Sample records for accessories optical instruments

  1. accessory optic system: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    electronics, and biomedical systems. However, given the continuous nature of optics, the inability to efficiently analyze optical system models using traditional...

  2. Absolute instruments and perfect imaging in geometrical optics

    E-Print Network [OSTI]

    Tyc, Tomas

    Absolute instruments and perfect imaging in geometrical optics Tom´as Tyc, Lenka Herz symmetric absolute instruments that provide perfect imaging in the sense of geometrical optics. We derive to propose several new absolute instruments, in particular a lens providing a stigmatic image of an optically

  3. X-ray optics metrology limited by random noise, instrumental drifts, and systematic errors

    E-Print Network [OSTI]

    Yashchuk, Valeriy V.

    2010-01-01T23:59:59.000Z

    X-ray optics metrology limited by random noise, instrumentalUSA Center for X-ray Optics, Lawrence Berkeley Nationaland reflecting x-ray optics suitable for micro- and nano-

  4. Tomorrow optical interferometry: astrophysical prospects and instrumental issues

    E-Print Network [OSTI]

    F. Malbet

    2006-09-14T23:59:59.000Z

    Interferometry has brought many new constraints in optical astronomy in the recent years. A major leap in this field is the opening of large interferometric facilities like the Very Large Telescope Interferometer and the Keck Interferometer to the astronomical community. Planning for the future is both easy --most specialists know in which directions to develop interferometry-- and difficult because of the increasing complexity of the technique. I present a short status of interferometry today. Then I detail the possible astrophysical prospects. Finally I address some important instrumental issues that are decisive for the future of interferometry.

  5. Purpose. To evaluate the reliability and validity of a portable instrument for measuring macular pigment optical density.

    E-Print Network [OSTI]

    macular pigment optical density. Methods. The instrument is small, uses light emitting diodes as light

  6. accessories fluido air: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    has satisfaction and self... Boyles, Rheba Merle; Hard, Graham; Roberson, Nena; Eaton, Fannie Brown 1958-01-01 3 6035 Hg(Ar) Lamp in 6058 Fiber Optic Accessory. Pencil...

  7. SLAC All Access: Atomic, Molecular and Optical Science Instrument

    SciTech Connect (OSTI)

    Bozek, John

    2013-11-05T23:59:59.000Z

    John Bozek, a staff scientist at SLAC's Linac Coherent Light Source (LCLS) X-ray laser who manages the LCLS Soft X-ray Department, takes us behind the scenes at the Atomic, Molecular and Optical Science (AMO) instrument, the first of six experimental stations now operating at LCLS. Samples used in AMO experiments include atoms, molecules, clusters, and nanoscale objects such as protein crystals or viruses. Science performed at AMO includes fundamental studies of light-matter interactions in the extreme X-ray intensity of the LCLS pules, time-resolved studies of increasingly charged states of atoms and molecules, X-ray diffraction imaging of nanocrystals, and single-shot imaging of a variety of objects.

  8. SLAC All Access: Atomic, Molecular and Optical Science Instrument

    ScienceCinema (OSTI)

    Bozek, John

    2014-06-03T23:59:59.000Z

    John Bozek, a staff scientist at SLAC's Linac Coherent Light Source (LCLS) X-ray laser who manages the LCLS Soft X-ray Department, takes us behind the scenes at the Atomic, Molecular and Optical Science (AMO) instrument, the first of six experimental stations now operating at LCLS. Samples used in AMO experiments include atoms, molecules, clusters, and nanoscale objects such as protein crystals or viruses. Science performed at AMO includes fundamental studies of light-matter interactions in the extreme X-ray intensity of the LCLS pules, time-resolved studies of increasingly charged states of atoms and molecules, X-ray diffraction imaging of nanocrystals, and single-shot imaging of a variety of objects.

  9. Giga-bit optical data transmission module for Beam Instrumentation

    E-Print Network [OSTI]

    Roedne, L T; Cenkeramaddi, L R; Jiao, L

    Particle accelerators require electronic instrumentation for diagnostic, assessment and monitoring during operation of the transferring and circulating beams. A sensor located near the beam provides an electrical signal related to the observable quantity of interest. The front-end electronics provides analog-to-digital conversion of the quantity being observed and the generated data are to be transferred to the external digital back-end for data processing, and to display to the operators and logging. This research project investigates the feasibility of radiation-tolerant giga-bit data transmission over optic fibre for beam instrumentation applications, starting from the assessment of the state of the art technology, identification of challenges and proposal of a system level solution, which should be validated with a PCB design in an experimental setup. Radiation tolerance of 10 kGy (Si) Total Ionizing Dose (TID) over 10 years of operation, Bit Error Rate (BER) 10-6 or better. The findings and results of th...

  10. Optical Fiber High Temperature Sensor Instrumentation for Energy Intensive Industries

    SciTech Connect (OSTI)

    Cooper, Kristie L.; Wang, Anbo; Pickrell, Gary R.

    2006-11-14T23:59:59.000Z

    This report summarizes technical progress during the program “Optical Fiber High Temperature Sensor Instrumentation for Energy Intensive Industries”, performed by the Center for Photonics Technology of the Bradley Department of Electrical and Computer Engineering at Virginia Tech. The objective of this program was to use technology recently invented at Virginia Tech to develop and demonstrate the application of self-calibrating optical fiber temperature and pressure sensors to several key energy-intensive industries where conventional, commercially available sensors exhibit greatly abbreviated lifetimes due primarily to environmental degradation. A number of significant technologies were developed under this program, including • a laser bonded silica high temperature fiber sensor with a high temperature capability up to 700°C and a frequency response up to 150 kHz, • the world’s smallest fiber Fabry-Perot high temperature pressure sensor (125 x 20 ?m) with 700°C capability, • UV-induced intrinsic Fabry-Perot interferometric sensors for distributed measurement, • a single crystal sapphire fiber-based sensor with a temperature capability up to 1600°C. These technologies have been well demonstrated and laboratory tested. Our work plan included conducting major field tests of these technologies at EPRI, Corning, Pratt & Whitney, and Global Energy; field validation of the technology is critical to ensuring its usefulness to U.S. industries. Unfortunately, due to budget cuts, DOE was unable to follow through with its funding commitment to support Energy Efficiency Science Initiative projects and this final phase was eliminated.

  11. Accessories Around the Clock.

    E-Print Network [OSTI]

    Boyles, Rheba Merle; Hard, Graham; Roberson, Nena; Eaton, Fannie Brown

    1958-01-01T23:59:59.000Z

    . For this % smartly dressed persen selects accesrories in scale with her size. A large, hmvy-looking purse or hut does not kmpliment the small, dainty pars&. Tke tiny hat with dktinty trimming is net beccrming t~ a largp person. (See propottion.) k-p~oin, neutral... FOR LOOKING SMART ~ssories prove costly if they are good for Choose ucce y one or two wearings. You will choose re wisely if you heed these fashion hints: x~ensive accessories, such as hats, shoes handbags usually should be the same lot of irmffkfb...

  12. Optical Fiber Sensor Instrumentation for Slagging Coal Gasifiers

    SciTech Connect (OSTI)

    Anbo Wang; Kristie Cooper

    2008-07-19T23:59:59.000Z

    Coal gasifier is one of the most promising solutions for clean fossil energy. Refractory thickness monitoring and online real-time temperature measurement is needed for improved reliability and advanced process control for current and future generation power plants. The objective of this program is to design and implement an optical fiber based sensing system that could potentially be used to monitor refractory wall thickness and temperature inside a coal gasifier. For the thickness monitoring, the system should be able to operate at temperatures up to 1000 C. For this temperature range, silica fiber can still work so it is chosen for the sensor design. The measurement is based on a photon counting optical time domain reflectometer. A narrow light pulse is launched into a silica fiber which could be embedded into the gasifier refractory wall, and is partially reflected by the far end of the fiber. The time of flight of the light pulse in the fiber then gives an indication of the position of the fiber end, which is a function of the wall thickness when the fiber is embedded. Results obtained show a measurement accuracy of {+-}2cm in environment of 1000 C with a saw cut fiber end. When the fiber end is corroded by sodium carbide at 900 C, the accuracy is {+-}3cm. For the temperature measurement, a single crystal sapphire fiber sensor is designed. The sapphire fiber guides the broadband light from a light emitting diode to a sapphire wafer functioning as a Fabry-Perot interferometer and the wafer optical thickness is a function of temperature. The returned optical signal is then demodulated by multimode fiber based whitelight interferometry. The system was tested up to 1500 C with a measurement accuracy of {+-}10 C for the entire measurement range.

  13. Determination of accuracy of measurements by NREL`s Scanning Hartmann Optical Test instrument

    SciTech Connect (OSTI)

    Jorgensen, G.; Wendelin, T.; Carasso, M.

    1991-04-01T23:59:59.000Z

    NREL`s Scanning Hartmann Optical Test (SHOT) instrument is routinely used to characterize the surface of candidate dish concentration elements for solar thermal applications. An approach was devised to quantify the accuracy of these measurements. Excellent reproducibility was exhibited and high confidence established. The SHOT instrument was designed to allow the surface figure of large optical test articles to be accurately specified. Such test articles are nominally parabolic with an f/D ratio (in which f=focal length and D=aperture diameter) in the range of 0.5--1.0. Recent modifications of SHOT have extended the characterization range out to about f/D=3.0. A series of experiments was designed to investigate and quantify the uncertainties associated with optical characterization performed by SHOT. This approach involved making a series of measurements with an arbitrary test article positioned at a number of locations transverse to the optical axis of SHOT. 3 refs.

  14. Determination of accuracy of measurements by NREL's Scanning Hartmann Optical Test instrument

    SciTech Connect (OSTI)

    Jorgensen, G.; Wendelin, T.; Carasso, M.

    1991-04-01T23:59:59.000Z

    NREL's Scanning Hartmann Optical Test (SHOT) instrument is routinely used to characterize the surface of candidate dish concentration elements for solar thermal applications. An approach was devised to quantify the accuracy of these measurements. Excellent reproducibility was exhibited and high confidence established. The SHOT instrument was designed to allow the surface figure of large optical test articles to be accurately specified. Such test articles are nominally parabolic with an f/D ratio (in which f=focal length and D=aperture diameter) in the range of 0.5--1.0. Recent modifications of SHOT have extended the characterization range out to about f/D=3.0. A series of experiments was designed to investigate and quantify the uncertainties associated with optical characterization performed by SHOT. This approach involved making a series of measurements with an arbitrary test article positioned at a number of locations transverse to the optical axis of SHOT. 3 refs.

  15. Invited Article: An integrated mid-infrared, far-infrared, and terahertz optical Hall effect instrument

    SciTech Connect (OSTI)

    Kühne, P., E-mail: kuehne@huskers.unl.edu; Schubert, M., E-mail: schubert@engr.unl.edu; Hofmann, T., E-mail: thofmann@engr.unl.edu [Department of Electrical Engineering and Center for Nanohybrid Functional Materials, University of Nebraska-Lincoln, Lincoln, Nebraska 68588 (United States); Herzinger, C. M., E-mail: cherzinger@jawoollam.com; Woollam, J. A., E-mail: jwoollam@jawoollam.com [J. A. Woollam Co., Inc., 645 M Street, Suite 102, Lincoln, Nebraska 68508-2243 (United States)

    2014-07-15T23:59:59.000Z

    We report on the development of the first integrated mid-infrared, far-infrared, and terahertz optical Hall effect instrument, covering an ultra wide spectral range from 3 cm{sup ?1} to 7000 cm{sup ?1} (0.1–210 THz or 0.4–870 meV). The instrument comprises four sub-systems, where the magneto-cryostat-transfer sub-system enables the usage of the magneto-cryostat sub-system with the mid-infrared ellipsometer sub-system, and the far-infrared/terahertz ellipsometer sub-system. Both ellipsometer sub-systems can be used as variable angle-of-incidence spectroscopic ellipsometers in reflection or transmission mode, and are equipped with multiple light sources and detectors. The ellipsometer sub-systems are operated in polarizer-sample-rotating-analyzer configuration granting access to the upper left 3 × 3 block of the normalized 4 × 4 Mueller matrix. The closed cycle magneto-cryostat sub-system provides sample temperatures between room temperature and 1.4 K and magnetic fields up to 8 T, enabling the detection of transverse and longitudinal magnetic field-induced birefringence. We discuss theoretical background and practical realization of the integrated mid-infrared, far-infrared, and terahertz optical Hall effect instrument, as well as acquisition of optical Hall effect data and the corresponding model analysis procedures. Exemplarily, epitaxial graphene grown on 6H-SiC, a tellurium doped bulk GaAs sample and an AlGaN/GaN high electron mobility transistor structure are investigated. The selected experimental datasets display the full spectral, magnetic field and temperature range of the instrument and demonstrate data analysis strategies. Effects from free charge carriers in two dimensional confinement and in a volume material, as well as quantum mechanical effects (inter-Landau-level transitions) are observed and discussed exemplarily.

  16. Cheap catalyst gets expensive accessory | EMSL

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    accessory Released: October 17, 2014 Together, iron and palladium help remove oxygen for biofuel reaction The October 2014 cover of ACS Catalysis illustrates a...

  17. Advanced Accessory Power Supply Topologies

    SciTech Connect (OSTI)

    Marlino, L.D.

    2010-06-15T23:59:59.000Z

    This Cooperative Research and Development Agreement (CRADA) began December 8, 2000 and ended September 30, 2009. The total funding provided by the Participant (General Motors Advanced Technology Vehicles [GM]) during the course of the CRADA totaled $1.2M enabling the Contractor (UT-Battelle, LLC [Oak Ridge National Laboratory, a.k.a. ORNL]) to contribute significantly to the joint project. The initial task was to work with GM on the feasibility of developing their conceptual approach of modifying major components of the existing traction inverter/drive to develop low cost, robust, accessory power. Two alternate methods for implementation were suggested by ORNL and both were proven successful through simulations and then extensive testing of prototypes designed and fabricated during the project. This validated the GM overall concept. Moreover, three joint U.S. patents were issued and subsequently licensed by GM. After successfully fulfilling the initial objective, the direction and duration of the CRADA was modified and GM provided funding for two additional tasks. The first new task was to provide the basic development for implementing a cascaded inverter technology into hybrid vehicles (including plug-in hybrid, fuel cell, and electric). The second new task was to continue the basic development for implementing inverter and converter topologies and new technology assessments for hybrid vehicle applications. Additionally, this task was to address the use of high temperature components in drive systems. Under this CRADA, ORNL conducted further research based on GM’s idea of using the motor magnetic core and windings to produce bidirectional accessory power supply that is nongalvanically coupled to the terminals of the high voltage dc-link battery of hybrid vehicles. In order not to interfere with the motor’s torque, ORNL suggested to use the zero-sequence, highfrequency harmonics carried by the main fundamental motor current for producing the accessory power. Two studies were conducted at ORNL. One was to put an additional winding in the motor slots to magnetically link with the high frequency of the controllable zero-sequence stator currents that do not produce any zero-sequence harmonic torques. The second approach was to utilize the corners of the square stator punching for the high-frequency transformers of the dc/dc inverter. Both approaches were successful. This CRADA validated the feasibility of GM’s desire to use the motor’s magnetic core and windings to produce bidirectional accessory power supply. Three joint U.S. patents with GM were issued to ORNL and GM by the U.S. Patent Office for the research results produced by this CRADA.

  18. REVIEW OF SCIENTIFIC INSTRUMENTS 83, 033109 (2012) Thermal effects in the Input Optics of the Enhanced Laser Interferometer

    E-Print Network [OSTI]

    Tanner, David B.

    proportional to the GW strain and the input power. The Fabry-Perot cavi- ties in the Michelson arms and a powerREVIEW OF SCIENTIFIC INSTRUMENTS 83, 033109 (2012) Thermal effects in the Input Optics run of the LIGO interferometers. The Initial LIGO Input Optics experienced thermal side effects when

  19. Optical instrument for measurement of vaginal coating thickness by drug delivery formulations

    SciTech Connect (OSTI)

    Henderson, Marcus H.; Peters, Jennifer J.; Walmer, David K.; Couchman, Grace M.; Katz, David F. [Department of Biomedical Engineering, Duke University, Durham, North Carolina 27708 (United States); Department of Obstetrics and Gynecology, Duke University, Durham, North Carolina 27710 (United States); Department of Biomedical Engineering, Duke University, Durham, North Carolina 27708 and Department of Obstetrics and Gynecology, Duke University, Durham, North Carolina 27710 (United States)

    2005-03-01T23:59:59.000Z

    An optical device has been developed for imaging the human vaginal epithelial surfaces, and quantitatively measuring distributions of coating thickness of drug delivery formulations - such as gels - applied for prophylaxis, contraception or therapy. The device consists of a rigid endoscope contained within a 27-mm-diam hollow, polished-transparent polycarbonate tube (150 mm long) with a hemispherical cap. Illumination is from a xenon arc. The device is inserted into, and remains stationary within the vagina. A custom gearing mechanism moves the endoscope relative to the tube, so that it views epithelial surfaces immediately apposing its outer surface (i.e., 150 mm long by 360 deg. azimuthal angle). Thus, with the tube fixed relative to the vagina, the endoscope sites local regions at distinct and measurable locations that span the vaginal epithelium. The returning light path is split between a video camera and photomultiplier. Excitation and emission filters in the light path enable measurement of fluorescence of the sited region. Thus, the instrument captures video images simultaneously with photometric measurement of fluorescence of each video field [{approx}10 mm diameter; formulations are labeled with 0.1% w/w United States Pharmacoepia (USP) injectable sodium fluorescein]. Position, time and fluorescence measurements are continuously displayed (on video) and recorded (to a computer database). The photomultiplier output is digitized to quantify fluorescence of the endoscope field of view. Quantification of the thickness of formulation coating of a surface sited by the device is achieved due to the linear relationship between thickness and fluorescence intensity for biologically relevant thin layers (of the order of 0.5 mm). Summary measures of coating have been developed, focusing upon extent, location and uniformity. The device has begun to be applied in human studies of model formulations for prophylaxis against infection with HIV and other sexually transmitted pathogens.

