville, TN)

2000-03-14T23:59:59.000Z

334

AcidBase Regulation in Fishes: Cellular and Molecular Mechanisms  

E-Print Network [OSTI]

, and functional studies that have begun to define the protein transporters involved in the acid­base relevant ion gill membrane transport processes in acid­base balance. J. Exp. Zool. 293:302­319, 2002. r 2002 Wiley on recent advances in our understand- ing of membrane transport systems which are responsible for the net

Claiborne, James Berkeley

335

Effects of the Biologically Produced Polymer Alginic Acid on  

E-Print Network [OSTI]

. Using a combined atomic force microscopy (AFM)/flow- through reactor apparatus, we investigated. In alginic acid, the acute step retreat rate is nearly unchanged in comparison to water, whereas the obtuse but propagate faster in the obtuse direction. To explain these observations, we propose that alginic acid

336

Production of amino acids using auxotrophic mutants of methylotrophic bacillus  

SciTech Connect (OSTI)

A method of producing amino acids by culturing an amino acid auxotroph of a biologically pure strain of a type I methylotrophic bacterium of the genus Bacillus which exhibits sustained growth at 50.degree. C. using methanol as a carbon and energy source and requiring vitamin B.sub.12 and biotin is provided.

Hanson, Richard S. (Wayzata, MN); Flickinger, Michael C. (St. Paul, MN); Schendel, Frederick J. (Falcon Heights, MN); Guettler, Michael V. (Waconia, MN)

2001-07-17T23:59:59.000Z

337

Propionic-Acid-Terminated Silicon Nanoparticles: Synthesis and Optical Characterization  

E-Print Network [OSTI]

producing water-dispersible, propionic-acid-terminated particles. From transmission electron microscope (TEM oxidation of the nanocrystals. The silicon nanocrystals could be transferred into water or methanol in acrylic acid, water, and methanol and showed essentially the same optical properties in all three solvents

Swihart, Mark T.

338

Inhibition of Aluminum Oxyhydroxide Precipitation with Citric Acid  

E-Print Network [OSTI]

Inhibition of Aluminum Oxyhydroxide Precipitation with Citric Acid Daniel M. Dabbs, Usha as an agent for increasing the solubility of aluminum oxyhydroxides in aqueous solutions of high (>2.47 mol/mol) hydroxide-to-aluminum ratios. Conversely, citric acid also colloidally stabilizes particles in aqueous

Aksay, Ilhan A.

339

Preparation of {alpha},{beta}-unsaturated carboxylic acids and esters  

DOE Patents [OSTI]

Disclosed is a process for the preparation of {alpha},{beta}-unsaturated carboxylic acids and esters thereof which comprises contacting formaldehyde or a source of formaldehyde with a carboxylic acid, ester or anhydride in the presence of a catalyst comprising an oxide of niobium.

Gogate, M.R.; Spivey, J.J.; Zoeller, J.R.

1998-09-15T23:59:59.000Z

340

Mercury-free dissolution of aluminum-clad fuel in nitric acid  

DOE Patents [OSTI]

A mercury-free dissolution process for aluminum involves placing the aluminum in a dissolver vessel in contact with nitric acid-fluoboric acid mixture at an elevated temperature. By maintaining a continuous flow of the acid mixture through the dissolver vessel, an effluent containing aluminum nitrate, nitric acid, fluoboric acid and other dissolved components are removed.

Christian, Jerry D. (Idaho Falls, ID); Anderson, Philip A. (Pocatello, ID)

1994-01-01T23:59:59.000Z

Note: This page contains sample records for the topic "acid dl dolomitic" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


341

Membrane Bound: C2-Domain Abscisic Acid-Related Proteins Help Abscisic Acid Receptors Get Where They Need to Go  

Science Journals Connector (OSTI)

...Membrane Bound: C2-Domain Abscisic Acid-Related Proteins Help Abscisic Acid Receptors Get Where They Need to Go Jennifer Lockhart jlockhart@aspb.org Science Editor www.plantcell.org/cgi/doi/10.1105/tpc.114.134411

Jennifer Lockhart

2014-12-02T23:59:59.000Z

342

Nucleic Acid Standards | Base Pair Geometry  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

A Standard Reference Frame for the Description A Standard Reference Frame for the Description of Nucleic Acid Base-pair Geometry Table 1. Cartesian coordinates of non-hydrogen atoms in the standard reference frames of the five common nitrogenous bases Atom Base x(Å) y(Å) z(Å) Adenine ATOM 1 C1' A A 1 -2.479 5.346 0.000 ATOM 2 N9 A A 1 -1.291 4.498 0.000 ATOM 3 C8 A A 1 0.024 4.897 0.000 ATOM 4 N7 A A 1 0.877 3.902 0.000 ATOM 5 C5 A A 1 0.071 2.771 0.000 ATOM 6 C6 A A 1 0.369 1.398 0.000 ATOM 7 N6 A A 1 1.611 0.909 0.000 ATOM 8 N1 A A 1 -0.668 0.532 0.000 ATOM 9 C2 A A 1 -1.912 1.023 0.000 ATOM 10 N3 A A 1 -2.320 2.290 0.000

343

Nucleic acids encoding human trithorax protein  

DOE Patents [OSTI]

In accordance with the present invention, there is provided an isolated peptide having the characteristics of human trithorax protein (as well as DNA encoding same, antisense DNA derived therefrom and antagonists therefor). The invention peptide is characterized by having a DNA binding domain comprising multiple zinc fingers and at least 40% amino acid identity with respect to the DNA binding domain of Drosophila trithorax protein and at least 70% conserved sequence with respect to the DNA binding domain of Drosophila trithorax protein, and wherein said peptide is encoded by a gene located at chromosome 11 of the human genome at q23. Also provided are methods for the treatment of subject(s) suffering from immunodeficiency, developmental abnormality, inherited disease, or cancer by administering to said subject a therapeutically effective amount of one of the above-described agents (i.e., peptide, antagonist therefor, DNA encoding said peptide or antisense DNA derived therefrom). Also provided is a method for the diagnosis, in a subject, of immunodeficiency, developmental abnormality, inherited disease, or cancer associated with disruption of chromosome 11 at q23.

Evans, Glen A. (Encinitas, CA); Djabali, Malek (Marseilles, FR); Selleri, Licia (Del Mar, CA); Parry, Pauline (San Diego, CA)

2001-01-01T23:59:59.000Z

344

GENETIC ANALYSIS OF ABSCISIC ACID BIOSYNTHESIS  

SciTech Connect (OSTI)

The carotenoid cleavage dioxygenases (CCD) catalyze synthesis of a variety of apo-carotenoid secondary metabolites in plants, animals and bacteria. In plants, the reaction catalyzed by the 11, 12, 9-cis-epoxy carotenoid dioxygenase (NCED) is the first committed and key regulated step in synthesis of the plant hormone, abscisic acid (ABA). ABA is a key regulator of plant stress responses and has critical functions in normal root and seed development. The molecular mechanisms responsible for developmental control of ABA synthesis in plant tissues are poorly understood. Five of the nine CCD genes present in the Arabidopsis genome encode NCED's involved in control of ABA synthesis in the plant. This project is focused on functional analysis of these five AtNCED genes as a key to understanding developmental regulation of ABA synthesis and dissecting the role of ABA in plant development. For this purpose, the project developed a comprehensive set of gene knockouts in the AtNCED genes that facilitate genetic dissection of ABA synthesis. These mutants were used in combination with key molecular tools to address the following specific objectives: (1) the role of ABA synthesis in root development; (2) developmental control of ABA synthesis in seeds; (3) analysis of ATNCED over-expressers; (4) preliminary crystallography of the maize VP14 protein.

MCCARTY D R

2012-01-10T23:59:59.000Z

345

Fate of the naphthenic acid, U-{sup 14}C-palmitic acid, in constructed wetlands; A microcosm study  

SciTech Connect (OSTI)

This study represents part of an overall initiative to assess the ecological viability of constructed wetlands for the treatment of oil sands wastewater. To determine the fate of naphthenic acids (C{sub n}H{sub 2n+z}O{sub 2}), the most toxic component of oil sands wastewater, in constructed wetlands, a representative naphthenic acid (NA), U-{sup 14}C-palmitic acid was added to microcosms placed within three control and three treatment wetlands. Treatment wetlands receive wastewater typical of effluent resulting from the oil sands extraction process. In each of the 6 microcosms, biotic compartments measured for {sup 14}C at t = 0, 1, 3, 5, 7, 14 and 21 days were: mineralized palmitic acid (evolved {sup 14}C-CO{sub 2}), water, suspended sediments, bottom sediments, cattail, chironomid larvae, and sticklebacks (liver, muscle and skin). The fate of the {sup 14}C-palmitic acid was similar between the control versus treatment microcosms. Exceptions were greater amounts of {sup 14}C-palmitic acid detected in water and suspended sediments of treatment versus control microcosms. Of the biotic compartments, at t = 21 days, the majority of the {sup 14}C-palmitic acid was found in chironomids and fish tissues. Mineralization and partitioning of {sup 14}C-palmitic acid onto sediments also represented important fates. From the initial addition of the labelled compound, with the exception of bottom sediments, by t = 1 day {sup 14}C was detected in ail biotic compartments. {sup 14}C was detected in bottom sediments by t = 7 days. These results indicate that in addition to mineralization being an important process influencing the fate palmitic acid within the wetlands, partitioning into biotic compartments such as chironomids and fish are also important fates. Hence, when considering the use of constructed wetlands for the treatment of oil sands effluent, the adverse effects of naphthenic acids on the biota needs to be fully addressed.

Wood, A.; Barjaktarovic, L.; Moore, M.; Kennedy, C.; Farrell, A.P.; Bendell-Young, L.I. [Simon Fraser Univ., Burnaby, British Columbia (Canada). Dept. of Biological Sciences

1995-12-31T23:59:59.000Z

346

Process for removing naphthenic acids from petroleum distillates  

SciTech Connect (OSTI)

A liquid extraction process is described for removing naphthenic acids from naphthenic acid containing petroleum distillates boiling within the range of about 180/sup 0/-600/sup 0/C. and having an acid number of at least about 0.2 which process comprises the steps of: (a) intimately contacting the petroleum distillates with a solvent consisting essentially of methanol, water, and about from 2-20 wt. % ammonia and having a methanol: water ratio in the range of about from 0.2 to 3 parts by weight of methanol per part by weight of water and using an ammonia to petroleum distillate ratio of about 0.1-1 part by weight of ammonia per 100 parts by weight of the petroleum distillate. This selectively extracts the naphthenic acids into the solvent and yielding an immiscible two-phase liquid mixture, one of which is naphthenic acid-rich solvent phase and the other of which is a substantially napthenic acid-free petroleum distillate phase; and (b) separating and respectively recovering the naphtenic acid-rich solvent phase and petroleum distillate phase.

Danzik, M.

1987-01-06T23:59:59.000Z

347

Ursolic acid improves domoic acid-induced cognitive deficits in mice  

SciTech Connect (OSTI)

Our previous findings suggest that mitochondrial dysfunction is the mechanism underlying cognitive deficits induced by domoic acid (DA). Ursolic acid (UA), a natural triterpenoid compound, possesses many important biological functions. Evidence shows that UA can activate PI3K/Akt signaling and suppress Forkhead box protein O1 (FoxO1) activity. FoxO1 is an important regulator of mitochondrial function. Here we investigate whether FoxO1 is involved in the oxidative stress-induced mitochondrial dysfunction in DA-treated mice and whether UA inhibits DA-induced mitochondrial dysfunction and cognitive deficits through regulating the PI3K/Akt and FoxO1 signaling pathways. Our results showed that FoxO1 knockdown reversed the mitochondrial abnormalities and cognitive deficits induced by DA in mice through decreasing HO-1 expression. Mechanistically, FoxO1 activation was associated with oxidative stress-induced JNK activation and decrease of Akt phosphorylation. Moreover, UA attenuated the mitochondrial dysfunction and cognitive deficits through promoting Akt phosphorylation and FoxO1 nuclear exclusion in the hippocampus of DA-treated mice. LY294002, an inhibitor of PI3K/Akt signaling, significantly decreased Akt phosphorylation in the hippocampus of DA/UA mice, which weakened UA actions. These results suggest that UA could be recommended as a possible candidate for the prevention and therapy of cognitive deficits in excitotoxic brain disorders. - Highlights: • Ursolic acid (UA) is a naturally triterpenoid compound. • UA attenuated the mitochondrial dysfunction and cognitive deficits. • Mechanistically, UA activates PI3K/Akt signaling and suppresses FoxO1 activity. • UA could be recommended as a possible candidate for anti-excitotoxic brain disorders.

