Sample records for accessory power including

  1. Advanced Accessory Power Supply Topologies

    SciTech Connect (OSTI)

    Marlino, L.D.

    2010-06-15T23:59:59.000Z

    This Cooperative Research and Development Agreement (CRADA) began December 8, 2000 and ended September 30, 2009. The total funding provided by the Participant (General Motors Advanced Technology Vehicles [GM]) during the course of the CRADA totaled $1.2M enabling the Contractor (UT-Battelle, LLC [Oak Ridge National Laboratory, a.k.a. ORNL]) to contribute significantly to the joint project. The initial task was to work with GM on the feasibility of developing their conceptual approach of modifying major components of the existing traction inverter/drive to develop low cost, robust, accessory power. Two alternate methods for implementation were suggested by ORNL and both were proven successful through simulations and then extensive testing of prototypes designed and fabricated during the project. This validated the GM overall concept. Moreover, three joint U.S. patents were issued and subsequently licensed by GM. After successfully fulfilling the initial objective, the direction and duration of the CRADA was modified and GM provided funding for two additional tasks. The first new task was to provide the basic development for implementing a cascaded inverter technology into hybrid vehicles (including plug-in hybrid, fuel cell, and electric). The second new task was to continue the basic development for implementing inverter and converter topologies and new technology assessments for hybrid vehicle applications. Additionally, this task was to address the use of high temperature components in drive systems. Under this CRADA, ORNL conducted further research based on GM’s idea of using the motor magnetic core and windings to produce bidirectional accessory power supply that is nongalvanically coupled to the terminals of the high voltage dc-link battery of hybrid vehicles. In order not to interfere with the motor’s torque, ORNL suggested to use the zero-sequence, highfrequency harmonics carried by the main fundamental motor current for producing the accessory power. Two studies were conducted at ORNL. One was to put an additional winding in the motor slots to magnetically link with the high frequency of the controllable zero-sequence stator currents that do not produce any zero-sequence harmonic torques. The second approach was to utilize the corners of the square stator punching for the high-frequency transformers of the dc/dc inverter. Both approaches were successful. This CRADA validated the feasibility of GM’s desire to use the motor’s magnetic core and windings to produce bidirectional accessory power supply. Three joint U.S. patents with GM were issued to ORNL and GM by the U.S. Patent Office for the research results produced by this CRADA.

  2. Electronic Position Sensor for Power Operated Accessory

    DOE Patents [OSTI]

    Haag, Ronald H.; Chia, Michael I.

    2005-05-31T23:59:59.000Z

    An electronic position sensor for use with a power operated vehicle accessory, such as a power liftgate. The position sensor includes an elongated resistive circuit that is mounted such that it is stationary and extends along the path of a track portion of the power operated accessory. The position sensor further includes a contact nub mounted to a link member that moves within the track portion such that the contact nub is slidingly biased against the elongated circuit. As the link member moves under the force of a motor-driven output gear, the contact nub slides along the surface of the resistive circuit, thereby affecting the overall resistance of the circuit. The position sensor uses the overall resistance to provide an electronic position signal to an ECU, wherein the signal is indicative of the absolute position of the power operated accessory. Accordingly, the electronic position sensor is capable of providing an electronic signal that enables the ECU to track the absolute position of the power operated accessory.

  3. Hybrid vehicle powertrain system with power take-off driven vehicle accessory

    DOE Patents [OSTI]

    Beaty, Kevin D.; Bockelmann, Thomas R.; Zou, Zhanijang; Hope, Mark E.; Kang, Xiaosong; Carpenter, Jeffrey L.

    2006-09-12T23:59:59.000Z

    A hybrid vehicle powertrain system includes a first prime mover, a first prime mover driven power transmission mechanism having a power take-off adapted to drive a vehicle accessory, and a second prime mover. The second prime mover is operable to drive the power transmission mechanism alone or in combination with the first prime mover to provide power to the power take-off through the power transmission mechanism. The invention further includes methods for operating a hybrid vehicle powertrain system.

  4. Electric power monthly, September 1990. [Glossary included

    SciTech Connect (OSTI)

    Not Available

    1990-12-17T23:59:59.000Z

    The purpose of this report is to provide energy decision makers with accurate and timely information that may be used in forming various perspectives on electric issues. The power plants considered include coal, petroleum, natural gas, hydroelectric, and nuclear power plants. Data are presented for power generation, fuel consumption, fuel receipts and cost, sales of electricity, and unusual occurrences at power plants. Data are compared at the national, Census division, and state levels. 4 figs., 52 tabs. (CK)

  5. A New Integrated Onboard Charger and Accessory Power Converter for Plug-in Electric Vehicles

    SciTech Connect (OSTI)

    Su, Gui-Jia [ORNL; Tang, Lixin [ORNL

    2014-01-01T23:59:59.000Z

    In this paper, a new approach is presented for integrating the function of onboard battery charging into the traction drive system and accessory dc-dc converter of a plug-in electric vehicle (PEV). The idea is to utilize the segmented traction drive system of a PEV as the frond converter of the charging circuit and the transformer and high voltage converter of the 14 V accessory dc-dc converter to form a galvanically isolated onboard charger. Moreover, a control method is presented for suppressing the battery current ripple component of twice the grid frequency with the reduced dc bus capacitor in the segmented inverter. The resultant integrated charger has lower cost, weight, and volume than a standalone charger due to a substantially reduced component count. The proposed integrated charger topology was verified by modeling and experimental results on a 5.8 kW charger prototype.

  6. Electric Power Monthly, August 1990. [Glossary included

    SciTech Connect (OSTI)

    Not Available

    1990-11-29T23:59:59.000Z

    The Electric Power Monthly (EPM) presents monthly summaries of electric utility statistics at the national, Census division, and State level. The purpose of this publication is to provide energy decisionmakers with accurate and timely information that may be used in forming various perspectives on electric issues that lie ahead. Data includes generation by energy source (coal, oil, gas, hydroelectric, and nuclear); generation by region; consumption of fossil fuels for power generation; sales of electric power, cost data; and unusual occurrences. A glossary is included.

  7. Power generation method including membrane separation

    DOE Patents [OSTI]

    Lokhandwala, Kaaeid A. (Union City, CA)

    2000-01-01T23:59:59.000Z

    A method for generating electric power, such as at, or close to, natural gas fields. The method includes conditioning natural gas containing C.sub.3+ hydrocarbons and/or acid gas by means of a membrane separation step. This step creates a leaner, sweeter, drier gas, which is then used as combustion fuel to run a turbine, which is in turn used for power generation.

  8. DYNAMIC MODELLING OF AUTONOMOUS POWER SYSTEMS INCLUDING RENEWABLE POWER SOURCES.

    E-Print Network [OSTI]

    Paris-Sud XI, Université de

    (thermal, gas, diesel) and renewable (hydro, wind) power units. The objective is to assess the impact - that have a special dynamic behaviour, and the wind turbines. Detailed models for each one of the power system components are developed. Emphasis is given in the representation of different hydro power plant

  9. C -parameter distribution at N 3 LL ' including power corrections

    DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

    Hoang, André H.; Kolodrubetz, Daniel W.; Mateu, Vicent; Stewart, Iain W.

    2015-05-01T23:59:59.000Z

    We compute the e?e? C-parameter distribution using the soft-collinear effective theory with a resummation to next-to-next-to-next-to-leading-log prime accuracy of the most singular partonic terms. This includes the known fixed-order QCD results up to O(?3s), a numerical determination of the two-loop nonlogarithmic term of the soft function, and all logarithmic terms in the jet and soft functions up to three loops. Our result holds for C in the peak, tail, and far tail regions. Additionally, we treat hadronization effects using a field theoretic nonperturbative soft function, with moments ?n. To eliminate an O(?QCD) renormalon ambiguity in the soft function, we switch from the MSŻ to a short distance “Rgap” scheme to define the leading power correction parameter ?1. We show how to simultaneously account for running effects in ?1 due to renormalon subtractions and hadron-mass effects, enabling power correction universality between C-parameter and thrust to be tested in our setup. We discuss in detail the impact of resummation and renormalon subtractions on the convergence. In the relevant fit region for ?s(mZ) and ?1, the perturbative uncertainty in our cross section is ? 2.5% at Q=mZ.

  10. Accessories Around the Clock.

    E-Print Network [OSTI]

    Boyles, Rheba Merle; Hard, Graham; Roberson, Nena; Eaton, Fannie Brown

    1958-01-01T23:59:59.000Z

    . For this % smartly dressed persen selects accesrories in scale with her size. A large, hmvy-looking purse or hut does not kmpliment the small, dainty pars&. Tke tiny hat with dktinty trimming is net beccrming t~ a largp person. (See propottion.) k-p~oin, neutral... FOR LOOKING SMART ~ssories prove costly if they are good for Choose ucce y one or two wearings. You will choose re wisely if you heed these fashion hints: x~ensive accessories, such as hats, shoes handbags usually should be the same lot of irmffkfb...

  11. Reliability analysis of electric power systems including time dependent sources 

    E-Print Network [OSTI]

    Kim, Younjong

    1987-01-01T23:59:59.000Z

    Chairman of Advisory Committee: Chanan Singh A method for reliability analysis of electric power systems with time dependent sources, such as photovoltaic and wind generation, is introduced. The fluctuating characteristic of unconventional generation... and active solar. wind, geothermal, and hydropower. Of all the renewable energy technologies that have been the focus of encouraging government and private R k D efforts, photovoltaic generation and wind turbine generation appear to be the leading...

  12. Reliability analysis of electric power systems including time dependent sources

    E-Print Network [OSTI]

    Kim, Younjong

    1987-01-01T23:59:59.000Z

    ' the PEP S subsystem is computed by: POP, = NP POt (3. 22) where POPt = power output of the PEPS subsystem during the jth hour NP = number of PEPS units in the subsystem 25 The parameters used for designing the PEPS subsystem are taken from I5... and wind velocity data are obtained for output computation. The capacity of two unconventional subsystem is designed to be equal to each other. 5. 1 System Description Generation System For the purpose of this study, one of the EPRI reduced scenarios...

  13. INCUBATOR ACCESSORIES: NUAIFE. INC.

    E-Print Network [OSTI]

    Kleinfeld, David

    11 12 13 14 15 16 DESCRIPTIDN 3-WAY SDLENDID LAMP GREEN (115V) LAMP BLOCK SWITCH SPST BUZZER (120V) BUZZER (230V) LAMP RED (220V) LAMP RED (115V) POWER CORD (115V) POWER Switch continuously monitors the selected tank. Ifthe selected tank is Tank 1, the CO2 Tank 1 LED

  14. #include #include

    E-Print Network [OSTI]

    Campbell, Andrew T.

    process #12;#include #include pid_t pid = fork(); if (pid () failed */ } else if (pid == 0) { /* parent process */ } else { /* child process */ } #12;thread #12

  15. #include #include

    E-Print Network [OSTI]

    Poinsot, Laurent

    #include #include //Rappels : "getpid()" permet d'obtenir son propre pid // "getppid()" renvoie le pid du père d'un processus int main (void) { pid_t pid_fils; pid_fils = fork(); if(pid_fils==-1) { printf("Erreur de création du processus fils\

  16. Power Flow Analysis Algorithm for Islanded LV Microgrids Including Distributed Generator Units with

    E-Print Network [OSTI]

    Chaudhary, Sanjay

    Power Flow Analysis Algorithm for Islanded LV Microgrids Including Distributed Generator Units With larger portion of growing electricity demand which is being fed through distributed generation (DG power system. Being able to operate in both grid-connected and islanded mode, a microgrid manages

  17. Cheap catalyst gets expensive accessory | EMSL

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    accessory Released: October 17, 2014 Together, iron and palladium help remove oxygen for biofuel reaction The October 2014 cover of ACS Catalysis illustrates a...

  18. Analysis of the Thermonuclear Instability including Low-Power ICRH Minority Heating in IGNITOR

    E-Print Network [OSTI]

    Cardinali, Alessandro

    2014-01-01T23:59:59.000Z

    The nonlinear thermal balance equation for classical plasma in a toroidal geometry is analytically and numerically investigated including ICRH power. The determination of the equilibrium temperature and the analysis of the stability of the solution are performed by solving the energy balance equation that includes the transport relations obtained by the kinetic theory. An estimation of the confinement time is also provided. We show that the ICRH heating in the IGNITOR experiment, among other applications, is expected to stabilize the power of the thermonuclear burning by automatic regulation of the RF coupled power. Here a scenario is considered where IGNITOR is led to operate in a slightly sub-critical regime by adding a small fraction of ${}^3He$ to the nominal 50-50 Deuterium-Tritium mixture. The difference between power lost and alpha heating is compensated by additional ICRH heating, which should be able to increase the global plasma temperature via collisions between ${}^3He$ minority and the background...

  19. OPTIMAL OPERATION OF AN INTEGRATED ENERGY PARK INCLUDING FOSSIL FUEL POWER GENERATION,

    E-Print Network [OSTI]

    Stanford University

    OPTIMAL OPERATION OF AN INTEGRATED ENERGY PARK INCLUDING FOSSIL FUEL POWER GENERATION, CO2 CAPTURE AND WIND A THESIS SUBMITTED TO THE DEPARTMENT OF ENERGY RESOURCES ENGINEERING OF STANFORD UNIVERSITY of Master of Science in Energy Resources Engineering. (Louis J. Durlofsky) Principal Co-Adviser I certify

  20. rved.Announcements Apparel & Accessories

    E-Print Network [OSTI]

    the resulting methane for later use. Because windmills and solar panels only work when the wind's blowing power and efficiency of, uh, farts Here's a new green machine that coaxes microbes into farting, storing, in turn, can be used to power fuel cells or to store the electrical energy chemically until it's needed

  1. Reliability Evaluation of Composite Power Systems Including the Effects of Hurricanes

    E-Print Network [OSTI]

    Liu, Yong

    2011-02-22T23:59:59.000Z

    Adverse weather such as hurricanes can significantly affect the reliability of composite power systems. Predicting the impact of hurricanes can help utilities for better preparedness and make appropriate restoration arrangements...

  2. Dual battery sets including zinc MnO{sub 2} rechargeable cells on constant power tests

    SciTech Connect (OSTI)

    Schumm, B. Jr.

    1998-07-01T23:59:59.000Z

    Electric vehicle power requirements typically are much greater than what would be recommended for rechargeable zinc manganese dioxide alkaline batteries. In order to use the zinc manganese dioxide system as an economical power source for heavy load or pulse systems it is necessary to augment the pulse load carrying capability. Eagle-Cliffs is testing commercially available rechargeable zinc manganese dioxide cells in sets. These sets consist one configuration of the zinc manganese dioxide cells accompanied by a much lower capacity device ( which may be another configuration of zinc manganese dioxide cells) supporting any heavy pulse current requirements. Thus the zinc manganese dioxide cells provide at least a low cost, environmentally desirable main power battery and perhaps the pulse power yet the system still meets the intermittent high power needs of many uses. In this test program, small zinc manganese dioxide rechargeable cells are supported by a nickel cadmium battery or a different set of zinc manganese dioxide cells simulating any of a number of devices such as power batteries, large capacitors, flywheels, etc. Discharge performance demonstrating forty-five to fifty watt-hours per kilogram and 80 watts per kilogram is achieved by the system.

  3. Numerical power balance and free energy loss analysis for solar cells including optical, thermodynamic, and electrical aspects

    SciTech Connect (OSTI)

    Greulich, Johannes, E-mail: johannes.greulich@ise.fraunhofer.de; Höffler, Hannes; Würfel, Uli; Rein, Stefan [Fraunhofer Institute for Solar Energy Systems, Heidenhofstr. 2, D-79110 Freiburg (Germany)

    2013-11-28T23:59:59.000Z

    A method for analyzing the power losses of solar cells is presented, supplying a complete balance of the incident power, the optical, thermodynamic, and electrical power losses and the electrical output power. The involved quantities have the dimension of a power density (units: W/m{sup 2}), which permits their direct comparison. In order to avoid the over-representation of losses arising from the ultraviolet part of the solar spectrum, a method for the analysis of the electrical free energy losses is extended to include optical losses. This extended analysis does not focus on the incident solar power of, e.g., 1000?W/m{sup 2} and does not explicitly include the thermalization losses and losses due to the generation of entropy. Instead, the usable power, i.e., the free energy or electro-chemical potential of the electron-hole pairs is set as reference value, thereby, overcoming the ambiguities of the power balance. Both methods, the power balance and the free energy loss analysis, are carried out exemplarily for a monocrystalline p-type silicon metal wrap through solar cell with passivated emitter and rear (MWT-PERC) based on optical and electrical measurements and numerical modeling. The methods give interesting insights in photovoltaic (PV) energy conversion, provide quantitative analyses of all loss mechanisms, and supply the basis for the systematic technological improvement of the device.

  4. Termination for a superconducting power transmission line including a horizontal cryogenic bushing

    DOE Patents [OSTI]

    Minati, Kurt F. (Northport, NY); Morgan, Gerry H. (Patchogue, NY); McNerney, Andrew J. (Shoreham, NY); Schauer, Felix (Upton, NY)

    1984-01-01T23:59:59.000Z

    A termination for a superconducting power transmission line is disclosed which is comprised of a standard air entrance insulated vertical bushing with an elbow, a horizontal cryogenic bushing linking the pressurized cryogenic cable environment to the ambient temperature bushing and a stress cone which terminates the cable outer shield and transforms the large radial voltage gradient in the cable dielectric into a much lower radial voltage gradient in the high density helium coolant at the cold end of the cryogenic bushing.

  5. Reliability evaluation of electric power generation systems including unconventional energy sources

    E-Print Network [OSTI]

    Lago-Gonzalez, Alex

    1984-01-01T23:59:59.000Z

    through photovoltaic cells, and wind power generation, proto- types have been built and tested. Commercial operation of these two is expected to start in the late 1980's or early 1990's. For the rest of the alternatives the expected date of operation... appropiate for these units because they may have several derated states. However, due to the short operating experience with these units, there is not enough data available to develop more accurate models. 3. 1 Description of PEPS Photovoltaic electric...

  6. EIS-0066: The Role of Bonneville Power Administration in the Pacific Northwest Power Supply System- including its Participation in a Hydro-Thermal Power Program

    Broader source: Energy.gov [DOE]

    The Bonneville Power Administration (BPA) prepared this EIS to examine the environmental impacts of the Pacific Northwest Power Planning and Conservation Act, which will foster regional electric power planning in the four Northwest states, as well as increase BPA’s authority to address future power needs.

  7. accessory sex glands: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AUTOMOTIVE ACCESSORIES: RETHINKING DESIGN MATERIALS THROUGH CORNSTARCH, SUGARCANE AND HEMP CiteSeer Summary: Current bioproducts or bio-based products do not only require less...

  8. accessory palmaris longus: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AUTOMOTIVE ACCESSORIES: RETHINKING DESIGN MATERIALS THROUGH CORNSTARCH, SUGARCANE AND HEMP CiteSeer Summary: Current bioproducts or bio-based products do not only require less...

  9. accessory nerve: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AUTOMOTIVE ACCESSORIES: RETHINKING DESIGN MATERIALS THROUGH CORNSTARCH, SUGARCANE AND HEMP CiteSeer Summary: Current bioproducts or bio-based products do not only require less...

  10. accessory drive device: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AUTOMOTIVE ACCESSORIES: RETHINKING DESIGN MATERIALS THROUGH CORNSTARCH, SUGARCANE AND HEMP CiteSeer Summary: Current bioproducts or bio-based products do not only require less...

  11. accessory sex organs: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AUTOMOTIVE ACCESSORIES: RETHINKING DESIGN MATERIALS THROUGH CORNSTARCH, SUGARCANE AND HEMP CiteSeer Summary: Current bioproducts or bio-based products do not only require less...

  12. accessory parotid gland: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AUTOMOTIVE ACCESSORIES: RETHINKING DESIGN MATERIALS THROUGH CORNSTARCH, SUGARCANE AND HEMP CiteSeer Summary: Current bioproducts or bio-based products do not only require less...

  13. accessory papillary muscle: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AUTOMOTIVE ACCESSORIES: RETHINKING DESIGN MATERIALS THROUGH CORNSTARCH, SUGARCANE AND HEMP CiteSeer Summary: Current bioproducts or bio-based products do not only require less...

  14. accessory gland size: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AUTOMOTIVE ACCESSORIES: RETHINKING DESIGN MATERIALS THROUGH CORNSTARCH, SUGARCANE AND HEMP CiteSeer Summary: Current bioproducts or bio-based products do not only require less...

  15. accessory sex gland: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AUTOMOTIVE ACCESSORIES: RETHINKING DESIGN MATERIALS THROUGH CORNSTARCH, SUGARCANE AND HEMP CiteSeer Summary: Current bioproducts or bio-based products do not only require less...

  16. accessory proteins vpr: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AUTOMOTIVE ACCESSORIES: RETHINKING DESIGN MATERIALS THROUGH CORNSTARCH, SUGARCANE AND HEMP CiteSeer Summary: Current bioproducts or bio-based products do not only require less...

  17. accessory spleen findings: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AUTOMOTIVE ACCESSORIES: RETHINKING DESIGN MATERIALS THROUGH CORNSTARCH, SUGARCANE AND HEMP CiteSeer Summary: Current bioproducts or bio-based products do not only require less...

  18. accessory nerve results: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AUTOMOTIVE ACCESSORIES: RETHINKING DESIGN MATERIALS THROUGH CORNSTARCH, SUGARCANE AND HEMP CiteSeer Summary: Current bioproducts or bio-based products do not only require less...

  19. accessory ridges mxpar: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AUTOMOTIVE ACCESSORIES: RETHINKING DESIGN MATERIALS THROUGH CORNSTARCH, SUGARCANE AND HEMP CiteSeer Summary: Current bioproducts or bio-based products do not only require less...

  20. accessory middle cerebral: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AUTOMOTIVE ACCESSORIES: RETHINKING DESIGN MATERIALS THROUGH CORNSTARCH, SUGARCANE AND HEMP CiteSeer Summary: Current bioproducts or bio-based products do not only require less...

  1. accessory mineral growth: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AUTOMOTIVE ACCESSORIES: RETHINKING DESIGN MATERIALS THROUGH CORNSTARCH, SUGARCANE AND HEMP CiteSeer Summary: Current bioproducts or bio-based products do not only require less...

  2. accessory subunit ac45: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AUTOMOTIVE ACCESSORIES: RETHINKING DESIGN MATERIALS THROUGH CORNSTARCH, SUGARCANE AND HEMP CiteSeer Summary: Current bioproducts or bio-based products do not only require less...

  3. accessory cell requirements: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AUTOMOTIVE ACCESSORIES: RETHINKING DESIGN MATERIALS THROUGH CORNSTARCH, SUGARCANE AND HEMP CiteSeer Summary: Current bioproducts or bio-based products do not only require less...

  4. accessory subunit kchip2: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AUTOMOTIVE ACCESSORIES: RETHINKING DESIGN MATERIALS THROUGH CORNSTARCH, SUGARCANE AND HEMP CiteSeer Summary: Current bioproducts or bio-based products do not only require less...

  5. accessory minerals zirconolite: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AUTOMOTIVE ACCESSORIES: RETHINKING DESIGN MATERIALS THROUGH CORNSTARCH, SUGARCANE AND HEMP CiteSeer Summary: Current bioproducts or bio-based products do not only require less...

  6. accessory navicular bone: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AUTOMOTIVE ACCESSORIES: RETHINKING DESIGN MATERIALS THROUGH CORNSTARCH, SUGARCANE AND HEMP CiteSeer Summary: Current bioproducts or bio-based products do not only require less...

  7. accessorial services: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AUTOMOTIVE ACCESSORIES: RETHINKING DESIGN MATERIALS THROUGH CORNSTARCH, SUGARCANE AND HEMP CiteSeer Summary: Current bioproducts or bio-based products do not only require less...

  8. accessory gland proteins: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AUTOMOTIVE ACCESSORIES: RETHINKING DESIGN MATERIALS THROUGH CORNSTARCH, SUGARCANE AND HEMP CiteSeer Summary: Current bioproducts or bio-based products do not only require less...

  9. automotive accessories: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AUTOMOTIVE ACCESSORIES: RETHINKING DESIGN MATERIALS THROUGH CORNSTARCH, SUGARCANE AND HEMP CiteSeer Summary: Current bioproducts or bio-based products do not only require less...

  10. accessory mental foramen: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AUTOMOTIVE ACCESSORIES: RETHINKING DESIGN MATERIALS THROUGH CORNSTARCH, SUGARCANE AND HEMP CiteSeer Summary: Current bioproducts or bio-based products do not only require less...

  11. accessory spleen mimicking: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AUTOMOTIVE ACCESSORIES: RETHINKING DESIGN MATERIALS THROUGH CORNSTARCH, SUGARCANE AND HEMP CiteSeer Summary: Current bioproducts or bio-based products do not only require less...

  12. accessory spleen compromising: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AUTOMOTIVE ACCESSORIES: RETHINKING DESIGN MATERIALS THROUGH CORNSTARCH, SUGARCANE AND HEMP CiteSeer Summary: Current bioproducts or bio-based products do not only require less...

  13. accessory protein mrap: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AUTOMOTIVE ACCESSORIES: RETHINKING DESIGN MATERIALS THROUGH CORNSTARCH, SUGARCANE AND HEMP CiteSeer Summary: Current bioproducts or bio-based products do not only require less...

  14. accessory conduction pathways: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AUTOMOTIVE ACCESSORIES: RETHINKING DESIGN MATERIALS THROUGH CORNSTARCH, SUGARCANE AND HEMP CiteSeer Summary: Current bioproducts or bio-based products do not only require less...

  15. accessory pathways evaluation: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AUTOMOTIVE ACCESSORIES: RETHINKING DESIGN MATERIALS THROUGH CORNSTARCH, SUGARCANE AND HEMP CiteSeer Summary: Current bioproducts or bio-based products do not only require less...

  16. accessory conduction pathway: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AUTOMOTIVE ACCESSORIES: RETHINKING DESIGN MATERIALS THROUGH CORNSTARCH, SUGARCANE AND HEMP CiteSeer Summary: Current bioproducts or bio-based products do not only require less...

  17. accessory gland protein: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AUTOMOTIVE ACCESSORIES: RETHINKING DESIGN MATERIALS THROUGH CORNSTARCH, SUGARCANE AND HEMP CiteSeer Summary: Current bioproducts or bio-based products do not only require less...

  18. accessory anterolateral talar: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AUTOMOTIVE ACCESSORIES: RETHINKING DESIGN MATERIALS THROUGH CORNSTARCH, SUGARCANE AND HEMP CiteSeer Summary: Current bioproducts or bio-based products do not only require less...

  19. accessory pudendal arteries: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AUTOMOTIVE ACCESSORIES: RETHINKING DESIGN MATERIALS THROUGH CORNSTARCH, SUGARCANE AND HEMP CiteSeer Summary: Current bioproducts or bio-based products do not only require less...

  20. accessory soleus muscle: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AUTOMOTIVE ACCESSORIES: RETHINKING DESIGN MATERIALS THROUGH CORNSTARCH, SUGARCANE AND HEMP CiteSeer Summary: Current bioproducts or bio-based products do not only require less...

  1. Relay telescope including baffle, and high power laser amplifier utilizing the same

    DOE Patents [OSTI]

    Dane, C. Brent; Hackel, Lloyd; Harris, Fritz B.

    2006-09-19T23:59:59.000Z

    A laser system includes an optical path having an intracavity relay telescope with a telescope focal point for imaging an output of the gain medium between an image location at or near the gain medium and an image location at or near an output coupler for the laser system. A kinematic mount is provided within a vacuum chamber, and adapted to secure beam baffles near the telescope focal point. An access port on the vacuum chamber is adapted for allowing insertion and removal of the beam baffles. A first baffle formed using an alignment pinhole aperture is used during alignment of the laser system. A second tapered baffle replaces the alignment aperture during operation and acts as a far-field baffle in which off angle beams strike the baffle a grazing angle of incidence, reducing fluence levels at the impact areas.

  2. Encoding Pheromonal Signals in the Accessory Olfactory Bulb of

    E-Print Network [OSTI]

    Fee, Michale S.

    Encoding Pheromonal Signals in the Accessory Olfactory Bulb of Behaving Mice Minmin Luo,1 * Michale single neurons in the accessory olfactory bulb, a nucleusthatprocessespheromonalsignals with sources of pheromones (4, 5). Olfactory receptor neurons project to the main olfactory bulb (MOB), whose

  3. Comparative genomics of the core and accessory genomes of 48 Sinorhizobium strains comprising five genospecies

    E-Print Network [OSTI]

    2013-01-01T23:59:59.000Z

    annotation and comparative genomics. Database (Oxford) 2009,et al. : Comparative genomics of the core and accessoryComparative genomics of the core and accessory genomes of 48

  4. ADVANCED POWER SYSTEMS - ASH BEHAVIOR IN POWER SYSTEMS. INCLUDES THE SEMIANNUAL REPORT FOR THE PERIOD JANUARY 01, 1998 - JUNE 30, 1998.

    SciTech Connect (OSTI)

    NONE

    1998-09-01T23:59:59.000Z

    The overall goal of this initiative is to develop fundamental knowledge of ash behavior in power systems for the purpose of increasing power production efficiency, reducing operation and maintenance costs, and reducing greenhouse gas emissions into the atmosphere. The specific objectives of this initiative focus primarily on ash behavior related to advanced power systems and include the following: Determine the current status of the fundamental ash interactions and deposition formation mechanisms as already reported through previous or ongoing projects at the EERC or in the literature; Determine sintering mechanisms for temperatures and particle compositions that are less well known and remain for the most part undetermined; Identify the relationship between the temperature of critical viscosity (T{sub cv}) as measured in a viscometer and the crystallization occurring in the melt; Perform a literature search on the use of heated-stage microscopy (HSM) for examining in situ ash-sintering phenomena and then validate the use of HSM in the determination of viscosity in spherical ash particles; Ascertain the formation and stability of specific mineral or amorphous phases in deposits typical of advanced power systems; and Evaluate corrosion for alloys being used in supercritical combustion systems.

  5. What next for accessory dwellings? : getting from bylaws to buildings

    E-Print Network [OSTI]

    Stege, Elinor Hope

    2009-01-01T23:59:59.000Z

    Accessory dwellings-secondary, self-contained housing units on the same property as a primary residence, either attached to or detached from the main dwelling, and subordinate in size, location and appearance-are recognized ...

  6. accessories fluido air: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    has satisfaction and self... Boyles, Rheba Merle; Hard, Graham; Roberson, Nena; Eaton, Fannie Brown 1958-01-01 3 6035 Hg(Ar) Lamp in 6058 Fiber Optic Accessory. Pencil...

  7. Our lab focuses on materials durability in extreme environments for energy, power, and propulsion applications. Current research interests include

    E-Print Network [OSTI]

    Acton, Scott

    applications. Current research interests include oxidation and corrosion of ceramics and ceramic matrix-the-art capabilities in isotopic mapping by Time-of-Flight Secondary Ion Mass Spectrometry. Ceramic Matrix Composites for Combustion Applications SiC-based Ceramic Matrix Composites are currently under development for turbine

  8. Environmental impact statement/state analysis report. Cedar Bay Cogeneration Project, Jacksonville, Florida (EPA and FDER). Including Technical Appendix. Draft report. [Independent Power Generation

    SciTech Connect (OSTI)

    Not Available

    1990-05-01T23:59:59.000Z

    AES/Cedar Bay, Inc. proposes to construct and operate a cogeneration facility on and existing industrial site within the North District of Duval County, approximately eight miles north of Jacksonville, Florida. The plant will produce 225 megawatts of electricity for sale to Florida Power and Light Company. In addition, steam will be sold to the adjacent Seminole Kraft Corporation paper mill. The document, prepared pursuant to the National Environmental Policy Act, assesses the proposed project and alternatives with respect to impacts on the natural and man-made environments. Potential mitigative measures are also evaluated. The Technical Appendix includes a copy of U.S. EPA's draft National Pollutant Discharge Elimination System permit, FDER's Conditions of Power Plant Siting Certification, as well as other state agency reports pertinent to the proposed project.

  9. Binding-induced Stabilization and Assembly of the Phage P22 Tail Accessory Factor gp4

    SciTech Connect (OSTI)

    Olia,A.; Al-Bassam, J.; Winn-Stapley, D.; Joss, L.; Casjens, S.; Cingolani, G.

    2006-01-01T23:59:59.000Z

    To infect and replicate, bacteriophage P22 injects its 43 kbp genome across the cell wall of Salmonella enterica serovar Typhimurium. The attachment of phage P22 to the host cell as well as the injection of the viral DNA into the host is mediated by the virion's tail complex. This 2.8 MDa molecular machine is formed by five proteins, which include the portal protein gp1, the adhesion tailspike protein gp9, and three tail accessory factors: gp4, gp10, gp26. We have isolated the tail accessory factor gp4 and characterized its structure and binding interactions with portal protein. Interestingly, gp4 exists in solution as a monomer, which displays an exceedingly low structural stability (T{sub m} 34 {sup o}C). Unfolded gp4 is prone to aggregation within a narrow range of temperatures both in vitro and in Salmonella extracts. In the virion the thermal unfolding of gp4 is prevented by the interaction with the dodecameric portal protein, which stabilizes the structure of gp4 and suppresses unfolded gp4 from irreversibly aggregating in the Salmonella milieu. The structural stabilization of gp4 is accompanied by the concomitant oligomerization of the protein to form a ring of 12 subunits bound to the lower end of the portal ring. The interaction of gp4 with portal protein is complex and likely involves the distinct binding of two non-equivalent sets of six gp4 proteins. Binding of the first set of six gp4 equivalents to dodecameric portal protein yields a gp(1){sub 12}:gp(4){sub 6} assembly intermediate, which is stably populated at 30 {sup o}C and can be resolved by native gel electrophoresis. The final product of the assembly reaction is a bi-dodecameric gp(1){sub 12}:gp(4){sub 12} complex, which appears hollow by electron microscopy, suggesting that gp4 does not physically plug the DNA entry/exit channel, but acts as a structural adaptor for the other tail accessory factors: gp10 and gp26.

  10. Large power transformers

    SciTech Connect (OSTI)

    Karsai, K.; Kerenyi, D.; Kiss, L.

    1987-01-01T23:59:59.000Z

    The book deals with the following aspects of transformer engineering: general principles governing the function of transformers, iron cores, windings, stray losses caused by stray flux, the insulation of transformers, and the structural parts and accessories. This edition includes the developments in theory and practice on the basis of the authors' experience in design, manufacturing and testing of large transformers. New developments have been particularly extensive in the fields of new magnetic materials, cooling methods, dielectric strength for overvoltages of different types, and stray-load loss problems, which are presented in the book in detail. The many diagrams in the book can be used directly in the design, manufacture and testing of large transformers. In preparing their text, the authors have aimed to satisfy the demand for a work that summarizes the latest experience in development and design of large power transformers.

  11. Power plant including an exhaust gas recirculation system for injecting recirculated exhaust gases in the fuel and compressed air of a gas turbine engine

    DOE Patents [OSTI]

    Anand, Ashok Kumar; Nagarjuna Reddy, Thirumala Reddy; Shaffer, Jason Brian; York, William David

    2014-05-13T23:59:59.000Z

    A power plant is provided and includes a gas turbine engine having a combustor in which compressed gas and fuel are mixed and combusted, first and second supply lines respectively coupled to the combustor and respectively configured to supply the compressed gas and the fuel to the combustor and an exhaust gas recirculation (EGR) system to re-circulate exhaust gas produced by the gas turbine engine toward the combustor. The EGR system is coupled to the first and second supply lines and configured to combine first and second portions of the re-circulated exhaust gas with the compressed gas and the fuel at the first and second supply lines, respectively.

  12. Positive Selection on Nucleotide Substitutions and Indels in Accessory Gland Proteins of the Drosophila pseudoobscura Subgroup

    E-Print Network [OSTI]

    Hellberg, Michael E.

    Positive Selection on Nucleotide Substitutions and Indels in Accessory Gland Proteins due to positive selection on nucleotide substitutions. While this general pattern is well established little explored, nor have possible targets of positive selection other than nucleotide substitutions

  13. A study of the incidence and histology of accessory corpora lutea in swine

    E-Print Network [OSTI]

    Schultz, Lewis Russell

    1969-01-01T23:59:59.000Z

    A STUDY OF THE INCIDENCE AND HISTOLOGY OF ACCESSORY CORPORA LUTEA IN SWINE A Thesis by LEWIS R. SCHULTZ Submitted to the Graduate College of Texas A&M University in partial fulfillment of the requirement for the degree of MASTER OF SCIENCE... May 1969 Major Subject: Physiology of Reproduction A STUDY OF THE INCIDENCE AND HISTOLOGY OF ACCESSORY CORPORA LUTEA IN SWINE A Thesis by LEWIS R. SCHULTZ Approved as to style and content by: (Chairman of Committee) (Head of Department) (M...

  14. inverter. He is the author or co-author of more than 300 publica-tions in his research fields including the book `Control in Power

    E-Print Network [OSTI]

    Simőes, Marcelo Godoy

    is connected to the grid or to other sources or storage, it can easily approach 100 kW [1]. Very specialized and custom-made wound- rotor schemes enable even higher power. More recently, power electronics and micro supple- ments, and asynchronous injection of power into the grid. Generator Selection for Wind Energy

  15. Truck Essential Power Systems Efficiency Improvements for Medium-Duty Trucks

    SciTech Connect (OSTI)

    Larry Slone; Jeffery Birkel

    2007-12-31T23:59:59.000Z

    With a variety of hybrid vehicles available in the passenger car market, electric technologies and components of that scale are becoming readily available. Commercial vehicle segments have lagged behind passenger car markets, leaving opportunities for component and system development. Escalating fuel prices impact all markets and provide motivation for OEMs, suppliers, customers, and end-users to seek new techniques and technologies to deliver reduced fuel consumption. The research presented here specifically targets the medium-duty (MD), Class 4-7, truck market with technologies aimed at reducing fuel consumption. These technologies could facilitate not only idle, but also parasitic load reductions. The development efforts here build upon the success of the More Electric Truck (MET) demonstration program at Caterpillar Inc. Employing a variety of electric accessories, the MET demonstrated the improvement seen with such technologies on a Class 8 truck. The Truck Essential Power Systems Efficiency Improvements for Medium-Duty Trucks (TEPS) team scaled the concepts and successes of MET to a MD chassis. The team designed an integrated starter/generator (ISG) package and energy storage system (ESS), explored ways to replace belt and gear-driven accessory systems, and developed supervisory control algorithms to direct the usage of the generated electricity and system behavior on the vehicle. All of these systems needed to fit within the footprint of a MD vehicle and be compatible with the existing conventional systems to the largest extent possible. The overall goal of this effort was to demonstrate a reduction in fuel consumption across the drive cycle, including during idle periods, through truck electrification. Furthermore, the team sought to evaluate the benefits of charging the energy storage system during vehicle braking. The vehicle features an array of electric accessories facilitating on-demand, variable actuation. Removal of these accessories from the belt or geartrain of the engine yields efficiency improvements for the engine while freeing those accessories to perform at their individual peak efficiencies to meet instantaneous demand. The net result is a systems approach to fuel usage optimization. Unique control algorithms were specifically developed to capitalize on the flexibility afforded by the TEPS architecture. Moreover, the TEPS truck technology mixture exhibits a means to supplant current accessory power sources such as on-board or trailer-mounted gasoline-powered generators or air compressors. Such functionality further enhances the value of the electric systems beyond the fuel savings alone. To demonstrate the fuel economy improvement wrought via the TEPS components, vehicle fuel economy testing was performed on the nearly stock (baseline) truck and the TEPS truck. Table 1 illustrates the fuel economy gains produced by the TEPS truck electrification. While the fuel economy results shown in Table 1 do reflect specific test conditions, they show that electrification of accessory hardware can yield significant fuel savings. In this case, the savings equated to a 15 percent reduction in fuel consumption during controlled on-road testing. Truck electrification allows engine shutdown during idle conditions as well as independent on-demand actuation of accessory systems. In some cases, independent actuation may even include lack of operation, a feature not always present in mechanically driven components. This combination of attributes allows significant improvements in system efficiency and the fuel economy improvements demonstrated by the TEPS team.