  20. Electronic Position Sensor for Power Operated Accessory

    DOE Patents [OSTI]

    Haag, Ronald H.; Chia, Michael I.

    2005-05-31T23:59:59.000Z

    An electronic position sensor for use with a power operated vehicle accessory, such as a power liftgate. The position sensor includes an elongated resistive circuit that is mounted such that it is stationary and extends along the path of a track portion of the power operated accessory. The position sensor further includes a contact nub mounted to a link member that moves within the track portion such that the contact nub is slidingly biased against the elongated circuit. As the link member moves under the force of a motor-driven output gear, the contact nub slides along the surface of the resistive circuit, thereby affecting the overall resistance of the circuit. The position sensor uses the overall resistance to provide an electronic position signal to an ECU, wherein the signal is indicative of the absolute position of the power operated accessory. Accordingly, the electronic position sensor is capable of providing an electronic signal that enables the ECU to track the absolute position of the power operated accessory.

  1. aexs instrument development: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    interferometer Ohta, Shigemi 2 Development of Models for Optical Instrument Transformers. Open Access Theses and Dissertations Summary: ??Optical Instrument Transformers...

  2. Development of Advanced Optics and High Resolution Instrumentation for Mass Spectrometry Based Proteomics

    E-Print Network [OSTI]

    Sherrod, Stacy D.

    2010-01-14T23:59:59.000Z

    ) improving the analytical figures of merit (i.e., spatial resolution, analysis time) by implementing a spatially dynamic optical system, and (3) increasing both mass spectral resolution and ion detection sensitivity by modifying a commercial time...

  3. Construction of force measuring optical tweezers instrumentation and investigations of biophysical properties of bacterial adhesion organelles

    E-Print Network [OSTI]

    Andersson, Magnus

    2015-01-01T23:59:59.000Z

    Optical tweezers are a technique in which microscopic-sized particles, including living cells and bacteria, can be non-intrusively trapped with high accuracy solely using focused light. The technique has therefore become a powerful tool in the field of biophysics. Optical tweezers thereby provide outstanding manipulation possibilities of cells as well as semi-transparent materials, both non-invasively and non-destructively, in biological systems. In addition, optical tweezers can measure minute forces (< 10-12 N), probe molecular interactions and their energy landscapes, and apply both static and dynamic forces in biological systems in a controlled manner. The assessment of intermolecular forces with force measuring optical tweezers, and thereby the biomechanical structure of biological objects, has therefore considerably facilitated our understanding of interactions and structures of biological systems. Adhesive bacterial organelles, so called pili, mediate adhesion to host cells and are therefore crucial...

  4. accessory sex glands: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AUTOMOTIVE ACCESSORIES: RETHINKING DESIGN MATERIALS THROUGH CORNSTARCH, SUGARCANE AND HEMP CiteSeer Summary: Current bioproducts or bio-based products do not only require less...

  5. accessory palmaris longus: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AUTOMOTIVE ACCESSORIES: RETHINKING DESIGN MATERIALS THROUGH CORNSTARCH, SUGARCANE AND HEMP CiteSeer Summary: Current bioproducts or bio-based products do not only require less...

  6. accessory nerve: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AUTOMOTIVE ACCESSORIES: RETHINKING DESIGN MATERIALS THROUGH CORNSTARCH, SUGARCANE AND HEMP CiteSeer Summary: Current bioproducts or bio-based products do not only require less...

  7. accessory drive device: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AUTOMOTIVE ACCESSORIES: RETHINKING DESIGN MATERIALS THROUGH CORNSTARCH, SUGARCANE AND HEMP CiteSeer Summary: Current bioproducts or bio-based products do not only require less...

  8. accessory sex organs: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AUTOMOTIVE ACCESSORIES: RETHINKING DESIGN MATERIALS THROUGH CORNSTARCH, SUGARCANE AND HEMP CiteSeer Summary: Current bioproducts or bio-based products do not only require less...

  9. accessory parotid gland: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AUTOMOTIVE ACCESSORIES: RETHINKING DESIGN MATERIALS THROUGH CORNSTARCH, SUGARCANE AND HEMP CiteSeer Summary: Current bioproducts or bio-based products do not only require less...

  10. accessory papillary muscle: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AUTOMOTIVE ACCESSORIES: RETHINKING DESIGN MATERIALS THROUGH CORNSTARCH, SUGARCANE AND HEMP CiteSeer Summary: Current bioproducts or bio-based products do not only require less...

  11. accessory gland size: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AUTOMOTIVE ACCESSORIES: RETHINKING DESIGN MATERIALS THROUGH CORNSTARCH, SUGARCANE AND HEMP CiteSeer Summary: Current bioproducts or bio-based products do not only require less...

  12. accessory sex gland: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AUTOMOTIVE ACCESSORIES: RETHINKING DESIGN MATERIALS THROUGH CORNSTARCH, SUGARCANE AND HEMP CiteSeer Summary: Current bioproducts or bio-based products do not only require less...

  13. accessory proteins vpr: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AUTOMOTIVE ACCESSORIES: RETHINKING DESIGN MATERIALS THROUGH CORNSTARCH, SUGARCANE AND HEMP CiteSeer Summary: Current bioproducts or bio-based products do not only require less...

  14. accessory spleen findings: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AUTOMOTIVE ACCESSORIES: RETHINKING DESIGN MATERIALS THROUGH CORNSTARCH, SUGARCANE AND HEMP CiteSeer Summary: Current bioproducts or bio-based products do not only require less...

  15. accessory nerve results: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AUTOMOTIVE ACCESSORIES: RETHINKING DESIGN MATERIALS THROUGH CORNSTARCH, SUGARCANE AND HEMP CiteSeer Summary: Current bioproducts or bio-based products do not only require less...

  16. accessory ridges mxpar: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AUTOMOTIVE ACCESSORIES: RETHINKING DESIGN MATERIALS THROUGH CORNSTARCH, SUGARCANE AND HEMP CiteSeer Summary: Current bioproducts or bio-based products do not only require less...

  17. accessory middle cerebral: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AUTOMOTIVE ACCESSORIES: RETHINKING DESIGN MATERIALS THROUGH CORNSTARCH, SUGARCANE AND HEMP CiteSeer Summary: Current bioproducts or bio-based products do not only require less...

  18. accessory mineral growth: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AUTOMOTIVE ACCESSORIES: RETHINKING DESIGN MATERIALS THROUGH CORNSTARCH, SUGARCANE AND HEMP CiteSeer Summary: Current bioproducts or bio-based products do not only require less...

  19. accessory subunit ac45: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AUTOMOTIVE ACCESSORIES: RETHINKING DESIGN MATERIALS THROUGH CORNSTARCH, SUGARCANE AND HEMP CiteSeer Summary: Current bioproducts or bio-based products do not only require less...

  20. accessory cell requirements: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AUTOMOTIVE ACCESSORIES: RETHINKING DESIGN MATERIALS THROUGH CORNSTARCH, SUGARCANE AND HEMP CiteSeer Summary: Current bioproducts or bio-based products do not only require less...

  1. accessory subunit kchip2: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AUTOMOTIVE ACCESSORIES: RETHINKING DESIGN MATERIALS THROUGH CORNSTARCH, SUGARCANE AND HEMP CiteSeer Summary: Current bioproducts or bio-based products do not only require less...

  2. accessory minerals zirconolite: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AUTOMOTIVE ACCESSORIES: RETHINKING DESIGN MATERIALS THROUGH CORNSTARCH, SUGARCANE AND HEMP CiteSeer Summary: Current bioproducts or bio-based products do not only require less...

  3. accessory navicular bone: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AUTOMOTIVE ACCESSORIES: RETHINKING DESIGN MATERIALS THROUGH CORNSTARCH, SUGARCANE AND HEMP CiteSeer Summary: Current bioproducts or bio-based products do not only require less...

  4. accessorial services: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AUTOMOTIVE ACCESSORIES: RETHINKING DESIGN MATERIALS THROUGH CORNSTARCH, SUGARCANE AND HEMP CiteSeer Summary: Current bioproducts or bio-based products do not only require less...

  5. accessory gland proteins: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AUTOMOTIVE ACCESSORIES: RETHINKING DESIGN MATERIALS THROUGH CORNSTARCH, SUGARCANE AND HEMP CiteSeer Summary: Current bioproducts or bio-based products do not only require less...

  6. automotive accessories: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AUTOMOTIVE ACCESSORIES: RETHINKING DESIGN MATERIALS THROUGH CORNSTARCH, SUGARCANE AND HEMP CiteSeer Summary: Current bioproducts or bio-based products do not only require less...

  7. accessory mental foramen: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AUTOMOTIVE ACCESSORIES: RETHINKING DESIGN MATERIALS THROUGH CORNSTARCH, SUGARCANE AND HEMP CiteSeer Summary: Current bioproducts or bio-based products do not only require less...

  8. accessory spleen mimicking: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AUTOMOTIVE ACCESSORIES: RETHINKING DESIGN MATERIALS THROUGH CORNSTARCH, SUGARCANE AND HEMP CiteSeer Summary: Current bioproducts or bio-based products do not only require less...

  9. accessory spleen compromising: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AUTOMOTIVE ACCESSORIES: RETHINKING DESIGN MATERIALS THROUGH CORNSTARCH, SUGARCANE AND HEMP CiteSeer Summary: Current bioproducts or bio-based products do not only require less...

  10. accessory protein mrap: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AUTOMOTIVE ACCESSORIES: RETHINKING DESIGN MATERIALS THROUGH CORNSTARCH, SUGARCANE AND HEMP CiteSeer Summary: Current bioproducts or bio-based products do not only require less...

  11. accessory conduction pathways: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AUTOMOTIVE ACCESSORIES: RETHINKING DESIGN MATERIALS THROUGH CORNSTARCH, SUGARCANE AND HEMP CiteSeer Summary: Current bioproducts or bio-based products do not only require less...

  12. accessory pathways evaluation: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AUTOMOTIVE ACCESSORIES: RETHINKING DESIGN MATERIALS THROUGH CORNSTARCH, SUGARCANE AND HEMP CiteSeer Summary: Current bioproducts or bio-based products do not only require less...

  13. accessory conduction pathway: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AUTOMOTIVE ACCESSORIES: RETHINKING DESIGN MATERIALS THROUGH CORNSTARCH, SUGARCANE AND HEMP CiteSeer Summary: Current bioproducts or bio-based products do not only require less...

  14. accessory gland protein: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AUTOMOTIVE ACCESSORIES: RETHINKING DESIGN MATERIALS THROUGH CORNSTARCH, SUGARCANE AND HEMP CiteSeer Summary: Current bioproducts or bio-based products do not only require less...

  15. accessory anterolateral talar: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AUTOMOTIVE ACCESSORIES: RETHINKING DESIGN MATERIALS THROUGH CORNSTARCH, SUGARCANE AND HEMP CiteSeer Summary: Current bioproducts or bio-based products do not only require less...

  16. accessory pudendal arteries: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AUTOMOTIVE ACCESSORIES: RETHINKING DESIGN MATERIALS THROUGH CORNSTARCH, SUGARCANE AND HEMP CiteSeer Summary: Current bioproducts or bio-based products do not only require less...

  17. accessory soleus muscle: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AUTOMOTIVE ACCESSORIES: RETHINKING DESIGN MATERIALS THROUGH CORNSTARCH, SUGARCANE AND HEMP CiteSeer Summary: Current bioproducts or bio-based products do not only require less...

  18. Encoding Pheromonal Signals in the Accessory Olfactory Bulb of

    E-Print Network [OSTI]

    Fee, Michale S.

    Encoding Pheromonal Signals in the Accessory Olfactory Bulb of Behaving Mice Minmin Luo,1 * Michale single neurons in the accessory olfactory bulb, a nucleusthatprocessespheromonalsignals with sources of pheromones (4, 5). Olfactory receptor neurons project to the main olfactory bulb (MOB), whose

  19. Comparative genomics of the core and accessory genomes of 48 Sinorhizobium strains comprising five genospecies

    E-Print Network [OSTI]

    2013-01-01T23:59:59.000Z

    annotation and comparative genomics. Database (Oxford) 2009,et al. : Comparative genomics of the core and accessoryComparative genomics of the core and accessory genomes of 48

  20. What next for accessory dwellings? : getting from bylaws to buildings

    E-Print Network [OSTI]

    Stege, Elinor Hope

    2009-01-01T23:59:59.000Z

    Accessory dwellings-secondary, self-contained housing units on the same property as a primary residence, either attached to or detached from the main dwelling, and subordinate in size, location and appearance-are recognized ...

  1. Wide-angle imaging LIDAR (WAIL): a ground-based instrument for monitoring the thickness and density of optically thick clouds.

    SciTech Connect (OSTI)

    Love, Steven P.; Davis, A. B. (Anthony B.); Rohde, C. A. (Charles A.); Ho, Cheng,

    2001-01-01T23:59:59.000Z

    Traditional lidar provides little information on dense clouds beyond the range to their base (ceilometry), due to their extreme opacity. At most optical wavelengths, however, laser photons are not absorbed but merely scattered out of the beam, and thus eventually escape the cloud via multiple scattering, producing distinctive extended space- and time-dependent patterns which are, in essence, the cloud's radiative Green functions. These Green functions, essentially 'movies' of the time evolution of the spatial distribution of escaping light, are the primary data products of a new type of lidar: Wide Angle Imaging Lidar (WAIL). WAIL data can be used to infer both optical depth and physical thickness of clouds, and hence the cloud liquid water content. The instrumental challenge is to accommodate a radiance field varying over many orders of magnitude and changing over widely varying time-scales. Our implementation uses a high-speed microchannel plate/crossed delay line imaging detector system with a 60-degree full-angle field of view, and a 532 nm doubled Nd:YAG laser. Nighttime field experiments testing various solutions to this problem show excellent agreement with diffusion theory, and retrievals yield plausible values for the optical and geometrical parameters of the observed cloud decks.

  2. Correlation lifetimes of quiet and magnetic granulation from the SOUP (Solar Optical Universal Polarimeter) instrument on Spacelab 2

    SciTech Connect (OSTI)

    Title, A.; Tarbell, T.; Topka, K.; Acton, L.; Duncan, D.

    1988-10-01T23:59:59.000Z

    The flight of the Solar Optical Universal Polarimeter (SOUP) on Spacelab 2 allowed the collection of time sequences of diffraction-limited (0.5 arc second) granulation images with excellent pointing (0.003 arc second jitter RMS) and freedom from the distortion that plagues ground-based images. The solar 5 minute oscillations are clearly seen in the data. Using Fourier transforms in the temporal and spatial domain, the authors show that these dominate the autocorrelation lifetime in magnetic regions. When the oscillations are removed the autocorrelation lifetime is found to be 410 and 890 seconds, respectively, in quiet and magnetic regions. In quiet areas exploding granules are common. It is hard to find that neither explodes nor is unaffected by a nearby explosion. A significant fraction of granule lifetimes are terminated by nearby explosions. Local correlation-tracking techniques are used to measure horizontal displacements, and thus transverse velocities, in the intensity field. In the quiet sun it is possible to detect both super- and mesogranulation. Horizontal velocities are as great as 1000 m/s quiet sun, and the average velocity is 400 m/s. In magnetic regions, horizontal velocities are much less, about 200 m/s. These flows effect the measured lifetime. A lower limit to the lifetime in quiet and magnetic sun is estimated to be 440 and 950 seconds respectively.

  3. Optical diagnostic instrument for monitoring etch uniformity during plasma etching of polysilicon in a chlorine-helium plasma

    SciTech Connect (OSTI)

    Hareland, W.A.; Buss, R.J.

    1993-06-01T23:59:59.000Z

    Nonuniform etching is a serious problem in plasma processing of semiconductor materials and has important consequences in the quality and yield of microelectronic components. In many plasmas, etching occurs at a faster rate near the periphery of the wafer, resulting in nonuniform removal of specific materials over the wafer surface. This research was to investigate in situ optical diagnostic techniques for monitoring etch uniformity during plasma processing of microelectronic components. We measured 2-D images of atomic chlorine at 726 nm in a chlorine-helium plasma during plasma etching of polysilicon in a parallel-plate plasma etching reactor. The 3-D distribution of atomic chlorine was determined by Abel inversion of the plasma image. The experimental results showed that the chlorine atomic emission intensity is at a maximum near the outer radius of the plasma and decreases toward the center. Likewise, the actual etch rate, as determined by profilometry on the processed wafer, was approximately 20% greater near the edge of the wafer than at its center. There was a direct correlation between the atomic chlorine emission intensity and the etch rate of polysilicon over the wafer surface. Based on these analyses, 3-D imaging would be a useful diagnostic technique for in situ monitoring of etch uniformity on wafers.

  4. Exertion instruments

    E-Print Network [OSTI]

    Vawter, Noah (Noah Theodore)

    2011-01-01T23:59:59.000Z

    This dissertation describes the research, development and reasoning behind a family of musical instruments called Exertion Instruments. They use inline electrical generators to run a synthesizer and an amplifier while ...