Wu, Dong-mei [School of Environment and Spatial Informatics, China University of Mining and Technology, Xuzhou 221008, Jiangsu Province (China); Key Laboratory for Biotechnology on Medicinal Plants of Jiangsu Province, School of Life Science, Xuzhou Normal University, Xuzhou 221116, Jiangsu Province (China); Lu, Jun, E-mail: lu-jun75@163.com [Key Laboratory for Biotechnology on Medicinal Plants of Jiangsu Province, School of Life Science, Xuzhou Normal University, Xuzhou 221116, Jiangsu Province (China); Zhang, Yan-qiu [School of Environment and Spatial Informatics, China University of Mining and Technology, Xuzhou 221008, Jiangsu Province (China); Zheng, Yuan-lin, E-mail: ylzheng@xznu.edu.cn [Key Laboratory for Biotechnology on Medicinal Plants of Jiangsu Province, School of Life Science, Xuzhou Normal University, Xuzhou 221116, Jiangsu Province (China); Hu, Bin [Key Laboratory for Biotechnology on Medicinal Plants of Jiangsu Province, School of Life Science, Xuzhou Normal University, Xuzhou 221116, Jiangsu Province (China); Cheng, Wei [School of Environment and Spatial Informatics, China University of Mining and Technology, Xuzhou 221008, Jiangsu Province (China); Zhang, Zi-feng; Li, Meng-qiu [Key Laboratory for Biotechnology on Medicinal Plants of Jiangsu Province, School of Life Science, Xuzhou Normal University, Xuzhou 221116, Jiangsu Province (China)

2013-09-01T23:59:59.000Z

348

An In-depth Investigation of an Aluminum Chloride Retarded Mud Acid System on Sandstone Reservoirs  

E-Print Network [OSTI]

Sandstone acidizing using mud acid is a quick and complex process where dissolution and precipitation occur simultaneously. Retarded mud acids are less reactive with the rock reducing the reaction rate hence increased penetration into the formation...

Aneto, Nnenna

2012-07-16T23:59:59.000Z

349

The Effect Of Viscoelastic Surfactants Used In Carbonate Matrix Acidizing On Wettability  

E-Print Network [OSTI]

Carbonate reservoirs are heterogeneous; therefore, proper acid placement/diversion is required to make matrix acid treatments effective. Viscoelastic surfactants (VES) are used as diverting agents in carbonate matrix acidizing. However...

Adejare, Oladapo

2012-07-16T23:59:59.000Z

350

E-Print Network 3.0 - acid-induced bile duct Sample Search Results  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

of Lithocholic Acid in the Regulation of Bile acid Detoxification, Synthesis... acid (LCA), a common ligand of VDR, FXR and PXR, on the regulation of proteins involved in bile...

351

E-Print Network 3.0 - acid sensor fxr Sample Search Results  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Role of Lithocholic Acid in the Regulation of Bile acid Detoxification, Summary: acid (LCA), a common ligand of VDR, FXR and PXR, on the regulation of proteins involved in bile...

352

E-Print Network 3.0 - acid base regulation Sample Search Results  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

12 Bio390 ACID-BASE thanks to Dr. J.F. Anderson, Summary: Bio390 ACID-BASE thanks to Dr. J.F. Anderson, Dept Zoology Univ of Florida, Gainesville... , there is more acid than base...

353

E-Print Network 3.0 - acids reduce body Sample Search Results  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

that is causing thialkalosis. Thus, the Pa... Bio390 ACID-BASE thanks to Dr. J.F. Anderson, Dept Zoology Univ of Florida, Gainesville... " "acid" ) log( "salt" "acid"...

354

E-Print Network 3.0 - acid sequence analysis Sample Search Results  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Acid Analysis Page 77 An Introduction to Amino Acid Analysis Summary: as a whole, and ISO 17025:2005 Technical competence in amino acid analysis and protein sequencing... An...

355

A novel method for the purification of prephenic acid  

E-Print Network [OSTI]

in the K ? of components eluting av with prephenate from G-10/NH4HC03 column. . III Elemental analysis of barium prephenate. . Page 22 28 30 is P rfi ti of p phe ic acid f ~oos o c essa. . . 35 LIST OF FIGURES Figure Prephenic acid Page... of the degree of cross-linking, type of gel and eluting solvent polarity on the separation of cis and trans-cin- namic acids. They found that the degree of cross-linking influences the degree of adsorption, as defined by K . The K for Sephadex 1 av av G-10...

Harding, Tammy Tiner

2012-06-07T23:59:59.000Z

356

Human retroviruses and AIDS 1996. A compilation and analysis of nucleic acid and amino acid sequences  

SciTech Connect (OSTI)

This compendium and the accompanying floppy diskettes are the result of an effort to compile and rapidly publish all relevant molecular data concerning the human immunodeficiency viruses (HIV) and related retroviruses. The scope of the compendium and database is best summarized by the five parts that it comprises: (1) Nuclear Acid Alignments and Sequences; (2) Amino Acid Alignments; (3) Analysis; (4) Related Sequences; and (5) Database Communications. Information within all the parts is updated throughout the year on the Web site, http://hiv-web.lanl.gov. While this publication could take the form of a review or sequence monograph, it is not so conceived. Instead, the literature from which the database is derived has simply been summarized and some elementary computational analyses have been performed upon the data. Interpretation and commentary have been avoided insofar as possible so that the reader can form his or her own judgments concerning the complex information. In addition to the general descriptions of the parts of the compendium, the user should read the individual introductions for each part.

Myers, G.; Foley, B.; Korber, B. [eds.] [Los Alamos National Lab., NM (United States). Theoretical Div.] [eds.; Los Alamos National Lab., NM (United States). Theoretical Div.; Mellors, J.W. [ed.] [Univ. of Pittsburgh, PA (United States)] [ed.; Univ. of Pittsburgh, PA (United States); Jeang, K.T. [ed.] [National Institutes of Health, Bethesda, MD (United States). Molecular Virology Section] [ed.; National Institutes of Health, Bethesda, MD (United States). Molecular Virology Section; Wain-Hobson, S. [Pasteur Inst., Paris (France)] [ed.] [Pasteur Inst., Paris (France); ed.

1997-04-01T23:59:59.000Z

357

Extraction of nitric acid, uranyl nitrate, and bismuth nitrate from aqueous nitric acid solutions with CMPO  

SciTech Connect (OSTI)

DOE sponsored development of the transuranium extraction (TRUEX) process for removing actinides from radioactive wastes. The solvent is a mixture of CMPO and TBP. Since the extraction characteristics of CMPO are not as well understood as those of TBP, the extraction of nitric acid, uranyl nitrate, and bismuth nitrate with CMPO (dissolved in n-dodecane) were studied. Results indicate that CMPO extracts nitric acid with a 1:1 stoichiometry; equilibrium constant is 2. 660{plus_minus}0.092 at 25 C, and extraction enthalpy is -5. 46{plus_minus}0.46 kcal/mol. Slope analysis indicates that uranyl nitrate extracts with a mixed equilibria of 1:1 and 2:1 stoichiometries in nearly equal proportion. Equil. constant of the 2: 1 extraction was 1.213 {times} 10{sup 6}{plus_minus}3.56 {times} 10{sup 4} at 25 C; reaction enthalpy was -9.610{plus_minus}0.594 kcal/mol. Nitration complexation constant is 8.412{plus_minus}0.579, with an enthalpy of -10.72{plus_minus}1.87 kcal/mol. Bismuth nitrate also extracts with a mixed equilibria of (perhaps) 1:1 and 2:1 stoichiometries. A 2:1 extraction equilibrium and a nitrate complexation adequately model the data. Kinetics and enthalpies were also measured.

Spencer, B.B.

1995-08-01T23:59:59.000Z

358

E-Print Network 3.0 - amino acid restriction Sample Search Results  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

of amino acid encoding to present amino acid sequences in the most beneficial way for machine learning... are calculated from position specific ... Source: Bodn, Mikael - School...

359

E-Print Network 3.0 - acid-metabolizing enzyme cytochrome Sample...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

on metabolic enzyme activities in the freshwater Summary: elegans. These include enzymes of carbohydrate, fatty acid, adenylate, and amino acid metabolism. Anoxia... recovery...

360

E-Print Network 3.0 - acid desaturase gene Sample Search Results  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

fatty acids. Mutagenesis and selection in E. coli yielded variants... . Cahoon EB, Shanklin J: Substrate-dependent mutant complementation to select fatty acid desaturase......

Note: This page contains sample records for the topic "acid dl dolomitic" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


361

E-Print Network 3.0 - acid suppresses uv-b-induced Sample Search...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

are discussed in relation to the Summary: in Chapter 3, carboxylic acids are the actual additives responsible for the suppression of catalase... excess of carboxylic acid in...

362

acid overcomes bcl-2-mediated: Topics by E-print Network  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

preservation A Rauramaa A Tommila J Ltd, Espoo Reseach Centre, PO Box 44, 02271 Espoo, Finland Formic acid is known to improve silage hygienic quality. Formic acid based...

363

E-Print Network 3.0 - acids electronic resource Sample Search...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

of Dicarboxylic Acid Clusters with Water Molecules Summary: Cluster Phase Chemistry: Gas-Phase Reactions of Anionic Sodium Salts of Dicarboxylic Acid Clusters... -phase...

364

E-Print Network 3.0 - acid electronic resource Sample Search...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

of Dicarboxylic Acid Clusters with Water Molecules Summary: Cluster Phase Chemistry: Gas-Phase Reactions of Anionic Sodium Salts of Dicarboxylic Acid Clusters... -phase...

365

E-Print Network 3.0 - acid derivative entrapped Sample Search...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

2003 ) Biodegradable hydrophilic polymers poly-lactic-co-glycolic acid (PLGA) and polyethylene oxide... -co-lactic acid (PELA) were used to encapsulate a small hydrophilic...

366

E-Print Network 3.0 - acid protects human Sample Search Results  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Introduction: Scope of the Thesis Ansar A. Khan Summary: , 155). The major products of LCA metabolism in human and rat liver microsomes are hyodeoxycholic acid... bile acids such...

367

E-Print Network 3.0 - acid dicamba dicloran Sample Search Results  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

weed control. Acetic acid (vinegar) WeedGrass Killer, Natural... weed control. Ammoniated soap of fatty acid Garden Safe Weed & Grass ... Source: Liskiewicz, Maciej -...

368

E-Print Network 3.0 - acid sequence determination Sample Search...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

by Scatchard analysis of 3 H nicotinic acid binding saturation isotherms. Relative cell surface... sequences from GPR109B. B, nicotinic acid- and ... Source: Hall, Randy A -...

369

E-Print Network 3.0 - amino acid-linked dialkyl Sample Search...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Amino acid may raise risk... tested blood for homocysteine, an amino acid known to mark heart ... Source: Portland State University, Center for Lakes and Reservoirs...

370

E-Print Network 3.0 - acid suppression predict Sample Search...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

the situation... the cloud condensation nucleus activity of organic acids on the basis of surface tension and osmolality... in the solutions of organic acids. The surface tension...

371

E-Print Network 3.0 - acid process effluent Sample Search Results  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

plant every few weeks, with the exception of fatty acid... characteristics of the wastewater effluent, the acidity of wastewater effluent was determined by...

372

E-Print Network 3.0 - acid pre hydrolysis Sample Search Results  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

at Madison Collection: Chemistry ; Biology and Medicine 9 Notes & Tips Mass spectrometric identification of pyroglutamic acid Summary: used for carboxylic acid ester- ification...

373

E-Print Network 3.0 - acid complex films Sample Search Results  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

doping acid during the formation of thin films. Both the electrical switching and electrochromic... and forms sulfuric acid within the PBZT film. The ... Source: Guo, John Zhanhu...

374

E-Print Network 3.0 - acid leach solutions Sample Search Results  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

acid produced by the decay fungi plays during leaching... acids. The soluble heavy metal complex can then be ... Source: Miha, Humar - Biotehnike fakultete, University of...

375

E-Print Network 3.0 - acid leaching present Sample Search Results  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

acid produced by the decay fungi plays during leaching... acids. The soluble heavy metal complex can then be leached from the wood. Thus, both the remediated wood... between...

376

E-Print Network 3.0 - ascorbic acid-related genes Sample Search...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

was to examine whether glutathione (GSH) and ascorbic acid, two reac- tive... groups: acrolein, acroleinGSH and acroleinascorbic acid. Re- sults: We found that while GSH resulted...

377

E-Print Network 3.0 - acid recruits beneficial Sample Search...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

was to examine whether glutathione (GSH) and ascorbic acid, two reac- tive... groups: acrolein, acroleinGSH and acroleinascorbic acid. Re- sults: We found that while GSH resulted...

378

E-Print Network 3.0 - acid brittleness Sample Search Results  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

search results for: acid brittleness Page: << < 1 2 3 4 5 > >> 1 Acid Fumigation of Sediment Samples (From UC Davis Isotope Lab website, http:stableisotopefacility.ucdavis.edu...

379

E-Print Network 3.0 - acid bilayers observed Sample Search Results  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

of Docosahexaenoic Acid-Containing Phospholipid Bilayers as Studied by 2H NMR... of vinyl perdeuterated arachidonic acid chains in bilayers of 1-palmitoyl-2-vinylperdeuterioara...

380

E-Print Network 3.0 - abscisic acid sensitivity Sample Search...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

altered sensitivity of growth responses to abscisic acid, auxin, gibberellins and ethylene... plant stress hormones - abscisic acid and ethylene - in opposite ways. Recent...

Note: This page contains sample records for the topic "acid dl dolomitic" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


381

E-Print Network 3.0 - acid oligomerisation manipulating Sample...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

of oxidising proteins or lipids and causing chemi- cal modication to nucleic acids (Gilbert... . The sec- ondary structure is mapped onto the amino acid sequence in Figure 3...