  16. A power system includes an engine, a motor/generator operatively connected to the engine, and a starter operatively connected to at least one of the engine and the motor/generator.

    DOE Patents [OSTI]

    Hoff, Brian D. (East Peoria, IL); Algrain, Marcelo C. (Peoria, IL)

    2008-12-09T23:59:59.000Z

    A power system includes an engine, a motor/generator operatively connected to the engine, and a starter operatively connected to at least one of the engine and the motor/generator.

  17. accessory left atrial: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    23 24 25 Next Page Last Page Topic Index 401 PREDICTION OF REMAINING LIFE OF POWER TRANSFORMERS BASED ON LEFT TRUNCATED AND RIGHT Mathematics Websites Summary: PREDICTION OF...

  18. Wireless Power May Cut the Cord for Plug-In Devices, Including Cars1 by Will Ferguson for National Geographic News, abbreviated2

    E-Print Network [OSTI]

    South Bohemia, University of

    ), aims to redefine how people use8 energy, making it possible to power devices without ever plugging them inches." WiTricity devices share energy through magnetic fields as well. However, unlike those generated legs at the resonant frequency of a swing to fly through the air, or an opera singer shatters a24 wine

  19. Promoting Eco Friendly Lifestyle to Save Enviornment Accessories

    E-Print Network [OSTI]

    Chiao, Jung-Chih

    . Siemens Wind Energy www.siemens.com/wind-power Siemens clean energy technology. Made in America windmills that are merely 1.8 mm wide are smaller than a grain of rice. They are able to transform the wind

  20. Material flows of mobile phones and accessories in Nigeria: Environmental implications and sound end-of-life management options

    SciTech Connect (OSTI)

    Osibanjo, Oladele [Department of Chemistry, University of Ibadan, Ibadan, Oyo State (Nigeria)], E-mail: osibanjo@baselnigeria.org; Nnorom, Innocent Chidi [Department of Industrial Chemistry, Abia State University Uturu (Nigeria)

    2008-02-15T23:59:59.000Z

    Presently, Nigeria is one of the fastest growing Telecom markets in the world. The country's teledensity increased from a mere 0.4 in 1999 to 10 in 2005 following the liberalization of the Telecom sector in 2001. More than 25 million new digital mobile lines have been connected by June 2006. Large quantities of mobile phones and accessories including secondhand and remanufactured products are being imported to meet the pent-up demand. This improvement in mobile telecom services resulted in the preference of mobile telecom services to fixed lines. Consequently, the contribution of fixed lines decreased from about 95% in year 2000 to less than 10% in March 2005. This phenomenal progress in information technology has resulted in the generation of large quantities of electronic waste (e-waste) in the country. Abandoned fixed line telephone sets estimated at 120,000 units are either disposed or stockpiled. Increasing quantities of waste mobile phones estimated at 8 million units by 2007, and accessories will be generated. With no material recovery facility for e-waste and/or appropriate solid waste management infrastructure in place, these waste materials end up in open dumps and unlined landfills. These practices create the potential for the release of toxic metals and halocarbons from batteries, printed wiring boards, liquid crystal display and plastic housing units. This paper presents an overview of the developments in the Nigerian Telecom sector, the material in-flow of mobile phones, and the implications of the management practices for wastes from the Telecom sector in the country.

  1. EST analysis of male accessory glands from Heliconius butterflies with divergent mating systems

    E-Print Network [OSTI]

    Walters, James R.; Harrison, Richard G.

    2008-12-08T23:59:59.000Z

    proteins observed in the male accessory gland cDNA libraries. Dots (.) indicate identity between sequences; tildes (~) represent alignment gaps; Hme00007 MNKILILLVVILGAMCLVEAEHDSNLDSKRAAGCPPGQEEYYGMCYGTRKSESGRRDQSGGLNNNNRRSQ Her00048 .KN..N..L..MA...I.A.....YYPS.N.RQ.P.........N.R...S.QG.I.ELG..R~~HHIG...E Hme00007 NEGLNNNNRRSQWEGLNNNNRRSQREGLNNNNRRSQSRELNNNNRRSQSGELNNNNRRSQREGLNNNNRR Her00048 .S* Hme00007...

  2. Version control Version control is a powerful tool for many kinds of work done over a period of time, including writing

    E-Print Network [OSTI]

    Alavi, Ali

    is a good idea are: · efficient development practices. It is very easy to try things out and experiment of time, including writing papers and theses as well as writing code. This session gives a introduction communication via a central server which stores the repository whereas a DVCS is completely distributed and each

  3. Environmental externalities: Applying the concept to Asian coal-based power generation. [Includes external environmental and societal costs and methods of evaluating them

    SciTech Connect (OSTI)

    Szpunar, C.B.; Gillette, J.L.

    1993-03-01T23:59:59.000Z

    This report examines the concept of environmental externality. It discusses various factors -- the atmospheric transformations, relationship of point-source emissions to ambient air quality, dose-response relationships, applicable cause-and-effect principles, and risk and valuation research -- that are considered by a number of state utilities when they apply the environmental externality concept to energy resource planning. It describes a methodology developed by Argonne National Laboratory for general use in resource planning, in combination with traditional methods that consider the cost of electricity production. Finally, it shows how the methodology can be applied in Indonesia, Thailand, and Taiwan to potential coal-fired power plant projects that will make use of clean coal technologies.

  4. MHK technologies include current energy conversion

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    research leverages decades of experience in engineering and design and analysis (D&A) of wind power technologies, and its vast research complex, including high-performance...

  5. Internship Contract (Includes Practicum)

    E-Print Network [OSTI]

    Thaxton, Christopher S.

    Internship Contract (Includes Practicum) Student's name-mail: _________________________________________ Internship Agency Contact Agency Name: ____________________________________ Address-mail: __________________________________________ Location of Internship, if different from Agency: ________________________________________________ Copies

  6. Pump apparatus including deconsolidator

    DOE Patents [OSTI]

    Sonwane, Chandrashekhar; Saunders, Timothy; Fitzsimmons, Mark Andrew

    2014-10-07T23:59:59.000Z

    A pump apparatus includes a particulate pump that defines a passage that extends from an inlet to an outlet. A duct is in flow communication with the outlet. The duct includes a deconsolidator configured to fragment particle agglomerates received from the passage.

  7. Living Expenses (includes approximately

    E-Print Network [OSTI]

    Maroncelli, Mark

    & engineering programs All other programs Graduate: MBA/INFSY at Erie & Harrisburg (12 credits) Business Guarantee 3 (Does not include Dependents Costs4 ) Altoona, Berks, Erie, and Harrisburg 12-Month Estimated

  8. EE Regional Technology Roadmap Includes comparison

    E-Print Network [OSTI]

    EE Regional Technology Roadmap Includes comparison against 6th Power Plan (Update cyclically Data Clearinghouse BPA/RTF NEEA/Regional Programs Group Update Regional EE Technology Roadmap Lighting

  9. 6035 Hg(Ar) Lamp in 6058 Fiber Optic Accessory. Pencil Style Calibration Lamps

    E-Print Network [OSTI]

    Woodall, Jerry M.

    to that of the Hg(Ar) Lamp, which is the characteristic mercury line spectrum. Forced air-cooling (i.e. from of the handle for connection to the power supply. Table 1 Usable Wavelengths of Spectral Calibration Lamps (in.2 1079.8 1084.5 1114.3 Power Supplies; AC versus DC We offer different power supplies for different needs

  10. In-vessel Retention Strategy for High Power Reactors - K-INERI Final Report (includes SBLB Test Results for Task 3 on External Reactor Vessel Cooling (ERVC) Boiling Data and CHF Enhancement Correlations)

    SciTech Connect (OSTI)

    F. B. Cheung; J. Yang; M. B. Dizon; J. Rempe

    2005-01-01T23:59:59.000Z

    In-vessel retention (IVR) of core melt is a key severe accident management strategy adopted by some operating nuclear power plants and proposed for some advanced light water reactors (ALWRs). If there were inadequate cooling during a reactor accident, a significant amount of core material could become molten and relocate to the lower head of the reactor vessel, as happened in the Three Mile Island Unit 2 (TMI-2) accident. If it is possible to ensure that the vessel head remains intact so that relocated core materials are retained within the vessel, the enhanced safety associated with these plants can reduce concerns about containment failure and associated risk. For example, the enhanced safety of the Westinghouse Advanced 600 MWe PWR (AP600), which relied upon External Reactor Vessel Cooling (ERVC) for IVR, resulted in the U.S. Nuclear Regulatory Commission (US NRC) approving the design without requiring certain conventional features common to existing LWRs. However, it is not clear that currently proposed external reactor vessel cooling (ERVC) without additional enhancements could provide sufficient heat removal for higher-power reactors (up to 1500 MWe). Hence, a collaborative, three-year, U.S. - Korean International Nuclear Energy Research Initiative (INERI) project was completed in which the Idaho National Engineering and Environmental Laboratory (INEEL), Seoul National University (SNU), Pennsylvania State University (PSU), and the Korea Atomic Energy Research Institute (KAERI) investigated the performance of ERVC and an in-vessel core catcher (IVCC) to determine if IVR is feasible for reactors up to 1500 MWe.

  11. Power system

    DOE Patents [OSTI]

    Hickam, Christopher Dale (Glasford, IL)

    2008-03-18T23:59:59.000Z

    A power system includes a prime mover, a transmission, and a fluid coupler having a selectively engageable lockup clutch. The fluid coupler may be drivingly connected between the prime mover and the transmission. Additionally, the power system may include a motor/generator drivingly connected to at least one of the prime mover and the transmission. The power-system may also include power-system controls configured to execute a control method. The control method may include selecting one of a plurality of modes of operation of the power system. Additionally, the control method may include controlling the operating state of the lockup clutch dependent upon the mode of operation selected. The control method may also include controlling the operating state of the motor/generator dependent upon the mode of operation selected.

  12. Power Right. Power Smart. Efficient Computer Power Supplies and...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AC power that you get from your electric company into the DC power consumed by most electronics, including your computer. We expect our power supplies to be safe, reliable, and...

  13. Power management system

    DOE Patents [OSTI]

    Algrain, Marcelo C. (Peoria, IL); Johnson, Kris W. (Washington, IL); Akasam, Sivaprasad (Peoria, IL); Hoff, Brian D. (East Peoria, IL)

    2007-10-02T23:59:59.000Z

    A method of managing power resources for an electrical system of a vehicle may include identifying enabled power sources from among a plurality of power sources in electrical communication with the electrical system and calculating a threshold power value for the enabled power sources. A total power load placed on the electrical system by one or more power consumers may be measured. If the total power load exceeds the threshold power value, then a determination may be made as to whether one or more additional power sources is available from among the plurality of power sources. At least one of the one or more additional power sources may be enabled, if available.

  14. Including Variability in Large-Scale Cluster Power Models

    E-Print Network [OSTI]

    Rivoire, Suzanne

    , mobile (laptop), desktop, and server processor spac- es, reflecting energy-efficient server.rivoire@sonoma.edu University of CA, Santa Cruz3 eka@soe.ucsc.edu Abstract--Studying the energy efficiency of large five-node clusters using embedded, laptop, desktop, and server processors. The variation is manifested

  15. Data:B0f7ee6d-3f73-4104-9dc1-ec5083dd1c49 | Open Energy Information

    Open Energy Info (EERE)

    installations protect the area served by such systems. Lighting accessory to the use of power is permitted under this schedule. All other lighting, including any lighting for...

  16. Power Factor Reactive Power

    E-Print Network [OSTI]

    motor power: 117.7 V x 5.1 A = 600 W? = 0.6 kW? NOT the power measured by meter #12;Page 9 PSERC: displacement power factor: angle between voltage and current = 0 degrees pf = cos(0 degrees) = 1.0 true powerPage 1 PSERC Power Factor and Reactive Power Ward Jewell Wichita State University Power Systems

  17. Dynamic Reactive Power Control of Isolated Power Systems

    E-Print Network [OSTI]

    Falahi, Milad

    2012-10-03T23:59:59.000Z

    This dissertation presents dynamic reactive power control of isolated power systems. Isolated systems include MicroGrids in islanded mode, shipboard power systems operating offshore, or any other power system operating in islanded mode intentionally...

  18. Countries Gasoline Prices Including Taxes

    Gasoline and Diesel Fuel Update (EIA)

    Selected Countries (U.S. dollars per gallon, including taxes) Date Belgium France Germany Italy Netherlands UK US 51115 6.15 6.08 6.28 6.83 6.96 6.75 3.06 5415 6.14 6.06...

  19. Sponsorship includes: Agriculture in the

    E-Print Network [OSTI]

    Nebraska-Lincoln, University of

    Sponsorship includes: · Agriculture in the Classroom · Douglas County Farm Bureau · Gifford Farm · University of Nebraska Agricultural Research and Development Center · University of Nebraska- Lincoln Awareness Coalition is to help youth, primarily from urban communities, become aware of agriculture

  20. Hybrid powertrain system including smooth shifting automated transmission

    DOE Patents [OSTI]

    Beaty, Kevin D.; Nellums, Richard A.

    2006-10-24T23:59:59.000Z

    A powertrain system is provided that includes a prime mover and a change-gear transmission having an input, at least two gear ratios, and an output. The powertrain system also includes a power shunt configured to route power applied to the transmission by one of the input and the output to the other one of the input and the output. A transmission system and a method for facilitating shifting of a transmission system are also provided.

  1. Oak Ridge National Laboratory Annual Progress Report for the Power Electronics and Electric Machinery Program

    SciTech Connect (OSTI)

    Olszewski, M.

    2006-10-31T23:59:59.000Z

    The U.S. Department of Energy (DOE) and the U.S. Council for Automotive Research (composed of automakers Ford, General Motors, and DaimlerChrysler) announced in January 2002 a new cooperative research effort. Known as FreedomCAR (derived from 'Freedom' and 'Cooperative Automotive Research'), it represents DOE's commitment to developing public/private partnerships to fund high-risk, high-payoff research into advanced automotive technologies. Efficient fuel cell technology, which uses hydrogen to power automobiles without air pollution, is a very promising pathway to achieve the ultimate vision. The new partnership replaces and builds upon the Partnership for a New Generation of Vehicles initiative that ran from 1993 through 2001. The Vehicle Systems subprogram within the FreedomCAR and Vehicle Technologies Program provides support and guidance for many cutting-edge automotive and heavy truck technologies now under development. Research is focused on understanding and improving the way the various new components of tomorrow's automobiles and heavy trucks will function as a unified system to improve fuel efficiency. This work also supports the development of advanced automotive accessories and the reduction of parasitic losses (e.g., aerodynamic drag, thermal management, friction and wear, and rolling resistance). In supporting the development of hybrid propulsion systems, the Vehicle Systems subprogram has enabled the development of technologies that will significantly improve fuel economy, comply with projected emissions and safety regulations, and use fuels produced domestically. The Vehicle Systems subprogram supports the efforts of the FreedomCAR and Fuel Partnership and the 21st Century Truck Partnership through a three-phase approach intended to: (1) Identify overall propulsion and vehicle-related needs by analyzing programmatic goals and reviewing industry's recommendations and requirements and then develop the appropriate technical targets for systems, subsystems, and component research and development activities; (2) Develop and validate individual subsystems and components, including electric motors, emission control devices, battery systems, power electronics, accessories, and devices to reduce parasitic losses; and (3) Determine how well the components and subsystems work together in a vehicle environment or as a complete propulsion system and whether the efficiency and performance targets at the vehicle level have been achieved. The research performed under the Vehicle Systems subprogram will help remove technical and cost barriers to enable the development of technology for use in such advanced vehicles as hybrid and fuel-cell-powered automobiles that meet the goals of the FreedomCAR Program. A key element in making hybrid electric vehicles practical is providing an affordable electric traction drive system. This will require attaining weight, volume, and cost targets for the power electronics and electrical machines subsystems of the traction drive system. Areas of development include these: (1) Novel traction motor designs that result in increased power density and lower cost; (2) Inverter technologies involving new topologies to achieve higher efficiency and the ability to accommodate higher-temperature environments; (3) Converter concepts that employ means of reducing the component count and integrating functionality to decrease size, weight, and cost; (4) More effective thermal control and packaging technologies; and (5) Integrated motor/inverter concepts. The Oak Ridge National Laboratory's (ORNL's) Power Electronics and Electric Machinery Research Center conducts fundamental research, evaluates hardware, and assists in the technical direction of the DOE Office of FreedomCAR and Vehicle Technologies Program, Power Electronics and Electric Machinery Program. In this role, ORNL serves on the FreedomCAR Electrical and Electronics Technical Team, evaluates proposals for DOE, and lends its technological expertise to the direction of projects and evaluation of developing technologies. ORNL also executes speci

  2. Power Electronics Symposium 2011 | ornl.gov

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    of expertise at the Center include: Advanced Power Electronics Electric Machines Thermal Control for Power Electronics Power Quality and Utility Interconnection The symposium will...

  3. Power Electonics & Electric Machinery | Clean Energy | ORNL

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Areas of expertise include advanced power electronics, electric machines, thermal control for power electronics, and power quality and utility interconnection. For more...

  4. Power Plant Power Plant

    E-Print Network [OSTI]

    Tingley, Joseph V.

    Basin Center for Geothermal Energy at University of Nevada, Reno (UNR) 2 Nevada Geodetic LaboratoryStillwater Power Plant Wabuska Power Plant Casa Diablo Power Plant Glass Mountain Geothermal Area Lassen Geothermal Area Coso Hot Springs Power Plants Lake City Geothermal Area Thermo Geothermal Area

  5. Green Power Purchase Plan

    Broader source: Energy.gov [DOE]

    Class I renewable energy resources include solar, wind, new sustainable biomass, landfill gas, fuel cells (using renewable or non-renewable fuels), ocean thermal power, wave or tidal power, low...

  6. Parts and Accessories: Essays

    E-Print Network [OSTI]

    Jackson, Kari

    2010-05-31T23:59:59.000Z

    it, his aviator sunglasses overwhelming my nose. I don‘t remember them together. The memories are all split. There were several inches of snow on the ground the day in January 2001 when 143 million cubic feet of compressed natural gas seeped...

  7. Battery control system for hybrid vehicle and method for controlling a hybrid vehicle battery

    DOE Patents [OSTI]

    Bockelmann, Thomas R. (Battle Creek, MI); Hope, Mark E. (Marshall, MI); Zou, Zhanjiang (Battle Creek, MI); Kang, Xiaosong (Battle Creek, MI)

    2009-02-10T23:59:59.000Z

    A battery control system for hybrid vehicle includes a hybrid powertrain battery, a vehicle accessory battery, and a prime mover driven generator adapted to charge the vehicle accessory battery. A detecting arrangement is configured to monitor the vehicle accessory battery's state of charge. A controller is configured to activate the prime mover to drive the generator and recharge the vehicle accessory battery in response to the vehicle accessory battery's state of charge falling below a first predetermined level, or transfer electrical power from the hybrid powertrain battery to the vehicle accessory battery in response to the vehicle accessory battery's state of charge falling below a second predetermined level. The invention further includes a method for controlling a hybrid vehicle powertrain system.

  8. Enabling Wind Power Nationwide

    Office of Environmental Management (EM)

    including natural gas, and competing renewable power resources such as solar photovoltaics. Figure 4-3. Wind turbine hub height trends in Germany from 2007 to 2014 Source:...

  9. Green Power Purchasing

    Broader source: Energy.gov [DOE]

    Eligible resources include tidal and wave power, fuel cells using renewable fuels, hydropower facilities less than 60 megawatts (MW), solar thermal-electric systems, photovoltaics (PV), wind,...

  10. Concentrated Thermoelectric Power

    Broader source: Energy.gov (indexed) [DOE]

    electricity. Representing about 15% of the total system cost, power blocks include the steam turbine, generator, and associated equipment such as condensers and water treatment...

  11. FY 2005 Oak Ridge National Laboratory Annual Progress Report for the Power Electronics and Electric Machinery Program

    SciTech Connect (OSTI)

    Olszewski, M

    2005-11-22T23:59:59.000Z

    The U.S. Department of Energy (DOE) and the U.S. Council for Automotive Research (composed of automakers Ford, General Motors, and DaimlerChrysler) announced in January 2002 a new cooperative research effort. Known as FreedomCAR (derived from ''Freedom'' and ''Cooperative Automotive Research''), it represents DOE's commitment to developing public/private partnerships to fund high-risk, high-payoff research into advanced automotive technologies. Efficient fuel cell technology, which uses hydrogen to power automobiles without air pollution, is a very promising pathway to achieve the ultimate vision. The new partnership replaces and builds upon the Partnership for a New Generation of Vehicles initiative that ran from 1993 through 2001. The Vehicle Systems subprogram within the FreedomCAR and Vehicle Technologies Program provides support and guidance for many cutting-edge automotive and heavy truck technologies now under development. Research is focused on understanding and improving the way the various new components of tomorrow's automobiles and heavy trucks will function as a unified system to improve fuel efficiency. This work also supports the development of advanced automotive accessories and the reduction of parasitic losses (e.g., aerodynamic drag, thermal management, friction and wear, and rolling resistance). In supporting the development of hybrid propulsion systems, the Vehicle Systems subprogram has enabled the development of technologies that will significantly improve fuel economy, comply with projected emissions and safety regulations, and use fuels produced domestically. The Vehicle Systems subprogram supports the efforts of the FreedomCAR and Fuel and the 21st Century Truck Partnerships through a three-phase approach intended to: (1) Identify overall propulsion and vehicle-related needs by analyzing programmatic goals and reviewing industry's recommendations and requirements, then develop the appropriate technical targets for systems, subsystems, and component research and development activities; (2) Develop and validate individual subsystems and components, including electric motors, emission control devices, battery systems, power electronics, accessories, and devices to reduce parasitic losses; and (3) Determine how well the components and subsystems work together in a vehicle environment or as a complete propulsion system and whether the efficiency and performance targets at the vehicle level have been achieved. The research performed under the Vehicle Systems subprogram will help remove technical and cost barriers to enable technology for use in such advanced vehicles as hybrid and fuel-cell-powered automobiles that meet the goals of the FreedomCAR Program. A key element in making hybrid electric vehicles practical is providing an affordable electric traction drive system. This will require attaining weight, volume, and cost targets for the power electronics and electrical machines subsystems of the traction drive system. Areas of development include: (1) Novel traction motor designs that result in increased power density and lower cost; (2) Inverter technologies involving new topologies to achieve higher efficiency and the ability to accommodate higher-temperature environments; (3) Converter concepts that employ means of reducing the component count and integrating functionality to decrease size, weight, and cost; (4) More effective thermal control and packaging technologies; and (5) Integrated motor/inverter concepts. The Oak Ridge National Laboratory's (ORNL's) Power Electronics and Electric Machinery Research Center conducts fundamental research, evaluates hardware, and assists in the technical direction of the DOE Office of FreedomCAR and Vehicle Technologies Program, Power Electronics and Electric Machinery Program. In this role, ORNL serves on the FreedomCAR Electrical and Electronics Technical Team, evaluates proposals for DOE, and lends its technological expertise to the direction of projects and evaluation of developing technologies. ORNL also executes specific projects for DOE. The following

  12. Solar Energy Education. Renewable energy: a background text. [Includes glossary

    SciTech Connect (OSTI)

    Not Available

    1985-01-01T23:59:59.000Z

    Some of the most common forms of renewable energy are presented in this textbook for students. The topics include solar energy, wind power hydroelectric power, biomass ocean thermal energy, and tidal and geothermal energy. The main emphasis of the text is on the sun and the solar energy that it yields. Discussions on the sun's composition and the relationship between the earth, sun and atmosphere are provided. Insolation, active and passive solar systems, and solar collectors are the subtopics included under solar energy. (BCS)

  13. The Neo-Flex LCD Arm is the perfect accessory to add flexibility to your LCD monitor or TV. Sleek and streamlined, it frees up desk space and allows you

    E-Print Network [OSTI]

    Saskatchewan, University of

    The Neo-Flex LCD Arm is the perfect accessory to add flexibility to your LCD monitor or TV. Sleek lifting the LCD with the other hand. Then position the LCD where you want it and release the button. It. Highlights · Great value at a great price · Easily position your LCD or TV for maximum comfort

  14. Engine lubrication circuit including two pumps

    DOE Patents [OSTI]

    Lane, William H.

    2006-10-03T23:59:59.000Z

    A lubrication pump coupled to the engine is sized such that the it can supply the engine with a predetermined flow volume as soon as the engine reaches a peak torque engine speed. In engines that operate predominately at speeds above the peak torque engine speed, the lubrication pump is often producing lubrication fluid in excess of the predetermined flow volume that is bypassed back to a lubrication fluid source. This arguably results in wasted power. In order to more efficiently lubricate an engine, a lubrication circuit includes a lubrication pump and a variable delivery pump. The lubrication pump is operably coupled to the engine, and the variable delivery pump is in communication with a pump output controller that is operable to vary a lubrication fluid output from the variable delivery pump as a function of at least one of engine speed and lubrication flow volume or system pressure. Thus, the lubrication pump can be sized to produce the predetermined flow volume at a speed range at which the engine predominately operates while the variable delivery pump can supplement lubrication fluid delivery from the lubrication pump at engine speeds below the predominant engine speed range.

  15. Power control system and method

    DOE Patents [OSTI]

    Steigerwald, Robert Louis; Anderson, Todd Alan

    2006-11-07T23:59:59.000Z

    A power system includes an energy harvesting device, a battery coupled to the energy harvesting device, and a circuit coupled to the energy harvesting device and the battery. The circuit is adapted to deliver power to a load by providing power generated by the energy harvesting device to the load without delivering excess power to the battery and to supplement the power generated by the energy harvesting device with power from the battery if the power generated by the energy harvesting device is insufficient to fully power the load. A method of operating the power system is also provided.

  16. Power control system and method

    DOE Patents [OSTI]

    Steigerwald, Robert Louis (Burnt Hills, NY) [Burnt Hills, NY; Anderson, Todd Alan (Niskayuna, NY) [Niskayuna, NY

    2008-02-19T23:59:59.000Z

    A power system includes an energy harvesting device, a battery coupled to the energy harvesting device, and a circuit coupled to the energy harvesting device and the battery. The circuit is adapted to deliver power to a load by providing power generated by the energy harvesting device to the load without delivering excess power to the battery and to supplement the power generated by the energy harvesting device with power from the battery if the power generated by the energy harvesting device is insufficient to fully power the load. A method of operating the power system is also provided.

  17. Writing Motor Specifications - How to Include Efficiency

    E-Print Network [OSTI]

    Quartermaine, B. J.

    1980-01-01T23:59:59.000Z

    The escalating cost of electric power coupled with the rapid depletion of our non-renewable resources makes consideration of motor efficiency good sense both from economic and conservation viewpoints. The efficiency of an electric motor can...

  18. How to Include Zebras in the

    E-Print Network [OSTI]

    Singh, Jaswinder Pal

    Cellular... So far in class, you've talked a lot about cellular service: ­ Cellular towers receive voice antennas available ­ Looking at 802.11 or VHF transmission Difficult terrain Power generation & storage

  19. Photonic-powered cable assembly

    DOE Patents [OSTI]

    Sanderson, Stephen N; Appel, Titus James; Wrye, IV, Walter C

    2014-06-24T23:59:59.000Z

    A photonic-cable assembly includes a power source cable connector ("PSCC") coupled to a power receive cable connector ("PRCC") via a fiber cable. The PSCC electrically connects to a first electronic device and houses a photonic power source and an optical data transmitter. The fiber cable includes an optical transmit data path coupled to the optical data transmitter, an optical power path coupled to the photonic power source, and an optical feedback path coupled to provide feedback control to the photonic power source. The PRCC electrically connects to a second electronic device and houses an optical data receiver coupled to the optical transmit data path, a feedback controller coupled to the optical feedback path to control the photonic power source, and a photonic power converter coupled to the optical power path to convert photonic energy received over the optical power path to electrical energy to power components of the PRCC.

  20. Photonic-powered cable assembly

    DOE Patents [OSTI]

    Sanderson, Stephen N.; Appel, Titus James; Wrye, IV, Walter C.

    2013-01-22T23:59:59.000Z

    A photonic-cable assembly includes a power source cable connector ("PSCC") coupled to a power receive cable connector ("PRCC") via a fiber cable. The PSCC electrically connects to a first electronic device and houses a photonic power source and an optical data transmitter. The fiber cable includes an optical transmit data path coupled to the optical data transmitter, an optical power path coupled to the photonic power source, and an optical feedback path coupled to provide feedback control to the photonic power source. The PRCC electrically connects to a second electronic device and houses an optical data receiver coupled to the optical transmit data path, a feedback controller coupled to the optical feedback path to control the photonic power source, and a photonic power converter coupled to the optical power path to convert photonic energy received over the optical power path to electrical energy to power components of the PRCC.

  1. Auxiliary power unit for moving a vehicle

    DOE Patents [OSTI]

    Akasam, Sivaprasad (Peoria, IL); Johnson, Kris W. (Peoria, IL); Johnson, Matthew D. (Peoria, IL); Slone, Larry M. (Washington, IL); Welter, James Milton (Chillicothe, IL)

    2009-02-03T23:59:59.000Z

    A power system is provided having at least one traction device and a primary power source configured to power the at least one traction device. In addition, the power system includes an auxiliary power source also configured to power the at least one traction device.

  2. vision clean power | netl.doe.gov

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    the left of this page. 1. Important products using CO2 as feedstock include urea and methanol Power Commercial Power Production based on Gasification Typical IGCC Configuration...

  3. Cogeneration handbook for the petroleum refining industry. [Glossary included

    SciTech Connect (OSTI)

    Not Available

    1984-02-01T23:59:59.000Z

    This Handbook deals only with industrial cogeneration, that is, simultaneous production of both heat and electricity at the industrial plant site. The cogenerator has the option of either selling all cogenerated power to the utility while simultaneously purchasing power to satisfy his plant demand, or directly supplying the plant demand with cogenerated power, thus displacing utility-supplied power. This Handbook provides the refinery plant manager or company energy coordinator with a framework for making a preliminary assessment of the feasibility and viability of cogeneration at a particular plant. The handbook is intended to provide an understanding of the potential of several standardized cogeneration systems, as well as their limitations. However, because the decision to cogenerate is very site specific, the handbook cannot provide all of the answers. It does attempt, however, to bring to light the major issues that should be addressed in the decision-making process. The decision of whether to cogenerate involves several considerations, including technical, economic, environmental, legal, and regulatory issues. Each of these issues is addressed separately in this handbook. In addition, a chapter is included on preparing a three-phase work statement, which is needed to guide the design of a cogeneration system. 39 figures, 37 tables.

  4. Fuel-cell based power generating system having power conditioning apparatus

    DOE Patents [OSTI]

    Mazumder, Sudip K. (Chicago, IL); Pradhan, Sanjaya K. (Des Plaines, IL)

    2010-10-05T23:59:59.000Z

    A power conditioner includes power converters for supplying power to a load, a set of selection switches corresponding to the power converters for selectively connecting the fuel-cell stack to the power converters, and another set of selection switches corresponding to the power converters for selectively connecting the battery to the power converters. The power conveners output combined power that substantially optimally meets a present demand of the load.

  5. Electrically powered hand tool

    DOE Patents [OSTI]

    Myers, Kurt S.; Reed, Teddy R.

    2007-01-16T23:59:59.000Z

    An electrically powered hand tool is described and which includes a three phase electrical motor having a plurality of poles; an electrical motor drive electrically coupled with the three phase electrical motor; and a source of electrical power which is converted to greater than about 208 volts three-phase and which is electrically coupled with the electrical motor drive.

  6. Transportation and Stationary Power

    E-Print Network [OSTI]

    ) is small. Previous feedback from industry has indicated that existing transportation fuel providers (oil for multiple fuel cell applications, including material handling equipment, backup power, and light- or heavy

  7. ELECTROCHEMICAL POWER FOR TRANSPORTATION

    E-Print Network [OSTI]

    Cairns, Elton J.

    2012-01-01T23:59:59.000Z

    Symposium on Power Systems for Electric Vehicles, Columbiaelectric vehicle must be considered as a total system which includes the primary energy source, electric powerpower for urban driving (32 W/kg), (130, Flow schematic for an electric vehicle battery system.

  8. Electrochemical system including lamella settler crystallizer

    DOE Patents [OSTI]

    Maimoni, Arturo (Orinda, CA)

    1988-01-01T23:59:59.000Z

    A crystallizer which incorporates a lamella settler and which is particularly applicable for use in batteries and power cells for electric vehicles or stationary applications. The lamella settler can be utilized for coarse particle separation or for agglomeration, and is particularly applicable to aluminum-air batteries or power cells for solving the hydrargillite (aluminum-hydroxide) removal problems from such batteries. This invention provides the advantages of very low energy consumption, turbulence, shear, cost and maintenance. Thus, due to the low shear and low turbulence of this invention, it is particularly effective in the control of aluminum hydroxide particle size distribution in the various sections of an aluminum-air system, as will as in other elecrochemical systems requiring separation for phases of different densities.

  9. European Space Power Conference

    SciTech Connect (OSTI)

    Bents, D.J.; Kohout, L.L.; Mckissock, B.I.; Rodriguez, C.D.; Withrow, C.A.; Colozza, A.; Hanlon, J.C.; Schmitz, P.C.

    1991-01-01T23:59:59.000Z

    To support the Space Exploration Initiative (SEI), a study was performed to investigate power system alternatives for the rover vehicles and servicers that were subsequently generated for each of these rovers and servicers, candidate power sources incorporating various power generation and energy storage technologies were identified. The technologies were those believed most appropriate to the SEI missions, and included solar, electrochemical, and isotope systems. The candidates were characterized with respect to system mass, deployed area, and volume. For each of the missions a preliminary selection was made. Results of this study depict the available power sources in light of mission requirements as they are currently defined.

  10. Power oscillator

    DOE Patents [OSTI]

    Gitsevich, Aleksandr (Montgomery Village, MD)

    2001-01-01T23:59:59.000Z

    An oscillator includes an amplifier having an input and an output, and an impedance transformation network connected between the input of the amplifier and the output of the amplifier, wherein the impedance transformation network is configured to provide suitable positive feedback from the output of the amplifier to the input of the amplifier to initiate and sustain an oscillating condition, and wherein the impedance transformation network is configured to protect the input of the amplifier from a destructive feedback signal. One example of the oscillator is a single active element device capable of providing over 70 watts of power at over 70% efficiency. Various control circuits may be employed to match the driving frequency of the oscillator to a plurality of tuning states of the lamp.

  11. Power marketing and renewable energy

    SciTech Connect (OSTI)

    Fang, J.M.

    1997-09-01T23:59:59.000Z

    Power marketing refers to wholesale and retail transactions of electric power made by companies other than public power entities and the regulated utilities that own the generation and distribution lines. The growth in power marketing has been a major development in the electric power industry during the last few years, and power marketers are expected to realize even more market opportunities as electric industry deregulation proceeds from wholesale competition to retail competition. This Topical Issues Brief examines the nature of the power marketing business and its relationship with renewable power. The information presented is based on interviews conducted with nine power marketing companies, which accounted for almost 54% of total power sales by power marketers in 1995. These interviews provided information on various viewpoints of power marketers, their experience with renewables, and their respective outlooks for including renewables in their resource portfolios. Some basic differences exist between wholesale and retail competition that should be recognized when discussing power marketing and renewable power. At the wholesale level, the majority of power marketers stress the commodity nature of electricity. The primary criteria for developing resource portfolios are the same as those of their wholesale customers: the cost and reliability of power supplies. At the retail level, electricity may be viewed as a product that includes value-added characteristics or services determined by customer preferences.

  12. DIDACTICAL HOLOGRAPHIC EXHIBIT INCLUDING (HOLOGRAPHIC TELEVISION)

    E-Print Network [OSTI]

    de Aguiar, Marcus A. M.

    DIDACTICAL HOLOGRAPHIC EXHIBIT INCLUDING HoloTV (HOLOGRAPHIC TELEVISION) José J. Lunazzi , DanielCampinasSPBrasil Abstract: Our Institute of Physics exposes since 1980 didactical exhibitions of holography in Brazil where

  13. Sessions include: Beginning Farmer and Rancher

    E-Print Network [OSTI]

    Watson, Craig A.

    Sessions include: ­ Beginning Farmer and Rancher ­ New Markets and Regulations ­ Food Safety ­ Good Bug, Bad Bug ID ­ Horticulture ­ Hydroponics ­ Livestock and Pastured Poultry ­ Mushrooms ­ Organic ­ Live animal exhibits ­ Saturday evening social, and ­ Local foods Florida Small Farms and Alternative

  14. Gas storage materials, including hydrogen storage materials

    DOE Patents [OSTI]

    Mohtadi, Rana F; Wicks, George G; Heung, Leung K; Nakamura, Kenji

    2014-11-25T23:59:59.000Z

    A material for the storage and release of gases comprises a plurality of hollow elements, each hollow element comprising a porous wall enclosing an interior cavity, the interior cavity including structures of a solid-state storage material. In particular examples, the storage material is a hydrogen storage material, such as a solid state hydride. An improved method for forming such materials includes the solution diffusion of a storage material solution through a porous wall of a hollow element into an interior cavity.

  15. Gas storage materials, including hydrogen storage materials

    DOE Patents [OSTI]

    Mohtadi, Rana F; Wicks, George G; Heung, Leung K; Nakamura, Kenji

    2013-02-19T23:59:59.000Z

    A material for the storage and release of gases comprises a plurality of hollow elements, each hollow element comprising a porous wall enclosing an interior cavity, the interior cavity including structures of a solid-state storage material. In particular examples, the storage material is a hydrogen storage material such as a solid state hydride. An improved method for forming such materials includes the solution diffusion of a storage material solution through a porous wall of a hollow element into an interior cavity.

  16. POWER SYSTEMS STABILITY WITH LARGE-SCALE WIND POWER PENETRATION

    E-Print Network [OSTI]

    Bak-Jensen, Birgitte

    of offshore wind farms, wind power fluctuations may introduce several challenges to reliable power system behaviour due to natural wind fluctuations. The rapid power fluctuations from the large scale wind farms Generation Control (AGC) system which includes large- scale wind farms for long-term stability simulation

  17. System and method for advanced power management

    DOE Patents [OSTI]

    Atcitty, Stanley (Albuquerque, NM); Symons, Philip C. (Surprise, AZ); Butler, Paul C. (Albuquerque, NM); Corey, Garth P. (Albuquerque, NM)

    2009-07-28T23:59:59.000Z

    A power management system is provided that includes a power supply means comprising a plurality of power supply strings, a testing means operably connected to said plurality of power supply strings for evaluating performance characteristics of said plurality of power supply strings, and a control means for monitoring power requirements and comprising a switching means for controlling switching of said plurality of power supply strings to said testing means.