  5. Positive Selection on Nucleotide Substitutions and Indels in Accessory Gland Proteins of the Drosophila pseudoobscura Subgroup

    E-Print Network [OSTI]

    Hellberg, Michael E.

    Positive Selection on Nucleotide Substitutions and Indels in Accessory Gland Proteins due to positive selection on nucleotide substitutions. While this general pattern is well established little explored, nor have possible targets of positive selection other than nucleotide substitutions

  6. A study of the incidence and histology of accessory corpora lutea in swine

    E-Print Network [OSTI]

    Schultz, Lewis Russell

    1969-01-01T23:59:59.000Z

    A STUDY OF THE INCIDENCE AND HISTOLOGY OF ACCESSORY CORPORA LUTEA IN SWINE A Thesis by LEWIS R. SCHULTZ Submitted to the Graduate College of Texas A&M University in partial fulfillment of the requirement for the degree of MASTER OF SCIENCE... May 1969 Major Subject: Physiology of Reproduction A STUDY OF THE INCIDENCE AND HISTOLOGY OF ACCESSORY CORPORA LUTEA IN SWINE A Thesis by LEWIS R. SCHULTZ Approved as to style and content by: (Chairman of Committee) (Head of Department) (M...

  7. TMT Science and Instruments

    E-Print Network [OSTI]

    David Crampton; Luc Simard; David Silva

    2008-01-23T23:59:59.000Z

    To meet the scientific goals of the Thirty Meter Telescope Project, full diffraction-limited performance is required from the outset and hence the entire observatory is being designed, as a system, to achieve this. The preliminary design phases of the telescope and the first light adaptive optic facility are now approaching completion so that much better predictions of the system performance are possible. The telescope design and instrumentation are summarized in this presentation, with a brief description of some of the scientific programs that are foreseen.

  8. ARM - Instruments

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645U.S. DOE Office of ScienceandMesa- PolarizationgovCampaignsSummer SinglegovInstrumentsvceilgovInstrumentsAirborne

  9. ARM - Instruments

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625govInstrumentstdmadap Documentation TDMADAP : XDC documentation ARMgovInstrumentswsiInstruments Related Links RHUBC

  10. ARM - Instruments

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOnItem NotEnergy,ARMForms About Become a User Recovery Act MissiongovInstruments

  11. EST analysis of male accessory glands from Heliconius butterflies with divergent mating systems

    E-Print Network [OSTI]

    Walters, James R.; Harrison, Richard G.

    2008-12-08T23:59:59.000Z

    proteins observed in the male accessory gland cDNA libraries. Dots (.) indicate identity between sequences; tildes (~) represent alignment gaps; Hme00007 MNKILILLVVILGAMCLVEAEHDSNLDSKRAAGCPPGQEEYYGMCYGTRKSESGRRDQSGGLNNNNRRSQ Her00048 .KN..N..L..MA...I.A.....YYPS.N.RQ.P.........N.R...S.QG.I.ELG..R~~HHIG...E Hme00007 NEGLNNNNRRSQWEGLNNNNRRSQREGLNNNNRRSQSRELNNNNRRSQSGELNNNNRRSQREGLNNNNRR Her00048 .S* Hme00007...

  12. 6035 Hg(Ar) Lamp in 6058 Fiber Optic Accessory. Pencil Style Calibration Lamps

    E-Print Network [OSTI]

    Woodall, Jerry M.

    to that of the Hg(Ar) Lamp, which is the characteristic mercury line spectrum. Forced air-cooling (i.e. from of the handle for connection to the power supply. Table 1 Usable Wavelengths of Spectral Calibration Lamps (in.2 1079.8 1084.5 1114.3 Power Supplies; AC versus DC We offer different power supplies for different needs

  13. A New Integrated Onboard Charger and Accessory Power Converter for Plug-in Electric Vehicles

    SciTech Connect (OSTI)

    Su, Gui-Jia [ORNL; Tang, Lixin [ORNL

    2014-01-01T23:59:59.000Z

    In this paper, a new approach is presented for integrating the function of onboard battery charging into the traction drive system and accessory dc-dc converter of a plug-in electric vehicle (PEV). The idea is to utilize the segmented traction drive system of a PEV as the frond converter of the charging circuit and the transformer and high voltage converter of the 14 V accessory dc-dc converter to form a galvanically isolated onboard charger. Moreover, a control method is presented for suppressing the battery current ripple component of twice the grid frequency with the reduced dc bus capacitor in the segmented inverter. The resultant integrated charger has lower cost, weight, and volume than a standalone charger due to a substantially reduced component count. The proposed integrated charger topology was verified by modeling and experimental results on a 5.8 kW charger prototype.

  14. Hybrid vehicle powertrain system with power take-off driven vehicle accessory

    DOE Patents [OSTI]

    Beaty, Kevin D.; Bockelmann, Thomas R.; Zou, Zhanijang; Hope, Mark E.; Kang, Xiaosong; Carpenter, Jeffrey L.

    2006-09-12T23:59:59.000Z

    A hybrid vehicle powertrain system includes a first prime mover, a first prime mover driven power transmission mechanism having a power take-off adapted to drive a vehicle accessory, and a second prime mover. The second prime mover is operable to drive the power transmission mechanism alone or in combination with the first prime mover to provide power to the power take-off through the power transmission mechanism. The invention further includes methods for operating a hybrid vehicle powertrain system.

  15. Low activated incore instrument

    DOE Patents [OSTI]

    Ekeroth, Douglas E. (Delmont, PA)

    1994-01-01T23:59:59.000Z

    Instrumentation for nuclear reactor head-mounted incore instrumentation systems fabricated of low nuclear cross section materials (i.e., zirconium or titanium). The instrumentation emits less radiation than that fabricated of conventional materials.

  16. Low activated incore instrument

    DOE Patents [OSTI]

    Ekeroth, D.E.

    1994-04-19T23:59:59.000Z

    Instrumentation is described for nuclear reactor head-mounted incore instrumentation systems fabricated of low nuclear cross section materials (i.e., zirconium or titanium). The instrumentation emits less radiation than that fabricated of conventional materials. 9 figures.

  17. Evaluating musical instruments

    SciTech Connect (OSTI)

    Campbell, D. Murray

    2014-04-01T23:59:59.000Z

    Scientific measurements of sound generation and radiation by musical instruments are surprisingly hard to correlate with the subtle and complex judgments of instrumental quality made by expert musicians.

  18. Candidate Selection Instrument

    Broader source: Energy.gov [DOE]

    The candidate selection instrument is designed to take the guesswork out of selecting candidates for the various career development programs of interest. The instrument is straightforward and...

  19. Career Map: Instrumentation Coordinator

    Broader source: Energy.gov [DOE]

    The Wind Program's Career Map provides job description information for Instrumentation Coordinator positions.

  20. Piping inspection instrument carriage

    SciTech Connect (OSTI)

    Zollinger, W.T.; Treanor, R.C.

    1993-09-20T23:59:59.000Z

    This invention is comprised of a pipe inspection instrument carriage for use with a pipe crawler or other locomotion means for performing internal inspections of piping surfaces. The carriage has a front leg assembly, a rear leg assembly and a central support connecting the two assemblies and for mounting an instrument arm having inspection instruments. The instrument arm has means mounted distally thereon for axially aligning the inspection instrumentation and means for extending the inspection instruments radially outward to operably position the inspection instruments on the piping interior. Also, the carriage has means for rotating the central support and the front leg assembly with respect to the rear leg assembly so that the inspection instruments azimuthally scan the piping interior. The instrument carriage allows performance of all piping inspection operations with a minimum of moving parts, thus decreasing the likelihood of performance failure.

  1. Examination of an Optical Transmittance Test for Photovoltaic Encapsulation Materials (Presentation)

    SciTech Connect (OSTI)

    Miller, D.; Bengoechea, J.; Bokria, J.; Kohl, M.; Powell, N. E.; Smith, M. E.; White, M. D.; Wilson, H. R.; Wohlgemuth, J. H.

    2013-09-01T23:59:59.000Z

    The optical transmittance of encapsulation materials is a key characteristic for their use in photovoltaic (PV) modules. Changes in transmittance with time in the field affect module performance, which may impact product warranties. Transmittance is important in product development, module manufacturing, and field power production (both immediate and long-term). Therefore, an international standard (IEC 62788-1-4) has recently been proposed by the Encapsulation Task-Group within the Working Group 2 (WG2) of the International Electrotechnical Commission (IEC) Technical Committee 82 (TC82) for the quantification of the optical performance of PV encapsulation materials. Existing standards, such as ASTM E903, are general and more appropriately applied to concentrated solar power than to PV. Starting from the optical transmittance measurement, the solar-weighted transmittance of photon irradiance, yellowness index (which may be used in aging studies to assess durability), and ultraviolet (UV) cut-off wavelength may all be determined using the proposed standard. The details of the proposed test are described. The results of a round-robin experiment (for five materials) conducted at seven laboratories to validate the test procedure using representative materials are also presented. For example, the Encapsulation Group actively explored the measurement requirements (wavelength range and resolution), the requirements for the spectrophotometer (including the integrating sphere and instrument accessories, such as a depolarizer), specimen requirements (choice of glass-superstrate and -substrate), and data analysis (relative to the light that may be used in the PV application). The round-robin experiment identified both intra- and inter-laboratory instrument precision and bias for five encapsulation materials (encompassing a range of transmittance and haze-formation characteristics).

  2. Examination of an Optical Transmittance Test for Photovoltaic Encapsulation Materials: Preprint

    SciTech Connect (OSTI)

    Miller, D. C.; Bengoechea, J.; Bokria, J. G.; Kohl, M.; Powell, N. E.; Smith, M. E.; White, M. D.; Wilson, H. R.; Wohlgemuth, J. H.

    2013-09-01T23:59:59.000Z

    The optical transmittance of encapsulation materials is a key characteristic for their use in photovoltaic (PV) modules. Changes in transmittance with time in the field affect module performance, which may impact product warranties. Transmittance is important in product development, module manufacturing, and field power production (both immediate and long-term). Therefore, an international standard (IEC 62788-1-4) has recently been proposed by the Encapsulation Task-Group within the Working Group 2 (WG2) of the International Electrotechnical Commission (IEC) Technical Committee 82 (TC82) for the quantification of the optical performance of PV encapsulation materials. Existing standards, such as ASTM E903, are general and more appropriately applied to concentrated solar power than to PV. Starting from the optical transmittance measurement, the solar-weighted transmittance of photon irradiance, yellowness index (which may be used in aging studies to assess durability), and ultraviolet (UV) cut-off wavelength may all be determined using the proposed standard. The details of the proposed test are described. The results of a round-robin experiment (for five materials) conducted at seven laboratories to validate the test procedure using representative materials are also presented. For example, the Encapsulation Group actively explored the measurement requirements (wavelength range and resolution), the requirements for the spectrophotometer (including the integrating sphere and instrument accessories, such as a depolarizer), specimen requirements (choice of glass-superstrate and -substrate), and data analysis (relative to the light that may be used in the PV application). The round-robin experiment identified both intra- and inter-laboratory instrument precision and bias for five encapsulation materials (encompassing a range of transmittance and haze-formation characteristics).

  3. Binding-induced Stabilization and Assembly of the Phage P22 Tail Accessory Factor gp4

    SciTech Connect (OSTI)

    Olia,A.; Al-Bassam, J.; Winn-Stapley, D.; Joss, L.; Casjens, S.; Cingolani, G.

    2006-01-01T23:59:59.000Z

    To infect and replicate, bacteriophage P22 injects its 43 kbp genome across the cell wall of Salmonella enterica serovar Typhimurium. The attachment of phage P22 to the host cell as well as the injection of the viral DNA into the host is mediated by the virion's tail complex. This 2.8 MDa molecular machine is formed by five proteins, which include the portal protein gp1, the adhesion tailspike protein gp9, and three tail accessory factors: gp4, gp10, gp26. We have isolated the tail accessory factor gp4 and characterized its structure and binding interactions with portal protein. Interestingly, gp4 exists in solution as a monomer, which displays an exceedingly low structural stability (T{sub m} 34 {sup o}C). Unfolded gp4 is prone to aggregation within a narrow range of temperatures both in vitro and in Salmonella extracts. In the virion the thermal unfolding of gp4 is prevented by the interaction with the dodecameric portal protein, which stabilizes the structure of gp4 and suppresses unfolded gp4 from irreversibly aggregating in the Salmonella milieu. The structural stabilization of gp4 is accompanied by the concomitant oligomerization of the protein to form a ring of 12 subunits bound to the lower end of the portal ring. The interaction of gp4 with portal protein is complex and likely involves the distinct binding of two non-equivalent sets of six gp4 proteins. Binding of the first set of six gp4 equivalents to dodecameric portal protein yields a gp(1){sub 12}:gp(4){sub 6} assembly intermediate, which is stably populated at 30 {sup o}C and can be resolved by native gel electrophoresis. The final product of the assembly reaction is a bi-dodecameric gp(1){sub 12}:gp(4){sub 12} complex, which appears hollow by electron microscopy, suggesting that gp4 does not physically plug the DNA entry/exit channel, but acts as a structural adaptor for the other tail accessory factors: gp10 and gp26.

  4. SCIAMACHY'S ABSORBING AEROSOL INDEX AND THE CONSEQUENCES OF INSTRUMENT DEGRADATION

    E-Print Network [OSTI]

    Tilstra, Gijsbert

    SCIAMACHY'S ABSORBING AEROSOL INDEX AND THE CONSEQUENCES OF INSTRUMENT DEGRADATION L. G. Tilstra1 a strong increase in the AAI with time, which is found to be caused completely by degradation of the optics. This we conclude from straightforward calculation of the effect of instrument degradation based

  5. Instrumentation for Nuclear Applications

    SciTech Connect (OSTI)

    NONE

    1998-09-18T23:59:59.000Z

    The objective of this project was to develop and coordinate nuclear instrumentation standards with resulting economies for the nuclear and radiation fields. There was particular emphasis on coordination and management of the Nuclear Instrument Module (NIM) System, U.S. activity involving the CAMAC international standard dataway system, the FASTBUS modular high-speed data acquisition and control system and processing and management of national nuclear instrumentation and detector standards, as well as a modest amount of assistance and consultation services to the Pollutant Characterization and Safety Research Division of the Office of Health and Environmental Research. The principal accomplishments were the development and maintenance of the NIM instrumentation system that is the predominant instrumentation system in the nuclear and radiation fields worldwide, the CAMAC digital interface system in coordination with the ESONE Committee of European Laboratories, the FASTBUS high-speed system and numerous national and international nuclear instrumentation standards.

  6. Engineering extension.uci.edu/optics

    E-Print Network [OSTI]

    Barrett, Jeffrey A.

    Engineering extension.uci.edu/optics OpticalEngineeringand OpticalInstrumentDesign Certificate and optical systems. These are essential to virtually every industry including defense, medical, clean energy. The Optical Engineering Certificate Program addresses the growing demand for skilled professionals who can

  7. Instrument validation project

    SciTech Connect (OSTI)

    Reynolds, B.A.; Daymo, E.A.; Geeting, J.G.H.; Zhang, J.

    1996-06-01T23:59:59.000Z

    Westinghouse Hanford Company Project W-211 is responsible for providing the system capabilities to remove radioactive waste from ten double-shell tanks used to store radioactive wastes on the Hanford Site in Richland, Washington. The project is also responsible for measuring tank waste slurry properties prior to injection into pipeline systems, including the Replacement of Cross-Site Transfer System. This report summarizes studies of the appropriateness of the instrumentation specified for use in Project W-211. The instruments were evaluated in a test loop with simulated slurries that covered the range of properties specified in the functional design criteria. The results of the study indicate that the compact nature of the baseline Project W-211 loop does not result in reduced instrumental accuracy resulting from poor flow profile development. Of the baseline instrumentation, the Micromotion densimeter, the Moore Industries thermocouple, the Fischer and Porter magnetic flow meter, and the Red Valve Pressure transducer meet the desired instrumental accuracy. An alternate magnetic flow meter (Yokagawa) gave nearly identical results as the baseline fischer and Porter. The Micromotion flow meter did not meet the desired instrument accuracy but could potentially be calibrated so that it would meet the criteria. The Nametre on-line viscometer did not meet the desired instrumental accuracy and is not recommended as a quantitative instrument although it does provide qualitative information. The recommended minimum set of instrumentation necessary to ensure the slurry meets the Project W-058 acceptance criteria is the Micromotion mass flow meter and delta pressure cells.

  8. ARM - Campaign Instrument - island-guest-instruments

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492air Comments? We would love to hear from you! Send us agovInstrumentsisland-guest-instruments Comments?

  9. Space Instrument Realization (ISR-5)

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    5 Space Instrument Realization Providing expertise to support the design and fabrication of space-based custom instrumentation Contacts Group Leader Amy Regan Email Staff...