382

E-Print Network 3.0 - adding zoledronic acid Sample Search Results  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Cancer Receiving... cancer is well recognized. We assessed the effects of quarterly infusion of zoledronic acid on bone... to treatment with zoledronic acid (4 mg) ... Source:...

383

E-Print Network 3.0 - administering zoledronic acid Sample Search...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Cancer Receiving... cancer is well recognized. We assessed the effects of quarterly infusion of zoledronic acid on bone... to treatment with zoledronic acid (4 mg) ... Source:...

384

E-Print Network 3.0 - acids cells humans Sample Search Results  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

the stomach... the effects of PPI action on acid levels 36. Our original gastric acid secretion model tracks four cell... popula- tions in the stomach considered critical for...

385

E-Print Network 3.0 - acid rain effects Sample Search Results  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

of Mexican Mayan monuments. Ingenieria... eroding because of acid rain. Just as water dis- solves an Alka-Seltzer tablet, acid rain erodes... Autonomous University of...

386

E-Print Network 3.0 - acid induced chemical Sample Search Results  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

levulinic acid. Proceeding... chemicals: kinetic study on the decomposition of 5-hydroxymethylfurfural into levulinic acid. Proceeding... ., Green chemicals: A kinetic study on the...

387

E-Print Network 3.0 - acid reactivity reaction Sample Search...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

; Biology and Medicine 42 A Kinetic Study on the Decomposition of 5-Hydroxymethylfurfural into Summary: -soluble products Levulinic acid + Formic acid Figure 3.1...

388

E-Print Network 3.0 - acid allied chemical Sample Search Results  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

levulinic acid. Proceeding... chemicals: kinetic study on the decomposition of 5-hydroxymethylfurfural into levulinic acid. Proceeding... ., Green chemicals: A kinetic study on the...

389

E-Print Network 3.0 - acid-soluble organic matrix Sample Search...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Environmental Sciences and Ecology 38 A Kinetic Study on the Decomposition of 5-Hydroxymethylfurfural into Summary: - methylfurfural Acid-soluble products Levulinic acid + Formic...

390

E-Print Network 3.0 - acid dha implications Sample Search Results  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

this effect remain uncertain. In general... to phosphocholine). The actions of DHA aere reproduced by eicosapentaenoic acid, another omega-3 compound... acid (DHA), a uridine...

391

Adsorption of (poly)maleic acid and aquatic fulvic accids by goethite.  

E-Print Network [OSTI]

?? The adsorption characteristics of a synthetic organic polymer - polymaleic acid (PMA) and Suwannee River fulvic acid (SRFA) by goethite was studied. The adsorption… (more)

Wang, Lili

1996-01-01T23:59:59.000Z

392

Reaction kinetics of the esterification reaction between ethanol and acetic acid catalyzed by Keggin heteropolyacids  

Science Journals Connector (OSTI)

Heteropolyacids (HPAs), such as silicotungstic (HSiW), phosphotungstic (HPW), and phosphomolybdic (HPMo) acids, effectively catalyzed the esterification reaction between ethanol and acetic acid. The catalytic act...

Xiufeng Lu; Hengbo Yin; Lingqin Shen…

2014-02-01T23:59:59.000Z

393

E-Print Network 3.0 - amino acid polymorphisms Sample Search...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Summary: by ascertainment bias. Contrasting Divergence and Polymorphism for the 75 Elementary Amino Acid Changes... . The potential biases toward collecting com- mon amino acid...

394

E-Print Network 3.0 - acid copper sulfate Sample Search Results  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

with chalcopyrite. 5239Cu isotopes in the supergene environment 12;with the copper isotope variation of acid-sulfate... bonding in the Cu mineral during acid- sulfate leaching...

395

E-Print Network 3.0 - adipocyte fatty acid-binding Sample Search...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Biochemistry 221: 127132, 2001. 2001 Kluwer Academic Publishers. Printed in the Netherlands. Summary: acid, gene regulation Introduction Fatty acid-binding proteins (FABPs)...

396

E-Print Network 3.0 - amino acid transport systems Sample Search...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

chain (aerobic pathway) Glyceraldehyde phosphate 1 Pyruvic acid Figure 24.7 NAD+ CO2 NADH... A Pyruvic acid from glycolysis Glycolysis Electron ... Source: Morrell, Thomas...

397

E-Print Network 3.0 - antiinflammatory 2-arylpropionic acids...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

2-arylpropionic acids Search Powered by Explorit Topic List Advanced Search Sample search results for: antiinflammatory 2-arylpropionic acids Page: << < 1 2 3 4 5 > >> 1 Efficient,...

398

E-Print Network 3.0 - anthranilic acid derivatives Sample Search...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

This acid has been used... -specific nucleic acid ligands via affinity ... Source: Beal, Peter A. - Department of Chemistry, University of Utah Collection: Chemistry 26 Direct...

399

E-Print Network 3.0 - acid dibutyl ester Sample Search Results  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

(D002) identifies wastes that are acidic or alkaline (basic... containers for corrosive waste or glass containers for waste containing hydrofluoric acid. For liquid waste......

400

E-Print Network 3.0 - acid phenylethyl ester Sample Search Results  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

(D002) identifies wastes that are acidic or alkaline (basic... containers for corrosive waste or glass containers for waste containing hydrofluoric acid. For liquid waste......

Note: This page contains sample records for the topic "acid dl dolomitic" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


401

Martinez Sulfuric Acid Regeneration Plt Biomass Facility | Open Energy  

Open Energy Info (EERE)

Martinez Sulfuric Acid Regeneration Plt Biomass Facility Martinez Sulfuric Acid Regeneration Plt Biomass Facility Jump to: navigation, search Name Martinez Sulfuric Acid Regeneration Plt Biomass Facility Facility Martinez Sulfuric Acid Regeneration Plt Sector Biomass Facility Type Non-Fossil Waste Location Contra Costa County, California Coordinates 37.8534093°, -121.9017954° Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"ROADMAP","zoom":14,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"350px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":37.8534093,"lon":-121.9017954,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}

402

Definition: Lead-acid battery | Open Energy Information  

Open Energy Info (EERE)

Definition Definition Edit with form History Facebook icon Twitter icon » Definition: Lead-acid battery Jump to: navigation, search Dictionary.png Lead-acid battery A type of battery that uses plates made of pure lead or lead oxide for the electrodes and sulfuric acid for the electrolyte.[1] View on Wikipedia Wikipedia Definition Related Terms Battery, electrolyte References ↑ http://www1.eere.energy.gov/solar/solar_glossary.html Retr LikeLike UnlikeLike You like this.Sign Up to see what your friends like. ieved from "http://en.openei.org/w/index.php?title=Definition:Lead-acid_battery&oldid=487934" Category: Definitions What links here Related changes Special pages Printable version Permanent link Browse properties 429 Throttled (bot load) Error 429 Throttled (bot load)

403

The Role of Acidizing in Proppant Fracturing in Carbonate Reservoirs  

E-Print Network [OSTI]

of the most widely considered alternatives for application in carbonate reservoirs. Especially in areas that have high closure stress, the non-smoothly etched surface created by acid fracturing may not remain open upon closing, resulting in decrease...

Densirimongkol, Jurairat

2010-10-12T23:59:59.000Z

404

Design, set up, and testing of a matrix acidizing apparatus  

E-Print Network [OSTI]

Well stimulation techniques are applied on a regular basis to enhance productivity and maximize recovery in oil and gas wells. Among these techniques, matrix acidizing is probably the most widely performed job because of its relative low cost...

Nevito Gomez, Javier

2006-10-30T23:59:59.000Z

405

Laboratory-scale fracture conductivity created by acid etching  

E-Print Network [OSTI]

Success of acid fracturing treatment depends greatly on the created conductivity under closure stress. In order to have sufficient conductivity, the fracture face must be non-uniformly etched while the fracture strength maintained to withstand...

Pournik, Maysam

2009-05-15T23:59:59.000Z

406

Effect of leavening acids on wheat flour tortillas  

E-Print Network [OSTI]

Reactivities of four leavening adds were evaluated during processing of wheat flour tortillas. These were: sodium aluminum phosphate (SAlP), sodium aluminum sulfate (SAS), monocalcium phosphate (MCP) and sodium acid pyrophosphate (SAPP-28). Each...

Cepeda, Minerva

2012-06-07T23:59:59.000Z

407

Alternative Non-Acid Eluants for Spherical Resorcinol-Formaldehyde  

SciTech Connect (OSTI)

Small-column ion exchange (SCIX) units installed in or near high-level waste tanks to remove Cs-137 from highly alkaline solutions are among the waste treatment plans in the DOE Complex. Spherical Resorcinol-Formaldehyde (sRF) is the ion exchange (IX) resin under consideration for SCIX at the Hanford site. The elution step of the multi-step IX process is typically done with nitric acid. An acid eluant is a potential hazard in the event of a spill, leak, etc. because the waste tanks are made of carbon steel. Corrosion and associated structural damage may ensue. A non-acid eluant may be a viable alternative. It will eliminate the need for special acid handling requirements within the tank farms.

Adu-Wusu, Kofi

2010-11-01T23:59:59.000Z

408

Isolated menthone reductase and nucleic acid molecules encoding same  

DOE Patents [OSTI]

The present invention provides isolated menthone reductase proteins, isolated nucleic acid molecules encoding menthone reductase proteins, methods for expressing and isolating menthone reductase proteins, and transgenic plants expressing elevated levels of menthone reductase protein.

Croteau, Rodney B; Davis, Edward M; Ringer, Kerry L

2013-04-23T23:59:59.000Z

409

Characterization of polystyrene-block-poly (acrylic acid) micelles  

E-Print Network [OSTI]

Several parameters that affect the formation, size and spatial distribution of micelles of poly(styrene-block-acrylic acid) (PS-b-PAA) in organic solvents or assembled on solid substrates have been investigated. The micelles ...

Kohen, Naomi (Naomi T.)

2005-01-01T23:59:59.000Z

410

Critical loads of acid deposition on Scottish soils  

Science Journals Connector (OSTI)

The impact of acid deposition, attributable to sulphur and nitrogen pollutants, on the soils of Scotland has been analysed using a critical loads approach. The critical load of a soil (as an indicator of ecolo...

Simon J. Langan; M. J. Wilson

1994-05-01T23:59:59.000Z

411

Effects of conjugated linoleic acid on cholesterol metabolism in swine  

E-Print Network [OSTI]

induced in cholesterol was an increase, though not statistically significant, in the LDL-cholesterol/HDL-cholesterol. Analysis of fatty acids demonstrated incorporation of CLA into plasma of those animals receiving it in their diet. Also...

Koteras, Theresa Ann

2012-06-07T23:59:59.000Z

412

Thermal runaway of valve-regulated lead-acid batteries  

Science Journals Connector (OSTI)

Valve-regulated lead-acid (VRLA) batteries that have aged on a float charge at constant voltage occasionally suffer from thermal runaway. Operating conditions for a VRLA battery have been simulated by changing th...

Junmei Hu; Yonglang Guo; Xuechou Zhou

2006-10-01T23:59:59.000Z

413

Angler exposure to domoic acid via consumption of contaminated fishes  

E-Print Network [OSTI]

Bay and San Francisco Bay seafood con- Mazzillo et al. :of domoic acid in unsalted seafood. J AOAC Int 78: RecFIN (2000) San Francisco Bay Seafood Consumption Study. SFEI,

Pomeroy, Caroline

2010-01-01T23:59:59.000Z

414

Lower-Cost Processes Developed for Phosphoric Acid Production  

Science Journals Connector (OSTI)

Two new processes for the production of phosphoric acid have been developed and are ready for commercialization. ... One is the BESA-2 process, developed by Bohna Engineering & Research, San Francisco; the other is Occidental Research Corp.'s KPA process. ...

JOSEPH HAGGIN

1985-10-21T23:59:59.000Z

415

300 Area waste acid treatment system closure plan. Revision 1  

SciTech Connect (OSTI)

This section provides a description of the Hanford Site, identifies the proposed method of 300 Area Waste Acid Treatment System (WATS) closure, and briefly summarizes the contents of each chapter of this plan.

NONE

1996-03-01T23:59:59.000Z

416

Acid soil fertility at the Cinzana station, Mali, West Africa  

E-Print Network [OSTI]

that may be associated with acid soil infertility include biological organisms (nematodes, termites), restrictive subsoil layers (claypans, ironpans, silt pans, plow pans, etc. ), soil erosion, zones of low soil moisture retention, and other physical...

Doumbia, Mamadou Diosse

1990-01-01T23:59:59.000Z

417

Competitive Adsorption of Arsenite and Silicic Acid on Goethite.  

E-Print Network [OSTI]

??The adsorption behavior of silicic acid and arsenite alone and competitively on goethite over a broad pH range (3-11) at environmentally relevant concentrations was investigated… (more)

Luxton, Todd Peter

2003-01-01T23:59:59.000Z

418

Improvement of D-glucaric acid production in Escherichia coli  

E-Print Network [OSTI]

D-glucaric acid is a naturally occurring compound which has been explored for a plethora of potential uses, including biopolymer production, cancer and diabetes treatment, cholesterol reduction, and as a replacement for ...