  18. Fall 2013 Composite Data Products - Backup Power

    SciTech Connect (OSTI)

    Kurtz, J.; Sprik, S.; Ainscough, C.; Saur, G.; Post, M.; Peters, M.

    2013-12-01T23:59:59.000Z

    This report includes 28 composite data products (CDPs) produced in Fall 2013 for fuel cell backup power systems.

  19. Spring 2014 Composite Data Products: Backup Power

    SciTech Connect (OSTI)

    Kurtz, J.; Sprik, S.; Saur, G.

    2014-06-01T23:59:59.000Z

    This report includes 30 composite data products (CDPs) produced in Spring 2014 for fuel cell backup power systems.

  20. Proceedings of a Topical Meeting On Small Scale Geothermal Power Plants and Geothermal Power Plant Projects

    SciTech Connect (OSTI)

    None

    1986-02-12T23:59:59.000Z

    These proceedings describe the workshop of the Topical Meeting on Small Scale Geothermal Power Plants and Geothermal Power Plant Projects. The projects covered include binary power plants, rotary separator, screw expander power plants, modular wellhead power plants, inflow turbines, and the EPRI hybrid power system. Active projects versus geothermal power projects were described. In addition, a simple approach to estimating effects of fluid deliverability on geothermal power cost is described starting on page 119. (DJE-2005)

  1. Comprehensive Diagnosis of Complex Electrical Power Distribution Systems

    E-Print Network [OSTI]

    Daigle, Matthew

    Comprehensive Diagnosis of Complex Electrical Power Distribution Systems Indranil Roychoudhury Abstract: Electrical power distribution systems are composed of heterogeneous components, which include and discrete faults in electrical power distribution systems that include dc and ac components. We use a hybrid

  2. Communication in automation, including networking and wireless

    E-Print Network [OSTI]

    Antsaklis, Panos

    Communication in automation, including networking and wireless Nicholas Kottenstette and Panos J and networking in automation is given. Digital communication fundamentals are reviewed and networked control are presented. 1 Introduction 1.1 Why communication is necessary in automated systems Automated systems use

  3. Electrochemical cell including ribbed electrode substrates

    SciTech Connect (OSTI)

    Breault, R.D.; Goller, G.J.; Roethlein, R.J.; Sprecher, G.C.

    1981-07-21T23:59:59.000Z

    An electrochemical cell including an electrolyte retaining matrix layer located between and in contact with cooperating anode and cathode electrodes is disclosed herein. Each of the electrodes is comprised of a ribbed (or grooved) substrate including a gas porous body as its main component and a catalyst layer located between the substrate and one side of the electrolyte retaining matrix layer. Each substrate body includes a ribbed section for receiving reactant gas and lengthwise side portions on opposite sides of the ribbed section. Each of the side portions includes a channel extending along its entire length from one surface thereof (e.g., its outer surface) to but stopping short of an opposite surface (e.g., its inner surface) so as to provide a web directly between the channel and the opposite surface. Each of the channels is filled with a gas impervious substance and each of the webs is impregnated with a gas impervious substance so as to provide a gas impervious seal along the entire length of each side portion of each substrate and between the opposite faces thereof (e.g., across the entire thickness thereof).

  4. Prices include compostable serviceware and linen tablecloths

    E-Print Network [OSTI]

    California at Davis, University of

    & BLACK BEAN ENCHILADAS Fresh corn tortillas stuffed with tender brown butter sautéed butternut squash, black beans and yellow on- ions, garnished with avocado and sour cream. $33 per person EDAMAME & CORN SQUASH & BLACK BEAN ENCHILADA FREE RANGE CHICK- EN SANDWICH PLATED ENTREES All plated entrees include

  5. Energy Consumption of Personal Computing Including Portable

    E-Print Network [OSTI]

    Namboodiri, Vinod

    Energy Consumption of Personal Computing Including Portable Communication Devices Pavel Somavat1 consumption, questions are being asked about the energy contribution of computing equipment. Al- though studies have documented the share of energy consumption by this type of equipment over the years, research

  6. alternative automotive power: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AUTOMOTIVE ACCESSORIES: RETHINKING DESIGN MATERIALS THROUGH CORNSTARCH, SUGARCANE AND HEMP CiteSeer Summary: Current bioproducts or bio-based products do not only require less...

  7. Heat and Power Systems Design

    E-Print Network [OSTI]

    Spriggs, H. D.; Shah, J. V.

    HEAT AND POWER SYSTEMS DESIGN H. D. Spriggs and J. V. Shah, Leesburg. VA ABSTRACT The selection of heat and power systems usually does not include a thorough analysis of the process heating. cooling and power requirements. In most cases..., these process requirements are accepted as specifications before heat and power systems are selected and designed. In t~is article we describe how Process Integration using Pinch Technology can be used to understand and achieve the minimum process heating...

  8. Subterranean barriers including at least one weld

    DOE Patents [OSTI]

    Nickelson, Reva A.; Sloan, Paul A.; Richardson, John G.; Walsh, Stephanie; Kostelnik, Kevin M.

    2007-01-09T23:59:59.000Z

    A subterranean barrier and method for forming same are disclosed, the barrier including a plurality of casing strings wherein at least one casing string of the plurality of casing strings may be affixed to at least another adjacent casing string of the plurality of casing strings through at least one weld, at least one adhesive joint, or both. A method and system for nondestructively inspecting a subterranean barrier is disclosed. For instance, a radiographic signal may be emitted from within a casing string toward an adjacent casing string and the radiographic signal may be detected from within the adjacent casing string. A method of repairing a barrier including removing at least a portion of a casing string and welding a repair element within the casing string is disclosed. A method of selectively heating at least one casing string forming at least a portion of a subterranean barrier is disclosed.

  9. Rotor assembly including superconducting magnetic coil

    DOE Patents [OSTI]

    Snitchler, Gregory L. (Shrewsbury, MA); Gamble, Bruce B. (Wellesley, MA); Voccio, John P. (Somerville, MA)

    2003-01-01T23:59:59.000Z

    Superconducting coils and methods of manufacture include a superconductor tape wound concentrically about and disposed along an axis of the coil to define an opening having a dimension which gradually decreases, in the direction along the axis, from a first end to a second end of the coil. Each turn of the superconductor tape has a broad surface maintained substantially parallel to the axis of the coil.

  10. Primal-Dual Interior Point Method Applied to the Short Term Hydroelectric Scheduling Including a

    E-Print Network [OSTI]

    Oliveira, Aurélio R. L.

    that minimizes losses in the transmission and costs in the generation of a hydroelectric power system, formulated such perturbing parameter. Keywords-- Hydroelectric power system, Network flow, Predispatch, Primal-dual interiorPrimal-Dual Interior Point Method Applied to the Short Term Hydroelectric Scheduling Including

  11. Multiverse rate equation including bubble collisions

    E-Print Network [OSTI]

    Michael P. Salem

    2013-02-19T23:59:59.000Z

    The volume fractions of vacua in an eternally inflating multiverse are described by a coarse-grain rate equation, which accounts for volume expansion and vacuum transitions via bubble formation. We generalize the rate equation to account for bubble collisions, including the possibility of classical transitions. Classical transitions can modify the details of the hierarchical structure among the volume fractions, with potential implications for the staggering and Boltzmann-brain issues. Whether or not our vacuum is likely to have been established by a classical transition depends on the detailed relationships among transition rates in the landscape.

  12. Optical panel system including stackable waveguides

    DOE Patents [OSTI]

    DeSanto, Leonard (Dunkirk, MD); Veligdan, James T. (Manorville, NY)

    2007-11-20T23:59:59.000Z

    An optical panel system including stackable waveguides is provided. The optical panel system displays a projected light image and comprises a plurality of planar optical waveguides in a stacked state. The optical panel system further comprises a support system that aligns and supports the waveguides in the stacked state. In one embodiment, the support system comprises at least one rod, wherein each waveguide contains at least one hole, and wherein each rod is positioned through a corresponding hole in each waveguide. In another embodiment, the support system comprises at least two opposing edge structures having the waveguides positioned therebetween, wherein each opposing edge structure contains a mating surface, wherein opposite edges of each waveguide contain mating surfaces which are complementary to the mating surfaces of the opposing edge structures, and wherein each mating surface of the opposing edge structures engages a corresponding complementary mating surface of the opposite edges of each waveguide.

  13. Optical panel system including stackable waveguides

    DOE Patents [OSTI]

    DeSanto, Leonard; Veligdan, James T.

    2007-03-06T23:59:59.000Z

    An optical panel system including stackable waveguides is provided. The optical panel system displays a projected light image and comprises a plurality of planar optical waveguides in a stacked state. The optical panel system further comprises a support system that aligns and supports the waveguides in the stacked state. In one embodiment, the support system comprises at least one rod, wherein each waveguide contains at least one hole, and wherein each rod is positioned through a corresponding hole in each waveguide. In another embodiment, the support system comprises at least two opposing edge structures having the waveguides positioned therebetween, wherein each opposing edge structure contains a mating surface, wherein opposite edges of each waveguide contain mating surfaces which are complementary to the mating surfaces of the opposing edge structures, and wherein each mating surface of the opposing edge structures engages a corresponding complementary mating surface of the opposite edges of each waveguide.

  14. Thermovoltaic semiconductor device including a plasma filter

    DOE Patents [OSTI]

    Baldasaro, Paul F. (Clifton Park, NY)

    1999-01-01T23:59:59.000Z

    A thermovoltaic energy conversion device and related method for converting thermal energy into an electrical potential. An interference filter is provided on a semiconductor thermovoltaic cell to pre-filter black body radiation. The semiconductor thermovoltaic cell includes a P/N junction supported on a substrate which converts incident thermal energy below the semiconductor junction band gap into electrical potential. The semiconductor substrate is doped to provide a plasma filter which reflects back energy having a wavelength which is above the band gap and which is ineffectively filtered by the interference filter, through the P/N junction to the source of radiation thereby avoiding parasitic absorption of the unusable portion of the thermal radiation energy.

  15. Fusion Power Deployment

    SciTech Connect (OSTI)

    J.A. Schmidt; J.M. Ogden

    2002-02-06T23:59:59.000Z

    Fusion power plants could be part of a future portfolio of non-carbon dioxide producing energy supplies such as wind, solar, biomass, advanced fission power, and fossil energy with carbon dioxide sequestration. In this paper, we discuss key issues that could impact fusion energy deployment during the last half of this century. These include geographic issues such as resource availability, scale issues, energy storage requirements, and waste issues. The resource needs and waste production associated with fusion deployment in the U.S. should not pose serious problems. One important feature of fusion power is the fact that a fusion power plant should be locatable within most local or regional electrical distribution systems. For this reason, fusion power plants should not increase the burden of long distance power transmission to our distribution system. In contrast to fusion power, regional factors could play an important role in the deployment of renewable resources such as wind, solar and biomass or fossil energy with CO2 sequestration. We examine the role of these regional factors and their implications for fusion power deployment.

  16. Environmental Assessment for power marketing policy for Southwestern Power Administration

    SciTech Connect (OSTI)

    Not Available

    1993-12-01T23:59:59.000Z

    Southwestern Power Administration (Southwestern) needs to renew expiring power sales contracts with new term (10 year) sales contracts. The existing contracts have been in place for several years and many will expire over the next ten years. Southwestern completed an Environmental Assessment on the existing power allocation in June, 1979 (a copy of the EA is attached), and there are no proposed additions of any major new generation resources, service to discrete major new loads, or major changes in operating parameters, beyond those included in the existing power allocation. Impacts from a no action plan, proposed alternative, and market power for less than 10 years are described.

  17. Nuclear Power

    E-Print Network [OSTI]

    Vilhena and Bardo E.J. Bodmann Carbon-#1;? in Terrestrial and Aquatic Environment of Ignalina Nuclear Power Plant: Sources of Production, Releases and Dose Estimates #3;?? Jonas Mazeika Impact of radionuclide discharges from Temel?n Nuclear Power... (chapter 5), ? Instrumentation and control (chapter 6), ? Diagnostics (chapter 7), ? Safety evaluation methods (chapters 6, 8, 9 and 10), ? Environment and nuclear power plants (chapters 11 - 15), ? Human factors (chapter 16), ? Software development...

  18. Models of Procyon A including seismic constraints

    E-Print Network [OSTI]

    P. Eggenberger; F. Carrier; F. Bouchy

    2005-01-14T23:59:59.000Z

    Detailed models of Procyon A based on new asteroseismic measurements by Eggenberger et al (2004) have been computed using the Geneva evolution code including shellular rotation and atomic diffusion. By combining all non-asteroseismic observables now available for Procyon A with these seismological data, we find that the observed mean large spacing of 55.5 +- 0.5 uHz favours a mass of 1.497 M_sol for Procyon A. We also determine the following global parameters of Procyon A: an age of t=1.72 +- 0.30 Gyr, an initial helium mass fraction Y_i=0.290 +- 0.010, a nearly solar initial metallicity (Z/X)_i=0.0234 +- 0.0015 and a mixing-length parameter alpha=1.75 +- 0.40. Moreover, we show that the effects of rotation on the inner structure of the star may be revealed by asteroseismic observations if frequencies can be determined with a high precision. Existing seismological data of Procyon A are unfortunately not accurate enough to really test these differences in the input physics of our models.

  19. Power LCAT

    ScienceCinema (OSTI)

    Drennen, Thomas

    2014-06-27T23:59:59.000Z

    POWER LCAT is a software tool used to compare elements of efficiency, cost, and environmental effects between different sources of energy.

  20. Power LCAT

    SciTech Connect (OSTI)

    Drennen, Thomas

    2012-08-15T23:59:59.000Z

    POWER LCAT is a software tool used to compare elements of efficiency, cost, and environmental effects between different sources of energy.

  1. Electric power annual 1995. Volume II

    SciTech Connect (OSTI)

    NONE

    1996-12-01T23:59:59.000Z

    This document summarizes pertinent statistics on various aspects of the U.S. electric power industry for the year and includes a graphic presentation. Data is included on electric utility retail sales and revenues, financial statistics, environmental statistics of electric utilities, demand-side management, electric power transactions, and non-utility power producers.

  2. Interim performance criteria for photovoltaic energy systems. [Glossary included

    SciTech Connect (OSTI)

    DeBlasio, R.; Forman, S.; Hogan, S.; Nuss, G.; Post, H.; Ross, R.; Schafft, H.

    1980-12-01T23:59:59.000Z

    This document is a response to the Photovoltaic Research, Development, and Demonstration Act of 1978 (P.L. 95-590) which required the generation of performance criteria for photovoltaic energy systems. Since the document is evolutionary and will be updated, the term interim is used. More than 50 experts in the photovoltaic field have contributed in the writing and review of the 179 performance criteria listed in this document. The performance criteria address characteristics of present-day photovoltaic systems that are of interest to manufacturers, government agencies, purchasers, and all others interested in various aspects of photovoltaic system performance and safety. The performance criteria apply to the system as a whole and to its possible subsystems: array, power conditioning, monitor and control, storage, cabling, and power distribution. They are further categorized according to the following performance attributes: electrical, thermal, mechanical/structural, safety, durability/reliability, installation/operation/maintenance, and building/site. Each criterion contains a statement of expected performance (nonprescriptive), a method of evaluation, and a commentary with further information or justification. Over 50 references for background information are also given. A glossary with definitions relevant to photovoltaic systems and a section on test methods are presented in the appendices. Twenty test methods are included to measure performance characteristics of the subsystem elements. These test methods and other parts of the document will be expanded or revised as future experience and needs dictate.

  3. Pulse transmission transmitter including a higher order time derivate filter

    DOE Patents [OSTI]

    Dress Jr., William B.; Smith, Stephen F.

    2003-09-23T23:59:59.000Z

    Systems and methods for pulse-transmission low-power communication modes are disclosed. A pulse transmission transmitter includes: a clock; a pseudorandom polynomial generator coupled to the clock, the pseudorandom polynomial generator having a polynomial load input; an exclusive-OR gate coupled to the pseudorandom polynomial generator, the exclusive-OR gate having a serial data input; a programmable delay circuit coupled to both the clock and the exclusive-OR gate; a pulse generator coupled to the programmable delay circuit; and a higher order time derivative filter coupled to the pulse generator. The systems and methods significantly reduce lower-frequency emissions from pulse transmission spread-spectrum communication modes, which reduces potentially harmful interference to existing radio frequency services and users and also simultaneously permit transmission of multiple data bits by utilizing specific pulse shapes.

  4. Electra-optical device including a nitrogen containing electrolyte

    DOE Patents [OSTI]

    Bates, John B. (Oak Ridge, TN); Dudney, Nancy J. (Knoxville, TN); Gruzalski, Greg R. (Oak Ridge, TN); Luck, Christopher F. (Knoxville, TN)

    1995-01-01T23:59:59.000Z

    Described is a thin-film battery, especially a thin-film microbattery, and a method for making same having application as a backup or primary integrated power source for electronic devices. The battery includes a novel electrolyte which is electrochemically stable and does not react with the lithium anode and a novel vanadium oxide cathode Configured as a microbattery, the battery can be fabricated directly onto a semiconductor chip, onto the semiconductor die or onto any portion of the chip carrier. The battery can be fabricated to any specified size or shape to meet the requirements of a particular application. The battery is fabricated of solid state materials and is capable of operation between -15.degree. C. and 150.degree. C.

  5. Electra-optical device including a nitrogen containing electrolyte

    DOE Patents [OSTI]

    Bates, J.B.; Dudney, N.J.; Gruzalski, G.R.; Luck, C.F.

    1995-10-03T23:59:59.000Z

    Described is a thin-film battery, especially a thin-film microbattery, and a method for making same having application as a backup or primary integrated power source for electronic devices. The battery includes a novel electrolyte which is electrochemically stable and does not react with the lithium anode and a novel vanadium oxide cathode. Configured as a microbattery, the battery can be fabricated directly onto a semiconductor chip, onto the semiconductor die or onto any portion of the chip carrier. The battery can be fabricated to any specified size or shape to meet the requirements of a particular application. The battery is fabricated of solid state materials and is capable of operation between {minus}15 C and 150 C.

  6. High power connection system

    DOE Patents [OSTI]

    Schaefer, Christopher E. (Warren, OH); Beer, Robert C. (Noblesville, IN); McCall, Mark D. (Youngstown, OH)

    2000-01-01T23:59:59.000Z

    A high power connection system adapted for automotive environments which provides environmental and EMI shielding includes a female connector, a male connector, and a panel mount. The female connector includes a female connector base and a snap fitted female connector cover. The male connector includes a male connector base and a snap fitted male connector cover. The female connector base has at least one female power terminal cavity for seatably receiving a respective female power terminal. The male connector base has at least one male power terminal cavity for seatably receiving a respective male power terminal. The female connector is covered by a cover seal and a conductive shroud. A pair of lock arms protrude outward from the front end of the male connector base, pass through the panel mount and interface with a lever of a lever rotatably connected to the shroud to thereby mechanically assist mating of the male and female connectors. Safety terminals in the male and female connectors provide a last-to-connect-first-to-break connection with an HVIL circuit.

  7. A study on power assists for bicycle rickshaws in India, including fabrication of test apparatus

    E-Print Network [OSTI]

    Hickman, Madeline R. (Madeline Ruth)

    2011-01-01T23:59:59.000Z

    Bicycle rickshaws impose significant physical burdens on their drivers. Used throughout India for transportation, these rickshaws are not designed for driver comfort and safety. Instead, traditional rickshaws are only ...

  8. Unique Selectivities. Pall's versatile line of media includes the powerful HyperCelTM sorbent family

    E-Print Network [OSTI]

    Lebendiker, Mario

    for those working in drug discovery, development, and manufacturing. Pall's chromatography products feature membrane · Aggregate polishing from MAb filter plates, Acrodisc feedstream syringe filters *In addition from research, to process development and scale up, to full-scale process manufacturing. Fully scalable

  9. Powered protrusion cutter

    DOE Patents [OSTI]

    Bzorgi, Fariborz M. (Knoxville, TN)

    2010-03-09T23:59:59.000Z

    An apparatus for clipping a protrusion of material is provided. The protrusion may, for example, be a bolt head, a nut, a rivet, a weld bead, or a temporary assembly alignment tab protruding from a substrate surface of assembled components. The apparatus typically includes a cleaver having a cleaving edge and a cutting blade having a cutting edge. Generally, a mounting structure configured to confine the cleaver and the cutting blade and permit a range of relative movement between the cleaving edge and the cutting edge is provided. Also typically included is a power device coupled to the cutting blade. The power device is configured to move the cutting edge toward the cleaving edge. In some embodiments the power device is activated by a momentary switch. A retraction device is also generally provided, where the retraction device is configured to move the cutting edge away from the cleaving edge.

  10. Electric power annual 1992

    SciTech Connect (OSTI)

    Not Available

    1994-01-06T23:59:59.000Z

    The Electric Power Annual presents a summary of electric utility statistics at national, regional and State levels. The objective of the publication is to provide industry decisionmakers, government policymakers, analysts and the general public with historical data that may be used in understanding US electricity markets. The Electric Power Annual is prepared by the Survey Management Division; Office of Coal, Nuclear, Electric and Alternate Fuels; Energy Information Administration (EIA); US Department of Energy. ``The US Electric Power Industry at a Glance`` section presents a profile of the electric power industry ownership and performance, and a review of key statistics for the year. Subsequent sections present data on generating capability, including proposed capability additions; net generation; fossil-fuel statistics; retail sales; revenue; financial statistics; environmental statistics; electric power transactions; demand-side management; and nonutility power producers. In addition, the appendices provide supplemental data on major disturbances and unusual occurrences in US electricity power systems. Each section contains related text and tables and refers the reader to the appropriate publication that contains more detailed data on the subject matter. Monetary values in this publication are expressed in nominal terms.

  11. Low inductance power electronics assembly

    DOE Patents [OSTI]

    Herron, Nicholas Hayden; Mann, Brooks S.; Korich, Mark D.; Chou, Cindy; Tang, David; Carlson, Douglas S.; Barry, Alan L.

    2012-10-02T23:59:59.000Z

    A power electronics assembly is provided. A first support member includes a first plurality of conductors. A first plurality of power switching devices are coupled to the first support member. A first capacitor is coupled to the first support member. A second support member includes a second plurality of conductors. A second plurality of power switching devices are coupled to the second support member. A second capacitor is coupled to the second support member. The first and second pluralities of conductors, the first and second pluralities of power switching devices, and the first and second capacitors are electrically connected such that the first plurality of power switching devices is connected in parallel with the first capacitor and the second capacitor and the second plurality of power switching devices is connected in parallel with the second capacitor and the first capacitor.

  12. Electric Power annual 1996: Volume II

    SciTech Connect (OSTI)

    NONE

    1997-12-01T23:59:59.000Z

    This document presents a summary of electric power industry statistics. Data are included on electric utility retail sales of electricity, revenues, environmental information, power transactions, emissions, and demand-side management.

  13. Guidelines for Power Factor Improvement Projects

    E-Print Network [OSTI]

    Massey, G. W.

    Power factor is an indication of electrical system efficiency. Low power factor, or low system efficiency, may be due to one or more causes, including lightly loaded transformers, oversized electric motors, and harmonic-generating non-linear loads...

  14. Hierarchical Hybrid Power Supply Networks Farinaz Koushanfar

    E-Print Network [OSTI]

    management, hybrid power supply, supercapacitors 1. INTRODUCTION AND MOTIVATION Historically, almost all in a hierarchical power sup- ply network would include batteries, supercapacitors, ionic supercapacitors, and future cycle, supercapacitors are advantageous rel- ative to the standard che

  15. EIS-0102: Bonneville Power Administration's 1983 Wholesale Power Rate

    Broader source: Energy.gov [DOE]

    The U.S. Department of Energy's Bonneville Power Administration prepared this EIS to evaluate the potential environmental impacts associated with an increase in wholesale power rates that would become effective on November 1, 1983, including the effects of rate hikes in that year and the cumulative effects of previous rate hikes.

  16. Active Power Controls from Wind Power: Bridging the Gaps

    SciTech Connect (OSTI)

    Ela, E.; Gevorgian, V.; Fleming, P.; Zhang, Y. C.; Singh, M.; Muljadi, E.; Scholbrook, A.; Aho, J.; Buckspan, A.; Pao, L.; Singhvi, V.; Tuohy, A.; Pourbeik, P.; Brooks, D.; Bhatt, N.

    2014-01-01T23:59:59.000Z

    This paper details a comprehensive study undertaken by the National Renewable Energy Laboratory, Electric Power Research Institute, and the University of Colorado to understand how the contribution of wind power providing active power control (APC) can benefit the total power system economics, increase revenue streams, improve the reliability and security of the power system, and provide superior and efficient response while reducing any structural and loading impacts that may reduce the life of the wind turbine or its components. The study includes power system simulations, control simulations, and actual field tests using turbines at NREL's National Wind Technology Center (NWTC). The study focuses on synthetic inertial control, primary frequency control, and automatic generation control, and analyzes timeframes ranging from milliseconds to minutes to the lifetime of wind turbines, locational scope ranging from components of turbines to large wind plants to entire synchronous interconnections, and additional topics ranging from economics to power system engineering to control design.

  17. Reliability Evaluation of Electric Power Generation Systems with Solar Power 

    E-Print Network [OSTI]

    Samadi, Saeed

    2013-11-08T23:59:59.000Z

    reliability evaluation of generation systems including Photovoltaic (PV) and Concentrated Solar Power (CSP) plants. Unit models of PV and CSP are developed first, and then generation system model is constructed to evaluate the reliability of generation systems...

  18. Strathclyde powerS ahead

    E-Print Network [OSTI]

    Mottram, Nigel

    Strathclyde powerS ahead the future of renewable energy SHARING AND ENHANCING RESEARCH Discover the vision of Principal Professor Jim McDonald THE FUTURE OF ENERGY Strathclyde pioneers renewableEdicinE Snapshot the reSearcher Following a decade of environmental research in her native egypt, nabila saleem

  19. Power combiner

    DOE Patents [OSTI]

    Arnold, Mobius; Ives, Robert Lawrence

    2006-09-05T23:59:59.000Z

    A power combiner for the combining of symmetric and asymmetric traveling wave energy comprises a feed waveguide having an input port and a launching port, a reflector for reflecting launched wave energy, and a final waveguide for the collection and transport of launched wave energy. The power combiner has a launching port for symmetrical waves which comprises a cylindrical section coaxial to the feed waveguide, and a launching port for asymmetric waves which comprises a sawtooth rotated about a central axis.

  20. Generator powered electrically heated diesel particulate filter

    DOE Patents [OSTI]

    Gonze, Eugene V; Paratore, Jr., Michael J

    2014-03-18T23:59:59.000Z

    A control circuit for a vehicle powertrain includes a switch that selectivity interrupts current flow between a first terminal and a second terminal. A first power source provides power to the first terminal and a second power source provides power to the second terminal and to a heater of a heated diesel particulate filter (DPF). The switch is opened during a DPF regeneration cycle to prevent the first power source from being loaded by the heater while the heater is energized.

  1. Power throttling of collections of computing elements

    DOE Patents [OSTI]

    Bellofatto, Ralph E. (Ridgefield, CT); Coteus, Paul W. (Yorktown Heights, NY); Crumley, Paul G. (Yorktown Heights, NY); Gara, Alan G. (Mount Kidsco, NY); Giampapa, Mark E. (Irvington, NY); Gooding; Thomas M. (Rochester, MN); Haring, Rudolf A. (Cortlandt Manor, NY); Megerian, Mark G. (Rochester, MN); Ohmacht, Martin (Yorktown Heights, NY); Reed, Don D. (Mantorville, MN); Swetz, Richard A. (Mahopac, NY); Takken, Todd (Brewster, NY)

    2011-08-16T23:59:59.000Z

    An apparatus and method for controlling power usage in a computer includes a plurality of computers communicating with a local control device, and a power source supplying power to the local control device and the computer. A plurality of sensors communicate with the computer for ascertaining power usage of the computer, and a system control device communicates with the computer for controlling power usage of the computer.

  2. RF power generation

    E-Print Network [OSTI]

    Carter, R G

    2011-01-01T23:59:59.000Z

    This paper reviews the main types of r.f. power amplifiers which are, or may be, used for particle accelerators. It covers solid-state devices, tetrodes, inductive output tubes, klystrons, magnetrons, and gyrotrons with power outputs greater than 10 kW c.w. or 100 kW pulsed at frequencies from 50 MHz to 30 GHz. Factors affecting the satisfactory operation of amplifiers include cooling, matching and protection circuits are discussed. The paper concludes with a summary of the state of the art for the different technologies.

  3. Wind power today

    SciTech Connect (OSTI)

    NONE

    1998-04-01T23:59:59.000Z

    This publication highlights initiatives of the US DOE`s Wind Energy Program. 1997 yearly activities are also very briefly summarized. The first article describes a 6-megawatt wind power plant installed in Vermont. Another article summarizes technical advances in wind turbine technology, and describes next-generation utility and small wind turbines in the planning stages. A village power project in Alaska using three 50-kilowatt turbines is described. Very brief summaries of the Federal Wind Energy Program and the National Wind Technology Center are also included in the publication.

  4. Incorporating HVDC's into monitoring and power system analysis

    E-Print Network [OSTI]

    Krishnaswamy, Vikram

    2002-01-01T23:59:59.000Z

    This thesis attempts to study the effect of incorporating HVDC's into monitoring and power system analysis. Power system analysis, including load flow and stability studies, and monitoring defines a complete cycle of the impact of HVDC in a power...

  5. Cleco Power- Power Miser New Home Program

    Broader source: Energy.gov [DOE]

    Louisiana's Cleco Power offers energy efficiency incentives to eligible customers. Cleco Power offers a rate discount for residential customers building homes that meet the Power Miser Program...

  6. The energy behind the power. Southwestern Power Administration 1994 annual report

    SciTech Connect (OSTI)

    NONE

    1994-12-31T23:59:59.000Z

    This is the Southwestern Power Administration 1994 annual report. The topics of the report include a letter to the secretary; an overview including the mission statement, a description of the Southwestern Federal Power System, financial statement, performance measurements, national performance review; year in review, summary of results, financial and statistical data and the Southwestern Power Administration Organization.

  7. Funding Opportunity Announcement: Concentrating Solar Power:...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    of the plant, including solar collectors, receivers and heat transfer fluids, thermal energy storage, power cycles, as well as operations and maintenance. The total federal...

  8. UCSD Biomass to Power Economic Feasibility Study

    E-Print Network [OSTI]

    Cattolica, Robert

    2009-01-01T23:59:59.000Z

    facilities that use biomass, waste, or renewable resources (Eligible renewable energy resources include biomass, solar renewable  power  than  there  is  in  the  market  for  biomass 

  9. Rocky Mountain Power- FinAnswer Express

    Broader source: Energy.gov [DOE]

    Rocky Mountain Power's FinAnswer Express Program includes incentives and technical assistance for lighting, HVAC and other equipment upgrades that increase energy efficiency and exceed code...

  10. Sandia National Laboratories: advanced auxiliary power units...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    auxiliary power units (including biofuels) Sandia Participated in the 3rd Annual Technology Forum of the U.S.-China Clean Energy Research Center - Clean Vehicles Consortium...

  11. Power Systems Development Facility

    SciTech Connect (OSTI)

    Southern Company Services

    2009-01-31T23:59:59.000Z

    In support of technology development to utilize coal for efficient, affordable, and environmentally clean power generation, the Power Systems Development Facility (PSDF), located in Wilsonville, Alabama, has routinely demonstrated gasification technologies using various types of coals. The PSDF is an engineering scale demonstration of key features of advanced coal-fired power systems, including a Transport Gasifier, a hot gas particulate control device, advanced syngas cleanup systems, and high-pressure solids handling systems. This final report summarizes the results of the technology development work conducted at the PSDF through January 31, 2009. Twenty-one major gasification test campaigns were completed, for a total of more than 11,000 hours of gasification operation. This operational experience has led to significant advancements in gasification technologies.

  12. Power inverter with optical isolation

    DOE Patents [OSTI]

    Duncan, Paul G.; Schroeder, John Alan

    2005-12-06T23:59:59.000Z

    An optically isolated power electronic power conversion circuit that includes an input electrical power source, a heat pipe, a power electronic switch or plurality of interconnected power electronic switches, a mechanism for connecting the switch to the input power source, a mechanism for connecting comprising an interconnecting cable and/or bus bar or plurality of interconnecting cables and/or input bus bars, an optically isolated drive circuit connected to the switch, a heat sink assembly upon which the power electronic switch or switches is mounted, an output load, a mechanism for connecting the switch to the output load, the mechanism for connecting including an interconnecting cable and/or bus bar or plurality of interconnecting cables and/or output bus bars, at least one a fiber optic temperature sensor mounted on the heat sink assembly, at least one fiber optic current sensor mounted on the load interconnection cable and/or output bus bar, at least one fiber optic voltage sensor mounted on the load interconnection cable and/or output bus bar, at least one fiber optic current sensor mounted on the input power interconnection cable and/or input bus bar, and at least one fiber optic voltage sensor mounted on the input power interconnection cable and/or input bus bar.

  13. POWER GRID RELIABILITY AND SECURITY

    SciTech Connect (OSTI)

    Bose, Anjan; Venkatasubramanian, Vaithianathan; Hauser, Carl; Bakken, David; Anderson, David; Zhao, Chuanlin; Liu, Dong; Yang, Tao; Meng, Ming; Zhang, Lin; Ning, Jiawei; Tashman, Zaid

    2014-09-30T23:59:59.000Z

    This project has led to the development of a real-time simulation platform for electric power grids called Grid Simulator or GridSim for simulating the dynamic and information network interactions of large- scale power systems. The platform consists of physical models of power system components including synchronous generators, loads and control, which are simulated using a modified commercial power simulator namely Transient Stability Analysis Tool (TSAT) [1] together with data cleanup components, as well as an emulated substation level and wide-area power analysis components. The platform also includes realistic representations of communication network middleware that can emulate the real-time information flow back and forth between substations and control centers in wide-area power systems. The platform has been validated on a realistic 6000-bus model of the western American power system. The simulator GridSim developed in this project is the first of its kind in its ability to simulate real-time response of large-scale power grids, and serves as a cost effective real-time stability and control simulation platform for power industry.

  14. Power Factor Compensation (PFC) Power Factor Compensation

    E-Print Network [OSTI]

    Knobloch,JĂĽrgen

    Power Factor Compensation (PFC) Power Factor Compensation The power factor (PF) is defined as the ratio between the active power and the apparent power of a system. If the current and voltage are periodic with period , and [ ), then the active power is defined by ( ) ( ) (their inner product

  15. ELECTROCHEMICAL POWER FOR TRANSPORTATION

    SciTech Connect (OSTI)

    Cairns, Elton J.; Hietbrink, Earl H.

    1981-01-01T23:59:59.000Z

    This section includes some historical background of the rise and fall and subsequent rebirth of the electric vehicle; and a brief discussion of current transportation needs, and environmental and energy utilization issues that resulted in the renewed interest in applying electrochemical energy conversion technology to electric vehicle applications. Although energy utilization has evolved to be the most significant and important issue, the environmental issue will be discussed first in this section only because of its chronological occurrence. The next part of the chapter is a review of passenger and commercial electric vehicle technology with emphasis on vehicle design and demonstrated performance of vehicles with candidate power sources being developed. This is followed by a discussion of electrochemical power source requirements associated with future electric vehicles that can play a role in meeting modern transportation needs. The last part of the chapter includes first a discussion of how to identify candidate electrochemical systems that might be of interest in meeting electric vehicle power source requirements. This is then followed by a review of the current technological status of these systems and a discussion of the most significant problems that must be resolved before each candidate system can be a viable power source.

  16. Star Power

    ScienceCinema (OSTI)

    None

    2014-11-18T23:59:59.000Z

    The U.S. Department of Energy's Princeton Plasma Physics Laboratory has released ''Star Power,'' a new informational video that uses dramatic and beautiful images and thought-provoking interviews to highlight the importance of the Laboratory's research into magnetic fusion.

  17. Star Power

    SciTech Connect (OSTI)

    None

    2014-10-17T23:59:59.000Z

    The U.S. Department of Energy's Princeton Plasma Physics Laboratory has released ''Star Power,'' a new informational video that uses dramatic and beautiful images and thought-provoking interviews to highlight the importance of the Laboratory's research into magnetic fusion.

  18. Operating-System Directed Power Reduction Yung-Hsiang Lu

    E-Print Network [OSTI]

    Lu, Jiaheng

    to workloads is called dynamic power management (DPM) [3]. Power managers (PM) determine power state transitions accord- ing to their shutdown rules (also called policies). Power management can be generalized, power management includes dynamic voltage setting [7] and variable clock speeds [14]. Setting voltages

  19. Silicon Valley Power- Residential Energy Efficiency Rebate Program

    Broader source: Energy.gov [DOE]

    Silicon Valley Power offers rebates to residential customers for the purchase of a variety of energy efficient products including:

  20. Wind Power Outlook 2004

    SciTech Connect (OSTI)

    anon.

    2004-01-01T23:59:59.000Z

    The brochure, expected to be updated annually, provides the American Wind Energy Association's (AWAE's) up-to-date assessment of the wind industry. It provides a summary of the state of wind power in the U.S., including the challenges and opportunities facing the industry. It provides summary information on the growth of the industry, policy-related factors such as the federal wind energy production tax credit status, comparisons with natural gas, and public views on wind energy.

  1. Combustion powered linear actuator

    DOE Patents [OSTI]

    Fischer, Gary J. (Albuquerque, NM)

    2007-09-04T23:59:59.000Z

    The present invention provides robotic vehicles having wheeled and hopping mobilities that are capable of traversing (e.g. by hopping over) obstacles that are large in size relative to the robot and, are capable of operation in unpredictable terrain over long range. The present invention further provides combustion powered linear actuators, which can include latching mechanisms to facilitate pressurized fueling of the actuators, as can be used to provide wheeled vehicles with a hopping mobility.

  2. Stirling engine power control

    DOE Patents [OSTI]

    Fraser, James P. (Scotia, NY)

    1983-01-01T23:59:59.000Z

    A power control method and apparatus for a Stirling engine including a valved duct connected to the junction of the regenerator and the cooler and running to a bypass chamber connected between the heater and the cylinder. An oscillating zone of demarcation between the hot and cold portions of the working gas is established in the bypass chamber, and the engine pistons and cylinders can run cold.