  10. ARM - Site Instruments

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625govInstrumentstdmadap Documentation TDMADAP :ProductsVaisala CL51InstrumentsCentralScienceLevelAtlanticInstruments

  11. ARM - Word Seek: Instruments

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625govInstrumentstdmadapInactiveVisiting the TWP TWP Related Links Facilities and InstrumentsInstruments Outreach Home

  12. Instrumented Bioreactors BIOMATERIALS

    E-Print Network [OSTI]

    Instrumented Bioreactors BIOMATERIALS Our goal is to develop novel bioreactors that combine are embedding sensing techniques into a custom bioreactor platform to enable real-time monitoring of tissue integrity during growth. Our present design builds on earlier bioreactors constructed at NIST that provided

  13. AC Resistance measuring instrument

    DOE Patents [OSTI]

    Hof, Peter J. (Richland, WA)

    1983-01-01T23:59:59.000Z

    An auto-ranging AC resistance measuring instrument for remote measurement of the resistance of an electrical device or circuit connected to the instrument includes a signal generator which generates an AC excitation signal for application to a load, including the device and the transmission line, a monitoring circuit which provides a digitally encoded signal representing the voltage across the load, and a microprocessor which operates under program control to provide an auto-ranging function by which range resistance is connected in circuit with the load to limit the load voltage to an acceptable range for the instrument, and an auto-compensating function by which compensating capacitance is connected in shunt with the range resistance to compensate for the effects of line capacitance. After the auto-ranging and auto-compensation functions are complete, the microprocessor calculates the resistance of the load from the selected range resistance, the excitation signal, and the load voltage signal, and displays of the measured resistance on a digital display of the instrument.

  14. AC resistance measuring instrument

    DOE Patents [OSTI]

    Hof, P.J.

    1983-10-04T23:59:59.000Z

    An auto-ranging AC resistance measuring instrument for remote measurement of the resistance of an electrical device or circuit connected to the instrument includes a signal generator which generates an AC excitation signal for application to a load, including the device and the transmission line, a monitoring circuit which provides a digitally encoded signal representing the voltage across the load, and a microprocessor which operates under program control to provide an auto-ranging function by which range resistance is connected in circuit with the load to limit the load voltage to an acceptable range for the instrument, and an auto-compensating function by which compensating capacitance is connected in shunt with the range resistance to compensate for the effects of line capacitance. After the auto-ranging and auto-compensation functions are complete, the microprocessor calculates the resistance of the load from the selected range resistance, the excitation signal, and the load voltage signal, and displays of the measured resistance on a digital display of the instrument. 8 figs.

  15. Center for Adaptive Optics* Santa Cruz,CA

    E-Print Network [OSTI]

    Grether, Gregory

    Center for Adaptive Optics* Santa Cruz,CA The Center for Adaptive Optics (CfAO) will concentrate on astronomical and vision science applications of adaptive optics and will reach out to other adaptive optics communities to share technologies. It will develop new instruments optimized for adaptive optics. Adaptive

  16. The ARCADE 2 Instrument

    E-Print Network [OSTI]

    Singal, J; Kogut, A; Levin, S; Limon, M; Lubin, P; Mirel, P; Seiffert, M; Villela, T; Wollack, E; Wünsche, C A

    2009-01-01T23:59:59.000Z

    The second generation Absolute Radiometer for Cosmology, Astrophysics, and Diffuse Emission (ARCADE 2) instrument is a balloon-borne experiment to measure the radiometric temperature of the cosmic microwave background and Galactic and extra-Galactic emission at six frequencies from 3 to 90 GHz. ARCADE 2 utilizes a double-nulled design where emission from the sky is compared to that from an external cryogenic full-aperture blackbody calibrator by cryogenic switching radiometers containing internal blackbody reference loads. In order to further minimize sources of systematic error, ARCADE 2 features a cold fully open aperture with all radiometrically active components maintained at near 2.7 K without windows or other warm objects, achieved through a novel thermal design. We discuss the design and performance of the ARCADE 2 instrument in its 2005 and 2006 flights.

  17. ARM - Site Instruments

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625govInstrumentstdmadap Documentation TDMADAP :ProductsVaisalaAlaskaInstruments NSA Related Links

  18. Instrumentation and diagnostics

    SciTech Connect (OSTI)

    Nakaishi, C.V.; Bedick, R.C.

    1990-12-01T23:59:59.000Z

    This Technology Status Report describes research and accomplishments for the Instrumentation and Diagnostics (I D) Projects within the Advanced Research and Technology Development (AR TD) Program of the United States Department of Energy (DOE) Office of Fossil Energy (FE). Process understanding and control can be improved through the development of advanced instrumentation and diagnostics. The thrust of the I D Projects is to further develop existing measurement and control techniques for application to advanced coal-based technologies. Project highlights are: an inductively coupled plasma (ICP) instrument has been developed to analyze trace elements in gasification and combustion process streams. An in situ two-color Mie scattering technique with LSS can simultaneously measure the size, velocity, and elemental composition of coal particles during combustion. A high-temperature, fluorescence thermometry technique has accurately measured gas temperatures during field testing in combustion and gasification environments. Expert systems have been developed to improve the control of advanced coal-based processes. Capacitance flowmeters were developed to determine the mass flowrate, solid volume fraction, and particle velocities of coal slurries. 32 refs., 9 figs.

  19. Geothermal high temperature instrumentation applications

    SciTech Connect (OSTI)

    Normann, R.A. [Sandia National Labs., Albuquerque, NM (United States); Livesay, B.J. [Livesay Consultants (United States)

    1998-06-11T23:59:59.000Z

    A quick look at the geothermal industry shows a small industry producing about $1 billion in electric sales annually. The industry is becoming older and in need of new innovative solutions to instrumentation problems. A quick look at problem areas is given along with basic instrumentation requirements. The focus of instrumentation is on high temperature electronics.

  20. ARM - Campaign Instrument - issrwp

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492air Comments? We would love to hear from you! Send us agovInstrumentsisland-guest-instruments

  1. ARM - Instrument - 50rwp

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006Datastreamstwrcam40m DocumentationJanuary 9, 2009 [Events,Forms Ingest Ingest WorkflowgovInstruments50rwp

  2. ARM - RHUBC II Instruments

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625govInstrumentstdmadap Documentation TDMADAP :ProductsVaisala CL51Instruments Related Links RHUBC-II Home RHUBC Home

  3. ARM - Recovery Act Instruments

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625govInstrumentstdmadap Documentation TDMADAP :ProductsVaisala CL51Instruments Related Links RHUBC-IIActRecovery Act

  4. ARM - Site Instruments

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625govInstrumentstdmadap Documentation TDMADAP :ProductsVaisala CL51InstrumentsCentralScienceLevel and82

  5. ARM - Site Instruments

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625govInstrumentstdmadap Documentation TDMADAP :ProductsVaisala CL51InstrumentsCentralScienceLevel and82

  6. ARM - Site Instruments

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625govInstrumentstdmadap Documentation TDMADAP :ProductsVaisala CL51InstrumentsCentralScienceLevel

  7. ARM - Site Instruments

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625govInstrumentstdmadap Documentation TDMADAP :ProductsVaisalaAlaskaInstruments NSA Related Links Facilities and

  8. ARM - Site Instruments

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625govInstrumentstdmadap Documentation TDMADAP :ProductsVaisalaAlaskaInstruments NSA Related Links Facilities

  9. ARM - Instrument Datastreams

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOnItem NotEnergy,ARMForms About Become a User Recovery Act Mission FAQgovDataInstrument

  10. ARM - Site Instruments

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645U.S. DOE Office of ScienceandMesa-Anomalous Radiative AbsorptionARM InArcticManacapuru, Brazil Instruments Manacapuru

  11. ARM - Site Instruments

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645U.S. DOE Office of ScienceandMesa-Anomalous Radiative AbsorptionARM InArcticManacapuru, Brazil Instruments

  12. ARM - Site Instruments

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645U.S. DOE Office of ScienceandMesa-Anomalous Radiative AbsorptionARM InArcticManacapuru, Brazil InstrumentsOliktok Point,

  13. ARM - Site Instruments

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645U.S. DOE Office of ScienceandMesa-Anomalous Radiative AbsorptionARM InArcticManacapuru, Brazil InstrumentsOliktok

  14. ARM - Site Instruments

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645U.S. DOE Office of ScienceandMesa-Anomalous Radiative AbsorptionARM InArcticManacapuru,Manus Site-InactiveInstruments TWP

  15. ARM - Site Instruments

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645U.S. DOE Office of ScienceandMesa-Anomalous Radiative AbsorptionARM InArcticManacapuru,Manus Site-InactiveInstruments

  16. Diffractive optical elements for spectroscopy Hallvard Angelskar

    E-Print Network [OSTI]

    Johansen, Tom Henning

    Diffractive optical elements for spectroscopy by Hallvard Angelsk°ar Submitted in partial;Abstract Diffractive optical elements can be used in spectroscopy instruments to fulfill several tasks to precisely fabricate complex diffractive optical elements with feature sizes below the micrometer scale

  17. Experimental Underground facility to evaluate remote sensing instruments

    E-Print Network [OSTI]

    Paris-Sud XI, Université de

    is quite easy to obtain, in the case of conventional techniques, but the problems remain with optical, hydrocarbons, and specific pollutants such äs NH3, naphtalene,... Before putting such an instrument Absorption Spectroscopy (DOAS) devices. The procedure is based on that used for conventional point monitors

  18. The QUIET Instrument

    SciTech Connect (OSTI)

    Bischoff, C.; et al.

    2012-07-01T23:59:59.000Z

    The Q/U Imaging ExperimenT (QUIET) is designed to measure polarization in the Cosmic Microwave Background, targeting the imprint of inflationary gravitational waves at large angular scales ({approx}1{sup o}). Between 2008 October and 2010 December, two independent receiver arrays were deployed sequentially on a 1.4m side-fed Dragonian telescope. The polarimeters which form the focal planes use a highly compact design based on High Electron Mobility Transistors (HEMTs) that provides simultaneous measurements of the Stokes parameters Q, U, and I in a single module. The 17-element Q-band polarimeter array, with a central frequency of 43.1 GHz, has the best sensitivity (69 {mu}Ks{sup 1/2}) and the lowest instrumental systematic errors ever achieved in this band, contributing to the tensor-to-scalar ratio at r < 0:1. The 84-element W-band polarimeter array has a sensitivity of 87 {mu}Ks{sup 1/2} at a central frequency of 94.5 GHz. It has the lowest systematic errors to date, contributing at r < 0:01. The two arrays together cover multipoles in the range {ell} {approx} 25 -- 975. These are the largest HEMT-based arrays deployed to date. This article describes the design, calibration, performance of, and sources of systematic error for the instrument.

  19. Material flows of mobile phones and accessories in Nigeria: Environmental implications and sound end-of-life management options

    SciTech Connect (OSTI)

    Osibanjo, Oladele [Department of Chemistry, University of Ibadan, Ibadan, Oyo State (Nigeria)], E-mail: osibanjo@baselnigeria.org; Nnorom, Innocent Chidi [Department of Industrial Chemistry, Abia State University Uturu (Nigeria)

    2008-02-15T23:59:59.000Z

    Presently, Nigeria is one of the fastest growing Telecom markets in the world. The country's teledensity increased from a mere 0.4 in 1999 to 10 in 2005 following the liberalization of the Telecom sector in 2001. More than 25 million new digital mobile lines have been connected by June 2006. Large quantities of mobile phones and accessories including secondhand and remanufactured products are being imported to meet the pent-up demand. This improvement in mobile telecom services resulted in the preference of mobile telecom services to fixed lines. Consequently, the contribution of fixed lines decreased from about 95% in year 2000 to less than 10% in March 2005. This phenomenal progress in information technology has resulted in the generation of large quantities of electronic waste (e-waste) in the country. Abandoned fixed line telephone sets estimated at 120,000 units are either disposed or stockpiled. Increasing quantities of waste mobile phones estimated at 8 million units by 2007, and accessories will be generated. With no material recovery facility for e-waste and/or appropriate solid waste management infrastructure in place, these waste materials end up in open dumps and unlined landfills. These practices create the potential for the release of toxic metals and halocarbons from batteries, printed wiring boards, liquid crystal display and plastic housing units. This paper presents an overview of the developments in the Nigerian Telecom sector, the material in-flow of mobile phones, and the implications of the management practices for wastes from the Telecom sector in the country.

  20. The MICE PID Instrumentation

    E-Print Network [OSTI]

    M. Bonesini

    2008-10-02T23:59:59.000Z

    The international Muon Ionization Cooling Experiment (MICE) will carry out a systematic investigation of ionization cooling of a muon beam. As the emittance measurement will be done on a particle-by-particle basis, sophisticated beam instrumentation is needed to measure particle coordinates and timing vs RF. A PID system based on three time-of-flight stations, two Aerogel Cerenkov detectors and a KLOE-like calorimeter has been constructed in order to keep beam contamination ($e, \\pi$) well below 1%. The MICE time-of-flight system will measure timing with a resolution better than 70 ps per plane, in a harsh environment due to high particle rates, fringe magnetic fields and electron backgrounds from RF dark current.

  1. Instrumented Pipeline Initiative

    SciTech Connect (OSTI)

    Thomas Piro; Michael Ream

    2010-07-31T23:59:59.000Z

    This report summarizes technical progress achieved during the cooperative agreement between Concurrent Technologies Corporation (CTC) and U.S. Department of Energy to address the need for a for low-cost monitoring and inspection sensor system as identified in the Department of Energy (DOE) National Gas Infrastructure Research & Development (R&D) Delivery Reliability Program Roadmap.. The Instrumented Pipeline Initiative (IPI) achieved the objective by researching technologies for the monitoring of pipeline delivery integrity, through a ubiquitous network of sensors and controllers to detect and diagnose incipient defects, leaks, and failures. This report is organized by tasks as detailed in the Statement of Project Objectives (SOPO). The sections all state the objective and approach before detailing results of work.

  2. Study on optical finite impulse response filter Guangjie Zeng

    E-Print Network [OSTI]

    Study on optical finite impulse response filter Ying Zhou Guangjie Zeng Feihong Yu Zhejiang University State Key Laboratory of Modern Optical Instrumentation Optical Engineering Department Hangzhou Kong Abstract. We present an optical finite impulse response (FIR) filter de- sign method. Based

  3. Sandia National Laboratories: meteorological instrumentation

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    meteorological instrumentation Characterizing Scaled Wind Farm Technology Facility Inflow On April 1, 2014, in Energy, News, News & Events, Partnership, Renewable Energy, Wind...

  4. LANSCE | Lujan Center | Instruments | FDS

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Difference Spectrometer (FDS) is used for molecular vibrational spectroscopy by inelastic neutron scattering. The instrument is designed for high count rates by use of large...

  5. Radiometric instrumentation and measurements guide for photovoltaic performance testing

    SciTech Connect (OSTI)

    Myers, D.

    1997-04-01T23:59:59.000Z

    The Photovoltaic Module and Systems Performance and Engineering Project at the National Renewable Energy Laboratory performs indoor and outdoor standardization, testing, and monitoring of the performance of a wide range of photovoltaic (PV) energy conversion devices and systems. The PV Radiometric Measurements and Evaluation Team (PVSRME) within that project is responsible for measurement and characterization of natural and artificial optical radiation which stimulates the PV effect. The PV manufacturing and research and development community often approaches project members for technical information and guidance. A great area of interest is radiometric instrumentation, measurement techniques, and data analysis applied to understanding and improving PV cell, module, and system performance. At the Photovoltaic Radiometric Measurements Workshop conducted by the PVSRME team in July 1995, the need to communicate knowledge of solar and optical radiometric measurements and instrumentation, gained as a result of NREL`s long-term experiences, was identified as an activity that would promote improved measurement processes and measurement quality in the PV research and manufacturing community. The purpose of this document is to address the practical and engineering need to understand optical and solar radiometric instrument performance, selection, calibration, installation, and maintenance applicable to indoor and outdoor radiometric measurements for PV calibration, performance, and testing applications. An introductory section addresses radiometric concepts and definitions. Next, concepts essential to spectral radiometric measurements are discussed. Broadband radiometric instrumentation and measurement concepts are then discussed. Each type of measurement serves as an important component of the PV cell, module, and system performance measurement and characterization process.

  6. D0 Instrument Air System

    SciTech Connect (OSTI)

    Serges, T.J.; /Fermilab

    1988-09-15T23:59:59.000Z

    The main function of the instrument air system is to operate control valves associated with the cryogenics in the D0 hall. Occasionally, it will be used for purging purposes. Appendix A shows a schematic of the air instrument system along with a corresponding components list.

  7. Development of metrology instruments for grazing incidence mirrors

    SciTech Connect (OSTI)

    Takacs, P.Z. (Brookhaven National Lab., Upton, NY (USA)); Church, E.L. (Army Research and Development Command, Dover, NJ (USA)); Qian, Shi-nan (China Univ. of Science and Technology, Hefei, AH (China). Hefei National Synchrotron Radiation Lab.); Liu, Wuming (Academia Sinica, Beijing, BJ (China). Inst. of High Energy Physics)

    1989-10-01T23:59:59.000Z

    The effective utilization of synchrotron radiation (SR) from high-brightness sources requires the use of optical components with very smooth surfaces and extremely precise shapes. Most manufacturers are not capable of measuring the figure and finish quality of the aspheric optics required for use in grazing incidence beam lines. Over the past several years we have developed measurement techniques and metrology instrumentation that have allowed us to measure the surface profile and roughness of large cylinder optics, up to one meter in length. Based on our measurements and feedback, manufacturers have been able to advance the state-of-the-art in mirror fabrication and are now able to produce acceptable components. Our analysis techniques enable designers to write meaningful specifications and predict the performance of real surfaces in their particular beamline configurations. Commercial instruments are now available for measuring surface microroughness with spatial periods smaller than about one millimeter. No commercial instruments are available for measuring the surface figure on cylindrical aspheres over long spatial periods, from one millimeter up to one meter. For that reason we developed a Long Trace Profiler (LTP) that measures surface profile over the long period range in a non-contact manner to extremely high accuracy. Examples of measured surfaces and data analysis techniques will be discussed, and limitations on the quality of optical surfaces related to intrinsic material properties will also be discussed. 15 refs., 14 figs., 2 tabs.