Shiue, Eric Chun-Jen

2014-01-01T23:59:59.000Z

419

JGI - Why Sequence Euryarchaeota in Acid Mine Drainage?  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Euryarchaeota in Acid Mine Drainage? Euryarchaeota in Acid Mine Drainage? Acid mine drainage (AMD) is a major worldwide environmental problem associated with the mining of energy resources (coal and uranium) and metals (eg., iron and copper), thus of direct DOE relevance. The processes that underpin AMD formation can be harnessed for bioleaching and bioremediation. Many scientific and industrial groups are studying various aspects of the biogeochemistry of AMD generation. Random shotgun sequencing of an extremely acidic (pH <0.9) chemolithotrophic subsurface AMD biofilm community (from the Richmond Mine in Iron Mountain, California) recovered a genome fragment from a novel euryarchaeon, named WTF-1. This novel lineage was previously missed by common broad-specificity primers used for PCR-based surveys. Further study

420

Materials and methods for efficient lactic acid production  

DOE Patents [OSTI]

The present invention provides derivatives of ethanologenic Escherichia coli K011 constructed for the production of lactic acid. The transformed E. coli of the invention are prepared by deleting the genes that encode competing pathways followed by a growth-based selection for mutants with improved performance. These transformed E. coli are useful for providing an increased supply of lactic acid for use in food and industrial applications.

Zhou, Shengde (Sycamore, IL); Ingram, Lonnie O'Neal (Gainesville, FL); Shanmugam, Keelnatham T. (Gainesville, FL); Yomano, Lorraine (Gainesville, FL); Grabar, Tammy B. (Gainesville, FL); Moore, Jonathan C. (Gainesville, FL)

2009-12-08T23:59:59.000Z

Note: This page contains sample records for the topic "acid dl dolomitic" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


421

Modification of the fatty acid composition of bovine tissues  

E-Print Network [OSTI]

MODIFICATION OF THE FATTY ACID COMPOSITION OF BOVINE TISSUES A Thesis by JOYCE CHANG Submitted to the Office of Graduate Studies of Texas A&M University in partial fulfillment of the requirements for the degree of MASTER OF SCIENCE August... 1990 Major Subject: Nutrition MODIFICATION OF THE FATTY ACID COMPOSITION OF BOVINE TISSUES A Thesis by JOYCE CHANG Approved as to style and content by: Stephen B. Smith (Chair of Committee) Barbara O' Brien (Member) aren S. Kubena (Member...

Chang, Joyce

2012-06-07T23:59:59.000Z

422

Non-essential amino acid metabolism in rats  

E-Print Network [OSTI]

NON-ESSENTIAL AMINO ACID METABOLISM IN RATS A Thesis by JAMES DARRELL CROOKS, JR. Submitted to the Graduate College of Texas A&M University in partial fulfillment of the requirement for the degree of MASTER OF SCIENCE May 1971 Major Subject...: Animal Nutrition O 4 0 E ? NON ESSENTIAL AMINO ACID METABOLISM IN RATS A Thesis by JAMES DARRELL CROOKS& JR. Approved as to style and content by: (Chairman of Committee) (Member) (Head of Department) (Member) May 197 1 ABSTRACT Non...

Crooks, James Darrell

2012-06-07T23:59:59.000Z

423

Materials and methods for efficient lactic acid production  

DOE Patents [OSTI]

The present invention provides derivatives of Escherichia coli constructed for the production of lactic acid. The transformed E. coli of the invention are prepared by deleting the genes that encode competing pathways followed by a growth-based selection for mutants with improved performance. These transformed E. coli are useful for providing an increased supply of lactic acid for use in food and industrial applications.

Zhou, Shengde; Ingram, Lonnie O'Neal; Shanmugam, Keelnatham T; Yomano, Lorraine; Grabar, Tammy B; Moore, Jonathan C

2013-04-23T23:59:59.000Z

424

Relation of Soil Acidity to Cotton Root Rot.  

E-Print Network [OSTI]

R79-437-6m TEXAS AGRICULTURAL EXPERIMENT STATION A. 13. CONNER, DIRECTOR COLLEGE STATION, BllAZOS COUNTY, TEXAS LLETIN NO. 545 JUNE, 1937 DIVISION OF PLANT PATHOLOGY AND PHYSIOLOGY AND DIVISION OF CHEMISTRY RELATION OF SOIL ACIDITY... at various depths in small plats Sulphur applied at small rates to surface soil, in plats i? which root rot was well established Discussion Summary Literature cited BULLETIN NO. 545 JUNE, 1937 RELATION OF SOIL ACIDITY TO COTTON ROOT ROT By J. J...

Taubenhaus, J. J. (Jacob Joseph); Ezekiel, Walter N. (Walter Naphtali); Fudge, J. F. (Joseph Franklin)

1937-01-01T23:59:59.000Z

425

Preparation of thio and seleno sugar esters of dimethylantimonous acid  

E-Print Network [OSTI]

arsenic in the periodic table and an extension of the work done with arsenic and phosphorus to include the antimony analogues presents a logical extension of this effort. 12 Sagan, et al. , have prepared eaters of dialkyl- arsinous acids using... in the preparation of the phosphorus analogues of the sugar arsenites. The synthesis of dialkylphosphinous acid eaters of the thio and seleno sugars was effected via the reaction of symmetrical tetraalkyldiphosphines with bis(2, 3, 4, 6 ? tetra-0-acetyl...

Baimbridge, Charles Lynn

2012-06-07T23:59:59.000Z

426

A chemical investigation of amino acid transport in Neurospora crassa  

E-Print Network [OSTI]

May 1977 Major Subject: Chemistry A CHEMICAL INVESTIGATION OF AMINO ACID TRANSPORT IN NEUROSPORA CRASSA A Thesis MARY WATSON CAENO Approved as to style and content by: (Chairman of Committee) (M r (Head of Department) Member (Member) ( ber...) May 1977 ABSTRACT A Chemical Investigation of Amino Acid Transport in Neurosoora Crassa (Yiay 1977) Nary Watson Carrano, B. S. , Southeastern Louisiana University Chairman of Advisory Committee Dr George I Glover At p td tl t t f~p t p t t lack...

Carrano, Mary Watson

2012-06-07T23:59:59.000Z

427

Ionic Ckonductivity and Glass Transition of Phosphoric Acids  

SciTech Connect (OSTI)

Here we report the low-temperature dielectric and viscoelastic properties of phosphoric acids in the range of H2O:P2O5 1.5 5. Both dielectric and viscosity measurements allow us to determine the glass-transition temperatures of phosphoric acids. The obtained glass-transition temperatures are in good agreement with previous differential scanning calorimetric measurements. Moreover, our analysis reveals moderate decoupling of ionic conductivity from structural relaxation in the vicinity of the glass transition.

Wang, Yangyang [ORNL; Lane, Nathan A [ORNL; Sun, Che-Nan [Oak Ridge National Laboratory (ORNL); Fan, Fei [ORNL; Zawodzinski, Thomas [University of Tennessee, Knoxville (UTK); Sokolov, Alexei P [ORNL

2013-01-01T23:59:59.000Z

428

Ionic conductivity and glass transition of phosphoric acids  

SciTech Connect (OSTI)

Here we report the low-temperature dielectric and viscoelastic properties of phosphoric acids in the range of H2O:P2O5 1.5 5. Both dielectric and viscosity measurements allow us to determine the glass-transition temperatures of phosphoric acids. The obtained glass-transition temperatures are in good agreement with previous differential scanning calorimetric measurements. Moreover, our analysis reveals moderate decoupling of ionic conductivity from structural relaxation in the vicinity of the glass transition.

Wang, Yangyang [Oak Ridge National Laboratory (ORNL)] [Oak Ridge National Laboratory (ORNL); Lane, Nathan A [ORNL] [ORNL; Sun, Che-Nan [Oak Ridge National Laboratory (ORNL)] [Oak Ridge National Laboratory (ORNL); Fan, Fei [ORNL] [ORNL; Zawodzinski, Thomas [University of Tennessee, Knoxville (UTK)] [University of Tennessee, Knoxville (UTK); Sokolov, Alexei P [ORNL] [ORNL

2013-01-01T23:59:59.000Z

429

Fatty acid-binding protein in bovine skeletal muscle  

E-Print Network [OSTI]

FATTY ACID-BINDING PROTEIN IN BOVINE SKELETAL MUSCLE A Thesis by KIMBERLY KIRBY MOORE Submitted to the Office of Graduate Studies of Texas A&M University in partial fulfillment of the requirements for the degree of MASTER OF SCIENCE... December 1989 Major Subject: Nutrition FATTY ACID-BINDING PROTEIN IN BOVINE SKELETAL MUSCLE A Thesis by KIMBERLY KIRBY MOORE Approved as to style and content by: Ste en B. Smith (Chair of Committee) Karen S. Kubena (Member) Gary C. Smith (Head...

Moore, Kimberly Kirby

2012-06-07T23:59:59.000Z

430

Characterization and purification of juvenile hormone acid methyltransferase  

E-Print Network [OSTI]

CHARACTERIZATION AND PURIFICATION OF JUVENILE HORMONE ACID METHYLTRANSFERASE A Thesis by KENNETH ELDEN PECK Submitted to the Office of Graduate Studies of Texas A&M University in partial fulfillment of the requirements for the degree... of MASTER OF SCIENCE December 1989 Major Subject: Biology CHARACTERIZATION AND PURIFICATION OF JUVENILE HORMONE ACID METHYLTRANSFERASE A Thesis by Kenneth Elden Peck Approve as to the style and content by: Karl H. Dahm (Chair of Committee...

Peck, Kenneth Elden

1989-01-01T23:59:59.000Z

431

Carbobenzoxy amino acids: Structural requirements for cholecystokinin receptor antagonist activity  

SciTech Connect (OSTI)

The authors used dispersed acini prepared from guinea pig pancreas to examine 28 carbobenzoxy (CBZ) amino acids for their abilities to function as cholecystokinin receptor antagonists. All amino acid derivatives tested, except for CBZ-alanine, CBZ-glycine, and N alpha-CBZ- lysine, were able to inhibit the stimulation of amylase secretion caused by the C-terminal octapeptide of cholecystokinin. In general, there was a good correlation between the ability of a carbobenzoxy amino acid to inhibit stimulated amylase secretion and the ability of the amino acid derivative to inhibit binding of /sup 125/I-cholecystokinin. The inhibition of cholecystokinin-stimulated amylase secretion was competitive, fully reversible, and specific for those secretagogues that interact with the cholecystokinin receptor. The potencies with which the various carbobenzoxy amino acids inhibited the action of cholecystokinin varied 100-fold and CBZ-cystine was the most potent cholecystokinin receptor antagonist. This variation in potency was primarily but not exclusively a function of the hydrophobicity of the amino acid side chain.

Maton, P.N.; Sutliff, V.E.; Jensen, R.T.; Gardner, J.D.

1985-04-01T23:59:59.000Z

432

Effects of charge-carrying amino acids on the gelatinization and retrogradation properties of potato starch  

Science Journals Connector (OSTI)

Abstract The objective of this study was to evaluate the effects of charge-carrying amino acids (lysine (Lys), arginine (Arg), aspartic acid (Asp) and glutamic acid (Glu)) on the gelatinization and retrogradation properties of potato starch. Acidic amino acids (Asp and Glu) showed a decreasing trend in swelling power and granule size of potato starch, but increased amylose leaching and gelatinization temperature. Alkaline amino acid (Arg) showed an increasing trend in swelling power and granule size of potato starch, but decreasing amylose leaching and gelatinization temperature. Lys had no effect on the swelling power of potato starch, except at a high content (0.2 mol/kg). Like other two acidic amino acids, Lys also increased gelatinization temperature. Moreover, the addition of alkaline amino acids (Arg) decreased syneresis value of potato starch but acidic amino acids (Asp and Glu) increased it. Compared to Arg, the syneresis of potato starch with Lys was similar to that of its native starch.

Wenting Chen; Hongxian Zhou; Hong Yang; Min Cui

2015-01-01T23:59:59.000Z

433

Carrier-mediated transport of monocarboxylic acids in BeWo cell monolayers as a model of the human trophoblast  

E-Print Network [OSTI]

The monolayer-forming, human choriocarcinoma cell line, BeWo, was used to study the mechanisms of monocarboxylic acid transport across the human trophoblast. Benzoic acid, acetic acid, and lactic acid were used as markers ...

Utoguchi, Naoki; Magnusson, Malin; Audus, Kenneth L.

1999-01-01T23:59:59.000Z

434

Hydroxycinnamic Acids Used as External Acceptors of Electrons: an Energetic Advantage for Strictly Heterofermentative Lactic Acid Bacteria  

Science Journals Connector (OSTI)

...investigated as a potential alternative energy route. Lactobacillus curvatus PE5 was...the reduced cofactor NADH, providing an energy advantage through NAD+ regeneration...lactic acid bacteria, which have lower energy yields than bacteria with a homofermentative...