  3. A Tariff for Reactive Power

    SciTech Connect (OSTI)

    Kueck, John D [ORNL; Kirby, Brendan J [ORNL; Li, Fangxing [ORNL; Tufon, Christopher [Pacific Gas and Electric Company; Isemonger, Alan [California Independent System Operator

    2008-07-01T23:59:59.000Z

    Two kinds of power are required to operate an electric power system: real power, measured in watts, and reactive power, measured in volt-amperes reactive or VARs. Reactive power supply is one of a class of power system reliability services collectively known as ancillary services, and is essential for the reliable operation of the bulk power system. Reactive power flows when current leads or lags behind voltage. Typically, the current in a distribution system lags behind voltage because of inductive loads such as motors. Reactive power flow wastes energy and capacity and causes voltage droop. To correct lagging power flow, leading reactive power (current leading voltage) is supplied to bring the current into phase with voltage. When the current is in phase with voltage, there is a reduction in system losses, an increase in system capacity, and a rise in voltage. Reactive power can be supplied from either static or dynamic VAR sources. Static sources are typically transmission and distribution equipment, such as capacitors at substations, and their cost has historically been included in the revenue requirement of the transmission operator (TO), and recovered through cost-of-service rates. By contrast, dynamic sources are typically generators capable of producing variable levels of reactive power by automatically controlling the generator to regulate voltage. Transmission system devices such as synchronous condensers can also provide dynamic reactive power. A class of solid state devices (called flexible AC transmission system devices or FACTs) can provide dynamic reactive power. One specific device has the unfortunate name of static VAR compensator (SVC), where 'static' refers to the solid state nature of the device (it does not include rotating equipment) and not to the production of static reactive power. Dynamic sources at the distribution level, while more costly would be very useful in helping to regulate local voltage. Local voltage regulation would reduce system losses, increase circuit capacity, increase reliability, and improve efficiency. Reactive power is theoretically available from any inverter-based equipment such as photovoltaic (PV) systems, fuel cells, microturbines, and adjustable-speed drives. However, the installation is usually only economical if reactive power supply is considered during the design and construction phase. In this report, we find that if the inverters of PV systems or the generators of combined heat and power (CHP) systems were designed with capability to supply dynamic reactive power, they could do this quite economically. In fact, on an annualized basis, these inverters and generators may be able to supply dynamic reactive power for about $5 or $6 per kVAR. The savings from the local supply of dynamic reactive power would be in reduced losses, increased capacity, and decreased transmission congestion. The net savings are estimated to be about $7 per kVAR on an annualized basis for a hypothetical circuit. Thus the distribution company could economically purchase a dynamic reactive power service from customers for perhaps $6/kVAR. This practice would provide for better voltage regulation in the distribution system and would provide an alternate revenue source to help amortize the cost of PV and CHP installations. As distribution and transmission systems are operated under rising levels of stress, the value of local dynamic reactive supply is expected to grow. Also, large power inverters, in the range of 500 kW to 1 MW, are expected to decrease in cost as they become mass produced. This report provides one data point which shows that the local supply of dynamic reactive power is marginally profitable at present for a hypothetical circuit. We expect that the trends of growing power flow on the existing system and mass production of inverters for distributed energy devices will make the dynamic supply of reactive power from customers an integral component of economical and reliable system operation in the future.

  4. Options for Affordable Fission Surface Power Systems

    SciTech Connect (OSTI)

    Houts, Mike; Gaddis, Steve; Porter, Ron; Van Dyke, Melissa; Martin, Jim; Godfroy, Tom; Bragg-Sitton, Shannon; Garber, Anne; Pearson, Boise [NASA Marshall Space Flight Center, VP31, MSFC, AL 35812 (United States)

    2006-07-01T23:59:59.000Z

    Fission surface power systems could provide abundant power anywhere on the surface of the moon or Mars. Locations could include permanently shaded regions on the moon and high latitudes on Mars. To be fully utilized, however, fission surface power systems must be safe, have adequate performance, and be affordable. This paper discusses options for the design and development of such systems. (authors)

  5. Progress Report on Power Division Work Plan

    E-Print Network [OSTI]

    RPS & impacts on PNW · Analysis of negative wholesale power prices · Wind Integration Forum · Maintain balancing" DR pilot programs · Tracking Smart Grid Demo Project ­ ­ Will include "conventional" and "load/windProgress Report on Power Division Work Plan Power Committee Meeting October 2010 1 #12;The Division

  6. Water reactive hydrogen fuel cell power system

    DOE Patents [OSTI]

    Wallace, Andrew P; Melack, John M; Lefenfeld, Michael

    2014-01-21T23:59:59.000Z

    A water reactive hydrogen fueled power system includes devices and methods to combine reactant fuel materials and aqueous solutions to generate hydrogen. The generated hydrogen is converted in a fuel cell to provide electricity. The water reactive hydrogen fueled power system includes a fuel cell, a water feed tray, and a fuel cartridge to generate power for portable power electronics. The removable fuel cartridge is encompassed by the water feed tray and fuel cell. The water feed tray is refillable with water by a user. The water is then transferred from the water feed tray into a fuel cartridge to generate hydrogen for the fuel cell which then produces power for the user.

  7. Water reactive hydrogen fuel cell power system

    DOE Patents [OSTI]

    Wallace, Andrew P; Melack, John M; Lefenfeld, Michael

    2014-11-25T23:59:59.000Z

    A water reactive hydrogen fueled power system includes devices and methods to combine reactant fuel materials and aqueous solutions to generate hydrogen. The generated hydrogen is converted in a fuel cell to provide electricity. The water reactive hydrogen fueled power system includes a fuel cell, a water feed tray, and a fuel cartridge to generate power for portable power electronics. The removable fuel cartridge is encompassed by the water feed tray and fuel cell. The water feed tray is refillable with water by a user. The water is then transferred from the water feed tray into the fuel cartridge to generate hydrogen for the fuel cell which then produces power for the user.

  8. Power superconducting power transmission cable

    DOE Patents [OSTI]

    Ashworth, Stephen P. (Cambridge, GB)

    2003-01-01T23:59:59.000Z

    The present invention is for a compact superconducting power transmission cable operating at distribution level voltages. The superconducting cable is a conductor with a number of tapes assembled into a subconductor. These conductors are then mounted co-planarly in an elongated dielectric to produce a 3-phase cable. The arrangement increases the magnetic field parallel to the tapes thereby reducing ac losses.

  9. Rocky Mountain NP, Colorado Nitrogen emissions from a variety of human made sources, including ammonia

    E-Print Network [OSTI]

    MacDonald, Lee

    sources. Sources of human made or excess atmospheric nitrogen include power plants, vehicle exhaust, oil are working with industry to reduce significant sources of nitrogen emissions. The State of Colorado will use at CSU is focused on identifying and refining voluntary best management practices (BMPs) for agricultural

  10. What measures climate? A variety of variables including their variability and extreme values determine climate for

    E-Print Network [OSTI]

    Allan, Richard P.

    climate zones? The sun is the ultimate power source for the climate "machine". The uneven distribution conditions. Typical variables to consider are temperature (maximum, miniumum), precipitation (includes rain, sleet, snow, hail, etc), sunlight/cloudiness, wind, humidity, ice cover, sea temperature, etc... Many

  11. [Article 1 of 7: Motivates and Includes the Consumer

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    grid must also accommodate new centralized plants. We will need conventional, centralized power stations - coal, oil, nuclear, gas and hydro - to help meet the increase in demand....

  12. Silicon Valley Power and Oklahoma Municipal Power Authority Win...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Silicon Valley Power and Oklahoma Municipal Power Authority Win 2014 Public Power Wind Awards Silicon Valley Power and Oklahoma Municipal Power Authority Win 2014 Public Power Wind...

  13. TEP Power Partners Project [Tucson Electric Power

    SciTech Connect (OSTI)

    None

    2013-11-19T23:59:59.000Z

    The Arizona Governor’s Office of Energy Policy, in partnership with Tucson Electric Power (TEP), Tendril, and Next Phase Energy (NPE), formed the TEP Power Partners pilot project to demonstrate how residential customers could access their energy usage data and third party applications using data obtained from an Automatic Meter Reading (AMR) network. The project applied for and was awarded a Smart Grid Data Access grant through the U.S. Department of Energy. The project participants’ goal for Phase I is to actively engage 1,700 residential customers to demonstrate sustained participation, reduction in energy usage (kWh) and cost ($), and measure related aspects of customer satisfaction. This Demonstration report presents a summary of the findings, effectiveness, and customer satisfaction with the 15-month TEP Power Partners pilot project. The objective of the program is to provide residential customers with energy consumption data from AMR metering and empower these participants to better manage their electricity use. The pilot recruitment goals included migrating 700 existing customers from the completed Power Partners Demand Response Load Control Project (DRLC), and enrolling 1,000 new participants. Upon conclusion of the project on November 19, 2013: ? 1,390 Home Area Networks (HANs) were registered. ? 797 new participants installed a HAN. ? Survey respondents’ are satisfied with the program and found value with a variety of specific program components. ? Survey respondents report feeling greater control over their energy usage and report taking energy savings actions in their homes after participating in the program. ? On average, 43 % of the participants returned to the web portal monthly and 15% returned weekly. ? An impact evaluation was completed by Opinion Dynamics and found average participant savings for the treatment period1 to be 2.3% of their household use during this period.2 In total, the program saved 163 MWh in the treatment period of 2013.

  14. Tidal power

    SciTech Connect (OSTI)

    Hammons, T.J. (Glasgow Univ., Scotland (United Kingdom))

    1993-03-01T23:59:59.000Z

    The paper reviews the physics of tidal power considering gravitational effects of moon and sun; semidiurnal, diurnal, and mixed tides; and major periodic components that affect the tidal range. Shelving, funneling, reflection, and resonance phenomena that have a significant effect on tidal range are also discussed. The paper then examines tidal energy resource for principal developments estimated from parametric modeling in Europe and worldwide. Basic parameters that govern the design of tidal power schemes in terms of mean tidal range and surface area of the enclosed basin are identified. While energy extracted is proportional to the tidal amplitude squared, requisite sluicing are is proportional to the square root of the tidal amplitude. Sites with large tidal amplitudes are therefore best suited for tidal power developments, whereas sites with low tidal amplitudes have sluicing that may be prohibitive. It is shown that 48% of the European tidal resource is in the United Kingdom, 42% in France and 8% in Ireland, other countries having negligible potential. Worldwide tidal resource is identified. Tidal barrage design and construction using caissons is examined, as are alternative operating modes (single-action generation, outflow generation, flood generation, two-way generation, twin basin generation, pumping, etc), development trends and possibilities, generation cost at the barrage boundary, sensitivity to discount rates, general economics, and markets. Environmental effects, and institutional constraints to the development of tidal barrage schemes are also discussed.

  15. Opportunities For Wind In The APX Green Power MarketTM

    E-Print Network [OSTI]

    Green Power Market. These include wind, solar, geothermal, biomass, landfill gas, and small hydro (less

  16. Power Technologies Energy Data Book - Fourth Edition

    SciTech Connect (OSTI)

    Aabakken, J.

    2006-08-01T23:59:59.000Z

    This report, prepared by NREL's Strategic Energy Analysis Center, includes up-to-date information on power technologies, including complete technology profiles. The data book also contains charts on electricity restructuring, power technology forecasts, electricity supply, electricity capability, electricity generation, electricity demand, prices, economic indicators, environmental indicators, and conversion factors.

  17. High voltage-high power components for large space power distribution systems

    SciTech Connect (OSTI)

    Renz, D.D.

    1984-08-01T23:59:59.000Z

    For over a decade, Lewis Research Center has been developing space power components. These components include a family of bi-polar power switching transistors, fast switching power diodes, heat pipe cooled high-frequency transformers and inductors, high frequency conduction cooled transformers, high powerhigh frequency capacitors, remote power controllers and rotary power transfer devices. Many of these components such as the power switching transistors, power diodes and the high frequency capacitor are commercially available. All the other components have been developed to the prototype level. Series resonant dc/dc converters have been built to the 25 kW level.

  18. Wind power and Wind power and

    E-Print Network [OSTI]

    Wind power and the CDM #12; Wind power and the CDM Emerging practices in developing wind power 2005 Jyoti P. Painuly, Niels-Erik Clausen, Jřrgen Fenhann, Sami Kamel and Romeo Pacudan #12; WIND POWER AND THE CDM Emerging practices in developing wind power projects for the Clean Development Mechanism Energy

  19. Nuclear Arms Control R&D Consortium includes Los Alamos

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Nuclear Arms Control R&D Consortium includes Los Alamos Nuclear Arms Control R&D Consortium includes Los Alamos A consortium led by the University of Michigan that includes LANL as...

  20. Smart Power Laboratory (Fact Sheet)

    SciTech Connect (OSTI)

    Not Available

    2011-10-01T23:59:59.000Z

    This fact sheet describes the purpose, lab specifications, applications scenarios, and information on how to partner with NREL's Smart Power Laboratory at the Energy Systems Integration Facility. Research at NREL's Smart Power Laboratory in the Energy Systems Integration Facility (ESIF) focuses on the development and integration of smart technologies including the integration of distributed and renewable energy resources through power electronics and smart energy management for building applications. The 5,300 sq. ft. laboratory is designed to be highly flexible and configurable, essential for a large variety of smart power applications that range from developing advanced inverters and power converters to testing residential and commercial scale meters and control technologies. Some application scenarios are: (1) Development of power converters for integration of distributed and renewable energy resources; (2) Development of advanced controls for smart power electronics; (3) Testing prototype and commercially available power converters for electrical interconnection and performance, advanced functionality, long duration reliability and safety; and (4) Hardware-in-loop development and testing of power electronics systems in smart distribution grid models.

  1. Isolated and soft-switched power converter

    DOE Patents [OSTI]

    Peng, Fang Zheng (Knoxville, TN); Adams, Donald Joe (Knoxville, TN)

    2002-01-01T23:59:59.000Z

    An isolated and soft-switched power converter is used for DC/DC and DC/DC/AC power conversion. The power converter includes two resonant tank circuits coupled back-to-back through an isolation transformer. Each resonant tank circuit includes a pair of resonant capacitors connected in series as a resonant leg, a pair of tank capacitors connected in series as a tank leg, and a pair of switching devices with anti-parallel clamping diodes coupled in series as resonant switches and clamping devices for the resonant leg. The power converter is well suited for DC/DC and DC/DC/AC power conversion applications in which high-voltage isolation, DC to DC voltage boost, bidirectional power flow, and a minimal number of conventional switching components are important design objectives. For example, the power converter is especially well suited to electric vehicle applications and load-side electric generation and storage systems, and other applications in which these objectives are important. The power converter may be used for many different applications, including electric vehicles, hybrid combustion/electric vehicles, fuel-cell powered vehicles with low-voltage starting, remote power sources utilizing low-voltage DC power sources, such as photovoltaics and others, electric power backup systems, and load-side electric storage and generation systems.

  2. A Roadmap to Success: Hiring, Retaining, and Including People...

    Broader source: Energy.gov (indexed) [DOE]

    A Roadmap to Success: Hiring, Retaining, and Including People with Disabilities A Roadmap to Success: Hiring, Retaining, and Including People with Disabilities December 5, 2014...

  3. [Article 1 of 7: Motivates and Includes the Consumer

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    and include the consumer exist. Some examples include advanced two-way metering (AMI), demand response (DR), and distributed energy resources (DER). A common misconception is...

  4. Including Retro-Commissioning in Federal Energy Savings Performance...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Including Retro-Commissioning in Federal Energy Savings Performance Contracts Including Retro-Commissioning in Federal Energy Savings Performance Contracts Document describes...

  5. Investigations into the Nature of Halogen Bonding Including Symmetry...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    into the Nature of Halogen Bonding Including Symmetry Adapted Perturbation Theory Analyses. Investigations into the Nature of Halogen Bonding Including Symmetry Adapted...

  6. SITE ELECTRICAL POWER SYSTEM DESCRIPTION DOCUMENT

    SciTech Connect (OSTI)

    E.P. McCann

    1999-04-16T23:59:59.000Z

    The Site Electrical Power System receives and distributes utility power to all North Portal site users. The major North Portal users are the Protected Area including the subsurface facility and Balance of Plant areas. The system is remotely monitored and controlled from the Surface Operations Monitoring and Control System. The system monitors power quality and provides the capability to transfer between Off-Site Utility and standby power (including dedicated safeguards and security power). Standby power is only distributed to selected loads for personnel safety and essential operations. Security power is only distributed to essential security operations. The standby safeguards and security power is independent from all other site power. The system also provides surface lighting, grounding grid, and lightning protection for the North Portal. The system distributes power during construction, operation, caretaker, and closure phases of the repository. The system consists of substation equipment (disconnect switches, breakers, transformers and grounding equipment) and power distribution cabling from substation to the north portal switch gear building. Additionally, the system includes subsurface facility substation (located on surface), switch-gear, standby diesel generators, underground duct banks, power cables and conduits, switch-gear building and associated distribution equipment for power distribution. Each area substation distributes power to the electrical loads and includes the site grounding, site lighting and lightning protection equipment. The site electrical power system distributes power of sufficient quantity and quality to meet users demands. The Site Electrical Power System interfaces with the North Portal surface systems requiring electrical power. The system interfaces with the Subsurface Electrical Distribution System which will supply power to the underground facilities from the North Portal. Power required for the South Portal and development side activities of the subsurface facility will be provided at the South Portal by the Subsurface Electrical Distribution System. The Site Electrical Power System interfaces with the Off-Site Utility System for the receipt of power. The System interfaces with the Surface Operations Monitoring and Control System for monitoring and control. The System interfaces with MGR Site Layout System for the physical location of equipment and power distribution.

  7. Power Recovery

    E-Print Network [OSTI]

    Murray, F.

    , will be the use of the ASTM Theoretical Steam Rate Tables. In addition, the author's experience regarding the minimum size for power recovery units that are economic in a Culf Coast plant will be presented. INTROD\\Jr.'rION When surveying an operation... will be discussed in detail. Each term in the equation will be considered in English units. Secondly, the use of Mollier diagrams to estimate the enthalphy change between the initial and final conditions will be considered. The last method, specific to steam...

  8. Yakama Power

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level:Energy: Grid Integration Redefining What'sis Taking Over OurThe Iron SpinPrincetonUsingWhatY-12 recognized for ...BER/NERSCYakama Power May

  9. Fusion Power

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645U.S. DOEThe Bonneville Power AdministrationField8,Dist.Newof EnergyFunding Opportunity fromFusion Links Fusion

  10. The elements of nuclear power

    SciTech Connect (OSTI)

    Bennet, D.J.; Thomson, J.R.

    1989-01-01T23:59:59.000Z

    An introduction to the principles of nuclear fission power generation. Describes the physical processes which occur in a nuclear reactor and discusses the theory behind the calculations. Also covers heat transfer in reactors, thermodynamic power cycles, reactor operators, and radiation shielding. Material covered includes topics on the effects of nuclear radiation on humans, the safety of nuclear reactors and of those parts of the nuclear fuel cycle which deal with fuel element manufacture and the reprocessing of irradiated fuel.

  11. Guide to Purchasing Green Power

    Broader source: Energy.gov [DOE]

    The Guide to Purchasing Green Power is intended for organizations that are considering the merits of buying green power as well as those that have decided to buy it and want help doing so. The guide was written for a broad audience, including businesses, government agencies, universities, and all organizations wanting to diversify their energy supply and reduce the environmental impact of their electricity use. The Guide can help with planning an on-site renewable generation project.

  12. Solar powered desalination system

    E-Print Network [OSTI]

    Mateo, Tiffany Alisa

    2011-01-01T23:59:59.000Z

    2008, uses concentrated solar power to split water. Figurethe main reason the potential for solar power is boundless.a clean energy source, solar power is inexhaustible, fairly

  13. ELECTROCHEMICAL POWER FOR TRANSPORTATION

    E-Print Network [OSTI]

    Cairns, Elton J.

    2012-01-01T23:59:59.000Z

    electric power generating plant, and the distributionrequired on the power-generating plant and not on the vehi-in either power-generating plants or combustion engines,

  14. Southwestern Power Administration

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Courses Instructors NERC Continuing Education Power Operations Training Center You'll find the "Power" of learning at Southwestern's Power Operations Training Center (POTC). POTC's...

  15. POWER PURCHASE AGREEMENT DELMARVA POWER & LIGHT COMPANY

    E-Print Network [OSTI]

    Firestone, Jeremy

    POWER PURCHASE AGREEMENT between DELMARVA POWER & LIGHT COMPANY ("Buyer") and BLUEWATER WIND 3.5 Energy Forecasts, Scheduling and Balancing.......................................... 39 3

  16. Systems and methods for an integrated electrical sub-system powered by wind energy

    DOE Patents [OSTI]

    Liu, Yan (Ballston Lake, NY); Garces, Luis Jose (Niskayuna, NY)

    2008-06-24T23:59:59.000Z

    Various embodiments relate to systems and methods related to an integrated electrically-powered sub-system and wind power system including a wind power source, an electrically-powered sub-system coupled to and at least partially powered by the wind power source, the electrically-powered sub-system being coupled to the wind power source through power converters, and a supervisory controller coupled to the wind power source and the electrically-powered sub-system to monitor and manage the integrated electrically-powered sub-system and wind power system.

  17. Direct current uninterruptible power supply method and system

    DOE Patents [OSTI]

    Sinha, Gautam

    2003-12-02T23:59:59.000Z

    A method and system are described for providing a direct current (DC) uninterruptible power supply with the method including, for example: continuously supplying fuel to a turbine; converting mechanical power from the turbine into alternating current (AC) electrical power; converting the AC electrical power to DC power within a predetermined voltage level range; supplying the DC power to a load; and maintaining a DC load voltage within the predetermined voltage level range by adjusting the amount of fuel supplied to the turbine.

  18. Analysis of Automotive Turbocharger Nonlinear Response Including Bifurcations

    E-Print Network [OSTI]

    Vistamehr, Arian

    2010-10-12T23:59:59.000Z

    Automotive turbochargers (TCs) increase internal combustion engine power and efficiency in passenger and commercial vehicles. TC rotors are usually supported on floating ring bearings (FRBs) or semi-floating ring bearings (SFRBs), both of which...

  19. Initial Northwest Power Act Power Sales Contracts : Final Environmental Impact Statement. Volume 1, Environmental Analysis.

    SciTech Connect (OSTI)

    United States. Bonneville Power Administration.

    1992-01-01T23:59:59.000Z

    This is volume 1 of the final environmental impact statement of the Bonneville Power Administration Information is included on the following: Purpose of and need for action; alternatives including the proposed action; affected environment; and environmental consequences.

  20. Cathode power distribution system and method of using the same for power distribution

    DOE Patents [OSTI]

    Williamson, Mark A; Wiedmeyer, Stanley G; Koehl, Eugene R; Bailey, James L; Willit, James L; Barnes, Laurel A; Blaskovitz, Robert J

    2014-11-11T23:59:59.000Z

    Embodiments include a cathode power distribution system and/or method of using the same for power distribution. The cathode power distribution system includes a plurality of cathode assemblies. Each cathode assembly of the plurality of cathode assemblies includes a plurality of cathode rods. The system also includes a plurality of bus bars configured to distribute current to each of the plurality of cathode assemblies. The plurality of bus bars include a first bus bar configured to distribute the current to first ends of the plurality of cathode assemblies and a second bus bar configured to distribute the current to second ends of the plurality of cathode assemblies.

  1. M-C Power`s product design and improvement

    SciTech Connect (OSTI)

    Scroppo, J.A.; Laurens, R.M.; Petraglia, V.J.

    1995-12-31T23:59:59.000Z

    The sole mission of M-C Power is the development and subsequent commercialization of molten carbonate fuel cell (MCFC) stacks. These MCFC stacks are based on the Internally Manifolded Heat EXchanger plate design developed by the Institute of Gas Technology. Integration of the MCFC stack into a commercially viable power plant is the mission of the IMHEX{sup {reg_sign}} team. The team is composed of leaders in the packaging and design of power generation equipment, including fuel cell technology, and includes Stewart & Stevenson, Bechtel, The Institute of Gas Technology and M-C Power. In an effort to succeed in their respective missions, M-C Power and the IMHEX{sup {reg_sign}} team have developed a commercialization program. At the present time, the team is making the transition from Phase I (Technology Development) to Phase II (Product Design & Improvement) of the program. Phase II`s objective is a commercially viable (cost effective and technologically reliable) MCFC power plant ready for market by the turn of the century.

  2. Cut Your Power Bills

    E-Print Network [OSTI]

    Greenwood, R. W.

    1979-01-01T23:59:59.000Z

    in lohich it was not at all obvious. If fuel and power factor adjustments are included, the equation becomes: M = $1650 + $3.948 BD + $0.20 rkVA + E ($0.0054 + FCA) The monthly bill is further increased, by 1%, unless the customer is served at 132 kV... and the National Energy Program, has mandated that states consider lifeline and marginal cost based rates. 3. Energy charges are based on those expenses that tend to vary with rate of electricity production such as fuel, operating labor and maintenance. Because...

  3. acid analysis including: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Nairn, John A. 12 A bottom-up analysis of including aviation within theEU's Emissions Trading Scheme Geosciences Websites Summary: A bottom-up analysis of including aviation...

  4. analysis including quantification: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Ausloos 2004-12-31 29 A bottom-up analysis of including aviation within theEU's Emissions Trading Scheme Geosciences Websites Summary: A bottom-up analysis of including aviation...

  5. Biomarkers Core Lab Price List Does NOT Include

    E-Print Network [OSTI]

    Grishok, Alla

    v3102014 Biomarkers Core Lab Price List Does NOT Include Kit Cost PURCHASED by INVESTIGATOR/1/2013 Page 1 of 5 #12;Biomarkers Core Lab Price List Does NOT Include Kit Cost PURCHASED by INVESTIGATOR

  6. Example Retro-Commissioning Scope of Work to Include Services...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Retro-Commissioning Scope of Work to Include Services as Part of an ESPC Investment-Grade Audit Example Retro-Commissioning Scope of Work to Include Services as Part of an ESPC...

  7. California Energy Commission Media Office POWER PLANT FACT SHEET

    E-Print Network [OSTI]

    California Energy Commission Media Office POWER PLANT FACT SHEET Updated: 12/4/2012 (Includes: Lodi has licensed or given small power plant exemptions to 78 power plants, totaling 29,156* megawatts (MW). Fifty-four licensed power plants are in operation, producing 17,737 MW. Since Governor Brown took office

  8. Optimization of Industrial Refrigeration Plants: Including a Case Study at Stonyfield Farm Yogurt

    E-Print Network [OSTI]

    Dixon, R.; McCowan, B.; Drake, L.; Epstein, G.; D'Antonio, M.; Moray, S.

    2006-01-01T23:59:59.000Z

    controls and unloading (specifically in the case of screw compressors which do not unload linearly). A lower refrigerant temperature results in lower suction pressure and increased compressor power requirements. A lower condensing pressure, which is a...Optimization of Industrial Refrigeration Plants: Including a Case Study at Stonyfield Farm Yogurt Mark D’Antonio Satyen Moray Brian McCowan Gary Epstein VP Engineering Services Project Manager VP Technology & Development President Energy...

  9. Solid state pulsed power generator

    DOE Patents [OSTI]

    Tao, Fengfeng; Saddoughi, Seyed Gholamali; Herbon, John Thomas

    2014-02-11T23:59:59.000Z

    A power generator includes one or more full bridge inverter modules coupled to a semiconductor opening switch (SOS) through an inductive resonant branch. Each module includes a plurality of switches that are switched in a fashion causing the one or more full bridge inverter modules to drive the semiconductor opening switch SOS through the resonant circuit to generate pulses to a load connected in parallel with the SOS.

  10. Wireless Power Transfer

    ScienceCinema (OSTI)

    None

    2013-11-19T23:59:59.000Z

    Wireless Power Transfer is an innovative approach using magnetic resonance coupling of air core transformers designed for today's growing plug-in electric vehicle market. This technology can provide a convenient, safe and flexible means to charge electric vehicles under stationary and dynamic conditions. Plug-in Electric Vehicles (PEV) are burdened by the need for cable and plug charger, galvanic isolation of the on-board electronics, bulk and cost of this charger and the large energy storage system (ESS) packs needed. With a system where you have to physically plug in there are a number of occasions where the owner could very well forget to charge the vehicle. For stationary applications (like charging of a PHEV at home), ORNL's innovative wireless power transfer technology adds a convenience factor compared to actually plugging in which will mean that the vehicle will have a full charge every morning. Electric vehicle charging must be safe, compact and efficient in order to be convenient for customers. By reconfiguring the transformer and altering the resonance frequency, energy is transferred to the battery with lower energy losses and with fewer demands on the primary circuit by the rest of the transformer system. The ORNL discovery shows that sufficient power for the battery can be transferred from the primary to secondary circuits without significant energy losses if the operating frequency is set at 50% to 95% of the resonance frequency of the circuit. The electrical power is then transmitted to the chargeable battery, which is electrically coupled to the secondary circuit through the air core transformer. Some advantages include: Reduced energy losses during transfer of energy to the battery; A charge potential that is relatively unaffected by up to 25% misalignment of vehicle; and Other receiving components draw less power from the primary circuit. These advantages allow wireless power technology applications to expand at the workplace and beyond as the demand for EV rises. For vehicles that operate over a fixed route such as busses and shuttle vehicles, Wireless Power Transfer (WPT) means that a smaller battery pack can be used. In the traditional system, the battery pack is designed to accommodate the needs of the entire route or shift. With WPT the battery can be downsized because it can be charged when the vehicle stops on its route (a rental car shuttle bus, for example, can charge when it waits in the terminal and again when it waits at the rental car place. Thus the battery only needs enough charge to get to the next stop. This decrease in battery size means significant cost savings to electrify the vehicle. This technology enables efficient "opportunity charging stations" for predefined routes and planned stops reducing down time. Charging can occur in minutes. This improvement also eliminates the harmful emissions that occur in garages while buses are at idle during charging. In larger cities, dynamic charging offers an even greater impact utilizing existing infrastructure. As vehicles travel along busy freeways and interstate systems, wireless charging can occur while the vehicle is in motion. With this technology a vehicle essentially has unlimited electric range while using a relatively small battery pack. In-motion charging stations use vehicle sensors to alert the driver. Traveling at normal speeds, sensors establish in-motion charging. WPT transmit pads sequentially energize to the negotiated power level based on vehicle speed and its requested charging energy. Lower power when vehicle speed is slow and much higher power for faster moving vehicles. Vehicle to Infrastructure communications (V2I) coordinates WPT charging level according to on-board battery pack state-of-charge. V2I activates the roadway transmit pads placing them in standby mode and negotiates charging fee based on prevailing grid rate and vehicle energy demand. Dynamic charging would allow electricity to supply a very large fraction of the energy for the transportation sector and reduce greatly petroleum consump

  11. Wireless Power Transfer

    SciTech Connect (OSTI)

    None

    2013-07-22T23:59:59.000Z

    Wireless Power Transfer is an innovative approach using magnetic resonance coupling of air core transformers designed for today's growing plug-in electric vehicle market. This technology can provide a convenient, safe and flexible means to charge electric vehicles under stationary and dynamic conditions. Plug-in Electric Vehicles (PEV) are burdened by the need for cable and plug charger, galvanic isolation of the on-board electronics, bulk and cost of this charger and the large energy storage system (ESS) packs needed. With a system where you have to physically plug in there are a number of occasions where the owner could very well forget to charge the vehicle. For stationary applications (like charging of a PHEV at home), ORNL's innovative wireless power transfer technology adds a convenience factor compared to actually plugging in which will mean that the vehicle will have a full charge every morning. Electric vehicle charging must be safe, compact and efficient in order to be convenient for customers. By reconfiguring the transformer and altering the resonance frequency, energy is transferred to the battery with lower energy losses and with fewer demands on the primary circuit by the rest of the transformer system. The ORNL discovery shows that sufficient power for the battery can be transferred from the primary to secondary circuits without significant energy losses if the operating frequency is set at 50% to 95% of the resonance frequency of the circuit. The electrical power is then transmitted to the chargeable battery, which is electrically coupled to the secondary circuit through the air core transformer. Some advantages include: Reduced energy losses during transfer of energy to the battery; A charge potential that is relatively unaffected by up to 25% misalignment of vehicle; and Other receiving components draw less power from the primary circuit. These advantages allow wireless power technology applications to expand at the workplace and beyond as the demand for EV rises. For vehicles that operate over a fixed route such as busses and shuttle vehicles, Wireless Power Transfer (WPT) means that a smaller battery pack can be used. In the traditional system, the battery pack is designed to accommodate the needs of the entire route or shift. With WPT the battery can be downsized because it can be charged when the vehicle stops on its route (a rental car shuttle bus, for example, can charge when it waits in the terminal and again when it waits at the rental car place. Thus the battery only needs enough charge to get to the next stop. This decrease in battery size means significant cost savings to electrify the vehicle. This technology enables efficient "opportunity charging stations" for predefined routes and planned stops reducing down time. Charging can occur in minutes. This improvement also eliminates the harmful emissions that occur in garages while buses are at idle during charging. In larger cities, dynamic charging offers an even greater impact utilizing existing infrastructure. As vehicles travel along busy freeways and interstate systems, wireless charging can occur while the vehicle is in motion. With this technology a vehicle essentially has unlimited electric range while using a relatively small battery pack. In-motion charging stations use vehicle sensors to alert the driver. Traveling at normal speeds, sensors establish in-motion charging. WPT transmit pads sequentially energize to the negotiated power level based on vehicle speed and its requested charging energy. Lower power when vehicle speed is slow and much higher power for faster moving vehicles. Vehicle to Infrastructure communications (V2I) coordinates WPT charging level according to on-board battery pack state-of-charge. V2I activates the roadway transmit pads placing them in standby mode and negotiates charging fee based on prevailing grid rate and vehicle energy demand. Dynamic charging would allow electricity to supply a very large fraction of the energy for the transportation sector and reduce greatly petroleum consump

  12. DIRECT FUEL/CELL/TURBINE POWER PLANT

    SciTech Connect (OSTI)

    Hossein Ghezel-Ayagh

    2004-05-01T23:59:59.000Z

    This report includes the progress in development of Direct FuelCell/Turbine{reg_sign} (DFC/T{reg_sign}) power plants for generation of clean power at very high efficiencies. The DFC/T power system is based on an indirectly heated gas turbine to supplement fuel cell generated power. The DFC/T power generation concept extends the high efficiency of the fuel cell by utilizing the fuel cell's byproduct heat in a Brayton cycle. Features of the DFC/T system include: electrical efficiencies of up to 75% on natural gas, 60% on coal gas, minimal emissions, simplicity in design, direct reforming internal to the fuel cell, reduced carbon dioxide release to the environment, and potential cost competitiveness with existing combined cycle power plants. FCE successfully completed testing of the pre-alpha DFC/T hybrid power plant. This power plant was constructed by integration of a 250kW fuel cell stack and a microturbine. The tests of the cascaded fuel cell concept for achieving high fuel utilizations were completed. The tests demonstrated that the concept results in higher power plant efficiency. Also, the preliminary design of a 40 MW power plant including the key equipment layout and the site plan was completed.

  13. PV/thermal solar power assembly | OSTI, US Dept of Energy, Office...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    PVthermal solar power assembly Re-direct Destination: A flexible solar power assembly (2) includes a flexible photovoltaic device (16) attached to a flexible thermal solar...

  14. February 2011 Mapping the power

    E-Print Network [OSTI]

    Farrell, Anthony P.

    February 2011 5 Mapping the power of sunshine 8 Aboriginal portal emphasizes video 10 The value or less) must be signed and include an address and phone number for verification. Submit letters to campus By Jody Jacob these compounds could potentially be controlled. "Using lavender as our test model

  15. Village Power `97. Proceedings

    SciTech Connect (OSTI)

    Cardinal, J.; Flowers, L.; Taylor, R.; Weingart, J. [eds.

    1997-09-01T23:59:59.000Z

    It is estimated that two billion people live without electricity and its services. In addition, there is a sizable number of rural villages that have limited electrical service, with either part-day operation by diesel gen-sets or partial electrification (local school or community center and several nearby houses). For many villages connected to the grid, power is often sporadically available and of poor quality. The U.S. National Renewable Energy Laboratory (NREL) in Golden, Colorado, has initiated a program to address these potential electricity opportunities in rural villages through the application of renewable energy (RE) technologies. The objective of this program is to develop and implement applications that demonstrate the technical performance, economic competitiveness, operational viability, and environmental benefits of renewable rural electric solutions, compared to the conventional options of line extension and isolated diesel mini-grids. These four attributes foster sustainability; therefore, the program is entitled Renewables for Sustainable Village Power (RSVP). The RSVP program is a multi-disciplinary, multi-technology, multi-application program composed of six key activities, including village application development, computer model development, systems analysis, pilot project development, technical assistance, and an Internet-based village power project database. The current program emphasizes wind, photovoltaics (PV), and their hybrids with diesel gen-sets. NREL`s RSVP team is currently involved in rural electricity projects in thirteen countries, with U.S., foreign, and internationally based agencies and institutions. This document contains reports presented at the Proceedings of Village Power, 1997. Individual projects have been processed separately for the United States Department of Energy databases.

  16. COMMISSIONDECISION Small Power Plant Exemption (06-SPPE-2)

    E-Print Network [OSTI]

    ............................................................................. 14 Transmission Line Safety & Nuisance...................................................... 15 to review and license proposals to construct and operate large electric power plants, includingCOMMISSIONDECISION Small Power Plant Exemption (06-SPPE-2) Imperial County Order No: 07

  17. Can New Nuclear Power Plants be Project Financed?

    E-Print Network [OSTI]

    Taylor, Simon

    This paper considers the prospects for financing a wave of new nuclear power plants (NPP) using project financing, which is used widely in large capital intensive infrastructure investments, including the power and gas sectors, but has...

  18. Optimal Shipboard Power System Management via Mixed Integer Dynamic Programming

    E-Print Network [OSTI]

    Kwatny, Harry G.

    feedback controls is described. Examples are given. I. INTRODUCTION Maintaining power flow to vital loads following component failure(s) is a central goal of power system management including electric shipboard

  19. Electric power annual 1997. Volume 2

    SciTech Connect (OSTI)

    NONE

    1998-10-01T23:59:59.000Z

    The Electric Power Annual 1997, Volume 2 contains annual summary statistics at national, regional, and state levels for the electric power industry, including information on both electric utilities and nonutility power producers. Included are data for electric utility retail sales of electricity, associated revenue, and average revenue per kilowatthour of electricity sold; financial statistics; environmental statistics; power transactions; and demand-side management. Also included are data for US nonutility power producers on installed capacity; gross generation; emissions; and supply and disposition of energy. The objective of the publication is to provide industry decisionmakers, government policymakers, analysts, and the general public with historical data that may be used in understanding US electricity markets. 15 figs., 62 tabs.

  20. Wave Power Demonstration Project at Reedsport, Oregon

    SciTech Connect (OSTI)

    Mekhiche, Mike [Principal Investigator] [Principal Investigator; Downie, Bruce [Project Manager] [Project Manager

    2013-10-21T23:59:59.000Z

    Ocean wave power can be a significant source of large?scale, renewable energy for the US electrical grid. The Electrical Power Research Institute (EPRI) conservatively estimated that 20% of all US electricity could be generated by wave energy. Ocean Power Technologies, Inc. (OPT), with funding from private sources and the US Navy, developed the PowerBuoy? to generate renewable energy from the readily available power in ocean waves. OPT's PowerBuoy converts the energy in ocean waves to electricity using the rise and fall of waves to move the buoy up and down (mechanical stroking) which drives an electric generator. This electricity is then conditioned and transmitted ashore as high?voltage power via underwater cable. OPT's wave power generation system includes sophisticated techniques to automatically tune the system for efficient conversion of random wave energy into low cost green electricity, for disconnecting the system in large waves for hardware safety and protection, and for automatically restoring operation when wave conditions normalize. As the first utility scale wave power project in the US, the Wave Power Demonstration Project at Reedsport, OR, will consist of 10 PowerBuoys located 2.5 miles off the coast. This U.S. Department of Energy Grant funding along with funding from PNGC Power, an Oregon?based electric power cooperative, was utilized for the design completion, fabrication, assembly and factory testing of the first PowerBuoy for the Reedsport project. At this time, the design and fabrication of this first PowerBuoy and factory testing of the power take?off subsystem are complete; additionally the power take?off subsystem has been successfully integrated into the spar.

  1. Introduction to Small-Scale Wind Energy Systems (Including RETScreen...

    Open Energy Info (EERE)

    Introduction to Small-Scale Wind Energy Systems (Including RETScreen Case Study) (Webinar) Jump to: navigation, search Tool Summary LAUNCH TOOL Name: Introduction to Small-Scale...