  8. Optical gamma thermometer

    DOE Patents [OSTI]

    Koster, Glen Peter; Xia, Hua; Lee, Boon Kwee

    2013-08-06T23:59:59.000Z

    An optical gamma thermometer includes a metal mass having a temperature proportional to a gamma flux within a core of a nuclear reactor, and an optical fiber cable for measuring the temperature of the heated metal mass. The temperature of the heated mass may be measured by using one or more fiber grating structures and/or by using scattering techniques, such as Raman, Brillouin, and the like. The optical gamma thermometer may be used in conjunction with a conventional reactor heat balance to calibrate the local power range monitors over their useful in-service life. The optical gamma thermometer occupies much less space within the in-core instrument tube and costs much less than the conventional gamma thermometer.

  9. Precision Tiltmeter as a Reference for Slope MeasuringInstruments

    SciTech Connect (OSTI)

    Kirschman, Jonathan L.; Domning, Edward E.; Morrison, Gregory Y.; Smith, Brian V.; Yashchuk, Valeriy V.

    2007-08-01T23:59:59.000Z

    The next generation of synchrotrons and free electron lasers require extremely high-performance x-ray optical systems for proper focusing. The necessary optics cannot be fabricated without the use of precise optical metrology instrumentation. In particular, the Long Trace Profiler (LTP) based on the pencil-beam interferometer is a valuable tool for low-spatial-frequency slope measurement with x-ray optics. The limitations of such a device are set by the amount of systematic errors and noise. A significant improvement of LTP performance was the addition of an optical reference channel, which allowed to partially account for systematic errors associated with wiggling and wobbling of the LTP carriage. However, the optical reference is affected by changing optical path length, non-homogeneous optics, and air turbulence. In the present work, we experimentally investigate the questions related to the use of a precision tiltmeter as a reference channel. Dependence of the tiltmeter performance on horizontal acceleration, temperature drift, motion regime, and kinematical scheme of the translation stage has been investigated. It is shown that at an appropriate experimental arrangement, the tiltmeter provides a slope reference for the LTP system with accuracy on the level of 0.1 {micro}rad (rms).

  10. Highly damped kinematic coupling for precision instruments

    DOE Patents [OSTI]

    Hale, Layton C. (Livermore, CA); Jensen, Steven A. (Livermore, CA)

    2001-01-01T23:59:59.000Z

    A highly damped kinematic coupling for precision instruments. The kinematic coupling provides support while causing essentially no influence to its nature shape, with such influences coming, for example, from manufacturing tolerances, temperature changes, or ground motion. The coupling uses three ball-cone constraints, each combined with a released flexural degree of freedom. This arrangement enables a gain of higher load capacity and stiffness, but can also significantly reduce the friction level in proportion to the ball radius divided by the distance between the ball and the hinge axis. The blade flexures reduces somewhat the stiffness of the coupling and provides an ideal location to apply constrained-layer damping which is accomplished by attaching a viscoelastic layer and a constraining layer on opposite sides of each of the blade flexures. The three identical ball-cone flexures provide a damped coupling mechanism to kinematically support the projection optics system of the extreme ultraviolet lithography (EUVL) system, or other load-sensitive apparatus.

  11. Optical Fibers Optics and Photonics

    E-Print Network [OSTI]

    Palffy-Muhoray, Peter

    Optical Fibers Optics and Photonics Dr. Palffy-Muhoray Ines Busuladzic Department of Theoretical and Applied Mathematics The University of Akron April 21, 2008 #12;Outline · History of optical fibers · What are optical fibers? · How are optical fibers made? · Light propagation through optical fibers · Application

  12. Departmental Business Instrument Numbering System

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    2000-12-05T23:59:59.000Z

    To prescribe procedures for assigning identifying numbers to all Department of Energy (DOE), including the National Nuclear Security Administration, business instruments. Cancels DOE 1331.2B. Canceled by DOE O 540.1A.

  13. Departmental Business Instrument Numbering System

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    2005-01-27T23:59:59.000Z

    The Order prescribes the procedures for assigning identifying numbers to all Department of Energy (DOE) and National Nuclear Security Administration (NNSA) business instruments. Cancels DOE O 540.1. Canceled by DOE O 540.1B.

  14. PEP instrumentation and control system

    SciTech Connect (OSTI)

    Melen, R.

    1980-06-01T23:59:59.000Z

    This paper describes the operating characteristics of the primary components that form the PEP Instrumentation and Control System. Descriptions are provided for the computer control system, beam monitors, and other support systems.

  15. The ING Instrumentation Conference Discussion, Options for a Competitive Observatory

    E-Print Network [OSTI]

    N. A. Walton; S. J. Smartt

    2000-08-10T23:59:59.000Z

    An expert panel initiated discussion on a number of key questions facing the role of 4-m and small telescopes in the new era of 8-m telescopes. The panel and audience agreed that the 4-m class telescope role would necessarily evolve, but would still be important in the coming years. The need for an active development programme of competitive instrumentation for 4-m class telescopes, and in particular the William Herschel Telescope (WHT) was stressed. In conjunction with this, the need to de-commission instrumentation made redundant by 8-m class telescopes was noted. New operational modes, including greater emphasis on survey programmes, and possibly queue scheduling, coupled with changes to the procedures for allocating time were seen as desirable. The panel and audience supported the Isaac Newton Group's emphasis on the development of instrumentation to exploit its imminent deployment of the WHT's facility Adaptive Optics system.

  16. Hindawi Publishing Corporation X-Ray Optics and Instrumentation

    E-Print Network [OSTI]

    , Elektronenspeicherring BESSY-II, Albert-Einstein-Str. 15, 12489 Berlin, Germany Correspondence should be addressed- and fourth-generation synchrotron radi- ation light sources achieve unprecedented high-brightness and low

  17. Diffuse optical imaging of the whole head Maria Angela Franceschini

    E-Print Network [OSTI]

    Diffuse optical imaging of the whole head Maria Angela Franceschini Danny K. Joseph Theodore J@nmr.mgh.harvard.edu Abstract. Near-Infrared Spectroscopy NIRS and diffuse optical im- aging DOI are increasingly used to detect of optodes in NIRS instruments has hampered measurement of optical signals from diverse brain regions. Our

  18. CHARACTERIZATION OF AN OPTICAL COLLISION AVOIDANCE SENSOR Kyle Watters

    E-Print Network [OSTI]

    Hornsey, Richard

    CHARACTERIZATION OF AN OPTICAL COLLISION AVOIDANCE SENSOR Kyle Watters , Cyrus Minwalla , Michael, unmanned aerial vehicles, sensor ar- ray 1. INTRODUCTION A prototype optical instrument is described detection' should be at a distance on the order of 5 km [2]. An optical sensor may have advantages in mass

  19. ATR NSUF Instrumentation Enhancement Efforts

    SciTech Connect (OSTI)

    Joy L. Rempe; Mitchell K. Meyer; Darrell L. Knudson; Keith G. Condie; Joshua E. Daw; Curtis Wilkins

    2011-01-01T23:59:59.000Z

    A key component of the Advanced Test Reactor (ATR) National Scientific User Facility (NSUF) effort is to expand instrumentation available to users conducting irradiation tests in this unique facility. In particular, development of sensors capable of providing real-time measurements of key irradiation parameters is emphasized because of their potential to increase data fidelity and reduce posttest examination costs. This paper describes the strategy for identifying new instrumentation needed for ATR irradiations and the program underway to develop and evaluate new sensors to address these needs. Accomplishments from this program are illustrated by describing new sensors now available to users of the ATR NSUF. In addition, progress is reported on current research efforts to provide improved in-pile instrumentation to users.

  20. International Conference Synchrotron Radiation Instrumentation SRI `94

    SciTech Connect (OSTI)

    Not Available

    1994-10-01T23:59:59.000Z

    This report contains abstracts for the international conference on Synchrotron Radiation Instrumentation at Brookhaven National Laboratory.

  1. ACRF Instrumentation Status and Information - June 2009

    SciTech Connect (OSTI)

    JW Voyles

    2009-06-01T23:59:59.000Z

    The purpose of this report is to provide a concise but comprehensive overview of Atmospheric Radiation Measurement Climate Research Facility instrumentation status. The report is divided into the following five sections: (1) new instrumentation in the process of being acquired and deployed, (2) field campaigns, (3) existing instrumentation and progress on improvements or upgrades, (4) proposed future instrumentation, and (5) Small Business Innovation Research instrument development.

  2. ACRF Instrumentation Status and Information September 2009

    SciTech Connect (OSTI)

    JW Voyles

    2009-10-01T23:59:59.000Z

    The purpose of this report is to provide a concise but comprehensive overview of Atmospheric Radiation Measurement Climate Research Facility instrumentation status. The report is divided into the following five sections: (1) new instrumentation in the process of being acquired and deployed, (2) field campaigns, (3) existing instrumentation and progress on improvements or upgrades, (4) proposed future instrumentation, and (5) Small Business Innovation Research instrument development.

  3. ACRF Instrumentation Status and Information July 2009

    SciTech Connect (OSTI)

    JW Voyles

    2009-08-13T23:59:59.000Z

    The purpose of this report is to provide a concise but comprehensive overview of Atmospheric Radiation Measurement Climate Research Facility instrumentation status. The report is divided into the following five sections: (1) new instrumentation in the process of being acquired and deployed, (2) field campaigns, (3) existing instrumentation and progress on improvements or upgrades, (4) proposed future instrumentation, and (5) Small Business Innovation Research instrument development.

  4. ACRF Instrumentation Status and Information April 2009

    SciTech Connect (OSTI)

    JW Voyles

    2009-05-07T23:59:59.000Z

    The purpose of this report is to provide a concise but comprehensive overview of Atmospheric Radiation Measurement Climate Research Facility instrumentation status. The report is divided into the following five sections: (1) new instrumentation in the process of being acquired and deployed, (2) field campaigns, (3) existing instrumentation and progress on improvements or upgrades, (4) proposed future instrumentation, and (5) Small Business Innovation Research instrument development.

  5. ACRF Instrumentation Status and Information August 2009

    SciTech Connect (OSTI)

    JW Voyles

    2009-09-09T23:59:59.000Z

    The purpose of this report is to provide a concise but comprehensive overview of Atmospheric Radiation Measurement Climate Research Facility instrumentation status. The report is divided into the following five sections: (1) new instrumentation in the process of being acquired and deployed, (2) field campaigns, (3) existing instrumentation and progress on improvements or upgrades, (4) proposed future instrumentation, and (5) Small Business Innovation Research instrument development.

  6. ACRF Instrumentation Status and Information May 2009

    SciTech Connect (OSTI)

    JW Voyles

    2009-05-01T23:59:59.000Z

    The purpose of this report is to provide a concise but comprehensive overview of Atmospheric Radiation Measurement Climate Research Facility instrumentation status. The report is divided into the following five sections: (1) new instrumentation in the process of being acquired and deployed, (2) field campaigns, (3) existing instrumentation and progress on improvements or upgrades, (4) proposed future instrumentation, and (5) Small Business Innovation Research instrument development.

  7. Performance Limits for Cherenkov Instruments

    E-Print Network [OSTI]

    W. Hofmann

    2006-03-17T23:59:59.000Z

    The performance of Cherenkov instruments for the detection of very high energy gamma rays is ultimately limited by the fluctuations in the development of air showers. With particular emphasis on the angular resolution, the ultimate performance limits are investigated on the basis of simulations.

  8. Vacuum enhanced cutaneous biopsy instrument

    DOE Patents [OSTI]

    Collins, Joseph (St. Petersburg, FL)

    2000-01-01T23:59:59.000Z

    A syringe-like disposable cutaneous biopsy instrument equipped with a tubular blade at its lower end, and designed so that a vacuum is created during use, said vacuum serving to retain undeformed a plug of tissue cut from a patient's skin.

  9. Micro benchtop optics by bulk silicon micromachining

    DOE Patents [OSTI]

    Lee, Abraham P. (Walnut Creek, CA); Pocha, Michael D. (Livermore, CA); McConaghy, Charles F. (Livermore, CA); Deri, Robert J. (Pleasanton, CA)

    2000-01-01T23:59:59.000Z

    Micromachining of bulk silicon utilizing the parallel etching characteristics of bulk silicon and integrating the parallel etch planes of silicon with silicon wafer bonding and impurity doping, enables the fabrication of on-chip optics with in situ aligned etched grooves for optical fibers, micro-lenses, photodiodes, and laser diodes. Other optical components that can be microfabricated and integrated include semi-transparent beam splitters, micro-optical scanners, pinholes, optical gratings, micro-optical filters, etc. Micromachining of bulk silicon utilizing the parallel etching characteristics thereof can be utilized to develop miniaturization of bio-instrumentation such as wavelength monitoring by fluorescence spectrometers, and other miniaturized optical systems such as Fabry-Perot interferometry for filtering of wavelengths, tunable cavity lasers, micro-holography modules, and wavelength splitters for optical communication systems.

  10. The matter in extreme conditions instrument at the Linac Coherent Light Source

    DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

    Nagler, Bob; Arnold, Brice; Bouchard, Gary; Boyce, Richard F.; Boyce, Richard M.; Callen, Alice; Campell, Marc; Curiel, Ruben; Galtier, Eric; Garofoli, Justin; et al

    2015-05-01T23:59:59.000Z

    The LCLS beam provides revolutionary capabilities for studying the transient behavior of matter in extreme conditions. The particular strength of the Matter in Extreme Conditions instrument is that it combines the unique LCLS beam with high-power optical laser beams, and a suite of dedicated diagnostics tailored for this field of science. In this paper an overview of the beamline, the capabilities of the instrumentation, and selected highlights of experiments and commissioning results are presented.

  11. 4-ID-D Instrumentation

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Area Diffractometors 8-Circle 4Tesla Magnet 13 Tesla Magnet Focussing Zone Plate Optics K-B Mirror System Temperature Control Low Temperature Displex (4.4 to 325 K) High...

  12. The Coherent X-ray Imaging (CXI) Instrument at the Linac Coherent Light Source (LCLS)

    SciTech Connect (OSTI)

    Boutet, Sebastien; Williams, Garth J.; /SLAC; ,

    2011-08-16T23:59:59.000Z

    The Linac Coherent Light Source (LCLS) has become the first ever operational hard X-ray Free Electron Laser in 2009. It will operate as a user facility capable of delivering unique research opportunities in multiple fields of science. The LCLS and the LCLS Ultrafast Science Instruments (LUSI) construction projects are developing instruments designed to make full use of the capabilities afforded by the LCLS beam. One such instrument is being designed to utilize the LCLS coherent beam to image with high resolution any sub-micron object. This instrument is called the Coherent X-ray Imaging (CXI) instrument. This instrument will provide a flexible optical system capable of tailoring key beam parameters for the users. A suite of shot-to-shot diagnostics will also be provided to characterize the beam on every pulse. The provided instrumentation will include multi-purpose sample environments, sample delivery and a custom detector capable of collecting 2D data at 120 Hz. In this article, the LCLS will be briefly introduced along with the technique of Coherent X-ray Diffractive Imaging (CXDI). A few examples of scientific opportunities using the CXI instrument will be described. Finally, the conceptual layout of the instrument will be presented along with a description of the key requirements for the overall system and specific devices required.

  13. INCUBATOR ACCESSORIES: NUAIFE. INC.

    E-Print Network [OSTI]

    Kleinfeld, David

    11 12 13 14 15 16 DESCRIPTIDN 3-WAY SDLENDID LAMP GREEN (115V) LAMP BLOCK SWITCH SPST BUZZER (120V) BUZZER (230V) LAMP RED (220V) LAMP RED (115V) POWER CORD (115V) POWER Switch continuously monitors the selected tank. Ifthe selected tank is Tank 1, the CO2 Tank 1 LED

  14. Parts and Accessories: Essays

    E-Print Network [OSTI]

    Jackson, Kari

    2010-05-31T23:59:59.000Z

    it, his aviator sunglasses overwhelming my nose. I don‘t remember them together. The memories are all split. There were several inches of snow on the ground the day in January 2001 when 143 million cubic feet of compressed natural gas seeped...

  15. Optical coherence techniques for plasma spectroscopy ,,invited... J. Howard,a)

    E-Print Network [OSTI]

    Howard, John

    Optical coherence techniques for plasma spectroscopy ,,invited... J. Howard,a) C. Michael, F. Glass, Australia Presented on 21 June 2000 A new electro-optically modulated optical solid-state MOSS spectrometer plasmas. The instrument is an electro-optically modulated fixed delay polarization interferometer

  16. Novel Scanning Lens Instrument for Evaluating Fresnel Lens Performance: Equipment Development and Initial Results (Presentation)

    SciTech Connect (OSTI)

    Herrero, R.; Miller, D. C.; Kurtz, S. R.; Anton, I.; Sala, G.

    2013-07-01T23:59:59.000Z

    A system dedicated to the optical transmittance characterization of Fresnel lenses has been developed at NREL, in collaboration with the UPM. The system quantifies the optical efficiency of the lens by generating a performance map. The shape of the focused spot may also be analyzed to understand change in the lens performance. The primary instrument components (lasers and CCD detector) have been characterized to confirm their capability for performing optical transmittance measurements. Measurements performed on SoG and PMMA lenses subject to a variety of indoor conditions (e.g., UV and damp heat) identified differences in the optical efficiency of the evaluated lenses, demonstrating the ability of the Scanning Lens Instrument (SLI) to distinguish between the aged lenses.

  17. Development and application of composite overhead ground wire with optical fibers

    SciTech Connect (OSTI)

    Tsujimoto, K.; Kato, T.; Okazato, A.; Sakurada, H.