Pasquale Filannino; Marco Gobbetti; Maria De Angelis; Raffaella Di Cagno

2014-09-26T23:59:59.000Z

435

Synthesis and Self-Assembly Behavior of Poly(acrylic Acid)-b-Poly(l-Amino Acid) System  

E-Print Network [OSTI]

The talk will present the synthesis and characterization of a new class of hybrid amphiphilic system between an electrolyte polyacrylic acid (PAA) synthetic segment, and a hydrophobic beta-sheet forming peptide segment, ...

Sinaga, Akasta

436

Abstract In plants, changes in the levels of oleic acid (18:1), a major monounsaturated fatty acid (FA),  

E-Print Network [OSTI]

2@uky.edu J. Shanklin Á E. Whittle Department of Biology, Brookhaven National Laboratory, Upton, NY isoforms to oleic acid synthesis Aardra Kachroo � John Shanklin � Edward Whittle � Ludmila Lapchyk � David

Kachroo, Pradeep

437

The Effect of Acid Additives on Carbonate Rock Wettability and Spent Acid Recovery in Low Permeability Gas Carbonates  

E-Print Network [OSTI]

Spent acid retention in the near-wellbore region causes reduction of relative permeability to gas and eventually curtailed gas production. In low-permeability gas carbonate reservoirs, capillary forces are the key parameters that affect the trapping...

Saneifar, Mehrnoosh

2012-10-19T23:59:59.000Z

438

EFFECT OF BILE ACID FEEDING AND SEQUESTRATION ON LIVER BILE ACID COMPOSITION AND GENE REGULATION IN MICE  

E-Print Network [OSTI]

The dissertation investigates the non-hepatotoxic doses of five bile acids (BAs) in the feed of mice, as well as adaptations in the expression of genes involved in BA homeostasis and the possible roles of FXR-mediated ...

Song, Peizhen

2010-12-16T23:59:59.000Z

439

Safety Slide 1 Hydrofluoric (HF) Acid Hazards http://www.emsworld.com/web/online/Education/Hydrofluoric-Acid-/5$12949  

E-Print Network [OSTI]

Safety Slide 1 ­ Hydrofluoric (HF) Acid Hazards http://www.emsworld.com/web may be delayed for up to 24 hours, even with dilute solutions. HF burns affect deep tissue layers

Cohen, Robert E.

440

Effects of dietary eicosapentaenoic acid and docosahexaenoic acid on mouse T-lymphocyte function and diglyceride formation  

E-Print Network [OSTI]

. Edwards (Interim Department Head) December 1992 ABSTRACT Effects of Dietary Eicosapentaenoic Acid and Docosahexaenoic Acid on Mouse T-Lymphocyte Function and Diglyceride Formation. (December 1992) Kara Hosack Fowler, B. S. , Texas A&%M University..., coupled to CD3, a mediator which acts in stimulation to bind to phospholipase C (PLC) (10). Mitogens act on the TCR-CD3 complex to stimulate phospholipase C and hydrolysis of phosphatidylinositol (100). This results in diacylglycerol (DAG) and inositol...

Fowler, Kara Hosack

1992-01-01T23:59:59.000Z

Note: This page contains sample records for the topic "acid dl dolomitic" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


441

Comparative Genomics of Regulation of Fatty Acid and Branched-chain Amino Acid Utilization in Proteobacteria  

SciTech Connect (OSTI)

Bacteria can use branched-chain amino acids (ILV, i.e. isoleucine, leucine, valine) and fatty acids (FA) as sole carbon and energy sources convering ILV into acetyl-CoA, propanoyl-CoA and propionyl-CoA, respectively. In this work, we used the comparative genomic approach to identify candidate transcriptional factors and DNA motifs that control ILV and FA utilization pathways in proteobacteria. The metabolic regulons were characterized based on the identification and comparison of candidate transcription factor binding sites in groups of phylogenetically related genomes. The reconstructed ILV/FA regulatory network demonstrates considerable variability and involves six transcriptional factors from the MerR, TetR and GntR families binding to eleven distinct DNA motifs. The ILV degradation genes in gamma- and beta-proteobacteria are mainly regulated by anovel regulator from the MerR family (e.g., LiuR in Pseudomonas aeruginosa) (40 species), in addition, the TetR-type regulator LiuQ was identified in some beta-proteobacteria (8 species). Besides the core set of ILV utilization genes, the LiuR regulon in some lineages is expanded to include genes from other metabolic pathways, such as the glyoxylate shunt and glutamate synthase in the Shewanella species. The FA degradation genes are controlled by four regulators including FadR in gamma-proteobacteria (34 species), PsrA in gamma- and beta-proteobacteria (45 species), FadP in beta-proteobacteria (14 species), and LiuR orthologs in alpha-proteobacteria (22 species). The remarkable variability of the regulatory systems associated with the FA degradation pathway is discussed from the functional and evolutionary points of view.

Kazakov, Alexey E.; Rodionov, Dmitry A.; Arkin, Adam Paul; Dubchak, Inna; Gelfand, Mikhail S.; Alm, Eric

2008-10-31T23:59:59.000Z

442

Tetrazole acetic acid: Tautomers, conformers, and isomerization  

SciTech Connect (OSTI)

Monomers of (tetrazol-5-yl)-acetic acid (TAA) were obtained by sublimation of the crystalline compound and the resulting vapors were isolated in cryogenic nitrogen matrices at 13 K. The conformational and tautomeric composition of TAA in the matrix was characterized by infrared spectroscopy and vibrational calculations carried out at the B3LYP/6-311++G(d,p) level. TAA may adopt two tautomeric modifications, 1H- and 2H-, depending on the position of the annular hydrogen atom. Two-dimensional potential energy surfaces (PESs) of TAA were theoretically calculated at the MP2/6-311++G(d,p) level, for each tautomer. Four and six symmetry-unique minima were located on these PESs, for 1H- and 2H-TAA, respectively. The energetics of the detected minima was subsequently refined by calculations at the QCISD level. Two 1H- and three 2H-conformers fall within the 0–8 kJ mol{sup ?1} energy range and should be appreciably populated at the sublimation temperature (?330 K). Observation of only one conformer for each tautomer (1ccc and 2pcc) is explained in terms of calculated barriers to conformational rearrangements. All conformers with the cis O=COH moiety are separated by low barriers (less than 10 kJ mol{sup ?1}) and collapse to the most stable 1ccc (1H-) and 2pcc (2H-) forms during deposition of the matrix. On the trans O=COH surfaces, the relative energies are very high (between 12 and 27 kJ mol{sup ?1}). The trans forms are not thermally populated at the sublimation conditions and were not detected in matrices. One high-energy form in each tautomer, 1cct (1H-) and 2pct (2H-), was found to differ from the most stable form only by rotation of the OH group and separated from other forms by high barriers. This opened a perspective for their stabilization in a matrix. 1cct and 2pct were generated in the matrices selectively by means of narrow-band near-infrared (NIR) irradiations of the samples at 6920 and 6937 cm{sup ?1}, where the first OH stretching overtone vibrations of 1ccc and 2pcc occur. The reverse transformations could be induced by irradiations at 7010 and 7030 cm{sup ?1}, transforming 1cct and 2pct back to 1ccc and 2pcc, also selectively. Besides the NIR-induced transformations, the photogenerated 1cct and 2pct forms also decay in N{sub 2} matrices back to 1ccc and 2pcc spontaneously, with characteristic decay times of hours (1H) and tens of minutes (2H). The decay mechanism is rationalized in terms of the proton tunneling. In crystals, TAA exists exclusively as 1H-tautomer. By contrast, the tautomeric composition of the matrix-isolated monomers was found to consist of both 1H- and 2H-tautomers, in comparable amounts. A mechanistic discussion of the tautomerization process occurring during sublimation, accounting also for the observed minor decomposition of TAA leading to CO{sub 2} and 5-methyl-tetrazole, is proposed.

Araujo-Andrade, C. [Unidad Académica de Física de la Universidad Autónoma de Zacatecas, Zacatecas (Mexico) [Unidad Académica de Física de la Universidad Autónoma de Zacatecas, Zacatecas (Mexico); Department of Chemistry, University of Coimbra, 3004-535 Coimbra (Portugal); Reva, I., E-mail: reva@qui.uc.pt; Fausto, R. [Department of Chemistry, University of Coimbra, 3004-535 Coimbra (Portugal)] [Department of Chemistry, University of Coimbra, 3004-535 Coimbra (Portugal)

2014-02-14T23:59:59.000Z

443

Two-dimensional hydrogen-bonded polymers in the crystal structures of the ammonium salts of phen­oxy­acetic acid, (4-fluoro­phen­oxy)acetic acid and (4-chloro-2-methyl­phen­oxy)acetic acid  

Science Journals Connector (OSTI)

The crystal of the isomorphous anhydrous ammonium salts of phen­oxy­acetic acid and (4-fluoro­phen­oxy)acetic acid and that of the hemihydrate ammonium salt of 4-chloro-2-methyl­phen­oxy)acetic acid show two-dimensional layered structures based on conjoined cyclic hydrogen-bonded motifs.

Smith, G.

2014-11-19T23:59:59.000Z

444

E-Print Network 3.0 - acid adenylating enzymes Sample Search...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

enzymes Search Powered by Explorit Topic List Advanced Search Sample search results for: acid adenylating enzymes...

445

Oligonucleoside alkyl or arylphosphonate derivatives capable of crosslinking with or cleaving nucleic acids  

DOE Patents [OSTI]

A composition for inactivating a target nucleic acid which comprises an oligonucleoside alkyl or arylphosphonate analogue which is complementary to the sequence of the target nucleic acid is provided. It includes a functional group which reacts with the target nucleic acid to render the target nucleic acid inactive or nonfunctional. 16 figs.

Miller, P.S.; Ts'o, P.O.P.

1999-06-15T23:59:59.000Z

446

E-Print Network 3.0 - acidic nuclear waste Sample Search Results  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

waste Search Powered by Explorit Topic List Advanced Search Sample search results for: acidic nuclear waste...

447

A Thin Porous Polyantimonic Acid Based Membrane as a Separator in Alkaline Water Electrolysis  

Science Journals Connector (OSTI)

Polyantimonic acid based membranes have been evaluated as a separator in alkaline water electrolysis.

R. Leysen; W. Doyen; R. Proost; H. Vandenborre

1986-01-01T23:59:59.000Z

448

The Relation of the Phosphoric Acid of the Soil to Pot Experiments.  

E-Print Network [OSTI]

by crops grown in the pot experiments, on an average, increased regularly with the amount of active phosphoric acid extracted from the soil by N/5 nitric acid. It was pointed out that the soil may pro- vide sufficient phosphoric acid for large field... potash were determined by so*lution in fifth-noml nitric acid, without correction for the acid neutralized. They are expressed in parts per million. The acid con- ~umed represents the percentage of the acid neutralized in the process of extracting...

Fraps, G. S. (George Stronach)

1920-01-01T23:59:59.000Z

449

Formic acid decomposition on polycrystalline platinum and palladized platinum electrodes  

SciTech Connect (OSTI)

This is a comprehensive study in which a formic acid decomposition reaction is examined as a probe of catalytic properties of polycrystalline platinum and palladized platinum electrodes. The electrode potential varies in a broad range, and the reaction is carried out in perchloric acid and sulfuric acid solutions containing different concentrations of HCOOH. Analytical methods used to access the decomposition reaction are chronoamperometry and cyclic voltammetry. At very short times, the authors prove that only a negligible amount of surface CO is formed, and the CO unaffected decomposition reaction, leading to CO{sub 2} formation, can be interrogated. Surprisingly, the decomposition reaction displays Tafel behavior only in a very narrow potential range. This observation, made with both clean Pt and Pt/Pd electrodes, suggests that water-surface interactions, and/or (bi)sulfate-surface interactions, increase with increasing electrode potential and create a steric/electronic barrier for the decomposition of formic acid (and methanol). The authors therefore offer a pessimistic view about platinum as a universal material for heterogeneous catalysis applications involving rearrangements of organic molecules. Such rearrangements may only be fulfilled with a low electrochemical driving force, at least at room temperature, but at higher potentials, the electrode becomes deactivated due to the unique attributes of the double layer structure on the platinum electrode. The authors have also found that the deceleration of formic acid oxidation (to CO{sub 2}) is primarily due to CO chemisorption only at potentials overlapping with those from the hydrogen adsorption range, or not too positive from this range. At more positive potentials, the decay in formic acid decomposition is neither due to CO formation nor to solution mass transfer limitations. The presence of interfacial CO{sub 2} or adsorption of formic acid and/or formate anion, could account for the decay. Finally, a detailed analysis of kinetic isotherms involved in the two pathways, CO{sub 2} formation and CO chemisorption, is made and the mechanism of formic acid decomposition on platinum is discussed. The electrolyte anion effects involved in formic acid oxidation in HClO{sub 4} and in H{sub 2}SO{sub 4} solutions are also presented.

Lu, G.Q.; Crown, A.; Wieckowski, A.

1999-11-04T23:59:59.000Z

450

Salicylic acid inhibits gibberellin-induced alpha-amylase expression and seed germination via a pathway involving an abscisic-acid-inducible WRKY gene  

Science Journals Connector (OSTI)

It is well known that abscisic acid (ABA) antagonizes gibberellin (GA)-promoted seed germination. Recent circumstantial evidence suggests that salicylic acid (SA) also inhibits seed germination in maize and Ar...