  2. Laboratory Curiosity rover ChemCam team, including Los Alamos...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    MEXICO, August 23, 2012-Members of the Mars Science Laboratory Curiosity rover ChemCam team, including Los Alamos National Laboratory scientists, squeezed in a little extra target...

  3. PLOT: A UNIX PROGRAM FOR INCLUDING GRAPHICS IN DOCUMENTS

    E-Print Network [OSTI]

    Curtis, Pavel

    2013-01-01T23:59:59.000Z

    simple, easy-to-read graphics language designed specificallyPROGRAM FOR INCLUDING GRAPHICS IN DOCUMENTS Pavel Curtismeanings as in the GRAFPAC graphics system. Definl. ~ tions

  4. analysis including plasma: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Assembly 2010 Space Plasmas in the Solar System, including Planetary Magnetospheres (D) Solar Variability, Cosmic Rays and Climate (D21) GEOMAGNETIC ACTIVITY AT HIGH-LATITUDE:...

  5. Energy Department Expands Gas Gouging Reporting System to Include...

    Energy Savers [EERE]

    Washington, DC - Energy Secretary Samuel W. Bodman announced today that the Department of Energy has expanded its gas gouging reporting system to include a toll-free telephone...

  6. arch dams including: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Websites Summary: insight into the gamut of shallow water waves, including kinematic, diffusion, dynamic, and gravity wavesDam-Breach Flood Wave Propagation Using...

  7. DIRECT FUEL CELL/TURBINE POWER PLANT

    SciTech Connect (OSTI)

    Hossein Ghezel-Ayagh

    2004-11-01T23:59:59.000Z

    This report includes the progress in development of Direct FuelCell/Turbine{reg_sign} (DFC/T{reg_sign}) power plants for generation of clean power at very high efficiencies. The DFC/T power system is based on an indirectly heated gas turbine to supplement fuel cell generated power. The DFC/T power generation concept extends the high efficiency of the fuel cell by utilizing the fuel cell's byproduct heat in a Brayton cycle. Features of the DFC/T system include: electrical efficiencies of up to 75% on natural gas, 60% on coal gas, minimal emissions, simplicity in design, direct reforming internal to the fuel cell, reduced carbon dioxide release to the environment, and potential cost competitiveness with existing combined cycle power plants. The operation of sub-MW hybrid Direct FuelCell/Turbine power plant test facility with a Capstone C60 microturbine was initiated in March 2003. The inclusion of the C60 microturbine extended the range of operation of the hybrid power plant to higher current densities (higher power) than achieved in previous tests using a 30kW microturbine. The design of multi-MW DFC/T hybrid systems, approaching 75% efficiency on natural gas, was initiated. A new concept was developed based on clusters of One-MW fuel cell modules as the building blocks. System analyses were performed, including systems for near-term deployment and power plants with long-term ultra high efficiency objectives. Preliminary assessment of the fuel cell cluster concept, including power plant layout for a 14MW power plant, was performed.

  8. Space nuclear power and man's extraterrestrial civilization

    SciTech Connect (OSTI)

    Angelo, J.J.; Buden, D.

    1983-01-01T23:59:59.000Z

    This paper examines leading space nuclear power technology candidates. Particular emphasis is given the heat-pipe reactor technology currently under development at the Los Alamos National Laboratory. This program is aimed at developing a 10-100 kWe, 7-year lifetime space nuclear power plant. As the demand for space-based power reaches megawatt levels, other nuclear reactor designs including: solid core, fluidized bed, and gaseous core, are considered.

  9. Microturbine Power Conversion Technology Review

    SciTech Connect (OSTI)

    Staunton, R.H.

    2003-07-21T23:59:59.000Z

    In this study, the Oak Ridge National Laboratory (ORNL) is performing a technology review to assess the market for commercially available power electronic converters that can be used to connect microturbines to either the electric grid or local loads. The intent of the review is to facilitate an assessment of the present status of marketed power conversion technology to determine how versatile the designs are for potentially providing different services to the grid based on changes in market direction, new industry standards, and the critical needs of the local service provider. The project includes data gathering efforts and documentation of the state-of-the-art design approaches that are being used by microturbine manufacturers in their power conversion electronics development and refinement. This project task entails a review of power converters used in microturbines sized between 20 kW and 1 MW. The power converters permit microturbine generators, with their non-synchronous, high frequency output, to interface with the grid or local loads. The power converters produce 50- to 60-Hz power that can be used for local loads or, using interface electronics, synchronized for connection to the local feeder and/or microgrid. The power electronics enable operation in a stand-alone mode as a voltage source or in grid-connect mode as a current source. Some microturbines are designed to automatically switch between the two modes. The information obtained in this data gathering effort will provide a basis for determining how close the microturbine industry is to providing services such as voltage regulation, combined control of both voltage and current, fast/seamless mode transfers, enhanced reliability, reduced cost converters, reactive power supply, power quality, and other ancillary services. Some power quality improvements will require the addition of storage devices; therefore, the task should also determine what must be done to enable the power conversion circuits to accept a varying dc voltage source. The study will also look at technical issues pertaining to the interconnection and coordinated/compatible operation of multiple microturbines. It is important to know today if modifications to provide improved operation and additional services will entail complete redesign, selected component changes, software modifications, or the addition of power storage devices. This project is designed to provide a strong technical foundation for determining present technical needs and identifying recommendations for future work.

  10. Pv-Thermal Solar Power Assembly

    DOE Patents [OSTI]

    Ansley, Jeffrey H. (El Cerrito, CA); Botkin, Jonathan D. (El Cerrito, CA); Dinwoodie, Thomas L. (Piedmont, CA)

    2001-10-02T23:59:59.000Z

    A flexible solar power assembly includes a flexible photovoltaic device attached to a flexible thermal solar collector. The solar power assembly can be rolled up for transport and then unrolled for installation on a surface, such as the roof or side wall of a building or other structure, by use of adhesive and/or other types of fasteners.

  11. Bonneville Power Administration Administrator Steve Wright

    E-Print Network [OSTI]

    Administrator Steve Wright, I strongly support a clean energy future for our region that includes plentiful wild salmon, clean, renewable energy, and a healthy economy. The Bonneville Power Administration (BPABonneville Power Administration Administrator Steve Wright PO Box 12999 Portland, OR 97208 Dear

  12. Power Management in Wireless Networks Kevin Klues

    E-Print Network [OSTI]

    Jain, Raj

    Power Management in Wireless Networks Kevin Klues Abstract This paper presents a survey on the various power saving techniques used in wireless networking today. The work presented covers topics at each layer of a wireless networking protocol stack. The types of wireless networks considered include

  13. ECE 418/618 Power System Analysis

    E-Print Network [OSTI]

    Bolding, M. Chad

    will be given during the semester as bonus*. * Bonus includes: Power Seminars, in class pop quizzes, power field trip and announced bonus homework. Final Grades: 90% and above A 80% - 89.9 % B 65% - 79.9 % C 50% - 64

  14. Lessons learned from existing biomass power plants

    SciTech Connect (OSTI)

    Wiltsee, G.

    2000-02-24T23:59:59.000Z

    This report includes summary information on 20 biomass power plants, which represent some of the leaders in the industry. In each category an effort is made to identify plants that illustrate particular points. The project experiences described capture some important lessons learned that lead in the direction of an improved biomass power industry.

  15. Quick Guide: Power Purchase Agreements (Fact Sheet)

    SciTech Connect (OSTI)

    Not Available

    2011-07-01T23:59:59.000Z

    Introduction to Federal power purchase agreements (PPAs), including available FEMP services and technical assistance as well as questions to ask when evaluating PPAs for a Federal renewable energy project.

  16. Quick Guide: Power Purchase Agreements (Fact Sheet)

    SciTech Connect (OSTI)

    Not Available

    2010-06-01T23:59:59.000Z

    Introduction to Federal power purchase agreements (PPAs), including available FEMP services and technical assistance as well as questions to ask when evaluating PPAs for a Federal renewable energy project.

  17. Spring 2013 Composite Data Products - Backup Power

    SciTech Connect (OSTI)

    Kurtz, J.; Wipke, K.; Sprik, S.; Ramsden, T.; Ainscough, C.; Saur, G.; Post, M.; Peters, M.

    2013-05-01T23:59:59.000Z

    This presentation from the U.S. Department of Energy's National Renewable Energy Laboratory includes 21 composite data products (CDPs) produced in Spring 2013 for fuel cell backup power systems.

  18. Catalog of DC Appliances and Power Systems

    E-Print Network [OSTI]

    Garbesi, Karina

    2012-01-01T23:59:59.000Z

    main conclusions about off-grid markets for DC appliances,and power systems. Mature Off-Grid Markets for DC Appliancesapplications include off-grid residential, telecom, remote

  19. Department of Energy Bonneville Power Administration

    E-Print Network [OSTI]

    Department of Energy Bonneville Power Administration P.O. Box 3621 Portland, Oregon 97208 on the programmatic approach BPA is taking with habitat projects. The concerns include decision/prioritization

  20. Department of Energy Bonneville Power Administration

    E-Print Network [OSTI]

    Department of Energy Bonneville Power Administration P.O. Box 3621 Portland, Oregon 97208 levels, which may include reallocation and/or prioritization of existing RM&E funding. Regional level

  1. The New Rules for Purchasing Electric Power

    E-Print Network [OSTI]

    Stern, K.

    others, largely because of its size and electricity consumption per customer. Industry today sees these changes manifested in a variety of ways, several of which represent alternative power costs. These include: - conventional published tariffs...

  2. Review of Power Corrections in DIS

    E-Print Network [OSTI]

    Thomas Kluge

    2006-06-23T23:59:59.000Z

    An overview is given of analyses in DIS at HERA which confront the predictions of power corrections with measured data. These include mean values and distributions of 2-jet as well as 3-jet event shape variables and jet rates.

  3. Long Island Power Authority- Renewable Electricity Goal

    Broader source: Energy.gov [DOE]

    As a municipal utility, the Long Island Power Authority (LIPA) is not obligated to comply with the [http://www.dsireusa.org/library/includes/incentive2.cfm?Incentive_Code=N... New York Renewable...

  4. City of Santa Monica- Green Power Purchasing

    Broader source: Energy.gov [DOE]

    The City of Santa Monica made history June 1, 1999, as green electricity began powering all municipal facilities -- including the Santa Monica Airport, City Hall and the Santa Monica Pier -- making...

  5. Articles which include chevron film cooling holes, and related processes

    DOE Patents [OSTI]

    Bunker, Ronald Scott; Lacy, Benjamin Paul

    2014-12-09T23:59:59.000Z

    An article is described, including an inner surface which can be exposed to a first fluid; an inlet; and an outer surface spaced from the inner surface, which can be exposed to a hotter second fluid. The article further includes at least one row or other pattern of passage holes. Each passage hole includes an inlet bore extending through the substrate from the inlet at the inner surface to a passage hole-exit proximate to the outer surface, with the inlet bore terminating in a chevron outlet adjacent the hole-exit. The chevron outlet includes a pair of wing troughs having a common surface region between them. The common surface region includes a valley which is adjacent the hole-exit; and a plateau adjacent the valley. The article can be an airfoil. Related methods for preparing the passage holes are also described.

  6. LIFE Power Plant Fusion Power Associates

    E-Print Network [OSTI]

    LIFE Power Plant Fusion Power Associates December 14, 2011 Mike Dunne LLNL #12;NIf-1111-23714.ppt LIFE power plant 2 #12;LIFE delivery timescale NIf-1111-23714.ppt 3 #12;Timely delivery is enabled dpa) § Removes ion threat and mitigates x-ray threat ­ allows simple steel piping § No need

  7. Hydroelectric Power Plants

    E-Print Network [OSTI]

    Purpose The Purpose

    Contents Purpose ..................... 1-1 1-1 Applicability .................. 1-2 1-1 References .................... 1-3 1-1 Limitations ................... 1-4 1-1 Contents ..................... 1-5 1-1 Design Procedures .............. 1-6 1-1 Other Design Information ......... 1-7 1-2 Deviations .................... 1-8 1-2 General Design Practices .......... 1-9 1-2 Safety Provisions ............... 1-10 1-2 Francis-Type Turbines ............ 2-2 2-1 Francis-Type Pump Turbines ....... 2-3 2-3 Kaplan-Type Turbines ............ 2-4 2-4 Turbine Considerations ........... 3-2 3-1 Handling Provisions ............. 3-3 3-1 Service Systems ................ 3-4 3-1 Considerations ................. 4-2 4-1 Penstock Shutoff Valves at the Valve Requirement ......... 5-2 5-1 Valve Selection ........... 5-3 5-1 Cranes .................. 6-2 6-1 Crane Lifting Accessories .... 6-3 6-6 Hoists .................. 6-4 6-8 Justification .............. 7-2 7-1 Loc

  8. New protection method for HVDC lines including cables

    SciTech Connect (OSTI)

    Takeda, H.; Ayakawa, H.; Tsumenaga, N.; Sanpei, M.

    1995-10-01T23:59:59.000Z

    For the third project of the Hokkaido-Honshu HVDC Link in Japan, called the HVDC Link III project (rated at 250 kVdc-1,200 A-300 MW), the authors developed an HVDC transmission line protection method based on a new working principle that allows high-speed and highly sensitive detection of faults, enhancing reliability in the supply of electric power. In general, increasing the sensitivity of relays will lead to an increased likelihood of undesired operation whereas lowering the sensitivity will impair the responsiveness of the relays. The proposed method meets these apparently incompatible requirements very well. Basically classified as a differential scheme, the HVDC transmission line protection method compensates for a charging and discharging current that flows through the line-to-ground capacitance at times of voltage variations caused by a line fault or by the operation of dc power systems. The developed protection method is also characterized in that it uses current changes induced by voltage variations to restrain the operation of a relay. This configuration has made the proposed method far superior in responsiveness and sensitivity to the conventional protection method. A simulation using an EMTP (Electro-Magnetic Transients Program) was conducted on this method. Developed relay equipment embodying the new protection method was subjected to various verification tests, where this equipment was connected to a power system simulator, before being delivered to the HVDC Link III facility.

  9. Solar powered desalination system

    E-Print Network [OSTI]

    Mateo, Tiffany Alisa

    2011-01-01T23:59:59.000Z

    are many solar photovoltaic power plants internationally andUSA, Blythe, CA Solar electric power plant, Blythe USA, SanTX Blue Wing solar electric power plant USA, Jacksonville,

  10. Solar powered desalination system

    E-Print Network [OSTI]

    Mateo, Tiffany Alisa

    2011-01-01T23:59:59.000Z

    of the electrical power output to the solar power input), aSolar Energy Calculator using Google Maps 23 Table 1.24: PV System Power Production Average Daily Irradiance (kWh/m2) Instillation Efficiency Labeled Efficiency Output

  11. Monitoring system including an electronic sensor platform and an interrogation transceiver

    DOE Patents [OSTI]

    Kinzel, Robert L.; Sheets, Larry R.

    2003-09-23T23:59:59.000Z

    A wireless monitoring system suitable for a wide range of remote data collection applications. The system includes at least one Electronic Sensor Platform (ESP), an Interrogator Transceiver (IT) and a general purpose host computer. The ESP functions as a remote data collector from a number of digital and analog sensors located therein. The host computer provides for data logging, testing, demonstration, installation checkout, and troubleshooting of the system. The IT transmits signals from one or more ESP's to the host computer to the ESP's. The IT host computer may be powered by a common power supply, and each ESP is individually powered by a battery. This monitoring system has an extremely low power consumption which allows remote operation of the ESP for long periods; provides authenticated message traffic over a wireless network; utilizes state-of-health and tamper sensors to ensure that the ESP is secure and undamaged; has robust housing of the ESP suitable for use in radiation environments; and is low in cost. With one base station (host computer and interrogator transceiver), multiple ESP's may be controlled at a single monitoring site.

  12. Turbomachine injection nozzle including a coolant delivery system

    DOE Patents [OSTI]

    Zuo, Baifang (Simpsonville, SC)

    2012-02-14T23:59:59.000Z

    An injection nozzle for a turbomachine includes a main body having a first end portion that extends to a second end portion defining an exterior wall having an outer surface. A plurality of fluid delivery tubes extend through the main body. Each of the plurality of fluid delivery tubes includes a first fluid inlet for receiving a first fluid, a second fluid inlet for receiving a second fluid and an outlet. The injection nozzle further includes a coolant delivery system arranged within the main body. The coolant delivery system guides a coolant along at least one of a portion of the exterior wall and around the plurality of fluid delivery tubes.

  13. Power control for heat engines

    DOE Patents [OSTI]

    Dineen, John J. (Durham, NH)

    1984-01-01T23:59:59.000Z

    A power control arrangement for a Stirling engine includes a sleeve mounted in each cylinder for axial movement and a port in the sleeve leading to a dead space. The port is covered by the piston at a position that is determined by the piston position and the axial adjustment of the sleeve. The compression phase of the Stirling cycle for that piston begins when the port is covered, so the position of the sleeve is used to set the Stirling engine power level.

  14. PowerPoint Presentation

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    April 30, 2013, Santa Clara, CA 2 Outline * Introduction Power Electronics in Electric Drive Vehicles Automotive Power Electronics Module Operation Automotive...

  15. Concentrated Solar Thermoelectric Power

    Broader source: Energy.gov (indexed) [DOE]

    CONCENTRATING SOLAR POWER PROGRAM REVIEW 2013 Concentrated Solar Thermoelectric Power Principal Investigator: Prof. Gang Chen Massachusetts Institute of Technology Cambridge, MA...

  16. TVA- Green Power Providers

    Broader source: Energy.gov [DOE]

    Tennessee Valley Authority (TVA) and participating power distributors of TVA power offer a performance-based incentive program to homeowners and businesses for the installation of renewable...

  17. Electrolytes for power sources

    DOE Patents [OSTI]

    Doddapaneni, N.; Ingersoll, D.

    1995-01-03T23:59:59.000Z

    Electrolytes are disclosed for power sources, particularly alkaline and acidic power sources, comprising benzene polysulfonic acids and benzene polyphosphonic acids or salts of such acids. 7 figures.

  18. Electrolytes for power sources

    DOE Patents [OSTI]

    Doddapaneni, Narayan (Albuquerque, NM); Ingersoll, David (Albuquerque, NM)

    1995-01-01T23:59:59.000Z

    Electrolytes for power sources, particularly alkaline and acidic power sources, comprising benzene polysulfonic acids and benzene polyphosphonic acids or salts of such acids.

  19. Flex power perspectives of indirect power system control through...

    Open Energy Info (EERE)

    power perspectives of indirect power system control through dynamic power price (Smart Grid Project) Jump to: navigation, search Project Name Flex power perspectives of indirect...

  20. New Horizons Mission Powered by Space Radioisotope Power Systems...

    Energy Savers [EERE]

    New Horizons Mission Powered by Space Radioisotope Power Systems New Horizons Mission Powered by Space Radioisotope Power Systems January 30, 2008 - 6:47pm Addthis Artist's concept...

  1. [Article 1 of 7: Motivates and Includes the Consumer

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    surges; the extra cost of these premium features can be included in the electric service contract. The Smart Grid will mitigate PQ events that originate in the transmission and...

  2. Including costs of supply chain risk in strategic sourcing decisions

    E-Print Network [OSTI]

    Jain, Avani

    2009-01-01T23:59:59.000Z

    Cost evaluations do not always include the costs associated with risks when organizations make strategic sourcing decisions. This research was conducted to establish and quantify the impact of risks and risk-related costs ...

  3. Direct FuelCell/Turbine Power Plant

    SciTech Connect (OSTI)

    Hossein Ghezel-Ayagh

    2004-11-19T23:59:59.000Z

    This report includes the progress in development of Direct Fuel Cell/Turbine. (DFC/T.) power plants for generation of clean power at very high efficiencies. The DFC/T power system is based on an indirectly heated gas turbine to supplement fuel cell generated power. The DFC/T power generation concept extends the high efficiency of the fuel cell by utilizing the fuel cell's byproduct heat in a Brayton cycle. Features of the DFC/T system include: electrical efficiencies of up to 75% on natural gas, 60% on coal gas, minimal emissions, simplicity in design, direct reforming internal to the fuel cell, reduced carbon dioxide release to the environment, and potential cost competitiveness with existing combined cycle power plants. FCE successfully completed testing of the pre-alpha sub-MW DFC/T power plant. This power plant was constructed by integration of a 250kW fuel cell stack and a microturbine. Following these proof-of-concept tests, a stand-alone test of the microturbine verified the turbine power output expectations at an elevated (representative of the packaged unit condition) turbine inlet temperature. Preliminary design of the packaged sub-MW alpha DFC/T unit has been completed and procurement activity has been initiated. The preliminary design of a 40 MW power plant including the key equipment layout and the site plan was completed. A preliminary cost estimate for the 40 MW DFC/T plant has also been prepared. The tests of the cascaded fuel cell concept for achieving high fuel utilizations were completed. The tests demonstrated that the concept results in higher power plant efficiency. Alternate stack flow geometries for increased power output/fuel utilization capabilities are also being evaluated.

  4. Limited Personal Use of Government Office Equipment including Information Technology

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    2005-01-07T23:59:59.000Z

    The Order establishes requirements and assigns responsibilities for employees' limited personal use of Government resources (office equipment and other resources including information technology) within DOE, including NNSA. The Order is required to provide guidance on appropriate and inappropriate uses of Government resources. This Order was certified 04/23/2009 as accurate and continues to be relevant and appropriate for use by the Department. Certified 4-23-09. No cancellation.

  5. Initial Northwest Power Act Power Sales Contracts : Final Environmental Impact Statement. Volume 4, Comments and Responses.

    SciTech Connect (OSTI)

    United States. Bonneville Power Administration.

    1992-01-01T23:59:59.000Z

    This volume of the Initial Northwest Power Act Power Sales Contracts Final Environmental Impact Statement (Final EIS) contains public comments addressing the Initial Northwest Power Act Power Sales Contracts Draft EIS, August 1990 and Bonneville Power Administration`s (BPA) responses. The Introduction provides information about the process BPA follows in addressing these comments. Part I contains a listing of the Alternative Actions evaluated in the Final EIS; Part II is organized by Alternatives and includes summaries of the comments and BPA responses; Part III provides copies of the original comments letters, and, for ease of identification, are coded in the margins according to the alternative(s) addressed.

  6. Climate VISION: Private Sector Initiatives: Electric Power: GHG...

    Office of Scientific and Technical Information (OSTI)

    - i.e., North American Industry Classification System 22 plants". It does not include CO2 emissions or electric output from industrial and commercial combined heat and power...

  7. Systems for Electrical Power from Coproduced and Low Temperature...

    Broader source: Energy.gov (indexed) [DOE]

    Presentation about Systems for Electrical Power from Coproduced and Low Temperature Geothermal Resources includes background, results and discussion, future plans and conclusion....

  8. Energy Storage & Power Electronics 2008 Peer Review - Energy...

    Broader source: Energy.gov (indexed) [DOE]

    that covered a broad range of new and ongoing, state-of-the-art, energy storage and power electronics technologies, including updates on the collaborations among DOEESPE,...

  9. Third Party Financing and Power Purchasing Agreements for Public...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    and Power Purchase Agreements for public sector PV projects presented at the TAP Web Seminar on May 27, 2009, includes economic and legal information. Third Party Financing...

  10. Power Systems Integration Laboratory (Fact Sheet), NREL (National...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    from fundamental research to applications engineering. Partners at the ESIF's Power Systems Integration Laboratory may include: * Manufacturers of distributed generation and...

  11. Solar thermal power system

    DOE Patents [OSTI]

    Bennett, Charles L.

    2010-06-15T23:59:59.000Z

    A solar thermal power generator includes an inclined elongated boiler tube positioned in the focus of a solar concentrator for generating steam from water. The boiler tube is connected at one end to receive water from a pressure vessel as well as connected at an opposite end to return steam back to the vessel in a fluidic circuit arrangement that stores energy in the form of heated water in the pressure vessel. An expander, condenser, and reservoir are also connected in series to respectively produce work using the steam passed either directly (above a water line in the vessel) or indirectly (below a water line in the vessel) through the pressure vessel, condense the expanded steam, and collect the condensed water. The reservoir also supplies the collected water back to the pressure vessel at the end of a diurnal cycle when the vessel is sufficiently depressurized, so that the system is reset to repeat the cycle the following day. The circuital arrangement of the boiler tube and the pressure vessel operates to dampen flow instabilities in the boiler tube, damp out the effects of solar transients, and provide thermal energy storage which enables time shifting of power generation to better align with the higher demand for energy during peak energy usage periods.

  12. Electric power monthly

    SciTech Connect (OSTI)

    NONE

    1995-08-01T23:59:59.000Z

    The Energy Information Administration (EIA) prepares the Electric Power Monthly (EPM) for a wide audience including Congress, Federal and State agencies, the electric utility industry, and the general public. This publication provides monthly statistics for net generation, fossil fuel consumption and stocks, quantity and quality of fossil fuels, cost of fossil fuels, electricity sales, revenue, and average revenue per kilowatthour of electricity sold. Data on net generation, fuel consumption, fuel stocks, quantity and cost of fossil fuels are also displayed for the North American Electric Reliability Council (NERC) regions. The EIA publishes statistics in the EPM on net generation by energy source, consumption, stocks, quantity, quality, and cost of fossil fuels; and capability of new generating units by company and plant. The purpose of this publication is to provide energy decisionmakers with accurate and timely information that may be used in forming various perspectives on electric issues that lie ahead.

  13. Power electronics reliability analysis.

    SciTech Connect (OSTI)

    Smith, Mark A.; Atcitty, Stanley

    2009-12-01T23:59:59.000Z

    This report provides the DOE and industry with a general process for analyzing power electronics reliability. The analysis can help with understanding the main causes of failures, downtime, and cost and how to reduce them. One approach is to collect field maintenance data and use it directly to calculate reliability metrics related to each cause. Another approach is to model the functional structure of the equipment using a fault tree to derive system reliability from component reliability. Analysis of a fictitious device demonstrates the latter process. Optimization can use the resulting baseline model to decide how to improve reliability and/or lower costs. It is recommended that both electric utilities and equipment manufacturers make provisions to collect and share data in order to lay the groundwork for improving reliability into the future. Reliability analysis helps guide reliability improvements in hardware and software technology including condition monitoring and prognostics and health management.

  14. Information regarding previous INCITE awards including selected highlights

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645U.S. DOEThe Bonneville PowerCherries 82981-1cnHigh SchoolIn Other News link toInfluence ofQuick Search3CURRENTRetailers|

  15. Lunar Wireless Power Transfer Feasibility Study

    SciTech Connect (OSTI)

    Sheldon Freid, et al.

    2008-06-01T23:59:59.000Z

    This study examines the feasibility of a multi-kilowatt wireless radio frequency (RF) power system to transfer power between lunar base facilities. Initial analyses, show that wireless power transfer (WPT) systems can be more efficient and less expensive than traditional wired approaches for certain lunar and terrestrial applications. The study includes evaluations of the fundamental limitations of lunar WPT systems, the interrelationships of possible operational parameters, and a baseline design approach for a notionial system that could be used in the near future to power remote facilities at a lunar base. Our notional system includes state-of-the-art photovoltaics (PVs), high-efficiency microwave transmitters, low-mass large-aperture high-power transmit antennas, high-efficiency large-area rectenna receiving arrays, and reconfigurable DC combining circuitry.

  16. Power Series Introduction

    E-Print Network [OSTI]

    Vickers, James

    Power Series 16.4 Introduction In this section we consider power series. These are examples of infinite series where each term contains a variable, x, raised to a positive integer power. We use the ratio test to obtain the radius of convergence R, of the power series and state the important result

  17. Offshore Wind Power USA

    Broader source: Energy.gov [DOE]

    The Offshore Wind Power USA conference provides the latest offshore wind market updates and forecasts.

  18. Dirty kilowatts: America's most polluting power plants

    SciTech Connect (OSTI)

    NONE

    2007-07-15T23:59:59.000Z

    In 2006, the US EPA tracked more than 1,400 fossil-fired power plants of varying sizes through its Acid Rain Program. This report ranks each of the 378 largest plants (generating at least 2 million megawatt-hours in 2006) for which both the most recent EPA emissions data and Energy Information Administration (EIA) electric generation data are available. The report ranks each plant based on emission rates, or pounds of pollutant for each megawatt-hour (or million megawatt-hours, in the case of mercury) the plant produced. It ranks the top fifty power plants polluters for sulfur dioxide, nitrogen oxides, carbon dioxide, and mercury. A complete listing of all 378 plants is included as Appendix A. Appendix B contains overheads of an NETL presentation: Tracking new coal-fired power plants - coal's resurgence in electric power generation, 24 January 2007. The 12 states with the heaviest concentrations of the dirtiest power plants, in terms of total tons of carbon dioxide emitted, are: Texas (five, including two of the top 10 dirtiest plants); Pennsylvania (four); Indiana (four, including two of the top 10 dirtiest plants); Alabama (three); Georgia (three, including two of the top three dirtiest plants); North Carolina (three); Ohio (three); West Virginia (three); Wyoming (two); Florida (two); Kentucky (two); and New Mexico (two). Carbon dioxide emissions from power plants are now at roughly 2.5 billion tons per year. Power plants are responsible for about 30%-40% of all man-made CO{sub 2} emissions in the USA. Power plants, especially those that burn coal, are by far the largest single contributor of SO{sub 2} pollution in the United States. Power plant mercury emissions remain steady as compared to previous years. A searchable database ranking 378 U.S. power plants on carbon dioxide, sulfur dioxide, nitrogen oxide and mercury pollution is available online at http://www.dirtykilowatts.org. 22 refs., 8 tabs., 2 apps.

  19. Methods of producing adsorption media including a metal oxide

    DOE Patents [OSTI]

    Mann, Nicholas R; Tranter, Troy J

    2014-03-04T23:59:59.000Z

    Methods of producing a metal oxide are disclosed. The method comprises dissolving a metal salt in a reaction solvent to form a metal salt/reaction solvent solution. The metal salt is converted to a metal oxide and a caustic solution is added to the metal oxide/reaction solvent solution to adjust the pH of the metal oxide/reaction solvent solution to less than approximately 7.0. The metal oxide is precipitated and recovered. A method of producing adsorption media including the metal oxide is also disclosed, as is a precursor of an active component including particles of a metal oxide.

  20. Metal vapor laser including hot electrodes and integral wick

    DOE Patents [OSTI]

    Ault, Earl R. (Livermore, CA); Alger, Terry W. (Tracy, CA)

    1995-01-01T23:59:59.000Z

    A metal vapor laser, specifically one utilizing copper vapor, is disclosed herein. This laser utilizes a plasma tube assembly including a thermally insulated plasma tube containing a specific metal, e.g., copper, and a buffer gas therein. The laser also utilizes means including hot electrodes located at opposite ends of the plasma tube for electrically exciting the metal vapor and heating its interior to a sufficiently high temperature to cause the metal contained therein to vaporize and for subjecting the vapor to an electrical discharge excitation in order to lase. The laser also utilizes external wicking arrangements, that is, wicking arrangements located outside the plasma tube.

  1. Metal vapor laser including hot electrodes and integral wick

    DOE Patents [OSTI]

    Ault, E.R.; Alger, T.W.

    1995-03-07T23:59:59.000Z

    A metal vapor laser, specifically one utilizing copper vapor, is disclosed herein. This laser utilizes a plasma tube assembly including a thermally insulated plasma tube containing a specific metal, e.g., copper, and a buffer gas therein. The laser also utilizes means including hot electrodes located at opposite ends of the plasma tube for electrically exciting the metal vapor and heating its interior to a sufficiently high temperature to cause the metal contained therein to vaporize and for subjecting the vapor to an electrical discharge excitation in order to lase. The laser also utilizes external wicking arrangements, that is, wicking arrangements located outside the plasma tube. 5 figs.

  2. Watson Library enhancements to include new service desk

    E-Print Network [OSTI]

    2008-01-01T23:59:59.000Z

    12/5/13 KU Libraries News: Watson Library enhancements to include new service desk www.lib.ku.edu/news/newservicedesk.shtml 1/1 Contact Us The University of Kansas Libraries Lawrence, KS 66045 (785) 864-8983 Copyright © 2013 by the University... of Kansas Watson Library enhancements to include new service desk The University of Kansas Libraries is adding a new service desk to Watson Library to enhance the user experience and draw attention to new and existing resources. The desk, which...

  3. Thin film solar cell including a spatially modulated intrinsic layer

    DOE Patents [OSTI]

    Guha, Subhendu (Troy, MI); Yang, Chi-Chung (Troy, MI); Ovshinsky, Stanford R. (Bloomfield Hills, MI)

    1989-03-28T23:59:59.000Z

    One or more thin film solar cells in which the intrinsic layer of substantially amorphous semiconductor alloy material thereof includes at least a first band gap portion and a narrower band gap portion. The band gap of the intrinsic layer is spatially graded through a portion of the bulk thickness, said graded portion including a region removed from the intrinsic layer-dopant layer interfaces. The band gap of the intrinsic layer is always less than the band gap of the doped layers. The gradation of the intrinsic layer is effected such that the open circuit voltage and/or the fill factor of the one or plural solar cell structure is enhanced.

  4. SMART POWER TURBINE

    SciTech Connect (OSTI)

    Nirm V. Nirmalan

    2003-11-01T23:59:59.000Z

    Gas turbines are the choice technology for high-performance power generation and are employed in both simple and combined cycle configurations around the world. The Smart Power Turbine (SPT) program has developed new technologies that are needed to further extend the performance and economic attractiveness of gas turbines for power generation. Today's power generation gas turbines control firing temperatures indirectly, by measuring the exhaust gas temperature and then mathematically calculating the peak combustor temperatures. But temperatures in the turbine hot gas path vary a great deal, making it difficult to control firing temperatures precisely enough to achieve optimal performance. Similarly, there is no current way to assess deterioration of turbine hot-gas-path components without shutting down the turbine. Consequently, maintenance and component replacements are often scheduled according to conservative design practices based on historical fleet-averaged data. Since fuel heating values vary with the prevalent natural gas fuel, the inability to measure heating value directly, with sufficient accuracy and timeliness, can lead to maintenance and operational decisions that are less than optimal. GE Global Research Center, under this Smart Power Turbine program, has developed a suite of novel sensors that would measure combustor flame temperature, online fuel lower heating value (LHV), and hot-gas-path component life directly. The feasibility of using the ratio of the integrated intensities of portions of the OH emission band to determine the specific average temperature of a premixed methane or natural-gas-fueled combustion flame was demonstrated. The temperature determined is the temperature of the plasma included in the field of view of the sensor. Two sensor types were investigated: the first used a low-resolution fiber optic spectrometer; the second was a SiC dual photodiode chip. Both methods worked. Sensitivity to flame temperature changes was remarkably high, that is a 1-2.5% change in ratio for an 11.1 C (20 F) change in temperature at flame temperatures between 1482.2 C (2700 F) and 1760 C (3200 F). Sensor ratio calibration was performed using flame temperatures determined by calculations using the amount of unburned oxygen in the exhaust and by the fuel/air ratio of the combustible gas mixture. The agreement between the results of these two methods was excellent. The sensor methods characterized are simple and viable. Experiments are underway to validate the GE Flame Temperature Sensor as a practical tool for use with multiburner gas turbine combustors. The lower heating value (LHV) Fuel Quality Sensor consists of a catalytic film deposited on the surface of a microhotplate. This micromachined design has low heat capacity and thermal conductivity, making it ideal for heating catalysts placed on its surface. Several methods of catalyst deposition were investigated, including micropen deposition and other proprietary methods, which permit precise and repeatable placement of the materials. The use of catalysts on the LHV sensor expands the limits of flammability (LoF) of combustion fuels as compared with conventional flames; an unoptimized LoF of 1-32% for natural gas (NG) in air was demonstrated with the microcombustor, whereas conventionally 4 to 16% is observed. The primary goal of this work was to measure the LHV of NG fuels. The secondary goal was to determine the relative quantities of the various components of NG mixes. This determination was made successfully by using an array of different catalysts operating at different temperatures. The combustion parameters for methane were shown to be dependent on whether Pt or Pd catalysts were used. In this project, significant effort was expended on making the LHV platform more robust by the addition of high-temperature stable materials, such as tantalum, and the use of passivation overcoats to protect the resistive heater/sensor materials from degradation in the combustion environment. Modeling and simulation were used to predict improved sensor designs.

  5. DIRECT FUEL CELL/TURBINE POWER PLANT

    SciTech Connect (OSTI)

    Hossein Ghezel-Ayagh

    2003-05-27T23:59:59.000Z

    The subMW hybrid DFC/T power plant facility was upgraded with a Capstone C60 microturbine and a state-of-the-art full size fuel cell stack. The integration of the larger microturbine extended the capability of the hybrid power plant to operate at high power ratings with a single gas turbine without the need for supplementary air. The objectives of this phase of subMW hybrid power plant tests are to support the development of process and control and to provide the insight for the design of the packaged subMW hybrid demonstration units. The development of the ultra high efficiency multi-MW power plants was focused on the design of 40 MW power plants with efficiencies approaching 75% (LHV of natural gas). The design efforts included thermodynamic cycle analysis of key gas turbine parameters such as compression ratio.

  6. Power module assemblies with staggered coolant channels

    DOE Patents [OSTI]

    Herron, Nicholas Hayden; Mann, Brooks S; Korich, Mark D

    2013-07-16T23:59:59.000Z

    A manifold is provided for supporting a power module assembly with a plurality of power modules. The manifold includes a first manifold section. The first face of the first manifold section is configured to receive the first power module, and the second face of the first manifold section defines a first cavity with a first baseplate thermally coupled to the first power module. The first face of the second manifold section is configured to receive the second power module, and the second face of the second manifold section defines a second cavity with a second baseplate thermally coupled to the second power module. The second face of the first manifold section and the second face of the second manifold section are coupled together such that the first cavity and the second cavity form a coolant channel. The first cavity is at least partially staggered with respect to second cavity.

  7. Dispersed power and renewables

    SciTech Connect (OSTI)

    O`Sullivan, J.B.

    1995-12-31T23:59:59.000Z

    Distributed power generation and renewable energy sources are discussed: The following topics are discussed: distributed resources, distributed generation, commercialization requirements, biomass power, location of existing biomass feedstocks, biomass business plan components, North Carolina BGCC partnership, New York biomass co-firing project, alfalfa for power and feed, Hawaii Pioneer Mill LOI project, next steps for biomass, wind power activity, photovoltaic modules and arrays, lead-acid batteries, superconducting magnetic energy storage, fuel cells, and electric power industry trends.

  8. High voltage DC power supply

    DOE Patents [OSTI]

    Droege, Thomas F. (Batavia, IL)

    1989-01-01T23:59:59.000Z

    A high voltage DC power supply having a first series resistor at the output for limiting current in the event of a short-circuited output, a second series resistor for sensing the magnitude of output current, and a voltage divider circuit for providing a source of feedback voltage for use in voltage regulation is disclosed. The voltage divider circuit is coupled to the second series resistor so as to compensate the feedback voltage for a voltage drop across the first series resistor. The power supply also includes a pulse-width modulated control circuit, having dual clock signals, which is responsive to both the feedback voltage and a command voltage, and also includes voltage and current measuring circuits responsive to the feedback voltage and the voltage developed across the second series resistor respectively.

  9. High voltage DC power supply

    DOE Patents [OSTI]

    Droege, T.F.