    1983-05-01T23:59:59.000Z

    A overhead ground wire composed with optical fibers has been developed, as well as the accessories and the joints. The overhead ground wire is provided with an aluminum pipe at the core thereof in which the optical fibers are inserted. The composite overhead ground wire with optical fibers was installed for the Kaga-Reinan 500 kV overhead transmission line in autumn, 1981 for the purposes of observing lightning and using as telecommunication line, as well. After the successful performance of the optical fiber, especially in view of transmission loss after installation, has been proved, the composite overhead ground wire is now being checked for the purposes as stated above. The ground wire was also installed for the Tsuruga Test Line at about the same time and investigations were started to confirm the reliability of the optical fiber to be over a long period of time under severe meteorological conditions such as strong winds and icing. The construction of the composite ground wire with optical fibers is such that the optical fibers contained therein are not restrained by the ground wire itself. This enables insertion and pulling out of optical fiber cables. Tests were conducted at certain sections of the Kaga-Reinan Line to confirm that there was no change in the performance of the optical fibers due to such operations of insertion and pulling out. This report briefly discusses the development of the composite ground wire with optical fibers, its installation and the test results.

  18. Exploring the mechanome with optical tweezers and single molecule fluorescence

    E-Print Network [OSTI]

    Brau, Ricardo R. (Ricardo Rafael), 1979-

    2008-01-01T23:59:59.000Z

    The combination of optical tweezers and single molecule fluorescence into an instrument capable of making combined, coincident measurements adds an observable dimension that allows for the examination of the localized ...

  19. Aerosol observing system platform integration and AAF instrumentation

    SciTech Connect (OSTI)

    Springston, S.; Sedlacek, A.

    2010-03-15T23:59:59.000Z

    As part of the federal government’s 2009 American Recovery and Reinvestment Act (ARRA), the U.S. DOE Office of Science allocated funds for the capital upgrade of the Atmospheric Radiation Measurement (ARM) Climate Research Facility to improve and expand observational capabilities related to cloud and aerosol properties. The ARM Facility was established as a national user facility for the global scientific community to conduct a wide range of interdisciplinary science. Part of the ARRA-funded expansion of the ARM Facility includes four new Aerosol Observing Systems (AOS) to be designed, instrumented, and mentored by BNL. The enclosures will be customized SeaTainers. These new platforms ([AMF2]: ARM Mobile Facility-2; [TWP-D]: Tropical Western Pacific at Darwin; and [MAOS-A]/[MAOS-C]: Mobile Aerosol Observing System-Aerosol/-Chemistry) will provide a laboratory environment for fielding instruments to collect data on aerosol life cycle, microphysics, and optical/physical properties. The extensive instrument suite includes both established methods and initial deployments of new techniques to add breadth and depth to the AOS data sets. The platforms are designed: (1) to have all instruments pre-installed before deployment, allowing a higher measurement duty cycle; (2) with a standardized configuration improving the robustness of data inter-comparability; (3) to provide remote access capability for instrument mentors; and (4) to readily accommodate guest instrumentation. The first deployment of the AMF2 platform will be at the upcoming StormVEx campaign held at Steamboat Springs, Colorado, October 15, 2010–March 31, 2011 while the TWP-D AOS will be stationed at the ARM Darwin site. The maiden deployments of the MAOS-A and MAOS-C platforms will be during the Ganges Valley Experiment (GVAX) scheduled for April 2011–April 2012. In addition to the ground-based AOS platforms, thee major instrument builds for the AAF are also being undertaken (new trace gas package [NO, NOx, NOy, CO, O3, and SO2]; Scanning Mobility Particle Sampler [SMPS]; and Particle into Liquid Sampler [PILS]). The current status of the AOS platforms, instrument suites, instituted QA/QC activities, projected AOS VAPs, and inlet design, as well as still-unresolved issues, will be presented.

  20. Design and performance of a combined secondary ion mass spectrometry-scanning probe microscopy instrument for high sensitivity and high-resolution elemental three-dimensional analysis

    SciTech Connect (OSTI)

    Wirtz, Tom; Fleming, Yves; Gerard, Mathieu [Department 'Science and Analysis of Materials' (SAM), Centre de Recherche Public, Gabriel Lippmann, 41 rue du Brill, L-4422 Belvaux (Luxembourg); Gysin, Urs; Glatzel, Thilo; Meyer, Ernst [Department of Physics, Universitaet Basel, Klingelbergstrasse 82, CH-4056 Basel (Switzerland); Wegmann, Urs [Department of Physics, Universitaet Basel, Klingelbergstrasse 82, CH-4056 Basel (Switzerland); Ferrovac GmbH, Thurgauerstr. 72, CH-8050 Zuerich (Switzerland); Maier, Urs [Ferrovac GmbH, Thurgauerstr. 72, CH-8050 Zuerich (Switzerland); Odriozola, Aitziber Herrero; Uehli, Daniel [SPECS Zurich GmbH, Technoparkstr. 1, CH-8005 Zuerich (Switzerland)

    2012-06-15T23:59:59.000Z

    State-of-the-art secondary ion mass spectrometry (SIMS) instruments allow producing 3D chemical mappings with excellent sensitivity and spatial resolution. Several important artifacts however arise from the fact that SIMS 3D mapping does not take into account the surface topography of the sample. In order to correct these artifacts, we have integrated a specially developed scanning probe microscopy (SPM) system into a commercial Cameca NanoSIMS 50 instrument. This new SPM module, which was designed as a DN200CF flange-mounted bolt-on accessory, includes a new high-precision sample stage, a scanner with a range of 100 {mu}m in x and y direction, and a dedicated SPM head which can be operated in the atomic force microscopy (AFM) and Kelvin probe force microscopy modes. Topographical information gained from AFM measurements taken before, during, and after SIMS analysis as well as the SIMS data are automatically compiled into an accurate 3D reconstruction using the software program 'SARINA,' which was developed for this first combined SIMS-SPM instrument. The achievable lateral resolutions are 6 nm in the SPM mode and 45 nm in the SIMS mode. Elemental 3D images obtained with our integrated SIMS-SPM instrument on Al/Cu and polystyrene/poly(methyl methacrylate) samples demonstrate the advantages of the combined SIMS-SPM approach.

  1. Flow Cytometry Instrument Policy & Penalties Sample Preparation

    E-Print Network [OSTI]

    Noble, James S.

    the integrity of the instrument, all samples must be filtered with a 40 µm mesh cell strainer just before

  2. ICFA Instrumentation Bulletin, Volume 13, Fall 1996

    SciTech Connect (OSTI)

    NONE

    1996-12-01T23:59:59.000Z

    The publication of the ICFA Instrumentation Bulletin is an activity of the Panel on Future Innovation and Development of ICFA (International Committee for Future Accelerators). The Bulletin reports on research and progress in the field of instrumentation with emphasis on application in the field of high-energy physics. It encourages issues of generic instrumentation.

  3. Optical keyboard

    DOE Patents [OSTI]

    Veligdan, James T. (Manorville, NY); Feichtner, John D. (Fiddletown, CA); Phillips, Thomas E. (San Diego, CA)

    2001-01-01T23:59:59.000Z

    An optical keyboard includes an optical panel having optical waveguides stacked together. First ends of the waveguides define an inlet face, and opposite ends thereof define a screen. A projector transmits a light beam outbound through the waveguides for display on the screen as a keyboard image. A light sensor is optically aligned with the inlet face for sensing an inbound light beam channeled through the waveguides from the screen upon covering one key of the keyboard image.

  4. Instrumentation for severe processes improved

    SciTech Connect (OSTI)

    Platt, R.J.

    1983-01-31T23:59:59.000Z

    This article discusses the evolution of equipment to solve or at least mitigate the serious control problems involved in petroleum refineries, where control valves and sensors become fouled, lead lines plug, and overall process performance is impaired. Points out that visbreaking, coal liquefaction and residfining (resid desulfurization) are all processes that impose severe conditions on process instrumentation. Reports that experience at the Exxon Coal Liquefaction Plant (ECLP) has shown that conventional cylindrical thermowells are subject to severe erosion, which can be prevented by eliminating mechanical bending through improved shape.

  5. Tevatron instrumentation: boosting collider performance

    SciTech Connect (OSTI)

    Shiltsev, Vladimir; Jansson, Andreas; Moore, Ronald; /Fermilab

    2006-05-01T23:59:59.000Z

    The Tevatron in Collider Run II (2001-present) is operating with six times more bunches, many times higher beam intensities and luminosities than in Run I (1992-1995). Beam diagnostics were crucial for the machine start-up and the never-ending luminosity upgrade campaign. We present the overall picture of the Tevatron diagnostics development for Run II, outline machine needs for new instrumentation, present several notable examples that led to Tevatron performance improvements, and discuss the lessons for the next big machines--LHC and ILC.

  6. Monocrystalline test structures, and use for calibrating instruments

    DOE Patents [OSTI]

    Cresswell, Michael W. (Frederick, MD); Ghoshtagore, R. N. (Ellicott City, MD); Linholm, Loren W. (Ijamsville, MD); Allen, Richard A. (Germantown, MD); Sniegowski, Jeffry J. (Albuquerque, NM)

    1997-01-01T23:59:59.000Z

    An improved test structure for measurement of width of conductive lines formed on substrates as performed in semiconductor fabrication, and for calibrating instruments for such measurements, is formed from a monocrystalline starting material, having an insulative layer formed beneath its surface by ion implantation or the equivalent, leaving a monocrystalline layer on the surface. The monocrystalline surface layer is then processed by preferential etching to accurately define components of the test structure. The substrate can be removed from the rear side of the insulative layer to form a transparent window, such that the test structure can be inspected by transmissive-optical techniques. Measurements made using electrical and optical techniques can be correlated with other measurements, including measurements made using scanning probe microscopy.

  7. Integrated optics for astronomical interferometry. I. Concept and astronomical applications

    E-Print Network [OSTI]

    F. Malbet; P. Kern; I. Schanen-Duport; J. -P. Berger; K. Rousselet-Perraut

    1999-07-02T23:59:59.000Z

    We propose a new instrumental concept for long-baseline optical single-mode interferometry using integrated optics which were developed for telecommunication. Visible and infrared multi-aperture interferometry requires many optical functions (spatial filtering, beam combination, photometric calibration, polarization control) to detect astronomical signals at very high angular resolution. Since the 80's, integrated optics on planar substrate have become available for telecommunication applications with multiple optical functions like power dividing, coupling, multiplexing, etc. We present the concept of an optical / infrared interferometric instrument based on this new technology. The main advantage is to provide an interferometric combination unit on a single optical chip. Integrated optics are compact, provide stability, low sensitivity to external constrains like temperature, pressure or mechanical stresses, no optical alignment except for coupling, simplicity and intrinsic polarization control. The integrated optics devices are inexpensive compared to devices that have the same functionalities in bulk optics. We think integrated optics will fundamentally change single-mode interferometry. Integrated optics devices are in particular well-suited for interferometric combination of numerous beams to achieve aperture synthesis imaging or for space-based interferometers where stability and a minimum of optical alignments are wished.

  8. Method for improving instrument response

    DOE Patents [OSTI]

    Hahn, David W. (7528 Oxford Cir., Dublin, Alameda County, CA 94568); Hencken, Kenneth R. (2665 Calle Alegre, Pleasanton, Alameda County, CA 94566); Johnsen, Howard A. (5443 Celeste Ave., Livermore, Alameda County, CA 94550); Flower, William L. (5447 Theresa Way, Livermore, Alameda County, CA 94550)

    2000-01-01T23:59:59.000Z

    This invention pertains generally to a method for improving the accuracy of particle analysis under conditions of discrete particle loading and particularly to a method for improving signal-to-noise ratio and instrument response in laser spark spectroscopic analysis of particulate emissions. Under conditions of low particle density loading (particles/m.sup.3) resulting from low overall metal concentrations and/or large particle size uniform sampling can not be guaranteed. The present invention discloses a technique for separating laser sparks that arise from sample particles from those that do not; that is, a process for systematically "gating" the instrument response arising from "sampled" particles from those responses which do not, is dislosed as a solution to his problem. The disclosed approach is based on random sampling combined with a conditional analysis of each pulse. A threshold value is determined for the ratio of the intensity of a spectral line for a given element to a baseline region. If the threshold value is exceeded, the pulse is classified as a "hit" and that data is collected and an average spectrum is generated from an arithmetic average of "hits". The true metal concentration is determined from the averaged spectrum.

  9. Polyplanar optical display electronics

    SciTech Connect (OSTI)

    DeSanto, L.; Biscardi, C. [Brookhaven National Lab., Upton, NY (United States). Dept. of Advanced Technology

    1997-07-01T23:59:59.000Z

    The Polyplanar Optical Display (POD) is a unique display screen which can be used with any projection source. The prototype ten inch display is two inches thick and has a matte black face which allows for high contrast images. The prototype being developed is a form, fit and functional replacement display for the B-52 aircraft which uses a monochrome ten-inch display. In order to achieve a long lifetime, the new display uses a 100 milliwatt green solid-state laser (10,000 hr. life) at 532 nm as its light source. To produce real-time video, the laser light is being modulated by a Digital Light Processing (DLP{trademark}) chip manufactured by Texas Instruments. In order to use the solid-state laser as the light source and also fit within the constraints of the B-52 display, the Digital Micromirror Device (DMD{trademark}) circuit board is removed from the Texas Instruments DLP light engine assembly. Due to the compact architecture of the projection system within the display chassis, the DMD{trademark} chip is operated remotely from the Texas Instruments circuit board. The authors discuss the operation of the DMD{trademark} divorced from the light engine and the interfacing of the DMD{trademark} board with various video formats (CVBS, Y/C or S-video and RGB) including the format specific to the B-52 aircraft. A brief discussion of the electronics required to drive the laser is also presented.

  10. The Neo-Flex LCD Arm is the perfect accessory to add flexibility to your LCD monitor or TV. Sleek and streamlined, it frees up desk space and allows you

    E-Print Network [OSTI]

    Saskatchewan, University of

    The Neo-Flex LCD Arm is the perfect accessory to add flexibility to your LCD monitor or TV. Sleek lifting the LCD with the other hand. Then position the LCD where you want it and release the button. It. Highlights · Great value at a great price · Easily position your LCD or TV for maximum comfort

  11. LCLS Ultrafast Science Instruments:Conceptual Design Report

    SciTech Connect (OSTI)

    Arthur, J.; Boutet, S.; Castagna, J-C.; Chapman, H.; Feng, Y.; Foyt, W.; Fritz, D.M.; Gaffney, K.J.; Gr|bel, G.; Hajdu, J.; Hastings, J.B.; Kurita, N.; Larsson, J.; Ludwig, K.; Messerschmidt, M.; Miao, J.; Reis, D.A.; Robert, A.; Stephenson, G.B.; Tschentscher, Th.; van Bakel, N.; /SLAC /LLNL, Livermore /DESY /Lund Inst. Tech. /Boston U. /UCLA /Michigan U. /Argonne

    2007-10-16T23:59:59.000Z

    The Stanford Linear Accelerator Center (SLAC), along with Argonne National Laboratory (ANL), Lawrence Livermore National Laboratory (LLNL), and the University of California at Los Angeles (UCLA), is constructing a Free-Electron Laser (FEL) facility, which will operate in the wavelength range 1.5 nm - 0.15 nm. This FEL, the Linac Coherent Light Source (LCLS), utilizes the SLAC linac and will produce sub-picosecond pulses of short wavelength X-rays with very high peak brightness and almost complete transverse coherence. The final one-third of the SLAC linac will be used as the source of electrons for the LCLS. The high energy electrons will be transported across the SLAC Research Yard, into a tunnel which will house a long undulator. In passing through the undulator, the electrons will be bunched by the force of their own synchrotron radiation and produce an intense, monochromatic, spatially coherent beam of X-rays. By varying the electron energy, the FEL X-ray wavelength will be tunable from 1.5 nm to 0.15 nm. The LCLS will include two experimental halls as well as X-ray optics and infrastructure necessary to create a facility that can be developed for research in a variety of disciplines such as atomic physics, materials science, plasma physics and biosciences. This Conceptual Design Report, the authors believe, confirms the feasibility of designing and constructing three X-ray instruments in order to exploit the unique scientific capability of this new LCLS facility. The technical objective of the LCLS Ultrafast Science Instruments (LUSI) project is to design, build, and install at the LCLS three hard X-ray instruments that will complement the initial instrument included in the LCLS construction. As the science programs advance and new technological challenges appear, instrumentation needs to be developed and ready to conquer these new opportunities. The LCLS instrument concepts have been developed in close consultation with the scientific community through a series of workshops team meetings and focused reviews. In particular, the LUSI project instruments have been identified as meeting the most urgent needs of the scientific community based on the advice of the LCLS Scientific Advisory Committee (SAC) in response to an open call for letters of intent (LOI) from the breadth of the scientific community.

  12. Compact Optical Technique for Streak Camera Calibration

    SciTech Connect (OSTI)

    Curt Allen; Terence Davies; Frans Janson; Ronald Justin; Bruce Marshall; Oliver Sweningsen; Perry Bell; Roger Griffith; Karla Hagans; Richard Lerche

    2004-04-01T23:59:59.000Z

    The National Ignition Facility is under construction at the Lawrence Livermore National Laboratory for the U.S. Department of Energy Stockpile Stewardship Program. Optical streak cameras are an integral part of the experimental diagnostics instrumentation. To accurately reduce data from the streak cameras a temporal calibration is required. This article describes a technique for generating trains of precisely timed short-duration optical pulses that are suitable for temporal calibrations.