Zhen Xie; Zhong-Lin Zhang; Shane Hanzlik; Everett Cook…

2007-06-01T23:59:59.000Z

451

Transport of acetic acid in Zygosaccharomyces bailii: effects of ethanol and their implications on the resistance of the yeast to acidic environments.  

Science Journals Connector (OSTI)

...with acetic acid, ethanol, or glycerol as the sole carbon and energy source transported...bailii: effects of ethanol and their implications...with acetic acid, ethanol, or glycerol as the sole carbon and energy source transported...

M J Sousa; L Miranda; M Côrte-Real; C Leão

1996-09-01T23:59:59.000Z

452

Methods And Devices For Characterizing Duplex Nucleic Acid Molecules  

DOE Patents [OSTI]

Methods and devices are provided for characterizing a duplex nucleic acid, e.g., a duplex DNA molecule. In the subject methods, a fluid conducting medium that includes a duplex nucleic acid molecule is contacted with a nanopore under the influence of an applied electric field and the resulting changes in current through the nanopore caused by the duplex nucleic acid molecule are monitored. The observed changes in current through the nanopore are then employed as a set of data values to characterize the duplex nucleic acid, where the set of data values may be employed in raw form or manipulated, e.g., into a current blockade profile. Also provided are nanopore devices for practicing the subject methods, where the subject nanopore devices are characterized by the presence of an algorithm which directs a processing means to employ monitored changes in current through a nanopore to characterize a duplex nucleic acid molecule responsible for the current changes. The subject methods and devices find use in a variety of applications, including, among other applications, the identification of an analyte duplex DNA molecule in a sample, the specific base sequence at a single nulceotide polymorphism (SNP), and the sequencing of duplex DNA molecules.

Akeson, Mark (Santa Cruz, CA); Vercoutere, Wenonah (Santa Cruz, CA); Haussler, David (Santa Cruz, CA); Winters-Hilt, Stephen (Santa Cruz, CA)

2005-08-30T23:59:59.000Z

453

Kinetics of the Decomposition of Fructose Catalyzed by Hydrochloric Acid in Subcritical Water:? Formation of 5-Hydroxymethylfurfural, Levulinic, and Formic Acids  

Science Journals Connector (OSTI)

Kinetics of the Decomposition of Fructose Catalyzed by Hydrochloric Acid in Subcritical Water:? Formation of 5-Hydroxymethylfurfural, Levulinic, and Formic Acids ... This paper deals with the dehydration of fructose (F) to 5-hydroxymethylfurfural (HMF) and the rehydration of HMF to levulinic acid (LA) along with formic acid (FA) in subcritical water (sub-CW) in the presence of HCl as catalyst. ... Selective Liquid Phase Adsorption of 5-Hydroxymethylfurfural on Nanoporous Hyper-Cross-Linked Polymers ...

Feridoun Salak Asghari; Hiroyuki Yoshida

2007-10-16T23:59:59.000Z

454

u.s. Dl!PARThIENT OF ENERGY EERE PROJECT MANAGEMENT CENTER NEPA DETERMINATION  

Broader source: Energy.gov (indexed) [DOE]

PARThIENT OF ENERGY PARThIENT OF ENERGY EERE PROJECT MANAGEMENT CENTER NEPA DETERMINATION Page 1 of2 RECIPIENT: University of Oregon STATE: OR PROJECT TITLE: Vapor Transport Deposition for Thin Film III-V Photovoltaics fo'unding Opportunity Announcement Number Procurement Instrument Number NEPA Control Number CID Number DE-FOA..()()()()654 DE-EEOOO5957 GF0-0005957·0Q1 Based on my review of the information concerning the proposed action, as NI<:PA Compliance Officer (authorized under DOE Order 451.1A), I have made the following determination : ex, EA, EIS APPENDIX AND NUMBER: Description: A9 Information gathering, analysis, and dissemination Information gathering (including, but not limited to, literature surveys, inventories, site visits, and audits). data analysis (including, but not limited to, computer modeling), document preparation

455

u.s. Dl!PAR1'M:ENT OF ENERGY EERE PROJECT MANAGEMENT CENTER  

Broader source: Energy.gov (indexed) [DOE]

PAR1'M:ENT OF ENERGY PAR1'M:ENT OF ENERGY EERE PROJECT MANAGEMENT CENTER NEPA DETERlIIINATION RECIPIENT :University of California San Diego PROJECT TITL.E: San Diego Center for Algae Biotechnology Page 1 of2 STATE: CA Funding Opportunity Announcement Number Procurement Instnlment Number NEPA Control Number em Number EEOOO3142 GF0-10-582 EE3142 Based on my review ortbe information concerning the proposed action, as NEPA Compliance Officer (authorukd under DOE Order 451.1A), I have made the following determination: ex, EA, EIS APPENDIX AND NUMBER: Description: 83.6 Siting . construction (or modification), operation, and deoommissioning of facilities for indoor bench-scale research projects and conventional laboratory operations (for example. preparation of chemical standards and sample analYSIS):

456

u.s. Dl!PARTMENT OF ENERGY EERE PROJECT MANAGEMENT CENTER Nl!PA DETERMINATION  

Broader source: Energy.gov (indexed) [DOE]

PARTMENT OF ENERGY PARTMENT OF ENERGY EERE PROJECT MANAGEMENT CENTER Nl!PA DETERMINATION RECIPIENT:WA Dept of Commerce Page 1 of3 STATE: WA PROJECT TITLE: SEP ARRA · WSU Anaerobic Digester - Nutrient Recovery Technology - Vander Haak Dairy Funding Opportunity Announcement Number Procurement Instrument Number NEPA Control Number CID Number EEOOOO139 GF0-0000139-040 0 Based on my review of the Information concerning the proposed action, as NEPA Compliance Officer (authorized under DOE Order 4S1.1A), I have made tbe following determination: ex, EA, EIS APPENDIX AND NUMBER: Description: A9 Information gathering, analysis, and dissemination Information gathering (including, but not limited to, literature surveys, inventories, site visils, and audits), data analysis (including

457

Data Compression and Harmonic Analysis D.L. Donoho, M. Vetterli,  

E-Print Network [OSTI]

, Littlewood­Paley theory, Sampling Theorem. ``Like the vague sighings of a wind at even, That wakes perhaps less familiar to the Information Theory community, growing out of the field of harmonic analysis analysis in this century. Typically, the problems and achievements of this field have involved goals

Donoho, David

458

Data Compression and Harmonic Analysis D.L. Donoho, M. Vetterli,  

E-Print Network [OSTI]

, Littlewood-Paley theory, Sampling Theorem. "Like the vague sighings of a wind at even, That wakes perhaps less familiar to the Information Theory community, growing out of the field of harmonic analysis analysis in this century. Typically, the problems and achievements of this field have involved goals

Donoho, David

459

TFI: RTEfuST, T{ ftd rDl-.I: 91.1.1.41493997  

E-Print Network [OSTI]

, windows, ventilators and partitions with extruded built up standard tubular sections/ appropriate Z for glazing I paneling, C.p. Oiass / stainless steel screws, all complete as per archjtectural drawings in aluminum doors, windows shutters and partition frames with C.p. brass / stainless steel screws etc

Bandyopadhyay, Antar

460

TRIAC: A code for track measurements using image analysis tools D.L. Patiris a  

E-Print Network [OSTI]

.G. Ioannides a,* a Nuclear Physics Laboratory, Department of Physics, University of Ioannina, 451 10 Ioannina State Nuclear Track Detectors CR39. The program using image analysis tools counts the number of tracks for dosimetry proposes and classifies the tracks according to their radii for the spectrometry of alpha

Blekas, Konstantinos

Note: This page contains sample records for the topic "acid dl dolomitic" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


461

A. E. K.Ris Ris-M-Dl^ Title and author(s)  

E-Print Network [OSTI]

Mechanics to Prer.oure Vocicel Reliability Analysis ty P.E. Becher and Arne Pedersen pages + tables -f- 16 OF STATISTICAL LINEAR ELASTIC FRACTURE MECHANICS TO PRESSURE VESSEL RELIABILITY ANALYSIS P.E. BECHER, A. PEDERSEN sampling. Copies to Library Reactor 100 50 Abstract to Available on request from the Library of the Danish

462

The foundational inequalities of D.L. Burkholder and some of their ...  

E-Print Network [OSTI]

Aug 3, 2011 ... multipliers obtained by projections (conditional expectations) of trans- formations of ...... of conformally invariant energy functionals and regularity of solutions to the generalized .... The Poisson process ??(t) of intensity ? arises from (0,0, ??1), where ?1 is the Dirac ...... other techniques, in the near future.

2011-08-03T23:59:59.000Z

463

Measurement of the B -> Dl nu branching fractions and form factor  

E-Print Network [OSTI]

J. Lee, 19 H. Schwarthoff, 19 A. Wolf, 19 M.M. Zoeller, 19 S.J. Richichi, 20 H. Severini, 20 P. Skubic, 20 A. Undrus, 20 M. Bishai, 21 S. Chen, 21 J. Fast, 21 J.W. Hinson, 21 N. Menon, 21 D.H. Miller, 21 E.I. Shibata, 21 I.P.J. Shipsey, 21 S. Glenn... efficiency and the smearing in ?w. The fraction of D 0 , 2 ?n decays in each w bin that is recon- structed is 17% to 21% and the average ?w resolution is 0.026, about one-half the bin width. The small statistical uncertainty in e ij is represented by s 2 e ij...

Ammar, Raymond G.; Baringer, Philip S.; Bean, Alice; Besson, David Zeke; Coppage, Don; Darling, C.; Davis, Robin E. P.; Kotov, S.; Kravchenko, I.; Kwak, Nowhan; Zhou, L.

1999-05-01T23:59:59.000Z

464

Transitional Cell Hyperplasia in the Bladders of Dogs Fed dl-Tryptophan  

Science Journals Connector (OSTI)

...these experiments add further fuel to the concept that tryptophan...available at a more resonable price, and a feeding experiment designed...REFERENCES 1. Brown, R. R., Price, J. M., Friedell, G. H...T., Brown, R. R., and Price, J. M. Incidence of Mouse...

J. L. Radomski; E. M. Glass; and William B. Deichmann

1971-11-01T23:59:59.000Z

465

Matematik Dnyas>, 2003 K>fl Tbitak Bilim dl (1979) sahibi, k>rk do-  

E-Print Network [OSTI]

> ayn> üniversiteden 1953'te ald>. 1960'da Ege �niversitesi T>p Fakültesi'nde "yabanc> ma- tematik ve- l>flt>. Ege �niversitesi'nde doçent (1965) ve profe- sör (1967) oldu. 1969-76 y>llar> aras>nda OD>rma Merke- zi'nde, 1995-97'de Gebze'de, Elektronik ve Krip- toloji Araflt>rma Merkezi'nde görev ald>. 1997

Sertöz, Ali Sinan

466

ISSN:1575-6807 D.L.: GC-1317-1999  

E-Print Network [OSTI]

Universitario de Ciencias y Tecnologías Cibernéticas Universidad de Las Palmas de Gran Canaria Campus de Tafira) Universidad de Las Palmas de Gran Canaria (ULPGC) Las Palmas de Gran Canaria December 4-6, 2003 Organized Editorial Commite in alphabetic order · Alvarez Luis (Universidad de Las Palmas de Gran Canaria) · Baumela

Granada, Universidad de

467

DOE/SC-ARM-13-003 ARM Lead Mentor Selection Process DL Sisterson  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

of the instrument system in a timely manner. * Use the Data Quality Problem Report (DQPR) process to alert the Site Scientist Team and Site Operations Team to problems with the...

468

Ternary complexes of copper(II), nickel(II) and zinc(II) with nitrilotriacetic acid as a primary ligand and some phenolic acids as secondary ligands  

Science Journals Connector (OSTI)

The formation of ternary complexes of the MAL3? type [where M = CuII, NiII and ZnII ; A = nitrilotriacetic acid (NTA); L = 1-hydroxy-2-naphthoic acid (1,2 HNA) and 2-hydroxy-1-naphthoic acid (2,1 HNA)] have been ...

Pradyot Kumar Datta; Madhup Chandra; Arun K. Dey

1980-01-01T23:59:59.000Z

469

The urban perspectives of acid rain. Workshop summary  

SciTech Connect (OSTI)

This report documents discussions held during a workshop an Urban Perspective of Acid Rain. The workshop was sponsored by the Office of the Director, National Acid Precipitation Assessment Program (NAPAP). NAPAP anticipates giving increased emphasis to the benefits in urban areas of emissions reductions. The goal of this informal, exploratory workshop was to serve as a first step towards identifying pollutant monitoring, and research and assessment needs to help answer, from an urban perspective, the two key questions posed to NAPAP by Congress: (1) what are the costs, benefits, and effectiveness of the acid rain control program, and (2) what reductions in deposition, rates are needed in order to prevent adverse effects? The workshop addressed research activities needed to respond to these questions. The discussions focused. sequentially, on data needs, data and model availability, and data and modeling gaps. The discussions concentrated on four areas of effects: human health, materials, urban forests, and visibility.

Tonn, B.E.