    1989-12-19T23:59:59.000Z

    A high voltage DC power supply having a first series resistor at the output for limiting current in the event of a short-circuited output, a second series resistor for sensing the magnitude of output current, and a voltage divider circuit for providing a source of feedback voltage for use in voltage regulation is disclosed. The voltage divider circuit is coupled to the second series resistor so as to compensate the feedback voltage for a voltage drop across the first series resistor. The power supply also includes a pulse-width modulated control circuit, having dual clock signals, which is responsive to both the feedback voltage and a command voltage, and also includes voltage and current measuring circuits responsive to the feedback voltage and the voltage developed across the second series resistor respectively. 7 figs.

  10. Detection of accessory corpora lutea in swine

    E-Print Network [OSTI]

    Reitmeyer, James Clement

    1962-01-01T23:59:59.000Z

    Post&onception Estrus Corpora Lutea in Pregnancy Mistclogy IIX ~ MATERIALS AMD METHOUS Animals and Breeding Anesthesia Surgery Slaughter IV. RESULTS AMU UXSCUSSIOM Anesthesia Surgery Marking tike Corpora Hemorrhagica Qvulati. on Rate Post...-Operative Care Mistology V. SUMMARY LXTERATURE CXTEU APPEMBXX 13 14 14 15 16 16 16 17 26 TABLES 1. Coaparisou of Corpora EeaorrhaEicua 3 days post Matiag to Corpora Lutea 40 days post MatiaE LIST OF FIGURES FLGURES 1. Marking a Corpus...

  11. Including Blind Students in Computer Science Through Access to Graphs

    E-Print Network [OSTI]

    Young, R. Michael

    Including Blind Students in Computer Science Through Access to Graphs Suzanne Balik, Sean Mealin SKetching tool, GSK, to provide blind and sighted people with a means to create, examine, and share graphs (node-link diagrams) in real-time. GSK proved very effective for one blind computer science student

  12. Bayesian hierarchical reconstruction of protein profiles including a digestion model

    E-Print Network [OSTI]

    Paris-Sud XI, Université de

    Bayesian hierarchical reconstruction of protein profiles including a digestion model Pierre to recover the protein biomarkers content in a robust way. We will focus on the digestion step since and each branch to a molecular processing such as digestion, ionisation and LC-MS separation

  13. Biomass Potentials from California Forest and Shrublands Including Fuel

    E-Print Network [OSTI]

    Biomass Potentials from California Forest and Shrublands Including Fuel Reduction Potentials-04-004 February 2005 Revised: October 2005 Arnold Schwarzenegger, Governor, State of California #12;Biomass Tiangco, CEC Bryan M. Jenkins, University of California #12;Biomass Potentials from California Forest

  14. Optimal Energy Management Strategy including Battery Health through Thermal

    E-Print Network [OSTI]

    Paris-Sud XI, Université de

    Optimal Energy Management Strategy including Battery Health through Thermal Management for Hybrid: Energy management strategy, Plug-in hybrid electric vehicles, Li-ion battery aging, thermal management, Pontryagin's Minimum Principle. 1. INTRODUCTION The interest for energy management strategy (EMS) of Hybrid

  15. Area of cooperation includes: Joint research and development on

    E-Print Network [OSTI]

    Buyya, Rajkumar

    Technologies August 2, 2006: HCL Technologies Ltd (HCL), India's leading global IT services company, has signed projects that are using this technology currently such as BioGrid in Japan, National Grid Service in UKArea of cooperation includes: · Joint research and development on Grid computing technologies

  16. Energy Transitions: A Systems Approach Including Marcellus Shale Gas Development

    E-Print Network [OSTI]

    Walter, M.Todd

    Energy Transitions: A Systems Approach Including Marcellus Shale Gas Development A Report Engineering) W. VA #12;Energy Transitions: A Systems Approach August 2011 version Page 2 Energy Transitions sources globally, some very strong short-term drivers of energy transitions reflect rising concerns over

  17. 1 INTRODUCTION A typical flexible pavement system includes four

    E-Print Network [OSTI]

    Zornberg, Jorge G.

    1 INTRODUCTION A typical flexible pavement system includes four distinct layers: asphalt concrete course in order to reduce costs or to minimize capil- lary action under the pavement. Figure 1: Cross-section of flexible pavement system (Muench 2006) Pavement distress may occur due to either traffic or environmental

  18. SAFETY AND HEALTH PROGRAM Including the Chemical Hygiene Plan

    E-Print Network [OSTI]

    Evans, Paul G.

    SAFETY AND HEALTH PROGRAM Including the Chemical Hygiene Plan Wisconsin Center for Applied, Technical Staff & Chemical Hygiene Officer kakupcho@wisc.edu 262-2982 Lab Facility Website http..........................................................................................................3 CHEMICAL HYGIENE PLAN III. Work-site Analysis and Hazard Identification 3.1 Hazardous Chemical

  19. HTS Conductor Design Issues Including Quench and Stability,

    E-Print Network [OSTI]

    HTS Conductor Design Issues Including Quench and Stability, AC Losses, and Fault Currents M. J objective and technical approach · The purpose of this collaborative R&D project is an investigation of HTS conductor design optimization with emphasis on stability and protection issues for YBCO wires and coils

  20. Free Energy Efficiency Kit includes CFL light bulbs,

    E-Print Network [OSTI]

    Rose, Annkatrin

    Free Energy Efficiency Kit Kit includes CFL light bulbs, spray foam, low-flow shower head, and more for discounted energy assessments. FREE HOME ENERGY EFFICIENCY SEMINAR N e w R i ver L i g ht & Pow e r a n d W! Building Science 101 Presentation BPI Certified Building Professionals will present home energy efficiency

  1. DO NOT INCLUDE: flatten cardboard staples, tape & envelope windows ok

    E-Print Network [OSTI]

    Wolfe, Patrick J.

    / bottles Metal items other than cans/foil Napkins Paper towels Plastic bags Plastic films Plastic utensilsDO NOT INCLUDE: flatten cardboard staples, tape & envelope windows ok Aerosol cans Books Bottle, PDAs, inkjet cartridges, CFL bulbs (cushioned, sealed in plastic) computers, printers, printer

  2. cDNA encoding a polypeptide including a hevein sequence

    DOE Patents [OSTI]

    Raikhel, N.V.; Broekaert, W.F.; Namhai Chua; Kush, A.

    1993-02-16T23:59:59.000Z

    A cDNA clone (HEV1) encoding hevein was isolated via polymerase chain reaction (PCR) using mixed oligonucleotides corresponding to two regions of hevein as primers and a Hevea brasiliensis latex cDNA library as a template. HEV1 is 1,018 nucleotides long and includes an open reading frame of 204 amino acids.

  3. Perhaps federal research grants can include infrastructure costs.

    E-Print Network [OSTI]

    Sur, Mriganka

    Perhaps federal research grants can include infrastructure costs. There are signs to find favour in China, a country beset by similar problems. The particular structure of Indian science and healthystart-uppackages. The government could contribute to these costs. 487 NATURE|Vol 436|28 July 2005

  4. Nuclear power and climate change | The Bulletin Online http://www.thebulletin.org/roundtable/nuclear-power-climate-change/ 1 of 11 9/25/07 2:14 PM

    E-Print Network [OSTI]

    Berry, R. Stephen

    Nuclear power and climate change | The Bulletin Online http://www.thebulletin.org/roundtable/nuclear-power-climate-change/ 1 of 11 9/25/07 2:14 PM ROUNDTABLE Roundtable > Nuclear power and climate change Nuclear power, experts argue that all options should be considered--including nuclear power. But with nuclear power comes

  5. Systems and methods for measuring a parameter of a landfill including a barrier cap and wireless sensor systems and methods

    DOE Patents [OSTI]

    Kunerth, Dennis C.; Svoboda, John M.; Johnson, James T.

    2007-03-06T23:59:59.000Z

    A method of measuring a parameter of a landfill including a cap, without passing wires through the cap, includes burying a sensor apparatus in the landfill prior to closing the landfill with the cap; providing a reader capable of communicating with the sensor apparatus via radio frequency (RF); placing an antenna above the barrier, spaced apart from the sensor apparatus; coupling the antenna to the reader either before or after placing the antenna above the barrier; providing power to the sensor apparatus, via the antenna, by generating a field using the reader; accumulating and storing power in the sensor apparatus; sensing a parameter of the landfill using the sensor apparatus while using power; and transmitting the sensed parameter to the reader via a wireless response signal. A system for measuring a parameter of a landfill is also provided.

  6. Seventh Power Plan: Generating Resources Advisory

    E-Print Network [OSTI]

    's Seventh Power Plan. ­ Included feedback and ideas from regional entities Council Members prioritized list of topics Council Members prioritized list of topics and identified four to focus on early in the process 2; strategies to help meet those needs Customer demand response, including its potential as a source of peaking

  7. Method for pulse control in a laser including a stimulated brillouin scattering mirror system

    DOE Patents [OSTI]

    Dane, C. Brent (Livermore, CA); Hackel, Lloyd (Livermore, CA); Harris, Fritz B. (Rocklin, CA)

    2007-10-23T23:59:59.000Z

    A laser system, such as a master oscillator/power amplifier system, comprises a gain medium and a stimulated Brillouin scattering SBS mirror system. The SBS mirror system includes an in situ filtered SBS medium that comprises a compound having a small negative non-linear index of refraction, such as a perfluoro compound. An SBS relay telescope having a telescope focal point includes a baffle at the telescope focal point which blocks off angle beams. A beam splitter is placed between the SBS mirror system and the SBS relay telescope, directing a fraction of the beam to an alternate beam path for an alignment fiducial. The SBS mirror system has a collimated SBS cell and a focused SBS cell. An adjustable attenuator is placed between the collimated SBS cell and the focused SBS cell, by which pulse width of the reflected beam can be adjusted.

  8. 34 IEEE TRANSACTIONS ON POWER SYSTEMS, VOL. 17, NO. 1, FEBRUARY 2002 Sensitivity of Transfer Capability Margins

    E-Print Network [OSTI]

    Dobson, Ian

    generalizes that practice to more detailed ac power system models that include voltage and re- active power--Optimization, power system control, power system security, power transmission planning, sensitivity. I. INTRODUCTION34 IEEE TRANSACTIONS ON POWER SYSTEMS, VOL. 17, NO. 1, FEBRUARY 2002 Sensitivity of Transfer

  9. Probabilistic Power Flow Simulation allowing Temporary Current Overloading

    E-Print Network [OSTI]

    Frank, Jason

    flow model subject to connection temperature constraints. Renewable power generation is included model. This substantially influences the choice of model for the renewable power source, as we explain realistically. Using such a constraint is justified the more by the intermittent nature of the renewable power

  10. Ultra Low Power Electronics for Medicine Rahul Sarpeshkar

    E-Print Network [OSTI]

    Sarpeshkar, Rahul

    Ultra Low Power Electronics for Medicine Rahul Sarpeshkar Analog VLSI and Biological Systems Group on an implanted 100mAh rechargeable battery. Another example includes an ultra low power portable pulse oximeter monitoring. Medical applications in the future are likely to benefit greatly from ultra low power electronics

  11. POWER FLOW ANALYSIS OF ELECTROSTRICTIVE ACTUATORS DRIVEN BYSWITCHMODE AMPLIFIERS

    E-Print Network [OSTI]

    Lindner, Douglas K.

    is developed with includes a dynamic structural model of the actuator, a dynamic model of the power electronics. It is shown that an outer acoustic control loop can modify this mechanical admittance and optimize the power, the power flow between the electrical and mechanical systems is analyzed through simulation. The flow

  12. IIIII 'I'. I'IU. ALSEP Array E Power Budget

    E-Print Network [OSTI]

    Rathbun, Julie A.

    Experiment Power Profiles Prepa red by:-::----::-q,.;___~--J(__(JJJIJJVI_____ J. E. Kasser #12;TABLE I DATA. ~~*Includes 0. 075 watts for quiescent load of PDU active circuits. All powers are in watts. Page 2 #12;TABLEIIIII 'I'. I'IU. ATM 1076 ALSEP Array E Power Budget OF 10 DATI! 2-1-72 SUMMARY This issue

  13. Small Power Plant Exemption (06-SPPE-1) Imperial County

    E-Print Network [OSTI]

    Small Power Plant Exemption (06-SPPE-1) Imperial County NILAND GAS TURBINE PLANT PRESIDINGMEMBER Member STANLEY VALKOSKY Chief Hearing Adviser GARRET SHEAN Hearing Officer Small Power Plant Exemption to construct and operate large electric power plants, including the authority to exempt proposals under 100 MW

  14. The Resurgence of U.S. Nuclear Power, 2. edition

    SciTech Connect (OSTI)

    NONE

    2007-11-15T23:59:59.000Z

    The updated report provides an overview of the opportunities for nuclear power in the U.S. electric industry, including a concise look at the challenges faced by nuclear power, the ability of advanced nuclear reactors to address these challenges, and the current state of nuclear power generation. Topics covered in the report include: an overview of U.S. Nuclear Power including its history, the current market environment, and the future of nuclear power in the U.S.; an analysis of the key business factors that are driving renewed interest in nuclear power; an analysis of the barriers that are hindering the implementation of new nuclear power plants; a description of nuclear power technology including existing reactors, as well as 3rd and 4th generation reactor designs; a review of the economics of new nuclear power projects and comparison to other generation alternatives; a discussion of the key government initiatives supporting nuclear power development; profiles of the key reactor manufacturers participating in the U.S. nuclear power market; and, profiles of the leading U.S. utilities participating in the U.S. nuclear power market.

  15. Active Power Control from Wind Power (Presentation)

    SciTech Connect (OSTI)

    Ela, E.; Brooks, D.

    2011-04-01T23:59:59.000Z

    In order to keep the electricity grid stable and the lights on, the power system relies on certain responses from its generating fleet. This presentation evaluates the potential for wind turbines and wind power plants to provide these services and assist the grid during critical times.

  16. High power fast ramping power supplies

    SciTech Connect (OSTI)

    Marneris,I.; Bajon, E.; Bonati, R.; Sandberg, J.; Roser, T.; Tsoupas, N.

    2009-05-04T23:59:59.000Z

    Hundred megawatt level fast ramping power converters to drive proton and heavy ion machines are under research and development at accelerator facilities in the world. This is a leading edge technology. There are several topologies to achieve this power level. Their advantages and related issues will be discussed.

  17. Multi-processor including data flow accelerator module

    DOE Patents [OSTI]

    Davidson, George S. (Albuquerque, NM); Pierce, Paul E. (Albuquerque, NM)

    1990-01-01T23:59:59.000Z

    An accelerator module for a data flow computer includes an intelligent memory. The module is added to a multiprocessor arrangement and uses a shared tagged memory architecture in the data flow computer. The intelligent memory module assigns locations for holding data values in correspondence with arcs leading to a node in a data dependency graph. Each primitive computation is associated with a corresponding memory cell, including a number of slots for operands needed to execute a primitive computation, a primitive identifying pointer, and linking slots for distributing the result of the cell computation to other cells requiring that result as an operand. Circuitry is provided for utilizing tag bits to determine automatically when all operands required by a processor are available and for scheduling the primitive for execution in a queue. Each memory cell of the module may be associated with any of the primitives, and the particular primitive to be executed by the processor associated with the cell is identified by providing an index, such as the cell number for the primitive, to the primitive lookup table of starting addresses. The module thus serves to perform functions previously performed by a number of sections of data flow architectures and coexists with conventional shared memory therein. A multiprocessing system including the module operates in a hybrid mode, wherein the same processing modules are used to perform some processing in a sequential mode, under immediate control of an operating system, while performing other processing in a data flow mode.

  18. Conversion of geothermal waste to commercial products including silica

    DOE Patents [OSTI]

    Premuzic, Eugene T. (East Moriches, NY); Lin, Mow S. (Rocky Point, NY)

    2003-01-01T23:59:59.000Z

    A process for the treatment of geothermal residue includes contacting the pigmented amorphous silica-containing component with a depigmenting reagent one or more times to depigment the silica and produce a mixture containing depigmented amorphous silica and depigmenting reagent containing pigment material; separating the depigmented amorphous silica and from the depigmenting reagent to yield depigmented amorphous silica. Before or after the depigmenting contacting, the geothermal residue or depigmented silica can be treated with a metal solubilizing agent to produce another mixture containing pigmented or unpigmented amorphous silica-containing component and a solubilized metal-containing component; separating these components from each other to produce an amorphous silica product substantially devoid of metals and at least partially devoid of pigment. The amorphous silica product can be neutralized and thereafter dried at a temperature from about 25.degree. C. to 300.degree. C. The morphology of the silica product can be varied through the process conditions including sequence contacting steps, pH of depigmenting reagent, neutralization and drying conditions to tailor the amorphous silica for commercial use in products including filler for paint, paper, rubber and polymers, and chromatographic material.

  19. Reducing power consumption during execution of an application on a plurality of compute nodes

    DOE Patents [OSTI]

    Archer, Charles J. (Rochester, MN); Blocksome, Michael A. (Rochester, MN); Peters, Amanda E. (Rochester, MN); Ratterman, Joseph D. (Rochester, MN); Smith, Brian E. (Rochester, MN)

    2012-06-05T23:59:59.000Z

    Methods, apparatus, and products are disclosed for reducing power consumption during execution of an application on a plurality of compute nodes that include: executing, by each compute node, an application, the application including power consumption directives corresponding to one or more portions of the application; identifying, by each compute node, the power consumption directives included within the application during execution of the portions of the application corresponding to those identified power consumption directives; and reducing power, by each compute node, to one or more components of that compute node according to the identified power consumption directives during execution of the portions of the application corresponding to those identified power consumption directives.

  20. Advancing the Spatially Enabled Smart Campus, Position Papers

    E-Print Network [OSTI]

    Center for Spatial Studies, UCSB

    2013-01-01T23:59:59.000Z

    solar power, wall, vehicle accessory port) Valarm provides affordable remote environmental monitoring, mobile data acquisition, and asset / fleet tracking.

  1. POWER SYSTEMS DEVELOPMENT FACILITY

    SciTech Connect (OSTI)

    Unknown

    2002-11-01T23:59:59.000Z

    This report discusses test campaign GCT4 of the Kellogg Brown & Root, Inc. (KBR) transport reactor train with a Siemens Westinghouse Power Corporation (Siemens Westinghouse) particle filter system at the Power Systems Development Facility (PSDF) located in Wilsonville, Alabama. The transport reactor is an advanced circulating fluidized-bed reactor designed to operate as either a combustor or a gasifier using one of two possible particulate control devices (PCDs). The transport reactor was operated as a pressurized gasifier during GCT4. GCT4 was planned as a 250-hour test run to continue characterization of the transport reactor using a blend of several Powder River Basin (PRB) coals and Bucyrus limestone from Ohio. The primary test objectives were: Operational Stability--Characterize reactor loop and PCD operations with short-term tests by varying coal-feed rate, air/coal ratio, riser velocity, solids-circulation rate, system pressure, and air distribution. Secondary objectives included the following: Reactor Operations--Study the devolatilization and tar cracking effects from transient conditions during transition from start-up burner to coal. Evaluate the effect of process operations on heat release, heat transfer, and accelerated fuel particle heat-up rates. Study the effect of changes in reactor conditions on transient temperature profiles, pressure balance, and product gas composition. Effects of Reactor Conditions on Synthesis Gas Composition--Evaluate the effect of air distribution, steam/coal ratio, solids-circulation rate, and reactor temperature on CO/CO{sub 2} ratio, synthesis gas Lower Heating Value (LHV), carbon conversion, and cold and hot gas efficiencies. Research Triangle Institute (RTI) Direct Sulfur Recovery Process (DSRP) Testing--Provide syngas in support of the DSRP commissioning. Loop Seal Operations--Optimize loop seal operations and investigate increases to previously achieved maximum solids-circulation rate.

  2. A novel power block for CSP systems

    SciTech Connect (OSTI)

    Mittelman, Gur [ASP Ltd., Advanced Solar Power, Industrial Zone, Be'er Tuviyya (Israel); Epstein, Michael [Solar Research Facilities Unit, Weizmann Institute of Science (Israel)

    2010-10-15T23:59:59.000Z

    Concentrating Solar Thermal Power (CSP) and in particular parabolic trough, is a proven large-scale solar power technology. However, CSP cost is not yet competitive with conventional alternatives unless subsidized. Current CSP plants typically include a condensing steam cycle power block which was preferably designed for a continuous operation and higher operating conditions and therefore, limits the overall plant cost effectiveness and deployment. The drawbacks of this power block are as follows: (i) no power generation during low insolation periods (ii) expensive, large condenser (typically water cooled) due to the poor extracted steam properties (high specific volume, sub-atmospheric pressure) and (iii) high installation and operation costs. In the current study, a different power block scheme is proposed to eliminate these obstacles. This power block includes a top Rankine cycle with a back pressure steam turbine and a bottoming Kalina cycle comprising another back pressure turbine and using ammonia-water mixture as a working fluid. The bottoming (moderate temperature) cycle allows power production during low insolation periods. Because of the superior ammonia-water vapor properties, the condensing system requirements are much less demanding and the operation costs are lowered. Accordingly, air cooled condensers can be used with lower economical penalty. Another advantage is that back pressure steam turbines have a less complex design than condensing steam turbines which make their costs lower. All of these improvements could make the combined cycle unit more cost effective. This unit can be applicable in both parabolic trough and central receiver (solar tower) plants. The potential advantage of the new power block is illustrated by a detailed techno-economical analysis of two 50 MW parabolic trough power plants, comparing between the standard and the novel power block. The results indicate that the proposed plant suggests a 4-11% electricity cost saving. (author)

  3. Resergence of U.S. Nuclear Power

    SciTech Connect (OSTI)

    none

    2006-02-15T23:59:59.000Z

    Over the past quarter century, things have not gone well for the nuclear industry. First came the Three Mile Island accident in America in 1979, then the disaster at the Chernobyl plant in Ukraine in 1986. In Japan, Tokyo Electric Power, the world's largest private electricity company, shut its 17 nuclear reactors after it was caught falsifying safety records to hide cracks at some of its plants in 2002. In addition, the attacks on September 11, 2001 were a sharp reminder that the risks of nuclear power generation were not only those inherent in the technology. But lately, prospects have brightened for the nuclear industry. Nuclear power is an important source of electricity in many countries. In 2003, 19 countries depended on nuclear power for at least 20 percent of their electricity generation. As of March 2005, there were 441 nuclear power reactors in operation around the world, and another 25 were under construction. Five new nuclear power plants began operation in 2004 - one each in China, Japan, and Russia and two in Ukraine. In addition, Canada?s Bruce 3 reactor was reconnected to the grid. Five nuclear power plants were permanently shut down in 2004 - one in Lithuania and four in the United Kingdom. Nuclear power is expected to see a revival in the next decade given the availability of uranium and the prospect of emission-free power generation, Also, with conventional energy sources such as oil and gas likely to see severe depletion over the next 30 years, the price of conventional power generation is set to rise significantly, which would put nuclear power generation in focus again. The report provides an overview of the opportunities for nuclear power in the U.S. electric industry and gives a concise look at the challenges faced by nuclear power, the ability of advanced nuclear reactors to address these challenges, and the current state of nuclear power generation. Topics covered in the report include: an overview of U.S. Nuclear Power including its history, the current market environment, and the future of nuclear power in the U.S.; an analysis of the key business factors that are driving renewed interest in nuclear power; an analysis of the barriers that are hindering the implementation of new nuclear power plants; a description of nuclear power technology including existing reactors, as well as 3rd and 4th generation reactor designs; a review of the economics of new nuclear power projects and comparison to other generation alternatives; a discussion of the key government initiatives supporting nuclear power development; profiles of the key reactor manufacturers participating in the U.S. nuclear power market; and, profiles of the leading U.S. utilities participating in the U.S. nuclear power market.

  4. Composite armor, armor system and vehicle including armor system

    DOE Patents [OSTI]

    Chu, Henry S.; Jones, Warren F.; Lacy, Jeffrey M.; Thinnes, Gary L.

    2013-01-01T23:59:59.000Z

    Composite armor panels are disclosed. Each panel comprises a plurality of functional layers comprising at least an outermost layer, an intermediate layer and a base layer. An armor system incorporating armor panels is also disclosed. Armor panels are mounted on carriages movably secured to adjacent rails of a rail system. Each panel may be moved on its associated rail and into partially overlapping relationship with another panel on an adjacent rail for protection against incoming ordnance from various directions. The rail system may be configured as at least a part of a ring, and be disposed about a hatch on a vehicle. Vehicles including an armor system are also disclosed.

  5. cDNA encoding a polypeptide including a hevein sequence

    DOE Patents [OSTI]

    Raikhel, Natasha V. (Okemos, MI); Broekaert, Willem F. (Dilbeek, BE); Chua, Nam-Hai (Scarsdale, NY); Kush, Anil (New York, NY)

    1993-02-16T23:59:59.000Z

    A cDNA clone (HEV1) encoding hevein was isolated via polymerase chain reaction (PCR) using mixed oligonucleotides corresponding to two regions of hevein as primers and a Hevea brasiliensis latex cDNA library as a template. HEV1 is 1018 nucleotides long and includes an open reading frame of 204 amino acids. The deduced amino acid sequence contains a pu GOVERNMENT RIGHTS This application was funded under Department of Energy Contract DE-AC02-76ER01338. The U.S. Government has certain rights under this application and any patent issuing thereon.

  6. Composite material including nanocrystals and methods of making

    DOE Patents [OSTI]

    Bawendi, Moungi G.; Sundar, Vikram C.

    2010-04-06T23:59:59.000Z

    Temperature-sensing compositions can include an inorganic material, such as a semiconductor nanocrystal. The nanocrystal can be a dependable and accurate indicator of temperature. The intensity of emission of the nanocrystal varies with temperature and can be highly sensitive to surface temperature. The nanocrystals can be processed with a binder to form a matrix, which can be varied by altering the chemical nature of the surface of the nanocrystal. A nanocrystal with a compatibilizing outer layer can be incorporated into a coating formulation and retain its temperature sensitive emissive properties.

  7. A coke oven model including thermal decomposition kinetics of tar

    SciTech Connect (OSTI)

    Munekane, Fuminori; Yamaguchi, Yukio [Mitsubishi Chemical Corp., Yokohama (Japan); Tanioka, Seiichi [Mitsubishi Chemical Corp., Sakaide (Japan)

    1997-12-31T23:59:59.000Z

    A new one-dimensional coke oven model has been developed for simulating the amount and the characteristics of by-products such as tar and gas as well as coke. This model consists of both heat transfer and chemical kinetics including thermal decomposition of coal and tar. The chemical kinetics constants are obtained by estimation based on the results of experiments conducted to investigate the thermal decomposition of both coal and tar. The calculation results using the new model are in good agreement with experimental ones.

  8. Numerical evaluation of propeller noise, including non-linear effects

    E-Print Network [OSTI]

    White, Terence Alan

    1985-01-01T23:59:59.000Z

    University Chairman of Advisor y Commitee: Dr. Kenneth Korkan Using the transonic flow field(s) generated by the NASPROP-E computer code for an eight blade SR3-series propeller, a method is investigated to calculate the total noise values and frequency... in three dimensions, and the influence of the damping on the calculated noise values is investigated. Since the flow field includes the wave systems near the blade surface, the quadr upole noise sour ce term is accounted for as are the monopole...

  9. What To Include In The Whistleblower Complaint? | National Nuclear Security

    National Nuclear Security Administration (NNSA)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOn AprilA Approved: 5-13-14Russian Nuclear Warheads ArrivesAdministration To Include In

  10. POWER-GEN '91 conference papers: Volume 7 (Non-utility power generation) and Volume 8 (New power plants - Gas and liquid fuels/combustion turbines). [Independent Power Production

    SciTech Connect (OSTI)

    Not Available

    1991-01-01T23:59:59.000Z

    This is book 4 of papers presented at the Fourth International Power Generation Exhibition and Conference on December 4-6, 1991. The book contains Volume 7, Non-Utility Power Generation and Volume 8, New Power Plants - Gas and Liquid Fuels/Combustion Turbines. The topics of the papers include PUHCA changes and transmission access, financing and economics of independent power projects, case histories, combustion turbine based technologies, coal gasification, and combined cycle.

  11. UGP Power Projects

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    wildlife and power generation on the Missouri River. Seven dams and powerplants have the installed capacity of 2,610 MW. That hydroelectric power is delivered across about 7,919...

  12. Residential Wind Power

    E-Print Network [OSTI]

    Willis, Gary

    2011-12-16T23:59:59.000Z

    This research study will explore the use of residential wind power and associated engineering and environmental issues. There is various wind power generating devices available to the consumer. The study will discuss the dependencies of human...

  13. Power production and ADS

    SciTech Connect (OSTI)

    Raja, Rajendran; /Fermilab

    2010-03-01T23:59:59.000Z

    We describe the power production process in Accelerator Driven Sub-critical systems employing Thorium-232 and Uranium-238 as fuel and examine the demands on the power of the accelerator required.

  14. Power Factor Improvement

    E-Print Network [OSTI]

    Viljoen, T. A.

    1979-01-01T23:59:59.000Z

    Power factor control is a necessary ingredient in any successful Energy Management Program. Many companies are operating with power factors of 70% or less and are being penalized through the electrical utility bill. This paper starts by describing...

  15. PowerPoint Presentation

    Broader source: Energy.gov (indexed) [DOE]

    Research Center Blvd. Fayetteville, AR 72701 Phone: (479)-443-5759 Email: marcelo@apei.net Website: www.apei.net High Temperature and High Power Density SiC Power Electronic...

  16. Idaho Power- Net Metering

    Broader source: Energy.gov [DOE]

    Idaho does not have a statewide net-metering policy. However, each of the state's three investor-owned utilities -- Avista Utilities, Idaho Power and Rocky Mountain Power -- has developed a net...

  17. PowerPoint Presentation

    Broader source: Energy.gov (indexed) [DOE]

    Research Center Blvd. Fayetteville, AR 72701 Phone: (479)-443-5759 Email: mschupb@apei.net Website: www.apei.net High Power Density Silicon Carbide Power Electronic Converters...

  18. Space Solar Power Program

    SciTech Connect (OSTI)

    Arif, H.; Barbosa, H.; Bardet, C.; Baroud, M.; Behar, A.; Berrier, K.; Berthe, P.; Bertrand, R.; Bibyk, I.; Bisson, J.; Bloch, L.; Bobadilla, G.; Bourque, D.; Bush, L.; Carandang, R.; Chiku, T.; Crosby, N.; De Seixas, M.; De Vries, J.; Doll, S.; Dufour, F.; Eckart, P.; Fahey, M.; Fenot, F.; Foeckersperger, S.; Fontaine, J.E.; Fowler, R.; Frey, H.; Fujio, H.; Gasa, J.M.; Gleave, J.; Godoe, J.; Green, I.; Haeberli, R.; Hanada, T.; Ha

    1992-08-01T23:59:59.000Z

    Information pertaining to the Space Solar Power Program is presented on energy analysis; markets; overall development plan; organizational plan; environmental and safety issues; power systems; space transportation; space manufacturing, construction, operations; design examples; and finance.

  19. Body powered thermoelectric systems

    E-Print Network [OSTI]

    Settaluri, Krishna Tej

    2012-01-01T23:59:59.000Z

    Great interest exists for and progress has be made in the effective utilization of the human body as a possible power supply in hopes of powering such applications as sensors and continuously monitoring medical devices ...

  20. Community Assessment Tool for Public Health Emergencies Including Pandemic Influenza

    SciTech Connect (OSTI)

    ORAU's Oak Ridge Institute for Science Education (HCTT-CHE)

    2011-04-14T23:59:59.000Z

    The Community Assessment Tool (CAT) for Public Health Emergencies Including Pandemic Influenza (hereafter referred to as the CAT) was developed as a result of feedback received from several communities. These communities participated in workshops focused on influenza pandemic planning and response. The 2008 through 2011 workshops were sponsored by the Centers for Disease Control and Prevention (CDC). Feedback during those workshops indicated the need for a tool that a community can use to assess its readiness for a disaster - readiness from a total healthcare perspective, not just hospitals, but the whole healthcare system. The CAT intends to do just that - help strengthen existing preparedness plans by allowing the healthcare system and other agencies to work together during an influenza pandemic. It helps reveal each core agency partners (sectors) capabilities and resources, and highlights cases of the same vendors being used for resource supplies (e.g., personal protective equipment [PPE] and oxygen) by the partners (e.g., public health departments, clinics, or hospitals). The CAT also addresses gaps in the community's capabilities or potential shortages in resources. This tool has been reviewed by a variety of key subject matter experts from federal, state, and local agencies and organizations. It also has been piloted with various communities that consist of different population sizes, to include large urban to small rural communities.

  1. Solving The High Energy Evolution Equation Including Running Coupling Corrections

    E-Print Network [OSTI]

    Javier L. Albacete; Yuri V. Kovchegov

    2007-06-22T23:59:59.000Z

    We study the solution of the nonlinear BK evolution equation with the recently calculated running coupling corrections [hep-ph/0609105, hep-ph/0609090]. Performing a numerical solution we confirm the earlier result of [hep-ph/0408216] that the high energy evolution with the running coupling leads to a universal scaling behavior for the dipole scattering amplitude. The running coupling corrections calculated recently significantly change the shape of the scaling function as compared to the fixed coupling case leading to a considerable increase in the anomalous dimension and to a slow-down of the evolution with rapidity. The difference between the two recent calculations is due to an extra contribution to the evolution kernel, referred to as the subtraction term, which arises when running coupling corrections are included. These subtraction terms were neglected in both recent calculations. We evaluate numerically the subtraction terms for both calculations, and demonstrate that when the subtraction terms are added back to the evolution kernels obtained in the two works the resulting dipole amplitudes agree with each other! We then use the complete running coupling kernel including the subtraction term to find the numerical solution of the resulting full non-linear evolution equation with the running coupling corrections. Again the scaling regime is recovered at very large rapidity.

  2. Soldier power. Battery charging.

    E-Print Network [OSTI]

    Hong, Deog Ki

    hours runtime at full load 50 W #12; (%) (kW) 300 1-5 Siemens-Power 30 (hr) 10,000 Siemens 300 Acumentrics 80 (mW/cm2) 600 400 Siemens-Power 85 (hr) 70,000 3,000 Siemens-Power 15 () 500 25 Siemens-Power 60 >2013 - , Bloom, MHI, Rolls Royce 6 #12; SOFCSOFC * (LSCF ) ( Ag

  3. Concentrating Solar Power

    SciTech Connect (OSTI)

    Not Available

    2008-09-01T23:59:59.000Z

    Summarizes the goals and activities of the DOE Solar Energy Technologies Program efforts within its concentrating solar power subprogram.

  4. Power Prepayment Program

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level:Energy: Grid Integration Redefining What's Possible forPortsmouth/Paducah Project OfficePower Electronics Power Electronics PowerPower

  5. Electrical power distribution control methods, electrical energy demand monitoring methods, and power management devices

    DOE Patents [OSTI]

    Chassin, David P. (Pasco, WA); Donnelly, Matthew K. (Kennewick, WA); Dagle, Jeffery E. (Richland, WA)

    2011-12-06T23:59:59.000Z

    Electrical power distribution control methods, electrical energy demand monitoring methods, and power management devices are described. In one aspect, an electrical power distribution control method includes providing electrical energy from an electrical power distribution system, applying the electrical energy to a load, providing a plurality of different values for a threshold at a plurality of moments in time and corresponding to an electrical characteristic of the electrical energy, and adjusting an amount of the electrical energy applied to the load responsive to an electrical characteristic of the electrical energy triggering one of the values of the threshold at the respective moment in time.

  6. Electrical power distribution control methods, electrical energy demand monitoring methods, and power management devices

    DOE Patents [OSTI]

    Chassin, David P. (Pasco, WA); Donnelly, Matthew K. (Kennewick, WA); Dagle, Jeffery E. (Richland, WA)

    2006-12-12T23:59:59.000Z

    Electrical power distribution control methods, electrical energy demand monitoring methods, and power management devices are described. In one aspect, an electrical power distribution control method includes providing electrical energy from an electrical power distribution system, applying the electrical energy to a load, providing a plurality of different values for a threshold at a plurality of moments in time and corresponding to an electrical characteristic of the electrical energy, and adjusting an amount of the electrical energy applied to the load responsive to an electrical characteristic of the electrical energy triggering one of the values of the threshold at the respective moment in time.

  7. The inspection of power purchase contracts at the Western Area Power Administration

    SciTech Connect (OSTI)

    NONE

    1995-05-01T23:59:59.000Z

    The Office of Inspector General received an allegation regarding possible irregularities in certain power purchase contracts awarded by the Western Area Power Administration (WAPA). Based on our survey of WAPA`s power purchase procedures, we expanded our allegation based inquiry to include several management issues. Thus, the purpose of this inspection was to review the specific allegation as well as to evaluate WAPA`s power purchase contracting procedures relating to competition, the documentation of the solicitation, negotiation, and award processes, and the determination of the reasonableness of the rates negotiated by WAPA.

  8. Power/Privilege Definitions

    E-Print Network [OSTI]

    Sheridan, Jennifer

    Major; People's Institute for Survival and Beyond, New Orleans 2. Power is the ability to define reality and to convince other people that it is their definition. ~ Dr. Wade Nobles 3. Power is the capacity to act. 4 different cultures. [JL] RACISM Racism is race prejudice plus power [See Racist]. People's Institute calls

  9. EXTERIOR POWERS KEITH CONRAD

    E-Print Network [OSTI]

    Lozano-Robledo, Alvaro

    form on a manifold is related to exterior powers of the dual space of the tangent space of a manifoldEXTERIOR POWERS KEITH CONRAD 1. Introduction Let R be a commutative ring. Unless indicated the alternating multilinear functions on Mk: the exterior power k(M). It is a certain quotient module of Mk

  10. Power Plant Cycling Costs

    SciTech Connect (OSTI)

    Kumar, N.; Besuner, P.; Lefton, S.; Agan, D.; Hilleman, D.

    2012-07-01T23:59:59.000Z

    This report provides a detailed review of the most up to date data available on power plant cycling costs. The primary objective of this report is to increase awareness of power plant cycling cost, the use of these costs in renewable integration studies and to stimulate debate between policymakers, system dispatchers, plant personnel and power utilities.

  11. Power Dancers Audition Packet

    E-Print Network [OSTI]

    O'Toole, Alice J.

    Power Dancers Dance Team Audition Packet September 8-10, 2014 #12;Power Dancers Dance Team Dear service to their school with the support of the faculty, administration, and other groups on campus, but they also provide a source of great school spirit to UT Dallas. Power Dancers provides a real opportunity

  12. Power Dancers Audition Packet

    E-Print Network [OSTI]

    O'Toole, Alice J.

    Power Dancers Dance Team Audition Packet September 9-11, 2013 #12;Power Dancers Dance Team Dear service to their school with the support of the faculty, administration, and other groups on campus, but they also provide a source of great school spirit to UT Dallas. Power Dancers provides a real opportunity

  13. Power Dancers Audition Packet

    E-Print Network [OSTI]

    O'Toole, Alice J.

    Power Dancers Dance Team Audition Packet September 10 & 12, 2012 #12;Power Dancers Dance Team Dear service to their school with the support of the faculty, administration, and other groups on campus, but they also provide a source of great school spirit to UT Dallas. Power Dancers provides a real opportunity

  14. Green Power Inverter Prvningsrapport

    E-Print Network [OSTI]

    Green Power Inverter Prřvningsrapport SolenergiCentret Sřren Poulsen Ivan Katic Oktober 2004 #12;Green Power Inverter mĺlerapport.doc SolenergiCentret - 04-03-2005 2 Forord Nćrvćrende rapport indeholder Teknologisk Instituts bidrag til mĺlinger i forbindelse med PSO projektet "Green Power Inverter

  15. Karnataka Power Corporation Limited and National Thermal Power...

    Open Energy Info (EERE)

    Limited and National Thermal Power Corporation JV Jump to: navigation, search Name: Karnataka Power Corporation Limited and National Thermal Power Corporation JV Place: India...