  13. Principal Components Instrumental Variable Estimation

    E-Print Network [OSTI]

    Winkelried, Diego; Smith, Richard J.

    2011-01-31T23:59:59.000Z

    ,1]. The parameter µ is the absolute value of the largest correlation between any two elements of z i . 14 The determination of rn can be made through a heuristic rule designed to satisfy (A) and (B). This is inspired by usual practices in the selection of those PC... of eigenvectors (the so-called ‘loadings’) has the form C = ? ? ? ? C¯K?×s 0K?×a CˆK?×(K??s) 0a×s Ia 0a×(K??s) ? ? ? ? therefore ZC = [Z?C¯ : Za : Z?Cˆ ] . (14) The PC of Z used as instruments are Z¯ = ZC r , the first r columns of ZC . From (14) it is clear...

  14. Front lighted optical tooling method and apparatus

    DOE Patents [OSTI]

    Stone, William J. (Kansas City, MO)

    1985-06-18T23:59:59.000Z

    An optical tooling method and apparatus uses a front lighted shadowgraphic technique to enhance visual contrast of reflected light. The apparatus includes an optical assembly including a fiducial mark, such as cross hairs, reflecting polarized light with a first polarization, a polarizing element backing the fiducial mark and a reflective surface backing the polarizing element for reflecting polarized light bypassing the fiducial mark and traveling through the polarizing element. The light reflected by the reflecting surface is directed through a second pass of the polarizing element toward the frontal direction with a polarization differing from the polarization of the light reflected by the fiducial mark. When used as a tooling target, the optical assembly may be mounted directly to a reference surface or may be secured in a mounting, such as a magnetic mounting. The optical assembly may also be mounted in a plane defining structure and used as a spherometer in conjunction with an optical depth measuring instrument. A method of measuring a radius of curvature of an unknown surface includes positioning the spherometer on a surface between the surface and a depth measuring optical instrument. As the spherometer is frontally illuminated, the distance from the depth measuring instrument to the fiducial mark and the underlying surface are alternately measured and the difference in these measurements is used as the sagittal height to calculate a radius of curvature.

  15. MC and A instrumentation catalog

    SciTech Connect (OSTI)

    Neymotin, L. [ed.] [Brookhaven National Lab., Upton, NY (United States); Sviridova, V. [ed.] [All-Russian Research Inst. of Automatics, Moscow (Russian Federation)

    1998-06-01T23:59:59.000Z

    In 1981 and 1985, two editions of a catalog of non-destructive nuclear measurement instrumentation, and material control and surveillance equipment, were published by Brookhaven National Laboratory (BNL). The last edition of the catalog included one hundred and twenty-five entries covering a wide range of devices developed in the US and abroad. More than ten years have elapsed since the publication of the more recent Catalog. Devices described in it have undergone significant modifications, and new devices have been developed. Therefore, in order to assist specialists in the field of Material Control and Accounting (MC and A), a new catalog has been created. Work on this instrumentation catalog started in 1997 as a cooperative effort of Brookhaven National Laboratory (BNL), operated by Brookhaven Science Associates under contract to the US Department of Energy, and the All-Russian Research Institute of Automatics (VNIIA), subordinate institute of the Atomic Energy Ministry of the Russian Federation, within the collaborative US-Russia Material Protection, Control, and Accounting (MPC and A) Program. Most of the equipment included in the Catalog are non-destructive assay (NDA) measurement devices employed for purposes of accounting, confirmation, and verification of nuclear materials. Other devices also included in the Catalog are employed in the detection and deterrence of unauthorized access to or removal of nuclear materials (material control: containment and surveillance). Equipment found in the Catalog comprises either: (1) complete devices or systems that can be used for MC and A applications; or (2) parts or components of complete systems, such as multi-channel analyzers, detectors, neutron generators, and software. All devices are categorized by their status of development--from prototype to serial production.

  16. Spectrometer for Sky-Scanning Sun-Tracking Atmospheric Research (4STAR): Instrument Technology

    SciTech Connect (OSTI)

    Dunagan, Stephen; Johnson, Roy; Zavaleta, Jhony; Russell, P. B.; Schmid, Beat; Flynn, Connor J.; Redemann, Jens; Shinozuka, Yohei; Livingston, J.; Segal Rozenhaimer, Michal

    2013-08-06T23:59:59.000Z

    The Spectrometer for Sky-Scanning, Sun-Tracking Atmospheric Research (4STAR) combines airborne sun tracking and sky scanning with diffraction spectroscopy, to improve knowledge of atmospheric constituents and their links to air-pollution/climate. Direct beam hyper-spectral measurement of optical depth improves retrievals of gas constituents and determination of aerosol properties. Sky scanning enhances retrievals of aerosol type and size distribution. 4STAR measurements will tighten the closure between satellite and ground-based measurements. 4STAR incorporates a modular sun-tracking/ sky-scanning optical head with fiber optic signal transmission to rack mounted spectrometers, permitting miniaturization of the external optical head, and future detector evolution. Technical challenges include compact optical collector design, radiometric dynamic range and stability, and broad spectral coverage. Test results establishing the performance of the instrument against the full range of operational requirements are presented, along with calibration, engineering flight test, and scientific field campaign data and results.

  17. TIMEDEPENDENT ELECTRON TRANSPORT AND OPTICAL EMISSIONS IN THE AURORA

    E-Print Network [OSTI]

    Peticolas, Laura

    TIME­DEPENDENT ELECTRON TRANSPORT AND OPTICAL EMISSIONS IN THE AURORA A THESIS Presented­DEPENDENT ELECTRON TRANSPORT AND OPTICAL EMISSIONS IN THE AURORA By Laura Marie Peticolas RECOMMENDED: Advisory observed in electron spectra of instruments flying over flickering aurora, are modeled with the time

  18. Optical Expanders with Applications in Optical Computing

    E-Print Network [OSTI]

    Reif, John H.

    Optical Expanders with Applications in Optical Computing John H. Reif Akitoshi Yoshida July 20, 1999 Abstract We describe and investigate an optical system which we call an optical expander. An optical expander elec- trooptically expands an optical boolean pattern encoded in d bits into an optical

  19. Kids with disabilities inspire a musical instrument

    ScienceCinema (OSTI)

    Daily, Dan; Pfeifer, Kent

    2014-02-10T23:59:59.000Z

    The Midiwing is a musical instrument that unites music and computer technology for those who lack the experience, physical ability, or maturity to play music with traditional instruments. To create the instrument, Dan Daily, Director of Musicode Innovations, reworked and recoded Musical Instrument Digital Interface (MIDI) technology and introduced ergonomic design. He applied to the New Mexico Small Business Assistance (NMSBA) Program to receive help when he discovered the microcontroller he used was being phased out. Daily and Kent Pfeifer, an engineer at Sandia National Laboratories and musician himself, partnered to create a new state-of-the-art design.

  20. Rotary mode system initial instrument calibration

    SciTech Connect (OSTI)

    Johns, B.R.

    1994-10-01T23:59:59.000Z

    The attached report contains the vendor calibration procedures used for the initial instrument calibration of the rotary core sampling equipment. The procedures are from approved vendor information files.

  1. Kids with disabilities inspire a musical instrument

    SciTech Connect (OSTI)

    Daily, Dan; Pfeifer, Kent

    2013-11-21T23:59:59.000Z

    The Midiwing is a musical instrument that unites music and computer technology for those who lack the experience, physical ability, or maturity to play music with traditional instruments. To create the instrument, Dan Daily, Director of Musicode Innovations, reworked and recoded Musical Instrument Digital Interface (MIDI) technology and introduced ergonomic design. He applied to the New Mexico Small Business Assistance (NMSBA) Program to receive help when he discovered the microcontroller he used was being phased out. Daily and Kent Pfeifer, an engineer at Sandia National Laboratories and musician himself, partnered to create a new state-of-the-art design.

  2. Sandia National Laboratories: Instrumentation and Materials ...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Instrumentation and Materials & Manufacturing Reliability Program Investigations on Marine Hydrokinetic Turbine Foil Structural Health Monitoring Presented at GMREC METS On June...

  3. Optical Turbulence Characterization at LAMOST Site: Observations and Models

    E-Print Network [OSTI]

    Liu, L -Y; Yao, Y -Q; Vernin, J; Chadid, M; Wang, H -S; Yin, J; Wang, Y -P

    2015-01-01T23:59:59.000Z

    Atmospheric optical turbulence seriously limits the performance of high angular resolution instruments. An 8-night campaign of measurements was carried out at the LAMOST site in 2011, to characterize the optical turbulence. Two instruments were set up during the campaign: a Differential Image Motion Monitor (DIMM) used to measure the total atmospheric seeing, and a Single Star Scidar (SSS) to measure the vertical profiles of the turbulence C_n^2(h) and the horizontal wind velocity V(h). The optical turbulence parameters are also calculated with the Weather Research and Forecasting (WRF) model coupled with the Trinquet-Vernin model, which describes optical effects of atmospheric turbulence by using the local meteorological parameters. This paper presents assessment of the optical parameters involved in high angular resolution astronomy. Its includes seeing, isoplanatic angle, coherence time, coherence etendue, vertical profiles of optical turbulence intensity _n^2(h)$ and horizontal wind speed V(h). The median...

  4. Toward automated beam optics control

    SciTech Connect (OSTI)

    Silbar, R.R.; Schultz, D.E.

    1987-01-01T23:59:59.000Z

    We have begun a program aiming toward automatic control of charged-particle beam optics using artificial intelligence programming techniques. In developing our prototype, we are working with LISP machines and the KEE expert system shell. Our first goal was to develop a ''mouseable'' representation of a typical beam line. This responds actively to changes entered from the mouse or keyboard, giving an updated display of the beam line itself, its optical properties, and the instrumentation and control devices as seen by the operater. We have incorporated TRANSPORT, written in Fortran but running as a callable procedure in the LISP environment, for simulation of the beam-line optics. This paper describes the experience gained in meeting our first goal and discusses plans to extend the work so that it is usable, in realtime, on an operating beam line. 11 refs.

  5. Two position optical element actuator device

    DOE Patents [OSTI]

    Holdener, Fred R. (Tracy, CA); Boyd, Robert D. (Livermore, CA)

    2002-01-01T23:59:59.000Z

    The present invention is a two position optical element actuator device utilizing a powered means to hold an actuation arm, to which an optical element is attached, in a first position. A non-powered means drives the actuation arm to a second position, when the powered means ceases to receive power. The optical element may be a electromagnetic (EM) radiation or particle source, an instrument, or EM radiation or particle transmissive, reflective or absorptive elements. A bearing is used to transfer motion and smoothly transition the actuation arm from the first to second position.

  6. The Durham Micro-Optics Programme

    E-Print Network [OSTI]

    J. Schmoll; C. M. Dubbeldam; D. J. Robertson; J. Yao

    2005-09-22T23:59:59.000Z

    The Durham Microoptics Programme was established to develop key components to be used for integral field spectrographs for upcoming instrumentation projects, focussing on currently existing telescopes as well as on the next generation of ELTs. These activities include monolithic multi-optics machining and grinding, optical surface improvement using various post polishing techniques and replication of micro-optical components. While these developments have mostly slicer-type IFUs in mind, also new types of microlens arrays are in development for fiber based high contrast IFU systems.

  7. Instrumentation for CTA site characterization

    E-Print Network [OSTI]

    Fruck, Christian; Ernenwein, Jean-Pierre; Mandát, Dušan; Schweizer, Thomas; Häfner, Dennis; Bulik, Tomasz; Cieslar, Marek; Costantini, Heide; Dominik, Michal; Ebr, Jan; Garczarczyk, Markus; Lorentz, Eckart; Pareschi, Giovanni; Pech, Miroslav; Puerto-Giménez, Irene; Teshima, Masahiro

    2015-01-01T23:59:59.000Z

    Many atmospheric and climatic criteria have to be taken into account for the selection of a suitable site for the next generation of imaging air-shower Cherenkov telescopes, the "Cherenkov Telescope Array" CTA. Such data are not available with sufficient precision or the comparability to allow for a comprehensive characterization of the proposed sites to be made. Identical cross-calibrated instruments have been developed which allow for precise comparison between sites, the cross-validation of existing data, and the ground-validation of satellite data. The site characterization work package of the CTA consortium opted to construct and deploy 9 copies of an autonomous multi-purpose weather sensor, incorporating an infrared cloud sensor a newly developed sensor for measuring the light of the night sky, and an All-Sky-Camera, the whole referred to as Autonomous Tool for Measuring Observatory Site COnditions PrEcisely (ATMOSCOPE). We present here the hardware that was combined into the ATMOSCOPE and characterize ...

  8. Instrumentation, Control, and Intelligent Systems

    SciTech Connect (OSTI)

    Not Available

    2005-09-01T23:59:59.000Z

    Abundant and affordable energy is required for U.S. economic stability and national security. Advanced nuclear power plants offer the best near-term potential to generate abundant, affordable, and sustainable electricity and hydrogen without appreciable generation of greenhouse gases. To that end, Idaho National Laboratory (INL) has been charged with leading the revitalization of nuclear power in the U.S. The INL vision is to become the preeminent nuclear energy laboratory with synergistic, world-class, multi-program capabilities and partnerships by 2015. The vision focuses on four essential destinations: (1) Be the preeminent internationally-recognized nuclear energy research, development, and demonstration laboratory; (2) Be a major center for national security technology development and demonstration; (3) Be a multi-program national laboratory with world-class capabilities; (4) Foster academic, industry, government, and international collaborations to produce the needed investment, programs, and expertise. Crucial to that effort is the inclusion of research in advanced instrumentation, control, and intelligent systems (ICIS) for use in current and advanced power and energy security systems to enable increased performance, reliability, security, and safety. For nuclear energy plants, ICIS will extend the lifetime of power plant systems, increase performance and power output, and ensure reliable operation within the system's safety margin; for national security applications, ICIS will enable increased protection of our nation's critical infrastructure. In general, ICIS will cost-effectively increase performance for all energy security systems.

  9. Distributed fiber-optic temperature sensing for hydrologic systems John S. Selker,1,2

    E-Print Network [OSTI]

    Selker, John

    Distributed fiber-optic temperature sensing for hydrologic systems John S. Selker,1,2 Luc The; accepted 27 October 2006; published 6 December 2006. [1] Instruments for distributed fiber-optic m with temporal resolution of fractions of a minute along standard fiber-optic cables used

  10. High sensitivity bulk electro-optic modulator field sensor for high voltage environments

    E-Print Network [OSTI]

    Shy,Jow-Tsong

    High sensitivity bulk electro-optic modulator field sensor for high voltage environments Mao December 2004) An optical electric field sensor is an effective instrument for surveying the electric attacked by unexpected electrical shocks through the metal cable of the sensor. Sensing by optical sensors

  11. Microfabricated field calibration assembly for analytical instruments

    DOE Patents [OSTI]

    Robinson, Alex L. (Albuquerque, NM); Manginell, Ronald P. (Albuquerque, NM); Moorman, Matthew W. (Albuquerque, NM); Rodacy, Philip J. (Albuquerque, NM); Simonson, Robert J. (Cedar Crest, NM)

    2011-03-29T23:59:59.000Z

    A microfabricated field calibration assembly for use in calibrating analytical instruments and sensor systems. The assembly comprises a circuit board comprising one or more resistively heatable microbridge elements, an interface device that enables addressable heating of the microbridge elements, and, in some embodiments, a means for positioning the circuit board within an inlet structure of an analytical instrument or sensor system.

  12. Void Fraction Instrument operation and maintenance manual

    SciTech Connect (OSTI)

    Borgonovi, G.; Stokes, T.I.; Pearce, K.L.; Martin, J.D.; Gimera, M.; Graves, D.B.

    1994-09-01T23:59:59.000Z

    This Operations and Maintenance Manual (O&MM) addresses riser installation, equipment and personnel hazards, operating instructions, calibration, maintenance, removal, and other pertinent information necessary to safely operate and store the Void Fraction Instrument. Final decontamination and decommissioning of the Void Fraction Instrument are not covered in this document.

  13. Instrument and Source Division Ron Crone, Director

    E-Print Network [OSTI]

    Pennycook, Steve

    Abercrombie Project Management/ Operations Analysis Barbara Thibadeau HFIR Instrument Operations Gary Lynn G. Visscher SNS Instrument Operations Bobby Lee Cross S. McNulty, Admin. Asst. Neutron Choppers J. Stockton. Knox1 Design Services K. Potter, Lead M. Hammons G. Jones W. Sharp S. Roy R. Taylor Survey, Alignment

  14. Proposal for a Universal Test Mirror for Characterization of SlopeMeasuring Instruments

    SciTech Connect (OSTI)

    Yashchuk, Valeriy V.; McKinney, Wayne R.; Warwick, Tony; Noll,Tino; Siewert, Frank; Zeschke, Thomas; Geckeler, Ralf D.

    2007-07-31T23:59:59.000Z

    The development of third generation light sources like theAdvanced Light Source (ALS) or BESSY II brought to a focus the need forhigh performance synchrotron optics with unprecedented tolerances forslope error and micro roughness. Proposed beam lines at Free ElectronLasers (FEL) require optical elements up to a length of one meter,characterized by a residual slope error in the range of 0.1murad (rms),and rms values of 0.1 nm for micro roughness. These optical elements mustbe inspected by highly accurate measuring instruments, providing ameasurement uncertainty lower than the specified accuracy of the surfaceunder test. It is essential that metrology devices in use at synchrotronlaboratories be precisely characterized and calibrated to achieve thistarget. In this paper we discuss a proposal for a Universal Test Mirror(UTM) as a realization of a high performance calibration instrument. Theinstrument would provide an ideal calibration surface to replicate aredundant surface under test of redundant figure. The application of asophisticated calibration instrument will allow the elimination of themajority of the systematic error from the error budget of an individualmeasurement of a particular optical element. We present the limitationsof existing methods, initial UTM design considerations, possiblecalibration algorithms, and an estimation of the expectedaccuracy.