1993-06-04T23:59:59.000Z

470

Water recovery from acid mine drainage by electrodialysis  

Science Journals Connector (OSTI)

In this study, the possibility of using electrodialysis for the treatment of acid mine drainage generated from coal mining to recover water is investigated. Electrodialysis allows for the separation of anions and metallic cations, possessing the advantages of removing contaminant metals and simultaneously recovering water. To investigate this technology, the passage of anions and cations from three different acid mine drainages through a HDX 200 anion-exchange membrane and a HDX 100 cation-exchange membrane, respectively, was evaluated. The results show that electrodialysis is suitable for recovering water from acid mine drainage, with contaminant removal efficiencies that are greater than 97%. However, the precipitation of iron at the surface of the cation-exchange membrane constitutes a problem for the system by causing a blockage of the membrane through the scaling phenomenon, which reduces the process efficiency.

Daniella Cardoso Buzzi; Lucas Stéphano Viegas; Marco Antônio Siqueira Rodrigues; Andréa Moura Bernardes; Jorge Alberto Soares Tenório

2013-01-01T23:59:59.000Z

471

Metabolic evolution of Escherichia coli strains that produce organic acids  

DOE Patents [OSTI]

This invention relates to the metabolic evolution of a microbial organism previously optimized for producing an organic acid in commercially significant quantities under fermentative conditions using a hexose sugar as sole source of carbon in a minimal mineral medium. As a result of this metabolic evolution, the microbial organism acquires the ability to use pentose sugars derived from cellulosic materials for its growth while retaining the original growth kinetics, the rate of organic acid production and the ability to use hexose sugars as a source of carbon. This invention also discloses the genetic change in the microorganism that confers the ability to use both the hexose and pentose sugars simultaneously in the production of commercially significant quantities of organic acids.

Grabar, Tammy; Gong, Wei; Yocum, R Rogers

2014-10-28T23:59:59.000Z

472

Distribution of 1-butanol between organic solvent and acidic solution  

SciTech Connect (OSTI)

1-butanol, a major TBP-degraded product, is known to react explosively with concentrated nitric acid under non-heated conditions. However, no quantitative data is available on the distribution behavior in the Purex solution. The distribution of 1-butanol between tributyl phosphate(TBP) diluted with n-dodecane and aqueous solution of nitric acid and uranyl nitrate was investigated under various conditions, by changing the concentration of nitric acid, uranyl nitrate, the composition of the organic mixture, the organic to aqueous phase volume ratio, and temperature. 1-butanol was found to distribute more in solvent phase, but the distribution ratio is not large, less than four under typical Purex solution conditions. The ratio was found to be correlated with the molar concentration of free TBP and 1-butanol. Effects of these characteristics on safety in radiochemical plants will be discussed from the local accumulation of 1-butanol.

Asakura, T.; Nemoto, H.; Uchiyama, G. [Japan Atomic Energy Research Institute, Ibaraki-ken (Japan)] [and others

1995-12-01T23:59:59.000Z

473

The thermodynamic properties of 2-amino-ethylphosphonic acid  

E-Print Network [OSTI]

-Alanine, and Ethylamine . X aST for pK1 and pK2 of Aminoethylphosphonic Acid and Phosphoric Acid . 25 29 35 36 38 39 41 LIST OF FIGURES Figure Page 1 Plot of pH vs. temperature for a . 05 M citric acid solution . 2 Plot of pK - ? A~ vs. ionic strength.... Circles ire approximately . 01 pK unit in radius Plot of pK2 - A/ I vs. ionic strength. Circles are approximately . 005 units in radius Plot of pK3 + 3Av I vs. ionic strength. Circles are approximately . Ol pk unit in radius. Plot of pK vs. 1/T x...

Unruh, Stephen George Walter

2012-06-07T23:59:59.000Z

474

High Level Waste System Impacts from Acid Dissolution of Sludge  

SciTech Connect (OSTI)

This research evaluates the ability of OLI{copyright} equilibrium based software to forecast Savannah River Site High Level Waste system impacts from oxalic acid dissolution of Tank 1-15 sludge heels. Without further laboratory and field testing, only the use of oxalic acid can be considered plausible to support sludge heel dissolution on multiple tanks. Using OLI{copyright} and available test results, a dissolution model is constructed and validated. Material and energy balances, coupled with the model, identify potential safety concerns. Overpressurization and overheating are shown to be unlikely. Corrosion induced hydrogen could, however, overwhelm the tank ventilation. While pH adjustment can restore the minimal hydrogen generation, resultant precipitates will notably increase the sludge volume. OLI{copyright} is used to develop a flowsheet such that additional sludge vitrification canisters and other negative system impacts are minimized. Sensitivity analyses are used to assess the processability impacts from variations in the sludge/quantities of acids.

KETUSKY, EDWARD

2006-04-20T23:59:59.000Z

475

Tantalum pillard montmorillonite: II. Acidic and catalytic properties  

SciTech Connect (OSTI)

The acidic and catalytic properties of a series of Ta-PILCs synthesized with a different initial tantalum content were characterized by adsorption of gaseous probe molecules (TPD of ammonia and FTIR spectra of absorbed pyridine) and by the test reaction of 1-butanol dehydration. A large increase of acidity was noted in Ta-PILCs compared to Na-montmorillonite or tantalum oxide. Cross-linking pillars and silica layers of the clay induce stronger Lewis and new Bronsted sites. The lack of basic sites formation is evidenced by the dehydration of 1-butanol to butene selectivity (100%). The incorporation of the tantalum oxide between the montmorillonite sheets produce, within Ta-PILC, acid centers of the same nature as observed for the silicon-tantalum mixed oxides. 32 refs., 4 figs., 5 tabs.

Guiu, G.; Grange, P. [Universite Catholique de Louvain, Louvain-la-Neuve (Belgium)] [Universite Catholique de Louvain, Louvain-la-Neuve (Belgium)

1997-06-01T23:59:59.000Z

476

Formation of acidic sulfates in kraft recovery boilers  

SciTech Connect (OSTI)

Acidic sulfates (NaHSO[sub 4] and Na[sub 2]S[sub 2]O[sub 7]) have been suggested as the cause of corrosive sticky deposits in recovery boilers. Recovery-boiler precipitator dusts and pure Na[sub 2]SO[sub 4] were examined for their tendency to form acidic sulfates in simulated flue gases. Formation was strongly influenced by temperature and by gas-phase concentrations of SO[sub x] and H[sub 2]O. Liquid NaHSO[sub 4] formed readily at 250 C at SO[sub x] concentration above 150 ppm. Formation reactions were hindered by Na[sub 2]CO[sub 3]. Under appropriate conditions, acidic sulfates can exist at tube surfaces near the furnace roof, at the upper screen tubes, and in the generating bank and economizer.

Poon, W.; Barham, D.; Tran, H. (Univ. of Toronto, Ontario (Canada))

1993-07-01T23:59:59.000Z

477

300 Area waste acid treatment system closure plan  

SciTech Connect (OSTI)

The Hanford Facility Dangerous Waste Permit Application is considered to be a single application organized into a General Information Portion (document number DOERL-91-28) and a Unit-Specific Portion. The scope of the Unit-Specific Portion includes closure plan documentation submitted for individual, treatment, storage, and/or disposal units undergoing closure, such as the 300 Area Waste Acid Treatment System. Documentation contained in the General Information Portion is broader in nature and could be used by multiple treatment, storage, and/or disposal units (e.g., the glossary provided in the General Information Portion). Whenever appropriate, 300 Area Waste Acid Treatment System documentation makes cross-reference to the General Information Portion, rather than duplicating text. This 300 Area Waste Acid Treatment System Closure Plan (Revision 2) includes a Hanford Facility Dangerous Waste Permit Application, Part A, Form 3. Information provided in this closure plan is current as of April 1999.

LUKE, S.N.

1999-05-17T23:59:59.000Z

478

Characterization and analysis of the cotton cyclopropane fatty acid synthase family and their contribution to cyclopropane fatty acid synthesis  

SciTech Connect (OSTI)

Cyclopropane fatty acids (CPA) have been found in certain gymnosperms, Malvales, Litchi and other Sapindales. The presence of their unique strained ring structures confers physical and chemical properties characteristic of unsaturated fatty acids with the oxidative stability displayed by saturated fatty acids making them of considerable industrial interest. While cyclopropenoid fatty acids (CPE) are well-known inhibitors of fatty acid desaturation in animals, CPE can also inhibit the stearoyl-CoA desaturase and interfere with the maturation and reproduction of some insect species suggesting that in addition to their traditional role as storage lipids, CPE can contribute to the protection of plants from herbivory. Three genes encoding cyclopropane synthase homologues GhCPS1, GhCPS2 and GhCPS3 were identified in cotton. Determination of gene transcript abundance revealed differences among the expression of GhCPS1, 2 and 3 showing high, intermediate and low levels, respectively, of transcripts in roots and stems; whereas GhCPS1 and 2 are both expressed at low levels in seeds. Analyses of fatty acid composition in different tissues indicate that the expression patterns of GhCPS1 and 2 correlate with cyclic fatty acid (CFA) distribution. Deletion of the N-terminal oxidase domain lowered GhCPS's ability to produce cyclopropane fatty acid by approximately 70%. GhCPS1 and 2, but not 3 resulted in the production of cyclopropane fatty acids upon heterologous expression in yeast, tobacco BY2 cell and Arabidopsis seed. In cotton GhCPS1 and 2 gene expression correlates with the total CFA content in roots, stems and seeds. That GhCPS1 and 2 are expressed at a similar level in seed suggests both of them can be considered potential targets for gene silencing to reduce undesirable seed CPE accumulation. Because GhCPS1 is more active in yeast than the published Sterculia CPS and shows similar activity when expressed in model plant systems, it represents a strong candidate gene for CFA accumulation via heterologous expression in production plants.

Yu X. H.; Shanklin J.; Rawat, R.

2011-05-01T23:59:59.000Z

479

Corrosion Testing of Carbon Steel in Acid Cleaning Solutions  

SciTech Connect (OSTI)

High level waste is stored in carbon steel tanks at the Savannah River Site (SRS). The site is currently in the process of waste removal from, and ultimately closure of, these tanks. One of the most time consuming steps in the waste removal process is cleaning the sludge heel from the bottom of the tanks to an acceptable residual quantity. The sludge consists primarily of metal oxides that formed after waste from the canyons was neutralized with sodium hydroxide. Since the canyon waste was originally a nitric acid solution, this acid is a prime candidate for sludge heel dissolution.

Wiersma, B.J.

2002-12-06T23:59:59.000Z

480

Enrichment of selected fatty acids in broiler tissues  

E-Print Network [OSTI]

ENRICHMENT OF SELECTED FATTY ACIDS IN BROILER TISSUES A Thesis by JIA-CHYI YAU Submitted to the Office of Graduate Study of Texas A&M University in partial fullfillment of the requirements for the degree of MASTER OF SCIENCE August 1990... Major Subject: Food Science and Technology ENRICHMENT OF SELECTED FATTY ACIDS IN BROILER TISSUES A Thesis by JIA-CHYI YAU Approved as to style and content by A. R. Sams (Chair of Comittee) C. A. Bailey (Member) J. T Eeet n (M mber) R. Creg...

Yau, Jia-Chyi

2012-06-07T23:59:59.000Z

Note: This page contains sample records for the topic "acid dl dolomitic" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


481

Experimental Study of Mechanistic Acid Deconstruction of Lignin  

SciTech Connect (OSTI)

Lignin is a major component of biomass, which remains highly underutilized in selective biomass conversion strategies to renewable fuels and chemicals. Here we are interested in studying the mechanisms related to the acid deconstruction of lignin with a combined theoretical and experimental approach. Quantum mechanical calculations were employed to elucidate possible deconstruction mechanisms with transition state theory. Model dimers, imitating H, S, and G lignins, were synthesized with the most abundant {beta} - O - 4 linkage in lignin. These compounds were then depolymerized using various acids and at different operating conditions. The deconstruction products were analyzed to complement the QM studies and investigate proposed mechanisms.

Sturgeon, M.; Kim, S.; Chmely, S. C.; Katahira, R.; Foust, T. D.; Beckham, G. T.

2012-01-01T23:59:59.000Z

482

Characterization of acidic components in Midway Sunset crude oil  

SciTech Connect (OSTI)

The crude oil from the Midway Sunset Field in California contains 70% non-distillable constituents called resid. Analysis of Midway Sunset crude components using standard analytical techniques such as GC and GC-MS is difficult due to the complex and intractable nature of the resid. Acidic components in crudes are of importance because the presence of these compounds results in problems related to pipe corrosion and waste-water contamination. Detailed characterization of the acidic components of Midway Sunset crude using high-resolution electron impact (HREI) and chemical ionization (HRCI) mass spectrometry have been undertaken.

Haas, G.W.; Ellis, L.; Hunt, J.E.; Winans, R.E. [Argonne National Lab., IL (United States)

1995-12-31T23:59:59.000Z

483

Mutant E. coli strain with increased succinic acid production  

DOE Patents [OSTI]

A method for isolating succinic acid producing bacteria is provided comprising increasing the biomass of an organism which lacks the ability to catabolize pyruvate, and then subjecting the biomass to glucose-rich medium in an anaerobic environment to enable pyruvate-catabolizing mutants to grow. The invention also provides for a mutant that produces high amounts of succinic acid, which has been derived from a parent which lacked the genes for pyruvate formate lyase and lactate dehydrogenase, and which belongs to the E.coli Group of Bacteria.