  16. How Power is Lost: Illusions of Alliance Among the Powerful

    E-Print Network [OSTI]

    Brion, Sebastien

    2010-01-01T23:59:59.000Z

    while most accounts of power loss focus on ethical breachesPower Loss .1. Proposed Model of Power Loss Figure 2. Social Monitoring

  17. High Power Laser Innovation Sparks Geothermal Power Potential...

    Office of Environmental Management (EM)

    power source among renewables, is poised to emerge also as a flexible power source, balancing intermittent wind and solar power production and reducing variability in energy...

  18. Using government purchasing power to reduce equipment standby power

    E-Print Network [OSTI]

    Harris, Jeffrey; Meier, Alan; Bartholomew, Emily; Thomas, Alison; Glickman, Joan; Ware, Michelle

    2003-01-01T23:59:59.000Z

    or external power supply, other specifications, and purchasethe consumer to purchase extra power strips and extensionan internal standby power function, shall purchase Although

  19. Energy Storage & Power Electronics 2008 Peer Review - Power Electronic...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Power Electronics (PE) Systems Presentations Energy Storage & Power Electronics 2008 Peer Review - Power Electronics (PE) Systems Presentations The 2008 Peer Review Meeting for the...

  20. Abstract--The U.S. power industry is under great pressure to provide reactive power or Var support. Although it is generally

    E-Print Network [OSTI]

    Tolbert, Leon M.

    Abstract--The U.S. power industry is under great pressure to provide reactive power or Var support to provide local reactive power support, a thorough quantitative investigation of the economic benefit reactive power compensation. This paper investigates the benefits including reduced losses, shifting

  1. Submitted to IEEE Transactions on Power Systems, Nov. 2007 1 Abstract--A key need facing the electric power industry is the

    E-Print Network [OSTI]

    Submitted to IEEE Transactions on Power Systems, Nov. 2007 1 Abstract--A key need facing are included, along with external system connections to demonstrate how power is imported and exported Terms--educational technology, energy conservation, power engineering education, power systems, load

  2. Next Generation Geothermal Power Plants

    SciTech Connect (OSTI)

    Brugman, John; Hattar, Mai; Nichols, Kenneth; Esaki, Yuri

    1995-09-01T23:59:59.000Z

    A number of current and prospective power plant concepts were investigated to evaluate their potential to serve as the basis of the next generation geothermal power plant (NGGPP). The NGGPP has been envisaged as a power plant that would be more cost competitive (than current geothermal power plants) with fossil fuel power plants, would efficiently use resources and mitigate the risk of reservoir under-performance, and minimize or eliminate emission of pollutants and consumption of surface and ground water. Power plant concepts were analyzed using resource characteristics at ten different geothermal sites located in the western United States. Concepts were developed into viable power plant processes, capital costs were estimated and levelized busbar costs determined. Thus, the study results should be considered as useful indicators of the commercial viability of the various power plants concepts that were investigated. Broadly, the different power plant concepts that were analyzed in this study fall into the following categories: commercial binary and flash plants, advanced binary plants, advanced flash plants, flash/binary hybrid plants, and fossil/geothed hybrid plants. Commercial binary plants were evaluated using commercial isobutane as a working fluid; both air-cooling and water-cooling were considered. Advanced binary concepts included cycles using synchronous turbine-generators, cycles with metastable expansion, and cycles utilizing mixtures as working fluids. Dual flash steam plants were used as the model for the commercial flash cycle. The following advanced flash concepts were examined: dual flash with rotary separator turbine, dual flash with steam reheater, dual flash with hot water turbine, and subatmospheric flash. Both dual flash and binary cycles were combined with other cycles to develop a number of hybrid cycles: dual flash binary bottoming cycle, dual flash backpressure turbine binary cycle, dual flash gas turbine cycle, and binary gas turbine cycle. Results of this study indicate that dual flash type plants are preferred at resources with temperatures above 400 F. Closed loop (binary type) plants are preferred at resources with temperatures below 400 F. A rotary separator turbine upstream of a dual flash plant can be beneficial at Salton Sea, the hottest resource, or at high temperature resources where there is a significant variance in wellhead pressures from well to well. Full scale demonstration is required to verify cost and performance. Hot water turbines that recover energy from the spent brine in a dual flash cycle improve that cycle's brine efficiency. Prototype field tests of this technology have established its technical feasibility. If natural gas prices remain low, a combustion turbine/binary hybrid is an economic option for the lowest temperature sites. The use of mixed fluids appear to be an attractive low risk option. The synchronous turbine option as prepared by Barber-Nichols is attractive but requires a pilot test to prove cost and performance. Dual flash binary bottoming cycles appear promising provided that scaling of the brine/working fluid exchangers is controllable. Metastable expansion, reheater, Subatmospheric flash, dual flash backpressure turbine, and hot dry rock concepts do not seem to offer any cost advantage over the baseline technologies. If implemented, the next generation geothermal power plant concept may improve brine utilization but is unlikely to reduce the cost of power generation by much more than 10%. Colder resources will benefit more from the development of a next generation geothermal power plant than will hotter resources. All values presented in this study for plant cost and for busbar cost of power are relative numbers intended to allow an objective and meaningful comparison of technologies. The goal of this study is to assess various technologies on an common basis and, secondarily, to give an approximate idea of the current costs of the technologies at actual resource sites. Absolute costs at a given site will be determined by the specifics of a given pr

  3. Hydraulic engine valve actuation system including independent feedback control

    DOE Patents [OSTI]

    Marriott, Craig D

    2013-06-04T23:59:59.000Z

    A hydraulic valve actuation assembly may include a housing, a piston, a supply control valve, a closing control valve, and an opening control valve. The housing may define a first fluid chamber, a second fluid chamber, and a third fluid chamber. The piston may be axially secured to an engine valve and located within the first, second and third fluid chambers. The supply control valve may control a hydraulic fluid supply to the piston. The closing control valve may be located between the supply control valve and the second fluid chamber and may control fluid flow from the second fluid chamber to the supply control valve. The opening control valve may be located between the supply control valve and the second fluid chamber and may control fluid flow from the supply control valve to the second fluid chamber.

  4. Fuel cell repeater unit including frame and separator plate

    DOE Patents [OSTI]

    Yamanis, Jean; Hawkes, Justin R; Chiapetta, Jr., Louis; Bird, Connie E; Sun, Ellen Y; Croteau, Paul F

    2013-11-05T23:59:59.000Z

    An example fuel cell repeater includes a separator plate and a frame establishing at least a portion of a flow path that is operative to communicate fuel to or from at least one fuel cell held by the frame relative to the separator plate. The flow path has a perimeter and any fuel within the perimeter flow across the at least one fuel cell in a first direction. The separator plate, the frame, or both establish at least one conduit positioned outside the flow path perimeter. The conduit is outside of the flow path perimeter and is configured to direct flow in a second, different direction. The conduit is fluidly coupled with the flow path.

  5. Copper laser modulator driving assembly including a magnetic compression laser

    DOE Patents [OSTI]

    Cook, Edward G. (Livermore, CA); Birx, Daniel L. (Oakley, CA); Ball, Don G. (Livermore, CA)

    1994-01-01T23:59:59.000Z

    A laser modulator (10) having a low voltage assembly (12) with a plurality of low voltage modules (14) with first stage magnetic compression circuits (20) and magnetic assist inductors (28) with a common core (91), such that timing of the first stage magnetic switches (30b) is thereby synchronized. A bipolar second stage of magnetic compression (42) is coupled to the low voltage modules (14) through a bipolar pulse transformer (36) and a third stage of magnetic compression (44) is directly coupled to the second stage of magnetic compression (42). The low voltage assembly (12) includes pressurized boxes (117) for improving voltage standoff between the primary winding assemblies (34) and secondary winding (40) contained therein.

  6. Including stereoscopic information in the reconstruction of coronal magnetic fields

    E-Print Network [OSTI]

    T. Wiegelmann; T. Neukirch

    2008-01-23T23:59:59.000Z

    We present a method to include stereoscopic information about the three dimensional structure of flux tubes into the reconstruction of the coronal magnetic field. Due to the low plasma beta in the corona we can assume a force free magnetic field, with the current density parallel to the magnetic field lines. Here we use linear force free fields for simplicity. The method uses the line of sight magnetic field on the photosphere as observational input. The value of $\\alpha$ is determined iteratively by comparing the reconstructed magnetic field with the observed structures. The final configuration is the optimal linear force solution constrained by both the photospheric magnetogram and the observed plasma structures. As an example we apply our method to SOHO MDI/EIT data of an active region. In the future it is planned to apply the method to analyse data from the SECCHI instrument aboard the STEREO mission.

  7. Improving Planck calibration by including frequency-dependent relativistic corrections

    E-Print Network [OSTI]

    Quartin, Miguel

    2015-01-01T23:59:59.000Z

    The Planck satellite detectors are calibrated in the 2015 release using the "orbital dipole", which is the time-dependent dipole generated by the Doppler effect due to the motion of the satellite around the Sun. Such an effect has also relativistic time-dependent corrections of relative magnitude 10^(-3), due to coupling with the "solar dipole" (the motion of the Sun compared to the CMB rest frame), which are included in the data calibration by the Planck collaboration. We point out that such corrections are subject to a frequency-dependent multiplicative factor. This factor differs from unity especially at the highest frequencies, relevant for the HFI instrument. Since currently Planck calibration errors are dominated by systematics, to the point that polarization data is currently unreliable at large scales, such a correction can in principle be highly relevant for future data releases.

  8. Protoplanetary disks including radiative feedback from accreting planets

    E-Print Network [OSTI]

    Montesinos, Matias; Perez, Sebastian; Baruteau, Clement; Casassus, Simon

    2015-01-01T23:59:59.000Z

    While recent observational progress is converging on the detection of compact regions of thermal emission due to embedded protoplanets, further theoretical predictions are needed to understand the response of a protoplanetary disk to the planet formation radiative feedback. This is particularly important to make predictions for the observability of circumplanetary regions. In this work we use 2D hydrodynamical simulations to examine the evolution of a viscous protoplanetary disk in which a luminous Jupiter-mass planet is embedded. We use an energy equation which includes the radiative heating of the planet as an additional mechanism for planet formation feedback. Several models are computed for planet luminosities ranging from $10^{-5}$ to $10^{-3}$ Solar luminosities. We find that the planet radiative feedback enhances the disk's accretion rate at the planet's orbital radius, producing a hotter and more luminous environement around the planet, independently of the prescription used to model the disk's turbul...

  9. Actuator assembly including a single axis of rotation locking member

    DOE Patents [OSTI]

    Quitmeyer, James N.; Benson, Dwayne M.; Geck, Kellan P.

    2009-12-08T23:59:59.000Z

    An actuator assembly including an actuator housing assembly and a single axis of rotation locking member fixedly attached to a portion of the actuator housing assembly and an external mounting structure. The single axis of rotation locking member restricting rotational movement of the actuator housing assembly about at least one axis. The single axis of rotation locking member is coupled at a first end to the actuator housing assembly about a Y axis and at a 90.degree. angle to an X and Z axis providing rotation of the actuator housing assembly about the Y axis. The single axis of rotation locking member is coupled at a second end to a mounting structure, and more particularly a mounting pin, about an X axis and at a 90.degree. angle to a Y and Z axis providing rotation of the actuator housing assembly about the X axis. The actuator assembly is thereby restricted from rotation about the Z axis.

  10. A Case for Including Transactions in OpenMP

    SciTech Connect (OSTI)

    Wong, M; Bihari, B L; de Supinski, B R; Wu, P; Michael, M; Liu, Y; Chen, W

    2010-01-25T23:59:59.000Z

    Transactional Memory (TM) has received significant attention recently as a mechanism to reduce the complexity of shared memory programming. We explore the potential of TM to improve OpenMP applications. We combine a software TM (STM) system to support transactions with an OpenMP implementation to start thread teams and provide task and loop-level parallelization. We apply this system to two application scenarios that reflect realistic TM use cases. Our results with this system demonstrate that even with the relatively high overheads of STM, transactions can outperform OpenMP critical sections by 10%. Overall, our study demonstrates that extending OpenMP to include transactions would ease programming effort while allowing improved performance.

  11. 2007 Wholesale Power Rate Case Initial Proposal : Revenue Requirement Study.

    SciTech Connect (OSTI)

    United States. Bonneville Power Administration.

    2005-11-01T23:59:59.000Z

    The purpose of this Study is to establish the level of revenues from wholesale power rates necessary to recover, in accordance with sound business principles, the Federal Columbia River Power System (FCRPS) costs associated with the production, acquisition, marketing, and conservation of electric power. The generation revenue requirement includes: recovery of the Federal investment in hydro generation, fish and wildlife and conservation costs; Federal agencies' operations and maintenance (O&M) expenses allocated to power; capitalized contract expenses associated with non-Federal power suppliers such as Energy Northwest (EN); other power purchase expenses, such as short-term power purchases; power marketing expenses; cost of transmission services necessary for the sale and delivery of FCRPS power; and all other generation-related costs incurred by the Administrator pursuant to law.

  12. PV/thermal solar power assembly

    DOE Patents [OSTI]

    Ansley, Jeffrey H.; Botkin, Jonathan D.; Dinwoodie, Thomas L.

    2004-01-13T23:59:59.000Z

    A flexible solar power assembly (2) includes a flexible photovoltaic device (16) attached to a flexible thermal solar collector (4). The solar power assembly can be rolled up for transport and then unrolled for installation on a surface, such as the roof (20, 25) or side wall of a building or other structure, by use of adhesive and/or other types of fasteners (23).

  13. Power electronics in electric utilities: HVDC power transmission systems

    SciTech Connect (OSTI)

    Nozari, F.; Patel, H.S.

    1988-04-01T23:59:59.000Z

    High Voltage Direct Current (HVDC) power transmission systems constitute an important application of power electronics technology. This paper reviews salient aspects of this growing industry. The paper summarizes the history of HVDC transmission and discusses the economic and technical reasons responsible for development of HVDC systems. The paper also describes terminal design and basic configurations of HVDC systems, as well as major equipments of HVDC transmission system. In this regard, the state-of-the-art technology in the equipments constructions are discussed. Finally, the paper reviews future developments in the HVDC transmission systems, including promising technologies, such as multiterminal configurations, Gate Turn-Off (GTO) devices, forced commutation converters, and new advances in control electronics.

  14. ADEPT: Efficient Power Conversion

    SciTech Connect (OSTI)

    None

    2011-01-01T23:59:59.000Z

    ADEPT Project: In today’s increasingly electrified world, power conversion—the process of converting electricity between different currents, voltage levels, and frequencies—forms a vital link between the electronic devices we use every day and the sources of power required to run them. The 14 projects that make up ARPA-E’s ADEPT Project, short for “Agile Delivery of Electrical Power Technology,” are paving the way for more energy efficient power conversion and advancing the basic building blocks of power conversion: circuits, transistors, inductors, transformers, and capacitors.

  15. Multimegawatt space power reactors

    SciTech Connect (OSTI)

    Dearien, J.A.; Whitbeck, J.F.

    1989-01-01T23:59:59.000Z

    In response to the need of the Strategic Defense Initiative (SDI) and long range space exploration and extra-terrestrial basing by the National Air and Space Administration (NASA), concepts for nuclear power systems in the multi-megawatt levels are being designed and evaluated. The requirements for these power systems are being driven primarily by the need to minimize weight and maximize safety and reliability. This paper will discuss the present requirements for space based advanced power systems, technological issues associated with the development of these advanced nuclear power systems, and some of the concepts proposed for generating large amounts of power in space. 31 figs.

  16. Multimode power processor

    DOE Patents [OSTI]

    O'Sullivan, George A. (Pottersville, NJ); O'Sullivan, Joseph A. (St. Louis, MO)

    1999-01-01T23:59:59.000Z

    In one embodiment, a power processor which operates in three modes: an inverter mode wherein power is delivered from a battery to an AC power grid or load; a battery charger mode wherein the battery is charged by a generator; and a parallel mode wherein the generator supplies power to the AC power grid or load in parallel with the battery. In the parallel mode, the system adapts to arbitrary non-linear loads. The power processor may operate on a per-phase basis wherein the load may be synthetically transferred from one phase to another by way of a bumpless transfer which causes no interruption of power to the load when transferring energy sources. Voltage transients and frequency transients delivered to the load when switching between the generator and battery sources are minimized, thereby providing an uninterruptible power supply. The power processor may be used as part of a hybrid electrical power source system which may contain, in one embodiment, a photovoltaic array, diesel engine, and battery power sources.

  17. Multimode power processor

    DOE Patents [OSTI]

    O'Sullivan, G.A.; O'Sullivan, J.A.

    1999-07-27T23:59:59.000Z

    In one embodiment, a power processor which operates in three modes: an inverter mode wherein power is delivered from a battery to an AC power grid or load; a battery charger mode wherein the battery is charged by a generator; and a parallel mode wherein the generator supplies power to the AC power grid or load in parallel with the battery. In the parallel mode, the system adapts to arbitrary non-linear loads. The power processor may operate on a per-phase basis wherein the load may be synthetically transferred from one phase to another by way of a bumpless transfer which causes no interruption of power to the load when transferring energy sources. Voltage transients and frequency transients delivered to the load when switching between the generator and battery sources are minimized, thereby providing an uninterruptible power supply. The power processor may be used as part of a hybrid electrical power source system which may contain, in one embodiment, a photovoltaic array, diesel engine, and battery power sources. 31 figs.

  18. Low thermal resistance power module assembly

    DOE Patents [OSTI]

    Hassani, Vahab (Denver, CO); Vlahinos, Andreas (Castle Rock, CO); Bharathan, Desikan (Arvada, CO)

    2007-03-13T23:59:59.000Z

    A power module assembly with low thermal resistance and enhanced heat dissipation to a cooling medium. The assembly includes a heat sink or spreader plate with passageways or openings for coolant that extend through the plate from a lower surface to an upper surface. A circuit substrate is provided and positioned on the spreader plate to cover the coolant passageways. The circuit substrate includes a bonding layer configured to extend about the periphery of each of the coolant passageways and is made up of a substantially nonporous material. The bonding layer may be solder material which bonds to the upper surface of the plate to provide a continuous seal around the upper edge of each opening in the plate. The assembly includes power modules mounted on the circuit substrate on a surface opposite the bonding layer. The power modules are positioned over or proximal to the coolant passageways.

  19. Radiation beam calorimetric power measurement system

    DOE Patents [OSTI]

    Baker, John (Livermore, CA); Collins, Leland F. (Pleasanton, CA); Kuklo, Thomas C. (Ripon, CA); Micali, James V. (Dublin, CA)

    1992-01-01T23:59:59.000Z

    A radiation beam calorimetric power measurement system for measuring the average power of a beam such as a laser beam, including a calorimeter configured to operate over a wide range of coolant flow rates and being cooled by continuously flowing coolant for absorbing light from a laser beam to convert the laser beam energy into heat. The system further includes a flow meter for measuring the coolant flow in the calorimeter and a pair of thermistors for measuring the temperature difference between the coolant inputs and outputs to the calorimeter. The system also includes a microprocessor for processing the measured coolant flow rate and the measured temperature difference to determine the average power of the laser beam.

  20. Photovoltaic solar system connected to the electric power grid operating as active power generator and reactive power compensator

    SciTech Connect (OSTI)

    Albuquerque, Fabio L.; Moraes, Adelio J.; Guimaraes, Geraldo C.; Sanhueza, Sergio M.R.; Vaz, Alexandre R. [Universidade Federal de Uberlandia, Uberlandia-MG, CEP 38400-902 (Brazil)

    2010-07-15T23:59:59.000Z

    In the case of photovoltaic (PV) systems acting as distributed generation (DG) systems, the DC energy that is produced is fed to the grid through the power-conditioning unit (inverter). The majority of contemporary inverters used in DG systems are current source inverters (CSI) operating at unity power factor. If, however, we assume that voltage source inverters (VSI) can replace CSIs, we can generate reactive power proportionally to the remaining unused capacity at any given time. According to the theory of instantaneous power, the inverter reactive power can be regulated by changing the amplitude of its output voltage. In addition, the inverter active power can be adjusted by modifying the phase angle of its output voltage. Based on such theory, both the active power supply and the reactive power compensation (RPC) can be carried out simultaneously. When the insolation is weak or the PV modules are inoperative at night, the RPC feature of a PV system can still be used to improve the inverter utilisation factor. Some MATLAB simulation results are included here to show the feasibility of the method. (author)

  1. Extractant composition including crown ether and calixarene extractants

    DOE Patents [OSTI]

    Meikrantz, David H. (Idaho Falls, ID); Todd, Terry A. (Aberdeen, ID); Riddle, Catherine L. (Idaho Falls, ID); Law, Jack D. (Pocalello, ID); Peterman, Dean R. (Idaho Falls, ID); Mincher, Bruce J. (Idaho Falls, ID); McGrath, Christopher A. (Blackfoot, ID); Baker, John D. (Blackfoot, ID)

    2009-04-28T23:59:59.000Z

    An extractant composition comprising a mixed extractant solvent consisting of calix[4] arene-bis-(tert-octylbenzo)-crown-6 ("BOBCalixC6"), 4',4',(5')-di-(t-butyldicyclo-hexano)-18-crown-6 ("DtBu18C6"), and at least one modifier dissolved in a diluent. The DtBu18C6 may be present at from approximately 0.01M to approximately 0.4M, such as at from approximately 0.086 M to approximately 0.108 M. The modifier may be 1-(2,2,3,3-tetrafluoropropoxy)-3-(4-sec-butylphenoxy)-2-propanol ("Cs-7SB") and may be present at from approximately 0.01M to approximately 0.8M. In one embodiment, the mixed extractant solvent includes approximately 0.15M DtBu18C6, approximately 0.007M BOBCalixC6, and approximately 0.75M Cs-7SB modifier dissolved in an isoparaffinic hydrocarbon diluent. The extractant composition further comprises an aqueous phase. The mixed extractant solvent may be used to remove cesium and strontium from the aqueous phase.

  2. DETECTION OF SUBSURFACE FACILITIES INCLUDING NON-METALLIC PIPE

    SciTech Connect (OSTI)

    Mr. Herb Duvoisin

    2003-05-26T23:59:59.000Z

    CyTerra has leveraged our unique, shallow buried plastic target detection technology developed under US Army contracts into deeper buried subsurface facilities and including nonmetallic pipe detection. This Final Report describes a portable, low-cost, real-time, and user-friendly subsurface plastic pipe detector (LULU- Low Cost Utility Location Unit) that relates to the goal of maintaining the integrity and reliability of the nation's natural gas transmission and distribution network by preventing third party damage, by detecting potential infringements. Except for frequency band and antenna size, the LULU unit is almost identical to those developed for the US Army. CyTerra designed, fabricated, and tested two frequency stepped GPR systems, spanning the frequencies of importance (200 to 1600 MHz), one low and one high frequency system. Data collection and testing was done at a variety of locations (selected for soil type variations) on both targets of opportunity and selected buried targets. We developed algorithms and signal processing techniques that provide for the automatic detection of the buried utility lines. The real time output produces a sound as the radar passes over the utility line alerting the operator to the presence of a buried object. Our unique, low noise/high performance RF hardware, combined with our field tested detection algorithms, represents an important advancement toward achieving the DOE potential infringement goal.

  3. Hydrodynamic Simulation of Supernova Remnants Including Efficient Particle Acceleration

    E-Print Network [OSTI]

    Donald C. Ellison; Anne Decourchelle; Jean Ballet

    2003-08-19T23:59:59.000Z

    A number of supernova remnants (SNRs) show nonthermal X-rays assumed to be synchrotron emission from shock accelerated TeV electrons. The existence of these TeV electrons strongly suggests that the shocks in SNRs are sources of galactic cosmic rays (CRs). In addition, there is convincing evidence from broad-band studies of individual SNRs and elsewhere that the particle acceleration process in SNRs can be efficient and nonlinear. If SNR shocks are efficient particle accelerators, the production of CRs impacts the thermal properties of the shock heated, X-ray emitting gas and the SNR evolution. We report on a technique that couples nonlinear diffusive shock acceleration, including the backreaction of the accelerated particles on the structure of the forward and reverse shocks, with a hydrodynamic simulation of SNR evolution. Compared to models which ignore CRs, the most important hydrodynamical effects of placing a significant fraction of shock energy into CRs are larger shock compression ratios and lower temperatures in the shocked gas. We compare our results, which use an approximate description of the acceleration process, with a more complete model where the full CR transport equations are solved (i.e., Berezhko et al., 2002), and find excellent agreement for the CR spectrum summed over the SNR lifetime and the evolving shock compression ratio. The importance of the coupling between particle acceleration and SNR dynamics for the interpretation of broad-band continuum and thermal X-ray observations is discussed.

  4. cDNA encoding a polypeptide including a hevein sequence

    DOE Patents [OSTI]

    Raikhel, Natasha V. (Okemos, MI); Broekaert, Willem F. (Dilbeek, BE); Chua, Nam-Hai (Scarsdale, NY); Kush, Anil (New York, NY)

    1999-05-04T23:59:59.000Z

    A cDNA clone (HEV1) encoding hevein was isolated via polymerase chain reaction (PCR) using mixed oligonucleotides corresponding to two regions of hevein as primers and a Hevea brasiliensis latex cDNA library as a template. HEV1 is 1018 nucleotides long and includes an open reading frame of 204 amino acids. The deduced amino acid sequence contains a putative signal sequence of 17 amino acid residues followed by a 187 amino acid polypeptide. The amino-terminal region (43 amino acids) is identical to hevein and shows homology to several chitin-binding proteins and to the amino-termini of wound-induced genes in potato and poplar. The carboxyl-terminal portion of the polypeptide (144 amino acids) is 74-79% homologous to the carboxyl-terminal region of wound-inducible genes of potato. Wounding, as well as application of the plant hormones abscisic acid and ethylene, resulted in accumulation of hevein transcripts in leaves, stems and latex, but not in roots, as shown by using the cDNA as a probe. A fusion protein was produced in E. coli from the protein of the present invention and maltose binding protein produced by the E. coli.

  5. CDNA encoding a polypeptide including a hevein sequence

    DOE Patents [OSTI]

    Raikhel, Natasha V. (Okemos, MI); Broekaert, Willem F. (Dilbeek, BE); Chua, Nam-Hai (Scarsdale, NY); Kush, Anil (New York, NY)

    1995-03-21T23:59:59.000Z

    A cDNA clone (HEV1) encoding hevein was isolated via polymerase chain reaction (PCR) using mixed oligonucleotides corresponding to two regions of hevein as primers and a Hevea brasiliensis latex cDNA library as a template. HEV1 is 1018 nucleotides long and includes an open reading frame of 204 amino acids. The deduced amino acid sequence contains a putative signal sequence of 17 amino acid residues followed by a 187 amino acid polypeptide. The amino-terminal region (43 amino acids) is identical to hevein and shows homology to several chitin-binding proteins and to the amino-termini of wound-induced genes in potato and poplar. The carboxyl-terminal portion of the polypeptide (144 amino acids) is 74-79% homologous to the carboxyl-terminal region of wound-inducible genes of potato. Wounding, as well as application of the plant hormones abscisic acid and ethylene, resulted in accumulation of hevein transcripts in leaves, stems and latex, but not in roots, as shown by using the cDNA as a probe. A fusion protein was produced in E. coli from the protein of the present invention and maltose binding protein produced by the E. coli.

  6. cDNA encoding a polypeptide including a hevein sequence

    DOE Patents [OSTI]

    Raikhel, N.V.; Broekaert, W.F.; Chua, N.H.; Kush, A.

    1995-03-21T23:59:59.000Z

    A cDNA clone (HEV1) encoding hevein was isolated via polymerase chain reaction (PCR) using mixed oligonucleotides corresponding to two regions of hevein as primers and a Hevea brasiliensis latex cDNA library as a template. HEV1 is 1,018 nucleotides long and includes an open reading frame of 204 amino acids. The deduced amino acid sequence contains a putative signal sequence of 17 amino acid residues followed by a 187 amino acid polypeptide. The amino-terminal region (43 amino acids) is identical to hevein and shows homology to several chitin-binding proteins and to the amino-termini of wound-induced genes in potato and poplar. The carboxyl-terminal portion of the polypeptide (144 amino acids) is 74--79% homologous to the carboxyl-terminal region of wound-inducible genes of potato. Wounding, as well as application of the plant hormones abscisic acid and ethylene, resulted in accumulation of hevein transcripts in leaves, stems and latex, but not in roots, as shown by using the cDNA as a probe. A fusion protein was produced in E. coli from the protein of the present invention and maltose binding protein produced by the E. coli. 11 figures.

  7. cDNA encoding a polypeptide including a hevein sequence

    DOE Patents [OSTI]

    Raikhel, N.V.; Broekaert, W.F.; Chua, N.H.; Kush, A.

    1999-05-04T23:59:59.000Z

    A cDNA clone (HEV1) encoding hevein was isolated via polymerase chain reaction (PCR) using mixed oligonucleotides corresponding to two regions of hevein as primers and a Hevea brasiliensis latex cDNA library as a template. HEV1 is 1018 nucleotides long and includes an open reading frame of 204 amino acids. The deduced amino acid sequence contains a putative signal sequence of 17 amino acid residues followed by a 187 amino acid polypeptide. The amino-terminal region (43 amino acids) is identical to hevein and shows homology to several chitin-binding proteins and to the amino-termini of wound-induced genes in potato and poplar. The carboxyl-terminal portion of the polypeptide (144 amino acids) is 74--79% homologous to the carboxyl-terminal region of wound-inducible genes of potato. Wounding, as well as application of the plant hormones abscisic acid and ethylene, resulted in accumulation of hevein transcripts in leaves, stems and latex, but not in roots, as shown by using the cDNA as a probe. A fusion protein was produced in E. coli from the protein of the present invention and maltose binding protein produced by the E. coli. 12 figs.

  8. Power Quality Aspects in a Wind Power Plant: Preprint

    SciTech Connect (OSTI)

    Muljadi, E.; Butterfield, C. P.; Chacon, J.; Romanowitz, H.

    2006-01-01T23:59:59.000Z

    Although many operational aspects affect wind power plant operation, this paper focuses on power quality. Because a wind power plant is connected to the grid, it is very important to understand the sources of disturbances that affect the power quality.

  9. EA-1726: Kahuku Wind Power, LLC Wind Power Generation Facility...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    6: Kahuku Wind Power, LLC Wind Power Generation Facility, O'ahu, HI EA-1726: Kahuku Wind Power, LLC Wind Power Generation Facility, O'ahu, HI May 3, 2010 EA-1726: Final...

  10. Energy star compliant voice over internet protocol (VoIP) telecommunications network including energy star compliant VoIP devices

    DOE Patents [OSTI]

    Kouchri, Farrokh Mohammadzadeh

    2012-11-06T23:59:59.000Z

    A Voice over Internet Protocol (VoIP) communications system, a method of managing a communications network in such a system and a program product therefore. The system/network includes an ENERGY STAR (E-star) aware softswitch and E-star compliant communications devices at system endpoints. The E-star aware softswitch allows E-star compliant communications devices to enter and remain in power saving mode. The E-star aware softswitch spools messages and forwards only selected messages (e.g., calls) to the devices in power saving mode. When the E-star compliant communications devices exit power saving mode, the E-star aware softswitch forwards spooled messages.

  11. E-beam high voltage switching power supply

    DOE Patents [OSTI]

    Shimer, D.W.; Lange, A.C.

    1996-10-15T23:59:59.000Z

    A high-power power supply produces a controllable, constant high voltage output under varying and arcing loads. The power supply includes a voltage regulator, an inductor, an inverter for producing a high frequency square wave current of alternating polarity, an improved inverter voltage clamping circuit, a step up transformer, an output rectifier for producing a dc voltage at the output of each module, and a current sensor for sensing output current. The power supply also provides dynamic response to varying loads by controlling the voltage regulator duty cycle and circuitry is provided for sensing incipient arc currents at the output of the power supply to simultaneously decouple the power supply circuitry from the arcing load. The power supply includes a plurality of discrete switching type dc--dc converter modules. 5 figs.

  12. E-beam high voltage switching power supply

    DOE Patents [OSTI]

    Shimer, Daniel W. (Danville, CA); Lange, Arnold C. (Livermore, CA)

    1996-01-01T23:59:59.000Z

    A high-power power supply produces a controllable, constant high voltage put under varying and arcing loads. The power supply includes a voltage regulator, an inductor, an inverter for producing a high frequency square wave current of alternating polarity, an improved inverter voltage clamping circuit, a step up transformer, an output rectifier for producing a dc voltage at the output of each module, and a current sensor for sensing output current. The power supply also provides dynamic response to varying loads by controlling the voltage regulator duty cycle and circuitry is provided for sensing incipient arc currents at the output of the power supply to simultaneously decouple the power supply circuitry from the arcing load. The power supply includes a plurality of discrete switching type dc--dc converter modules.

  13. Community Assessment Tool for Public Health Emergencies Including Pandemic Influenza

    SciTech Connect (OSTI)

    HCTT-CHE

    2011-04-14T23:59:59.000Z

    The Community Assessment Tool (CAT) for Public Health Emergencies Including Pandemic Influenza (hereafter referred to as the CAT) was developed as a result of feedback received from several communities. These communities participated in workshops focused on influenza pandemic planning and response. The 2008 through 2011 workshops were sponsored by the Centers for Disease Control and Prevention (CDC). Feedback during those workshops indicated the need for a tool that a community can use to assess its readiness for a disaster—readiness from a total healthcare perspective, not just hospitals, but the whole healthcare system. The CAT intends to do just that—help strengthen existing preparedness plans by allowing the healthcare system and other agencies to work together during an influenza pandemic. It helps reveal each core agency partners' (sectors) capabilities and resources, and highlights cases of the same vendors being used for resource supplies (e.g., personal protective equipment [PPE] and oxygen) by the partners (e.g., public health departments, clinics, or hospitals). The CAT also addresses gaps in the community's capabilities or potential shortages in resources. While the purpose of the CAT is to further prepare the community for an influenza pandemic, its framework is an extension of the traditional all-hazards approach to planning and preparedness. As such, the information gathered by the tool is useful in preparation for most widespread public health emergencies. This tool is primarily intended for use by those involved in healthcare emergency preparedness (e.g., community planners, community disaster preparedness coordinators, 9-1-1 directors, hospital emergency preparedness coordinators). It is divided into sections based on the core agency partners, which may be involved in the community's influenza pandemic influenza response.

  14. Frequency-dependent polarizability of helium including relativistic effects with nuclear recoil terms

    E-Print Network [OSTI]

    Piszczatowski, Konrad; Komasa, Jacek; Jeziorski, Bogumil; Szalewicz, Krzysztof

    2015-01-01T23:59:59.000Z

    Future metrology standards will be partly based on physical quantities computed from first principles rather than measured. In particular, a new pressure standard can be established if the dynamic polarizability of helium can be determined from theory with an uncertainty smaller than 0.2 ppm. We present calculations of the frequency-dependent part of this quantity including relativistic effects with full account of leading nuclear recoil terms and using highly optimized explicitly correlated basis sets. A particular emphasis is put on uncertainty estimates. At the He-Ne laser wavelength of 632.9908 nm, the computed polarizability value of 1.391 811 41 a.u. has uncertainty of 0.1 ppm that is two orders of magnitude smaller than those of the most accurate polarizability measurements. We also obtained an accurate expansion of the helium refractive index in powers of density.

  15. The NASA CSTI High Capacity Power Project

    SciTech Connect (OSTI)

    Winter, J.; Dudenhoefer, J.; Juhasz, A.; Schwarze, G.; Patterson, R.; Ferguson, D.; Titran, R. [National Aeronautics and Space Administration, Cleveland, OH (United States). Lewis Research Center; Schmitz, P. [Sverdrup Technology, Inc., Brook Park, OH (United States). Lewis Research Center Group; Vandersande, J. [Jet Propulsion Lab., Pasadena, CA (United States)

    1994-09-01T23:59:59.000Z

    The SP-100 Space Nuclear Power Program was established in 1983 by DOD, DOE, and NASA as a joint program to develop technology for military and civil applications. Starting in 1986, NASA has funded a technology program to maintain the momentum of promising aerospace technology advancement started during Phase I of SP-100 and to strengthen, in key areas, the changes for successful development and growth capability of space nuclear reactor power systems for a wide range of future space applications. The elements of the CSTI High Capacity Power Project include Systems Analysis, Stirling Power Conversion, Thermoelectric Power Conversion, Thermal Management, Power Management, Systems Diagnostics, Environmental Interactions, and Material/Structural Development. Technology advancement in all elements is required to provide the growth capability, high reliability and 7 to 10 year lifetime demanded for future space nuclear power systems. The overall project with develop and demonstrate the technology base required to provide a wide range of modular power systems compatible with the SP-100 reactor which facilitates operation during lunar and planetary day/night cycles as well as allowing spacecraft operation at any attitude or distance from the sun. Significant accomplishments in all of the project elements will be presented, along with revised goals and project timelines recently developed.

  16. PASSIVE CONTROL OF FLUID POWERED HUMAN POWER AMPLIFIERS

    E-Print Network [OSTI]

    Li, Perry Y.

    PASSIVE CONTROL OF FLUID POWERED HUMAN POWER AMPLIFIERS Perry Y. Li and Venkat Durbha Center is proposed for the control of fluid powered human power amplifiers. Human power amplifiers are mechanical as a torque/force source. The control objective is to amplify the power that the human exerts on the machine

  17. INTEGRATED CONTROL OF NEXT GENERATION POWER SYSTEM

    SciTech Connect (OSTI)

    None

    2010-02-28T23:59:59.000Z

    Control methodologies provide the necessary data acquisition, analysis and corrective actions needed to maintain the state of an electric power system within acceptable operating limits. These methods are primarily software-based algorithms that are nonfunctional unless properly integrated with system data and the appropriate control devices. Components of the control of power systems today include protective relays, supervisory control and data acquisition (SCADA), distribution automation (DA), feeder automation, software agents, sensors, control devices and communications. Necessary corrective actions are still accomplished using large electromechanical devices such as vacuum, oil and gas-insulated breakers, capacitor banks, regulators, transformer tap changers, reclosers, generators, and more recently FACTS (flexible AC transmission system) devices. The recent evolution of multi-agent system (MAS) technologies has been reviewed and effort made to integrate MAS into next generation power systems. A MAS can be defined as ��a loosely-coupled network of problem solvers that work together to solve problems that are beyond their individual capabilities��. These problem solvers, often called agents, are autonomous and may be heterogeneous in nature. This project has shown that a MAS has significant advantages over a single, monolithic, centralized problem solver for next generation power systems. Various communication media are being used in the electric power system today, including copper, optical fiber and power line carrier (PLC) as well as wireless technologies. These technologies have enabled the deployment of substation automation (SA) at many facilities. Recently, carrier and wireless technologies have been developed and demonstrated on a pilot basis. Hence, efforts have been made by this project to penetrate these communication technologies as an infrastructure for next generation power systems. This project has thus pursued efforts to use specific MAS methods as well as pertinent communications protocols to imbed and assess such technologies in a real electric power distribution system, specifically the Circuit of the Future (CoF) developed by Southern California Edison (SCE). By modeling the behavior and communication for the components of a MAS, the operation and control of the power distribution circuit have been enhanced. The use of MAS to model and integrate a power distribution circuit offers a significantly different approach to the design of next generation power systems. For example, ways to control a power distribution circuit that includes a micro-grid while considering the impacts of thermal constraints, and integrating voltage control and renewable energy sources on the main power system have been pursued. Both computer simulations and laboratory testbeds have been used to demonstrate such technologies in electric power distribution systems. An economic assessment of MAS in electric power systems was also performed during this project. A report on the economic feasibility of MAS for electric power systems was prepared, and particularly discusses the feasibility of incorporating MAS in transmission and distribution (T&D) systems. Also, the commercial viability of deploying MAS in T&D systems has been assessed by developing an initial case study using utility input to estimate the benefits of deploying MAS. In summary, the MAS approach, which had previously been investigated with good success by APERC for naval shipboard applications, has now been applied with promising results for enhancing an electric power distribution circuit, such as the Circuit of the Future developed by Southern California Edison. The results for next generation power systems include better ability to reconfigure circuits, improve protection and enhance reliability.

  18. Alternative Energy Technologies Solar Power

    E-Print Network [OSTI]

    Scott, Christopher

    #12;Alternative Energy Technologies Solar Power Photovoltaics Concentrating Solar Power (CSP) Power;Concentrating Solar Power (CSP) Reflector material is Aluminum or Silver Tube material ..... Several possible ............... Mexico, Canada, Peru Alumina ............Guinea, Brazil, Australia, Jamaica Manganese ....... S. Africa

  19. Entangling Power of Permutations

    E-Print Network [OSTI]

    Lieven Clarisse; Sibasish Ghosh; Simone Severini; Anthony Sudbery

    2005-04-11T23:59:59.000Z

    The notion of entangling power of unitary matrices was introduced by Zanardi, Zalka and Faoro [PRA, 62, 030301]. We study the entangling power of permutations, given in terms of a combinatorial formula. We show that the permutation matrices with zero entangling power are, up to local unitaries, the identity and the swap. We construct the permutations with the minimum nonzero entangling power for every dimension. With the use of orthogonal latin squares, we construct the permutations with the maximum entangling power for every dimension. Moreover, we show that the value obtained is maximum over all unitaries of the same dimension, with possible exception for 36. Our result enables us to construct generic examples of 4-qudits maximally entangled states for all dimensions except for 2 and 6. We numerically classify, according to their entangling power, the permutation matrices of dimension 4 and 9, and we give some estimates for higher dimensions.

  20. Thermionic power generation. January 1970-December 1980 (citations from the Engineering Index Data Base). Report for January 1970-December 1980

    SciTech Connect (OSTI)

    Not Available

    1980-12-01T23:59:59.000Z

    Research on thermionic power generation, power plant design, converter design, and basic research on thermionic materials are cited in the bibliography. Spacecraft applications are also included. (Contains 138 citations, fully indexed and including a table of contents.)

  1. Bi-directional power control system for voltage converter

    DOE Patents [OSTI]

    Garrigan, N.R.; King, R.D.; Schwartz, J.E.

    1999-05-11T23:59:59.000Z

    A control system for a voltage converter includes: a power comparator for comparing a power signal on input terminals of the converter with a commanded power signal and producing a power comparison signal; a power regulator for transforming the power comparison signal to a commanded current signal; a current comparator for comparing the commanded current signal with a measured current signal on output terminals of the converter and producing a current comparison signal; a current regulator for transforming the current comparison signal to a pulse width modulator (PWM) duty cycle command signal; and a PWM for using the PWM duty cycle command signal to control electrical switches of the converter. The control system may further include: a command multiplier for converting a voltage signal across the output terminals of the converter to a gain signal having a value between zero (0) and unity (1), and a power multiplier for multiplying the commanded power signal by the gain signal to provide a limited commanded power signal, wherein power comparator compares the limited commanded power signal with the power signal on the input terminals. 10 figs.

  2. Bi-directional power control system for voltage converter

    DOE Patents [OSTI]

    Garrigan, Neil Richard (Niskayuna, NY); King, Robert Dean (Schenectady, NY); Schwartz, James Edward (Slingerlands, NY)

    1999-01-01T23:59:59.000Z

    A control system for a voltage converter includes: a power comparator for comparing a power signal on input terminals of the converter with a commanded power signal and producing a power comparison signal; a power regulator for transforming the power comparison signal to a commanded current signal; a current comparator for comparing the commanded current signal with a measured current signal on output terminals of the converter and producing a current comparison signal; a current regulator for transforming the current comparison signal to a pulse width modulator (PWM) duty cycle command signal; and a PWM for using the PWM duty cycle command signal to control electrical switches of the converter. The control system may further include: a command multiplier for converting a voltage signal across the output terminals of the converter to a gain signal having a value between zero (0) and unity (1), and a power multiplier for multiplying the commanded power signal by the gain signal to provide a limited commanded power signal, wherein power comparator compares the limited commanded power signal with the power signal on the input terminals.

  3. TidGen Power System Commercialization Project

    SciTech Connect (OSTI)

    Sauer, Christopher R. [President & CEO] [President & CEO; McEntee, Jarlath [VP Engineering & CTO] [VP Engineering & CTO

    2013-12-30T23:59:59.000Z

    ORPC Maine, LLC, a wholly-owned subsidiary of Ocean Renewable Power Company, LLC (collectively ORPC), submits this Final Technical Report for the TidGen® Power System Commercialization Project (Project), partially funded by the U.S. Department of Energy (DE-EE0003647). The Project was built and operated in compliance with the Federal Energy Regulatory Commission (FERC) pilot project license (P-12711) and other permits and approvals needed for the Project. This report documents the methodologies, activities and results of the various phases of the Project, including design, engineering, procurement, assembly, installation, operation, licensing, environmental monitoring, retrieval, maintenance and repair. The Project represents a significant achievement for the renewable energy portfolio of the U.S. in general, and for the U.S. marine hydrokinetic (MHK) industry in particular. The stated Project goal was to advance, demonstrate and accelerate deployment and commercialization of ORPC’s tidal-current based hydrokinetic power generation system, including the energy extraction and conversion technology, associated power electronics, and interconnection equipment capable of reliably delivering electricity to the domestic power grid. ORPC achieved this goal by designing, building and operating the TidGen® Power System in 2012 and becoming the first federally licensed hydrokinetic tidal energy project to deliver electricity to a power grid under a power purchase agreement in North America. Located in Cobscook Bay between Eastport and Lubec, Maine, the TidGen® Power System was connected to the Bangor Hydro Electric utility grid at an on-shore station in North Lubec on September 13, 2012. ORPC obtained a FERC pilot project license for the Project on February 12, 2012 and the first Maine Department of Environmental Protection General Permit issued for a tidal energy project on January 31, 2012. In addition, ORPC entered into a 20-year agreement with Bangor Hydro Electric Company on January 1, 2013 for up to 5 megawatts at a price of $215/MWh, escalating at 2.0% per year.

  4. Strong permanent magnets provide a backbone technology required many products, including computers, electric cars, and

    E-Print Network [OSTI]

    McQuade, D. Tyler

    , electric cars, and wind-powered generators. Currently, the strongest permanent magnets contain rare earth

  5. Interleaved power converter

    DOE Patents [OSTI]

    Zhu, Lizhi (Canton, MI)

    2007-11-13T23:59:59.000Z

    A power converter architecture interleaves full bridge converters to alleviate thermal management problems in high current applications, and may, for example, double the output power capability while reducing parts count and costs. For example, one phase of a three phase inverter is shared between two transformers, which provide power to a rectifier such as a current doubler rectifier to provide two full bridge DC/DC converters with three rather than four high voltage inverter legs.

  6. Electric power annual 1993

    SciTech Connect (OSTI)

    Not Available

    1994-12-08T23:59:59.000Z

    This report presents a summary of electric power industry statistics at national, regional, and state levels: generating capability and additions, net generation, fossil-fuel statistics, retail sales and revenue, finanical statistics, environmental statistics, power transactions, demand side management, nonutility power producers. Purpose is to provide industry decisionmakers, government policymakers, analysts, and the public with historical data that may be used in understanding US electricity markets.

  7. Power System load management

    SciTech Connect (OSTI)

    Rudenko, Yu.N.; Semenov, V.A.; Sovalov, S.A.; Syutkin, B.D.

    1984-01-01T23:59:59.000Z

    The variation in demand nonuniformity is analyzed for the Unified Electric Power System of the USSR and certain interconnected power systems; the conditions for handling such nonuniformity with utilization of generating equipment having differing flexibility capabilities are also considered. On this basis approaches and techniques for acting on user loads, load management, in order to assure a balance between generated and consumed power are considered.

  8. Electric power monthly, July 1993

    SciTech Connect (OSTI)

    Not Available

    1993-07-29T23:59:59.000Z

    The Electric Power Monthly (EPM) presents monthly electricity statistics. The purpose of this publication is to provide energy decisionmakers with accurate and timely information that may be used in forming various perspectives on electric issues that lie ahead. Data in this report are presented for a wide audience including Congress, Federal and State agencies, the electric utility industry, and the general public. The EIA collected the information in this report to fulfill its data collection and dissemination responsibilities as specified in the Federal Energy Administration Act of 1974 (Public Law 93-275) as amended.

  9. Electric power monthly, June 1994

    SciTech Connect (OSTI)

    Not Available

    1994-06-01T23:59:59.000Z

    The Electric Power Monthly (EPM) presents monthly electricity statistics. The purpose of this publication is to provide energy decisionmakers with accurate and timely information that may be used in forming various perspectives on electric issues that lie ahead. Data in this report are presented for a wide audience including Congress, Federal and State agencies, the electric utility industry, and the general public. The EIA collected the information in this report to fulfill its data collection and dissemination responsibilities as specified in the Federal Energy Administration Act of 1974 (Public Law 93-275) as amended.

  10. Electric power monthly, August 1994

    SciTech Connect (OSTI)

    Not Available

    1994-08-24T23:59:59.000Z

    The Electric Power Monthly (EPM) presents monthly electricity statistics. The purpose of this publication is to provide energy decisionmakers with accurate and timely information that may be used in forming various perspectives on electric issues that lie ahead. Data in this report are presented for a wide audience including Congress, Federal and State agencies, the electric utility industry, and the general public. The EIA collected the information in this report to fulfill its data collection and dissemination responsibilities as specified in the Federal Energy Administration Act of 1974 (Public Law 93-275) as amended.

  11. Western Area Power Administration

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    29-30, 2011 2 Agenda * Overview of Western Area Power Administration * Post-1989 Loveland Area Projects (LAP) Marketing Plan * Energy Planning and Management Program * Development...

  12. PowerPoint Presentation

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    and Characterization (SciChar) Workshop Characterization Capabilities Battery Questions Neutron Advantages * Scattering Power unrelated to Z - Many low Z elements have high cross...

  13. 2025 Power Marketing Initiative

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    the LAP FES contracts and has developed a plan for marketing and allocating LAP hydroelectric power after the current FES contracts expire. We call this plan our 2025...

  14. Power Supply Negotiations

    Office of Environmental Management (EM)

    Southeastern Federal Power Alliance Incremental Decay in Energy March 11, 2014 2 Incremental Decay in Energy Hydropower customers observations from our review of the Buford...

  15. Power Purchase Agreements Update

    Broader source: Energy.gov [DOE]

    Presentation covers an update on power purchase agreements and is given at the Spring 2011 Federal Utility Partnership Working Group (FUPWG) meeting.

  16. Green Power Offer (Maine)

    Broader source: Energy.gov [DOE]

    This chapter establishes requirements, standards and procedures and a competitive bidding process to implement the green power offer program. The program is designed to make renewable energy...

  17. Municipal Electric Power (Minnesota)

    Broader source: Energy.gov [DOE]

    This section describes energy procurement for local utilities operating in Minnesota and provides a means for Minnesota cities to construct and operate hydroelectric power plants. The statute gives...

  18. Alabama Power- UESC Activities

    Broader source: Energy.gov [DOE]

    Presentation—given at the Fall 2012 Federal Utility Partnership Working Group (FUPWG) meeting—discusses Alabama Power and its utility energy service contract (UESC) projects and activities.

  19. Concentrated Solar Thermoelectric Power

    Broader source: Energy.gov [DOE]

    This presentation was delivered at the SunShot Concentrating Solar Power (CSP) Program Review 2013, held April 23–25, 2013 near Phoenix, Arizona.

  20. Critical pulse power components

    SciTech Connect (OSTI)

    Sarjeant, W.J.; Rohwein, G.J.

    1981-01-01T23:59:59.000Z

    Critical components for pulsed power conditioning systems will be reviewed. Particular emphasis will be placed on those components requiring significant development efforts. Capacitors, for example, are one of the weakest elements in high-power pulsed systems, especially when operation at high-repetition frequencies for extended periods of time are necessary. Switches are by far the weakest active components of pulse power systems. In particular, opening switches are essentially nonexistent for most applications. Insulaton in all systems and components requires development and improvement. Efforts under way in technology base development of pulse power components will be discussed.

  1. PowerPoint Presentation

    Office of Environmental Management (EM)

    Systems Program 1 DOE Energy Storage & Power Electronics Research Programs October 8, 2009 Marcelo Schupbach, Ph.D. Chief Technology Officer APEI, Inc. 535 Research Center Blvd....

  2. Energy 101: Hydroelectric Power

    Office of Energy Efficiency and Renewable Energy (EERE)

    Learn how hydroelectric power, or hydropower, captures the kinetic energy of flowing water and turns it into electricity for our homes and businesses.

  3. Southwestern Power Administration

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    POTC Home Courses Instructors NERC Continuing Education Power Operations Training Center Instructors All instructors at Southwestern's POTC are NERC-approved continuing education...

  4. Combined Heat & Power

    Broader source: Energy.gov (indexed) [DOE]

    & Power (CHP) Michael Ellis Director AGL Energy Services Federal Utility Partnership Working Group May 7 - 8, 2014 Virginia Beach, VA "CHP is the most efficient way of generating...

  5. Application Power Signature Analysis

    SciTech Connect (OSTI)

    Hsu, Chung-Hsing [ORNL] [ORNL; Combs, Jacob [Sonoma State University] [Sonoma State University; Nazor, Jolie [Sonoma State University] [Sonoma State University; Santiago, Fabian [Sonoma State University] [Sonoma State University; Thysell, Rachelle [Sonoma State University] [Sonoma State University; Rivoire, Suzanne [Sonoma State University] [Sonoma State University; Poole, Stephen W [ORNL] [ORNL

    2014-01-01T23:59:59.000Z

    The high-performance computing (HPC) community has been greatly concerned about energy efficiency. To address this concern, it is essential to understand and characterize the electrical loads of HPC applications. In this work, we study whether HPC applications can be distinguished by their power-consumption patterns using quantitative measures in an automatic manner. Using a collection of 88 power traces from 4 different systems, we find that basic statistical measures do a surprisingly good job of summarizing applications' distinctive power behavior. Moreover, this study opens up a new area of research in power-aware HPC that has a multitude of potential applications.

  6. PowerPoint Presentation

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    CONTRIBUTORS Developed by Rob Carmichael, Cadeo Group, Mark Bielecki and Amy Meyer, Navigant Consulting and Kristin Salvador, Artisan. Developed for the Bonneville Power...

  7. PowerPoint Presentation

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    in SAM Photovoltaics Concentrating PV Solar Water Heating Geothermal Dish-Stirling Linear Fresnel Power Tower Parabolic Trough Small Wind Utility-scale Wind Biomass...

  8. Web-based Tool for Preliminary Assessment of Wind Power Plant Design

    E-Print Network [OSTI]

    Mustakerov, Ivan

    Web-based Tool for Preliminary Assessment of Wind Power Plant Design Daniela Borissova1 and Ivan. Designing of reliable and cost-effective industrial wind power plant is a prerequisite for the effective use of wind power as an alternative resource. The design of a wind power plant includes the determination

  9. PowerPack: Energy Profiling and Analysis of High-Performance Systems and Applications

    E-Print Network [OSTI]

    PowerPack: Energy Profiling and Analysis of High-Performance Systems and Applications Rong Ge of power and energy on the computer systems community, few studies provide insight to where and how power of these systems. These analyses include the impacts of chip multiprocessing on power and energy efficiency

  10. Dynamics of Electric Power Supply Chain Networks under Risk and Uncertainty

    E-Print Network [OSTI]

    Nagurney, Anna

    power industry in the US and in several other countries has been undergoing a fundamental transformation multicriteria decision-makers, who operate in a decentralized manner and include power generators, power time. Keywords: Electric power; Supply chains; Networks; Multicriteria optimization; Projected dynam

  11. A Parametric Device Study for SiC Power Electronics Burak Ozpineci

    E-Print Network [OSTI]

    Tolbert, Leon M.

    A Parametric Device Study for SiC Power Electronics Burak Ozpineci 1,3 burak@ieee.org Leon M to be used. The circuits people, including power electronics researchers, take the devices as black boxes Typically, power electronics researchers have to choose off-the-shelf power devices with the specifications

  12. High-Level Power Estimation with Interconnect Effects Kavel M. Buyuksahin

    E-Print Network [OSTI]

    Najm, Farid N.

    the predicted (at RTL) power against that measured using SPICE. An average er- ror of 14.4% is obtainedHigh-Level Power Estimation with Interconnect Effects Kavel M. B¨uy¨uks¸ahin ECE Dept.najm@toronto.edu ABSTRACT We extend earlier work on high-level average power esti- mation to include the power due

  13. Plasma physics and related challenges of millimeter-wave-to-terahertz and high power microwave generationa...

    E-Print Network [OSTI]

    Smith, James E.

    confronting "classic" high power microwave HPM generators including long-life bright electron beam sources, high power mmw-to-THz sources are compared and contrasted to those of HPM generation, and future assume long pulse or average power, with exceptions be- tween 1 and 10 GHz for high power microwave HPM

  14. Flexibility in 21st Century Power Systems (Fact Sheet)

    SciTech Connect (OSTI)

    Not Available

    2014-10-01T23:59:59.000Z

    Flexibility of operation--the ability of a power system to respond to change in demand and supply--is a characteristic of all power systems. Flexibility is especially prized in twenty-first century power systems, with higher levels of grid-connected variable renewable energy (primarily, wind and solar). Sources of flexibility exist--and can be enhanced--across all of the physical and institutional elements of the power system, including system operations and markets, demand side resources and storage; generation; and transmission networks. Accessing flexibility requires significant planning to optimize investments and ensure that both short- and long-time power system requirements are met.

  15. POWER SYSTEMS DEVELOPMENT FACILITY

    SciTech Connect (OSTI)

    Unknown

    2002-05-01T23:59:59.000Z

    This report discusses test campaign GCT3 of the Halliburton KBR transport reactor train with a Siemens Westinghouse Power Corporation (Siemens Westinghouse) particle filter system at the Power Systems Development Facility (PSDF) located in Wilsonville, Alabama. The transport reactor is an advanced circulating fluidized-bed reactor designed to operate as either a combustor or a gasifier using one of two possible particulate control devices (PCDs). The transport reactor was operated as a pressurized gasifier during GCT3. GCT3 was planned as a 250-hour test run to commission the loop seal and continue the characterization of the limits of operational parameter variations using a blend of several Powder River Basin coals and Bucyrus limestone from Ohio. The primary test objectives were: (1) Loop Seal Commissioning--Evaluate the operational stability of the loop seal with sand and limestone as a bed material at different solids circulation rates and establish a maximum solids circulation rate through the loop seal with the inert bed. (2) Loop Seal Operations--Evaluate the loop seal operational stability during coal feed operations and establish maximum solids circulation rate. Secondary objectives included the continuation of reactor characterization, including: (1) Operational Stability--Characterize the reactor loop and PCD operations with short-term tests by varying coal feed, air/coal ratio, riser velocity, solids circulation rate, system pressure, and air distribution. (2) Reactor Operations--Study the devolatilization and tar cracking effects from transient conditions during transition from start-up burner to coal. Evaluate the effect of process operations on heat release, heat transfer, and accelerated fuel particle heat-up rates. Study the effect of changes in reactor conditions on transient temperature profiles, pressure balance, and product gas composition. (3) Effects of Reactor Conditions on Syngas Composition--Evaluate the effect of air distribution, steam/coal ratio, solids circulation rate, and reactor temperature on CO/CO{sub 2} ratio, H{sub 2}/converted carbon ratio, gasification rates, carbon conversion, and cold and hot gas efficiencies. Test run GCT3 was started on December 1, 2000, with the startup of the thermal oxidizer fan, and was completed on February 1, 2001. This test was conducted in two parts; the loop seal was commissioned during the first part of this test run from December 1 through 15, which consisted of hot inert solids circulation testing. These initial tests provided preliminary data necessary to understand different parameters associated with the operation and performance of the loop seal. The loop seal was tested with coal feed during the second part of the test run and additional data was gathered to analyze reactor operations and to identify necessary modifications to improve equipment and process performance. In the second part of GCT3, the gasification portion of the test, from January 20 to February 1, 2001, the mixing zone and riser temperatures were varied between 1,675 and 1,825 F at pressures ranging from 200 to 240 psig. There were 306 hours of solid circulation and 184 hours of coal feed attained in GCT3.

  16. Space Power System Modeling with EBAL

    SciTech Connect (OSTI)

    Zillmer, Andrew; Hanks, David; Wen-Hsiung 'Tony' Tu [Pratt and Whitney Rocketdyne, 6633 Canoga Avenue MC LA 13, PO Box 7922, Canoga Park, CA 91309 (United States)

    2006-07-01T23:59:59.000Z

    Pratt and Whitney Rocket dyne's Engine Balance (EBAL) thermal/fluid system code has been expanded to model nuclear power closed Brayton cycle (CBC) power conversion systems. EBAL was originally developed to perform design analysis of hypersonic vehicle propellant and thermal management systems analysis. Later, it was adapted to rocket engine cycles. The new version of EBAL includes detailed, physics-based models of all key CBC system components. Some component examples are turbo-alternators, heat exchangers, heat pipe radiators, and liquid metal pumps. A liquid metal cooled reactor is included and a gas cooled reactor model is in work. Both thermodynamic and structural analyses are performed for each component. EBAL performs steady-state design analysis with optimization as well as off-design performance analysis. Design optimization is performed both at the component level by the component models and on the system level with a global optimizer. The user has the option to manually drive the optimization process or run parametric analysis to better understand system trade-off. Although recent EBAL developments have focused on a CBC conversion system, the code is easily extendible to other power conversion cycles. This new, more powerful version of EBAL allows for rapid design analysis and optimization of space power systems. A notional example of EBAL's capabilities is included. (authors)

  17. Power transaction issues in deregulated power systems

    E-Print Network [OSTI]

    Roycourt, Henrik

    2000-01-01T23:59:59.000Z

    of each generator to the individual transmission lines flows. The method's implementation is described in detail and numerical examples are included for its illustration....

  18. Power, Media & Montesquieu. New forms of public power and the balance of power

    E-Print Network [OSTI]

    van den Brink, Jeroen

    SUMMARY Power, Media & Montesquieu. New forms of public power and the balance of power are organized it is crucial to restrain the power that the state exerts on its citizens. The state has three functions, commonly known as powers: the legislative, executive and judicial powers. This three

  19. NUCLEAR POWER in CALIFORNIA

    E-Print Network [OSTI]

    NUCLEAR POWER in CALIFORNIA: 2007 STATUS REPORT CALIFORNIA ENERGY COMMISSION October 2007 CEC-100, California Contract No. 700-05-002 Prepared For: California Energy Commission Barbara Byron, Senior Nuclear public workshops on nuclear power. The Integrated Energy Policy Report Committee, led by Commissioners

  20. Purchasing Renewable Power

    Broader source: Energy.gov [DOE]

    Federal agencies can purchase renewable power or renewable energy certificates (RECs) from a utility or other organization to meet Federal renewable energy requirements. Renewable power and RECs are good choices for facilities where on-site projects may be difficult or capital budgets are limited.

  1. The Icelandic Power Situation

    E-Print Network [OSTI]

    Karlsson, Brynjar

    energy attracts power intensive industry to Iceland Households use only 5% 90% of district heating ensured · Feasible to sell excess energy · Takes advantage of the flexiblity of hydropower · Energy with low cost geothermal energy 80% 5% 15% Households Other users Power intensive industries #12;Future

  2. LED lamp power management system and method

    DOE Patents [OSTI]

    Gaines, James; Clauberg, Bernd; Van Erp, Josephus A. M.

    2013-03-19T23:59:59.000Z

    An LED lamp power management system and method including an LED lamp having an LED controller 58; a plurality of LED channels 60 operably connected to the LED controller 58, each of the plurality of LED channels 60 having a channel switch 62 in series with at least one shunted LED circuit 83, the shunted LED circuit 83 having a shunt switch 68 in parallel with an LED source 80. The LED controller 58 reduces power loss in one of the channel switch 62 and the shunt switch 68 when LED lamp electronics power loss (P.sub.loss) exceeds an LED lamp electronics power loss limit (P.sub.lim); and each of the channel switches 62 receives a channel switch control signal 63 from the LED controller 58 and each of the shunt switches 68 receives a shunt switch control signal 69 from the LED controller 58.

  3. Superconductivity for electric power systems: Program overview

    SciTech Connect (OSTI)

    Not Available

    1995-02-01T23:59:59.000Z

    Largely due to government and private industry partnerships, electric power applications based upon high-temperature superconductivity are now being designed and tested only seven years after the discovery of the high-temperature superconductors. These applications offer many benefits to the national electric system including: increased energy efficiency, reduced equipment size, reduced emissions, increased stability/reliability, deferred expansion, and flexible electricity dispatch/load management. All of these benefits have a common outcome: lower electricity costs and improved environmental quality. The U.S. Department of Energy (DOE) sponsors research and development through its Superconductivity Program for Electric Power Systems. This program will help develop the technology needed for U.S. industries to commercialize high-temperature superconductive electric power applications. DOE envisions that by 2010 the U.S. electric power systems equipment industry will regain a major share of the global market by offering superconducting products that outperform the competition.

  4. Electric power annual 1997. Volume 1

    SciTech Connect (OSTI)

    NONE

    1998-07-01T23:59:59.000Z

    The Electric Power Annual presents a summary of electric power industry statistics at national, regional, and State levels. The objective of the publication is to provide industry decisionmakers, government policy-makers, analysts, and the general public with data that may be used in understanding US electricity markets. The Electric Power Annual is prepared by the Electric Power Division; Office of Coal, Nuclear, Electric and Alternate Fuels; Energy Information Administration (EIA); US Department of Energy. Volume 1 -- with a focus on US electric utilities -- contains final 1997 data on net generation and fossil fuel consumption, stocks, receipts, and cost; preliminary 1997 data on generating unit capability, and retail sales of electricity, associated revenue, and the average revenue per kilowatthour of electricity sold (based on a monthly sample: Form EIA-826, ``Monthly Electric Utility Sales and Revenue Report with State Distributions``). Additionally, information on net generation from renewable energy sources and on the associated generating capability is included in Volume 1 of the EPA.

  5. Power module assembly

    DOE Patents [OSTI]

    Campbell, Jeremy B. (Torrance, CA); Newson, Steve (Redondo Beach, CA)

    2011-11-15T23:59:59.000Z

    A power module assembly of the type suitable for deployment in a vehicular power inverter, wherein the power inverter has a grounded chassis, is provided. The power module assembly comprises a conductive base layer electrically coupled to the chassis, an insulating layer disposed on the conductive base layer, a first conductive node disposed on the insulating layer, a second conductive node disposed on the insulating layer, wherein the first and second conductive nodes are electrically isolated from each other. The power module assembly also comprises a first capacitor having a first electrode electrically connected to the conductive base layer, and a second electrode electrically connected to the first conductive node, and further comprises a second capacitor having a first electrode electrically connected to the conductive base layer, and a second electrode electrically connected to the second conductive node.

  6. Electric power annual 1995. Volume I

    SciTech Connect (OSTI)

    NONE

    1996-07-01T23:59:59.000Z

    The Electric Power Annual presents a summary of electric power industry statistics at national, regional, and State levels. The objective of the publication is to provide industry decisionmakers, government policymakers, analysts, and the general public with data that may be used in understanding U.S. electricity markets. The Electric Power Annual is prepared by the Coal and Electric Data and Renewables Division; Office of Coal, Nuclear, Electric and Alternate Fuels; Energy Information Administration (EIA); U.S. Department of Energy. In the private sector, the majority of the users of the Electric Power Annual are researchers and analysts and, ultimately, individuals with policy- and decisionmaking responsibilities in electric utility companies. Financial and investment institutions, economic development organizations interested in new power plant construction, special interest groups, lobbyists, electric power associations, and the news media will find data in the Electric Power Annual useful. In the public sector, users include analysts, researchers, statisticians, and other professionals with regulatory, policy, and program responsibilities for Federal, State, and local governments. The Congress and other legislative bodies may also be interested in general trends related to electricity at State and national levels. Much of the data in these reports can be used in analytic studies to evaluate new legislation. Public service commissions and other special government groups share an interest in State-level statistics. These groups can also compare the statistics for their States with those of other jurisdictions.

  7. Submerged passively-safe power plant

    DOE Patents [OSTI]

    Herring, J. Stephen (Idaho Falls, ID)

    1993-01-01T23:59:59.000Z

    The invention as presented consists of a submerged passively-safe power station including a pressurized water reactor capable of generating at least 600 MW of electricity, encased in a double hull vessel, and provides fresh water by using the spent thermal energy in a multistage flash desalination process.

  8. ERDA-76/110/l FUSION POWER

    E-Print Network [OSTI]

    ERDA-76/110/l UC-20 FUSION POWER BY MAGNETIC CONFINEMENT PROGRAMPLAN VOLUME I SUMMARY JULY 1976 electric plants. These include direct production of hydrogen gas and/or synthetic fuels; direct energy production for chemical processing; fissile fuel production; fission product waste disposal; and fusion

  9. Power conditioning system for energy sources

    DOE Patents [OSTI]

    Mazumder, Sudip K. (Chicago, IL); Burra, Rajni K. (Chicago, IL); Acharya, Kaustuva (Chicago, IL)

    2008-05-13T23:59:59.000Z

    Apparatus for conditioning power generated by an energy source includes an inverter for converting a DC input voltage from the energy source to a square wave AC output voltage, and a converter for converting the AC output voltage from the inverter to a sine wave AC output voltage.

  10. Water Power Program: Marine and Hydrokinetic Technologies

    Broader source: Energy.gov [DOE]

    Pamphlet that describes the Office of EERE's Water Power Program in fiscal year 2009, including the fiscal year 2009 funding opportunities, the Small Business Innovation Research and Small Business Technology Transfer Programs, the U.S. hydrodynamic testing facilities, and the fiscal year 2008 Advanced Water Projects awards.

  11. Solar Decathlon: Powered by the Sun (Revised)

    SciTech Connect (OSTI)

    Not Available

    2005-08-01T23:59:59.000Z

    The Solar Decathlon is a collegiate competition to design and build the most energy efficient, solar-powered house. It is also an event on the National Mall in Washington D.C. to which the public is invited. This gatefold brochure describes the Solar Decathlon 2005 competition and event, including a schedule of activities.

  12. Submerged passively-safe power plant

    SciTech Connect (OSTI)

    Herring, J.S.

    1991-12-31T23:59:59.000Z

    The invention as presented consists of a submerged passively-safe power station including a pressurized water reactor capable of generating at least 600 MW of electricity, encased in a double hull vessel, and provides fresh water by using the spent thermal energy in a multistage flash desalination process.

  13. Submerged passively-safe power plant

    DOE Patents [OSTI]

    Herring, J.S.

    1993-09-21T23:59:59.000Z

    The invention as presented consists of a submerged passively-safe power station including a pressurized water reactor capable of generating at least 600 MW of electricity, encased in a double hull vessel, and provides fresh water by using the spent thermal energy in a multistage flash desalination process. 8 figures.

  14. Sabotage at Nuclear Power Plants

    SciTech Connect (OSTI)

    Purvis, James W.

    1999-07-21T23:59:59.000Z

    Recently there has been a noted worldwide increase in violent actions including attempted sabotage at nuclear power plants. Several organizations, such as the International Atomic Energy Agency and the US Nuclear Regulatory Commission, have guidelines, recommendations, and formal threat- and risk-assessment processes for the protection of nuclear assets. Other examples are the former Defense Special Weapons Agency, which used a risk-assessment model to evaluate force-protection security requirements for terrorist incidents at DOD military bases. The US DOE uses a graded approach to protect its assets based on risk and vulnerability assessments. The Federal Aviation Administration and Federal Bureau of Investigation conduct joint threat and vulnerability assessments on high-risk US airports. Several private companies under contract to government agencies use formal risk-assessment models and methods to identify security requirements. The purpose of this paper is to survey these methods and present an overview of all potential types of sabotage at nuclear power plants. The paper discusses emerging threats and current methods of choice for sabotage--especially vehicle bombs and chemical attacks. Potential consequences of sabotage acts, including economic and political; not just those that may result in unacceptable radiological exposure to the public, are also discussed. Applicability of risk-assessment methods and mitigation techniques are also presented.

  15. EIS-0173: Bonneville Power Administration/Puget Power Northwest Washington Transmission Project

    Broader source: Energy.gov [DOE]

    The Bonneville Power Administration (BPA) prepared this environmental impact statement to analyze the environmental impacts of an upgrade that BPA and Puget Sound Power & Light Company are considering implementing on the existing high- voltage transmission system in the Whatcom and Skagit Counties area of the State of Washington, between the towns of Custer and Sedro Woolley, including some areas within the City of Bellingham, starting in 1995.

  16. Power Sales to Electric Utilities

    SciTech Connect (OSTI)

    None

    1989-02-01T23:59:59.000Z

    The Public Utilities Regulatory Policies Act (PURPA) of 1979 requires that electrical utilities interconnect with qualifying facilities and purchase electricity at a rate based upon their full avoided costs (i.e., costs of providing both capacity and energy). Qualifying facilities (QF) include solar or geothermal electric units, hydropower, municipal solid waste or biomass-fired power plants, and cogeneration projects that satisfy maximum size, fuel use, ownership, location, and/or efficiency criteria. In Washington State, neither standard power purchase prices based upon a proxy ''avoided plant'', standard contracts, or a standard offer process have been used. Instead, a variety of power purchase contracts have been negotiated by developers of qualifying facilities with investor-owned utilities, public utility districts, and municipally-owned and operated utilities. With a hydro-based system, benefits associated with resource acquisition are determined in large part by how compatible the resource is with a utility's existing generation mix. Power purchase rates are negotiated and vary according to firm energy production, guarantees, ability to schedule maintenance or downtime, rights of refusal, power plant purchase options, project start date and length of contract; front-loading or levelization provisions; and the ability of the project to provide ''demonstrated'' capacity. Legislation was also enacted which allows PURPA to work effectively. Initial laws established ownership rights and provided irrigation districts, PUDs, and municipalities with expanded enabling powers. Financial processes were streamlined and, in some cases, simplified. Finally, laws were passed which are designed to ensure that development proceeds in an environmentally acceptable manner. In retrospect, PURPA has worked well within Washington. In the state of Washington, 20 small-scale hydroelectric projects with a combined generating capacity of 77 MW, 3 solid waste-to-energy facilities with 55 MW of electrical output, 4 cogeneration projects with 34.5 MW of generating capability, and 4 wastewater treatment facility digester gas-to-energy projects with 5 MW of electrical production have come on-line (or are in the final stages of construction) since the passage of PURPA. These numbers represent only a small portion of Washington's untapped and underutilized cogeneration and renewable resource generating potentials. [DJE-2005

  17. The NASA CSTI High Capacity Power Program

    SciTech Connect (OSTI)

    Winter, J.M.

    1994-09-01T23:59:59.000Z

    The SP-100 program was established in 1983 by DOD, DOE, and NASA as a joint program to develop the technology necessary for space nuclear power systems for military and civil applications. During 1986 and 1987, the NASA Advanced Technology Program was responsible for maintaining the momentum of promising technology advancement efforts started during Phase I of SP-100 and to strengthen, in key areas, the chances for successful development and growth capability of space nuclear reactor power systems for future space applications. In 1988, the NASA Advanced Technology Program was incorporated into NASA`s new Civil Space Technology Initiative (CSTI). The CSTI program was established to provide the foundation for technology development in automation and robotics, information, propulsion, and power. The CSTI High Capacity Power Program builds on the technology efforts of the SP-100 program, incorporates the previous NASA advanced technology project, and provides a bridge to the NASA exploration technology programs. The elements of CSTI high capacity power development include conversion systems - Stirling and thermoelectric, thermal management, power management, system diagnostics, and environmental interactions. Technology advancement in all areas, including materials, is required to provide the growth capability, high reliability and 7 to 10 years lifetime demanded for future space nuclear power systems. The overall program will develop and demonstrate the technology base required to provide a wide range of modular power systems while minimizing the impact of day/night operation as well as attitudes and distance from the Sun. Significant accomplishments in all of the program elements will be discussed, along with revised goals and project timelines recently developed.

  18. Southeastern Power Administration 2007 Annual Report

    SciTech Connect (OSTI)

    none,

    2007-12-28T23:59:59.000Z

    Dear Secretary Chu: I am proud to submit Southeastern Power Administration’s (Southeastern’s) fiscal year (FY) 2007 Annual Report for your review. The information included in this report reflects Southeastern’s programs, accomplishments, and financial activities for the 12-month period beginning October 1, 2006 and ending September 30, 2007. Southeastern marketed more than 5 billion kilowatt-hours of energy to 492 wholesale Federal power customers in an 11-state marketing area in FY 2007. Revenues from the sale of this power totaled approximately $219 million. Drought conditions continued to plague the southeast region of the United States during 2007 placing strains on our natural and financial resources. Southeastern purchased more than $40 million in replacement power to meet customer contract requirements to ensure the continued reliability of our nation’s power grid. With the financial assistance and support of our Federal power customers, continued funding for capitalized equipment replacements at various Corps of Engineers’ (Corps) hydroelectric projects provided much needed repairs and maintenance for aging facilities. Southeastern’s cyber and physical security program continued to be reviewed and updated to meet Department of Energy (DOE), Homeland Security, and North American Electric Reliability Corporation standards and requirements. Plans for the upcoming year include communication and cooperation with DOE, Federal power customers, and the Corps to maximize the benefits of our nation’s water resources. Competition for the use of water and the prolonged drought conditions will present another challenging year for our agency. The employees at Southeastern will be proactive in meeting these challenges and providing reliable hydroelectric power to the people in the southeast. Sincerely, Kenneth E. Legg Administrator

  19. SMITH AND BARGHNONCONSCIOUS EFFECTS OF POWER NONCONSCIOUS EFFECTS OF POWER

    E-Print Network [OSTI]

    Bargh, John A.

    SMITH AND BARGHNONCONSCIOUS EFFECTS OF POWER NONCONSCIOUS EFFECTS OF POWER ON BASIC APPROACH to the approach/inhibition theory of power (Keltner, Gruenfeld, & Anderson, 2003), having power should be associated with the approach system, and lacking power with the avoidance system. However

  20. Northwest Power and Conservation Council Fifth Northwest Power Plan

    E-Print Network [OSTI]

    Northwest Power and Conservation Council Fifth Northwest Power Plan Statement of Basis and Purpose for the Fifth Power Plan and Response to Comments on the Draft Fifth Power Plan February 2005 #12;I. Background.........................................................................................................................................3 B. Developing the Fifth Power Plan