Donnelly, Mark (Warrenville, IL); Millard, Cynthia S. (Plainfield, IL); Stols, Lucy (Woodridge, IL)

2002-01-01T23:59:59.000Z

484

Single Molecule Acid-Base Kinetics and Thermodynamics  

Science Journals Connector (OSTI)

We report a method in which temperature dependent single-molecule fluorescence measurements are used to study the kinetics and thermodynamics of the acid-base interaction in films of photoresist polymer. We use the two distinct fluorescent prototropic forms of Coumarin 6 (C6?C6+) to indicate the state of the acid-base system. Data are analyzed using a statistical model of the intensity probability distributions, yielding temperature dependent proton exchange rates, which is confirmed through agreement with a simple two-state Monte Carlo model. The temperature dependent rates are used to calculate the activation enthalpy for proton exchange.

Michael D. Mason; Krishanu Ray; Robert D. Grober; Gerd Pohlers; James Cameron

2004-08-13T23:59:59.000Z

485

Understanding Humic Acid / Zr(IV) Interaction - A Spectromicroscopy Approach  

SciTech Connect (OSTI)

Complexation of Zr(IV) by humic acid (HA) and polyacrylic acid (PAA) is investigated from the point of view of the organic ligand. STXM Spectromicroscopy and C 1s-NEXAFS point to different interaction mechanisms between Zr(IV) cations and oxo/hydroxo colloids and PAA. Under conditions where the metal aquo ion is stable, strong complexes are formed. In contrast, unspecific surface coating is identified when PAA is contacted with Zr(IV) oxo/hydroxide colloids. HA exhibits similar C 1s-NEXAFS features indicating a complexation reaction.

Rothe, Joerg; Plaschke, Markus; Denecke, Melissa A. [Forschungszentrum Karlsruhe, Institut fuer Nukleare Entsorgung, P.O. Box 3640, D-76021 Karlsruhe (Germany)

2007-02-02T23:59:59.000Z

486

Production of Butyric Acid and Butanol from Biomass  

Alternative Fuels and Advanced Vehicles Data Center [Office of Energy Efficiency and Renewable Energy (EERE)]

Production of Butyric Acid and Butanol from Biomass Production of Butyric Acid and Butanol from Biomass Final Report Work Performed Under: Contract No.: DE-F-G02-00ER86106 For: U.S. Department of Energy Morgantown, WV By David Ramey Environmental Energy Inc. 1253 N. Waggoner Road P.O. Box 15 Blacklick, Ohio 43004 And Shang-Tian Yang Department of Chemical and Biomolecular Engineering The Ohio State University 140 West 19 th Avenue Columbus, Ohio 43210 - 2004 - Table of Contents Page Proposal Face Page ..........................................................................................................................1 Table of Contents.............................................................................................................................2 Executive Summary

487

Lipid Metabolism, Learning Ability and Potential Biomarkers for Atherosclerosis in Monk Parrots (Myiopsitta monachus) Fed N-3 Fatty Acids  

E-Print Network [OSTI]

EC Esterified Cholesterol EOOC Extinguish the Open One Cube Behavior EPA Eicosapentaenoic Acid FAMEs Fatty Acid Methyl Esters FC Free Cholesterol FLX Flaxseed Diet HALA High ?-Linolenic Acid Diet HDL High-Density Lipoprotein LA Linoleic Acid... LALA Low ?-Linolenic Acid Diet LDL Low-Density Lipoprotein LP-C Lipoprotein Cholesterol ix MALA Medium ?-Linolenic Acid Diet MDA Malondialdehyde OOC Open One Cube Learning Task PUFA Polyunsaturated Fatty Acid ROOC Relearn Open One Cube Learning...

Petzinger, Christina

2012-07-16T23:59:59.000Z

488

Water-enhanced solubility of carboxylic acids in organic solvents and its applications to extraction processes  

SciTech Connect (OSTI)

The solubilities of carboxylic acids in certain organic solvents increase remarkably with an increasing amount of water in the organic phase. This phenomenon leads to a novel extract regeneration process in which the co-extracted water is selectively removed from an extract, and the carboxylic acid precipitates. This approach is potentially advantageous compared to other regeneration processes because it removes a minor component of the extract in order to achieve a large recovery of acid from the extract. Carboxylic acids of interest include adipic acid, fumaric acid, and succinic acid because of their low to moderate solubilities in organic solvents. Solvents were screened for an increase in acid solubility with increased water concentration in the organic phase. Most Lewis-base solvents were found to exhibit this increased solubility phenomena. Solvents that have a carbonyl functional group showed a very large increase in acid solubility. 71 refs., 52 figs., 38 tabs.

Starr, J.N.; King, C.J.

1991-11-01T23:59:59.000Z

489

Arachidonic Acid Accumulation and Delta-5 Desaturation in Felines After Feeding a Gamma-Linolenic Acid Enriched Diet  

E-Print Network [OSTI]

animals possess the same requirements [1]. Mammals, including cats, and most ruminants, possess the ability to synthesize both nonessential saturated and monounsaturated fatty acids (MUFA) de novo from amino acids or glucose via acetyl CoA [2... collected at d0, d140, and d300 were all utilized in preparing FAMEs for analysis. Five hundred ?L of each sample were transferred into 12 mL Teflon-lined screw topped tubes along with 9 mL of chloroform:methanol (2:1, v/v) containing 0.2% glacial...

Chamberlin, Amy Jo

2011-02-22T23:59:59.000Z

490

Static corrosion of construction materials exposed to superphosphoric acid made from various sources of phosphate rock  

SciTech Connect (OSTI)

Corrosion tests were performed with various construction materials, such as carbon steel, cast iron, stainless steels, nickel and nickel-based alloys, copper and its alloys, aluminum alloy, zirconium alloy, and tantalum, exposed to wet-process superphosphoric acids (approximately 70% P{sub 2}O{sub 5}) from all the suppliers in the United States and to a technical-grade (55% P{sub 2}O{sub 5}) acid made by the electric furnace process. The study was conducted in response to reports from pipe-reactor users of excessive corrosion by superphosphoric acids and electric furnace acid. Test temperatures were ambient (approximately 21{degrees}C or 70{degrees}F), 66{degrees}C (150{degrees}F), and 93{degrees}C (200{degrees}F). Test results showed that temperature was a significant factor in acid corrosivity. Electric furnace acid was more corrosive than the superphosphoric acids. Carbon steel, cast iron, and aluminum alloy were not resistant to either the superphosphoric acids or the electric furnace acid. Nickel-chromium (Ni-Cr) and nickel-molybdenum (Ni-Mo) based alloys and tantalum exhibited adequate corrosion resistance in the superphosphoric acids and the electric furnace acid. Stainless steels performed well in all test acids at all test temperatures with some exceptions in the electric furnace acid at 93{degrees}C. Zirconium alloy, copper and its alloys, pure nickel, and Monel 400 provided adequate corrosion resistance to all test acids at ambient temperature only.

Nguyen, D.T.; McDonald, C.L.; McGill, K.E.

1994-10-01T23:59:59.000Z

491

Advanced Lead Acid Battery Consortium | Open Energy Information  

Open Energy Info (EERE)

Lead Acid Battery Consortium Lead Acid Battery Consortium Jump to: navigation, search Name Advanced Lead-Acid Battery Consortium Place Durham, North Carolina Zip 27713 Sector Vehicles Product The ALABC is a research consortium of more than 50 battery-related companies that was originally formed in 1992 to advance the capabilities of the valve-regulated lead acid battery to help electric vehicles become a reality. Coordinates 45.396265°, -122.755099° Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"ROADMAP","zoom":14,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"350px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":45.396265,"lon":-122.755099,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}

492

Integrated boiler, superheater, and decomposer for sulfuric acid decomposition  

DOE Patents [OSTI]

A method and apparatus, constructed of ceramics and other corrosion resistant materials, for decomposing sulfuric acid into sulfur dioxide, oxygen and water using an integrated boiler, superheater, and decomposer unit comprising a bayonet-type, dual-tube, counter-flow heat exchanger with a catalytic insert and a central baffle to increase recuperation efficiency.

Moore, Robert (Edgewood, NM); Pickard, Paul S. (Albuquerque, NM); Parma, Jr., Edward J. (Albuquerque, NM); Vernon, Milton E. (Albuquerque, NM); Gelbard, Fred (Albuquerque, NM); Lenard, Roger X. (Edgewood, NM)

2010-01-12T23:59:59.000Z

493

A Solid-Phase Radioimmunoassay for Human Prostatic Acid Phosphatase  

Science Journals Connector (OSTI)

...PBS. After the addition of0.5 mlO...surface. After the addition of0.5 ml 0...were studied. In addition, I5 patients...adsorbtion (5), ion exchange resin (25), paper...Histochemical Demonstration of Acid Phosphatase...

Andras G. Foti; Harvey Herschman; and J. Fenimore Cooper

1975-09-01T23:59:59.000Z

494

Yellow Acid-Cation Complexes in Lake Water  

Science Journals Connector (OSTI)

...predominant N-terminal amino acids in fractions I to IV, the major car-riers of triglyceride in plasma. N-Ter-minal aspartic...Figure 1 B is a similarly run chromatogram of material from Panther Lake, Washington; it also shows region-ally typical results...

JOSEPH SHAPIRO

1958-03-28T23:59:59.000Z

495

Process for immobilizing radioactive boric acid liquid wastes  

DOE Patents [OSTI]

A method of immobilizing boric acid liquid wastes containing radionuclides by neutralizing the solution and evaporating the resulting precipitate to near dryness. The dry residue is then fused into a reduced volume, insoluble, inert, solid form containing substantially all the radionuclides.

Greenhalgh, Wilbur O. (Richland, WA)

1986-01-01T23:59:59.000Z

496

Interaction Between Simple Sugars and Amino-Acids  

Science Journals Connector (OSTI)

... A spot of identical R p value was observed when a mixture of 1 mol. 5 - hydroxymethylfurfural and 1-5 mol. L-lysine at ??. 8-0 was kept for four ... acid for four hours at 100 C., the chromatograms showed a* spot identical with 5-hydroxymethylfurfural with regard to RF value (0-80) and colour, when sprayed with naphthoresorcinol ...

A. GOTTSCHALK; S. M. PARTRIDGE

1950-04-29T23:59:59.000Z

497

THE ENZYMATIC SYNTHESIS IN VITRO OF HYALURONIC ACID CHAINS  

Science Journals Connector (OSTI)

...the sample is lost. Electrodialysis for 48 hours at 800...the C'4-HA from water alone leads to a considerable...butanol-acetic acid- water solvent, one strip...of the digested HA. Water eluates were made separately...cross-linked. The Dowex treatment was done twice with...

Luis Glaser; David H. Brown

1955-01-01T23:59:59.000Z

498

Can Delignification Decrease Cellulose Digestibility in Acid Pretreated Corn Stover?  

SciTech Connect (OSTI)

It has previously been shown that the improved digestibility of dilute acid pretreated corn stover is at least partially due to the removal of xylan and the consequent increase in accessibility of the cellulose to cellobiohydrolase enzymes. We now report on the impact that lignin removal has on the accessibility and digestibility of dilute acid pretreated corn stover. Samples of corn stover were subjected to dilute sulfuric acid pretreatment with and without simultaneous (partial) lignin removal. In addition, some samples were completely delignified after the pretreatment step using acidified sodium chlorite. The accessibility and digestibility of the samples were tested using a fluorescence-labeled cellobiohydrolase (Trichoderma reesei Cel7A) purified from a commercial cellulase preparation. Partial delignification of corn stover during dilute acid pretreatment was shown to improve cellulose digestibility by T. reesei Cel7A; however, decreasing the lignin content below 5% (g g{sup -1}) by treatment with acidified sodium chlorite resulted in a dramatic reduction in cellulose digestibility. Importantly, this effect was found to be enhanced in samples with lower xylan contents suggesting that the near complete removal of xylan and lignin may cause aggregation of the cellulose microfibrils resulting in decreased cellulase accessibility.

Ishizawa, C. I.; Jeoh, T.; Adney, W. S.; Himmel, M. E.; Johnson, D. K.; Davis, M. F.

2009-01-01T23:59:59.000Z

499

Impact of Acid Additives on Elastic Modulus of Viscoelastic Surfactants  

E-Print Network [OSTI]

In live acid solutions at concentrations of HCl namely 15-20 wt% HCl, elastic modulus remained quite low as compared to 10-12 wt% HCl concentrations. At 10 wt% HCl concentration, elastic modulus was 3.4 Pa observed whereas at 20 wt% HCl...

Khan, Waqar Ahmad

2012-02-14T23:59:59.000Z

500

Acid-Catalyzed Dehydrogenation of Amine-Boranes  

Energy Innovation Portal (Marketing Summaries) [EERE]

A method of dehydrogenating an amine-borane using an acid-catalyzed reaction. The method generates hydrogen and produces a solid polymeric product. The method of dehydrogenating amine-boranes may be used to generate hydrogen for power generation sources such as fuel cells....

2013-03-28T23:59:59.000Z