  15. Fiber optic coupled optical sensor

    DOE Patents [OSTI]

    Fleming, Kevin J. (Albuquerque, NM)

    2001-01-01T23:59:59.000Z

    A displacement sensor includes a first optical fiber for radiating light to a target, and a second optical fiber for receiving light from the target. The end of the first fiber is adjacent and not axially aligned with the second fiber end. A lens focuses light from the first fiber onto the target and light from the target onto the second fiber.

  16. Matter in Extreme Conditions Instrument - Conceptual Design Report

    SciTech Connect (OSTI)

    Boyce, R.F.; Boyce, R.M.; Haller, G.; Hastings, J.B.; Hays, G.; Lee, H.J.; /SLAC; Lee, R.W.; /LLNL, Livermore; Nagler, B.; /Rutherford; Scharfenstein, M.; Marsh, D.; White, W.E.; /SLAC; ,

    2009-12-09T23:59:59.000Z

    The SLAC National Accelerator Laboratory (SLAC), in collaboration with Argonne National Laboratory (ANL), Lawrence Livermore National Laboratory (LLNL), and the University of California at Los Angeles (UCLA), is constructing a Free-Electron Laser (FEL) research facility. The FEL has already met its performance goals in the wavelength range 1.5 nm - 0.15 nm. This facility, the Linac Coherent Light Source (LCLS), utilizes the SLAC 2-Mile Linear Accelerator (linac) and will produce sub-picosecond pulses of short wavelength X-rays with very high peak brightness and almost complete transverse coherence. The final one-third of the SLAC linac is used as the source of electrons for the LCLS. The high energy electrons are transported across the SLAC Research Yard, into a tunnel which houses a long undulator. In passing through the undulator, the electrons are bunched by the force of their own synchrotron radiation and produce an intense, monochromatic, spatially coherent beam of X-rays. By varying the electron energy, the FEL X-ray wavelength is tunable from 1.5 nm to 0.15 nm. The LCLS includes two experimental halls as well as X-ray optics and infrastructure necessary to create a facility that can be developed for research in a variety of disciplines such as atomic physics, materials science, plasma physics and biosciences. This Conceptual Design Report, the authors believe, confirms the feasibility of designing and constructing an X-ray instrument in order to exploit the unique scientific capability of LCLS by creating extreme conditions and study the behavior of plasma under those controlled conditions. This instrument will address the Office of Science, Fusion Energy Sciences, mission objective related to study of Plasma and Warm Dense Matter as described in the report titled LCLS, the First Experiments, prepared by the LCLS Scientific Advisory Committee (SAC) in September 2000. The technical objective of the LCLS Matter in Extreme Conditions (MEC) Instrument project is to design, build, and install at the LCLS an X-ray instrument that will complement the initial instrument suite included in the LCLS construction and the LUSI Major Item of Equipment (MIE) Instruments. As the science programs advance and new technological challenges appear, instrumentation must be developed and ready to conquer these new opportunities. The MEC concept has been developed in close consultation with the scientific community through a series of workshops team meetings and focused reviews. In particular, the MEC instrument has been identified as meeting one of the most urgent needs of the scientific community based on the advice of the LCLS Scientific Advisory Committee (SAC) in response to an open call for letters of intent (LOI) from the breadth of the scientific community. The primary purpose of the MEC instrument is to create High Energy Density (HED) matter and measure its physical properties. There are three primary elements of the MEC instrument: (A) Optical laser drivers that will create HED states by irradiation in several ways and provide diagnostics capability; (B) The LCLS x-ray free electron laser, which will provide the unique capability to create, probe and selectively pump HED states; and, (C) A suite of diagnostic devices required to observe the evolution of the HED state. These elements when combined in the MEC instrument meet the 'Mission Need' as defined in CD-0. For the purposes of the description we separate the types of experiments to be performed into three categories: (1) High pressure: Here we are interested in the generation of high pressure using the optical lasers to irradiate a surface that ablates and drives a pressure wave into a sample, similar to a piston. The pressures that can be reached exceed 1 Mbar and the properties of interest are for example, the reflectivity, conductivity, opacity as well as the changes driven by the pressure wave on, e.g., condensed matter structure. These phenomena will be studied by means of diffraction measurements, measurements of the pressure wave characteristics, in situ probing by

  17. LCLS-II New Instruments Workshops Report

    SciTech Connect (OSTI)

    Baradaran, Samira; Bergmann, Uwe; Durr, Herrmann; Gaffney, Kelley; Goldstein, Julia; Guehr, Markus; Hastings, Jerome; Heimann, Philip; Lee, Richard; Seibert, Marvin; Stohr, Joachim; /SLAC; ,

    2012-08-08T23:59:59.000Z

    The LCLS-II New Instruments workshops chaired by Phil Heimann and Jerry Hastings were held on March 19-22, 2012 at the SLAC National Accelerator Laboratory. The goal of the workshops was to identify the most exciting science and corresponding parameters which will help define the LCLS-II instrumentation. This report gives a synopsis of the proposed investigations and an account of the workshop. Scientists from around the world have provided short descriptions of the scientific opportunities they envision at LCLS-II. The workshops focused on four broadly defined science areas: biology, materials sciences, chemistry and atomic, molecular and optical physics (AMO). Below we summarize the identified science opportunities in the four areas. The frontiers of structural biology lie in solving the structures of large macromolecular biological systems. Most large protein assemblies are inherently difficult to crystallize due to their numerous degrees of freedom. Serial femtosecond protein nanocrystallography, using the 'diffraction-before-destruction' approach to outrun radiation damage has been very successfully pioneered at LCLS and diffraction patterns were obtained from some of the smallest protein crystals ever. The combination of femtosecond x-ray pulses of high intensity and nanosized protein crystals avoids the radiation damage encountered by conventional x-ray crystallography with focused beams and opens the door for atomic structure determinations of the previously largely inaccessible class of membrane proteins that are notoriously difficult to crystallize. The obtained structures will allow the identification of key protein functions and help in understanding the origin and control of diseases. Three dimensional coherent x-ray imaging at somewhat lower resolution may be used for larger objects such as viruses. The chemistry research areas of primary focus are the predictive understanding of catalytic mechanisms, with particular emphasis on photo- and heterogeneous catalysis. Of particular interest is the efficient conversion of light to electrical or chemical energy, which requires understanding the non-adiabatic dynamics of electronic excited states. Ultrafast x-ray scattering presents an excellent opportunity to investigate structural dynamics of molecular systems with atomic resolution, and x-ray scattering and spectroscopy present an excellent opportunity to investigating the dynamics of the electronic charge distribution. Harnessing solar energy to generate fuels, either indirectly with photovoltaics and electrochemical catalysis or directly with photocatalysts, presents a critical technological challenge that will require the use of forefront scientific tools such as ultrafast x-rays. At the center of this technical challenge is the rational design of efficient and cost effective catalysts. Important materials science opportunities relate to information technology applications, in particular the transport and storage of information on increasingly smaller length- and faster time-scales. Of interest are the understanding of the intrinsic size limits associated with the storage of information bits and the speed limits of information or bit processing. Key questions revolve about how electronic charges and spins of materials can be manipulated by electric and magnetic fields. This requires the exploration of speed limits subject to the fundamental conservation laws of energy and linear and angular momentum and the different coupling of polar electric and axial magnetic fields to charge and spin. Of interest are novel composite materials, including molecular systems combining multi electric and magnetic functionality. Ultrafast x-rays offer the required probing speed, can probe either the charge or spin properties through polarization control and through scattering and spectroscopy cover the entire energy-time-momentum-distance phase space. In the field of atomic and molecular science, LCLS II promises to elucidate the fundamental interactions among electrons and between electrons and nuclei, and to explore the fron

  18. Front lighted optical tooling method and apparatus

    DOE Patents [OSTI]

    Stone, W.J.

    1983-06-30T23:59:59.000Z

    An optical tooling method and apparatus uses a front lighted shadowgraphic technique to enhance visual contrast of reflected light. The apparatus includes an optical assembly including a fiducial mark, such as cross hairs, reflecting polarized light with a first polarization, a polarizing element backing the fiducial mark and a reflective surface backing the polarizing element for reflecting polarized light bypassing the fiducial mark and traveling through the polarizing element. The light reflected by the reflecting surface is directed through a second pass of the polarizing element toward the frontal direction with a polarization differing from the polarization of the light reflected by the fiducial mark. When used as a tooling target, the optical assembly may be mounted directly to a reference surface or may be secured in a mounting, such as a magnetic mounting. The optical assembly may also be mounted in a plane defining structure and used as a spherometer in conjunction with an optical depth measuring instrument.

  19. Optical Expanders with Applications in Optical Computing

    E-Print Network [OSTI]

    Reif, John H.

    Optical Expanders with Applications in Optical Computing John H. Reif \\Lambda Akitoshi Yoshida \\Lambda July 20, 1999 Abstract We describe and investigate an optical system which we call an optical expander. An optical expander elec­ trooptically expands an optical boolean pattern encoded in d bits

  20. An Atmospheric Radiation Measurement Value-Added Product to Retrieve Optically Thin Cloud Visible Optical Depth using Micropulse Lidar

    SciTech Connect (OSTI)

    Lo, C; Comstock, JM; Flynn, C

    2006-10-01T23:59:59.000Z

    The purpose of the Micropulse Lidar (MPL) Cloud Optical Depth (MPLCOD) Value-Added Product (VAP) is to retrieve the visible (short-wave) cloud optical depth for optically thin clouds using MPL. The advantage of using the MPL to derive optical depth is that lidar is able to detect optically thin cloud layers that may not be detected by millimeter cloud radar or radiometric techniques. The disadvantage of using lidar to derive optical depth is that the lidar signal becomes attenuation limited when ? approaches 3 (this value can vary depending on instrument specifications). As a result, the lidar will not detect optically thin clouds if an optically thick cloud obstructs the lidar beam.

  1. Plasma instrumentation for fusion power reactor control

    SciTech Connect (OSTI)

    Sager, G.T.; Bauer, J.F.; Maya, I.; Miley, G.H.

    1985-07-01T23:59:59.000Z

    Feedback control will be implemented in fusion power reactors to guard against unpredicted behavior of the plant and to assure desirable operation. In this study, plasma state feedback requirements for plasma control by systems strongly coupled to the plasma (magnet sets, RF, and neutral beam heating systems, and refueling systems) are estimated. Generic considerations regarding the impact of the power reactor environment on plasma instrumentation are outlined. Solutions are proposed to minimize the impact of the power reactor environment on plasma instrumentation. Key plasma diagnostics are evaluated with respect to their potential for upgrade and implementation as power reactor instruments.

  2. Applications of transputers to astronomical instruments

    SciTech Connect (OSTI)

    Stewart, J.M.; Beard, S,M.; Kelly, B.D.; Paterson, M.J. (Royal Observatory, Edinburgh (UK))

    1990-04-01T23:59:59.000Z

    Parallel processing techniques based on transputers are being applied to astronomical instruments under development. On the COSMOS photographic plate measuring machine, a data farm of transputers allows backgrounds to be determined in realtime instead of requiring 1.5 hours of offline VAX processing per plate. Transputers have been adopted as the embedded processors in a submillimetre bolometer array instrument and their use is planned in demanding future applications such as thermal infrared array instruments and data compression applied to remote observing. The techniques of interfacing transputers to external hardware and to VAX/VMS computers are discussed.

  3. ACRF Instrumentation Status: New, Current, and Future March 2007

    SciTech Connect (OSTI)

    JC Liljegren

    2007-03-01T23:59:59.000Z

    The purpose of this report is to provide a concise but comprehensive overview of Atmospheric Radiation Measurement Program Climate Research Facility instrumentation status. The report is divided into four sections: (1) new instrumentation in the process of being acquired and deployed, (2) existing instrumentation and progress on improvements or upgrades, (3) proposed future instrumentation, and (4) Small Business Innovation Research instrument development.

  4. ACRF Instrumentation Status: New, Current, and Future June 2007

    SciTech Connect (OSTI)

    JC Liljegren

    2007-06-01T23:59:59.000Z

    The purpose of this report is to provide a concise but comprehensive overview of Atmospheric Radiation Measurement Program Climate Research Facility instrumentation status. The report is divided into four sections: (1) new instrumentation in the process of being acquired and deployed, (2) existing instrumentation and progress on improvements or upgrades, (3) proposed future instrumentation, and (4) Small Business Innovation Research instrument development.

  5. ACRF Instrumentation Status: New, Current, and Future May 2007

    SciTech Connect (OSTI)

    JC Liljegren

    2007-05-01T23:59:59.000Z

    The purpose of this report is to provide a concise but comprehensive overview of Atmospheric Radiation Measurement Program Climate Research Facility instrumentation status. The report is divided into four sections: (1) new instrumentation in the process of being acquired and deployed, (2) existing instrumentation and progress on improvements or upgrades, (3) proposed future instrumentation, and (4) Small Business Innovation Research instrument development.

  6. ACRF Instrumentation Status: New, Current, and Future February 2007

    SciTech Connect (OSTI)

    JC Liljegren

    2007-02-01T23:59:59.000Z

    The purpose of this report is to provide a concise but comprehensive overview of Atmospheric Radiation Measurement Program Climate Research Facility instrumentation status. The report is divided into four sections: (1) new instrumentation in the process of being acquired and deployed, (2) existing instrumentation and progress on improvements or upgrades, (3) proposed future instrumentation, and (4) Small Business Innovation Research instrument development

  7. ACRF Instrumentation Status: New, Current, and Future January 2007

    SciTech Connect (OSTI)

    JC Liljegren

    2007-01-01T23:59:59.000Z

    The purpose of this report is to provide a concise but comprehensive overview of Atmospheric Radiation Measurement Program Climate Research Facility instrumentation status. The report is divided into four sections: (1) new instrumentation in the process of being acquired and deployed, (2) existing instrumentation and progress on improvements or upgrades, (3) proposed future instrumentation, and (4) Small Business Innovation Research instrument development.

  8. ACRF Instrumentation Status: New, Current, and Future - March 2008

    SciTech Connect (OSTI)

    JW Voyles

    2008-04-01T23:59:59.000Z

    The purpose of this report is to provide a concise but comprehensive overview of Atmospheric Radiation Measurement Climate Research Facility instrumentation status. The report is divided into the following four sections: (1) new instrumentation in the process of being acquired and deployed, (2) existing instrumentation and progress on improvements or upgrades, (3) proposed future instrumentation, and (4) Small Business Innovation Research instrument development.

  9. ACRF Instrumentation Status: New, Current, and Future - November – December 2007

    SciTech Connect (OSTI)

    JW Voyles

    2007-12-01T23:59:59.000Z

    The purpose of this report is to provide a concise but comprehensive overview of Atmospheric Radiation Measurement Climate Research Facility instrumentation status. The report is divided into the following four sections: (1) new instrumentation in the process of being acquired and deployed, (2) existing instrumentation and progress on improvements or upgrades, (3) proposed future instrumentation, and (4) Small Business Innovation Research instrument development.

  10. ACRF Instrumentation Status: New, Current, and Future - September – October 2007

    SciTech Connect (OSTI)

    JW Voyles

    2007-10-30T23:59:59.000Z

    The purpose of this report is to provide a concise but comprehensive overview of Atmospheric Radiation Measurement (ARM) Climate Research Facility (ACRF) instrumentation status. The report is divided into the following four sections: (1) new instrumentation in the process of being acquired and deployed, (2) existing instrumentation and progress on improvements or upgrades, (3) proposed future instrumentation, and (4) SBIR instrument development.

  11. ACRF Instrumentation Status: New, Current, and Future July 2007

    SciTech Connect (OSTI)

    JC Liljegren

    2007-07-01T23:59:59.000Z

    The purpose of this report is to provide a concise but comprehensive overview of ACRF instrumentation status. The report is divided into four sections: (1) new instrumentation in the process of being acquired and deployed, (2) existing instrumentation and progress on improvements or upgrades, (3) proposed future instrumentation, and (4) SBIR instrument development.

  12. ACRF Instrumentation Status: New, Current, and Future - February 2008

    SciTech Connect (OSTI)

    JW Voyles

    2008-03-01T23:59:59.000Z

    The purpose of this report is to provide a concise but comprehensive overview of Atmospheric Radiation Measurement Climate Research Facility instrumentation status. The report is divided into the following four sections: (1) new instrumentation in the process of being acquired and deployed, (2) existing instrumentation and progress on improvements or upgrades, (3) proposed future instrumentation, and (4) Small Business Innovation Research instrument development.

  13. ACRF Instrumentation Status: New, Current, and Future May 2007

    SciTech Connect (OSTI)

    JC Liljegren

    2007-04-01T23:59:59.000Z

    The purpose of this report is to provide a concise but comprehensive overview of Atmospheric Radiation Measurement Program Climate Research Facility instrumentation status. The report is divided into four sections: (1) new instrumentation in the process of being acquired and deployed, (2) existing instrumentation and progress on improvements or upgrades, (3) proposed future instrumentation, and (4) Small Business Innovation Research instrument development.

  14. ACRF Instrumentation Status: New, Current, and Future October 2006

    SciTech Connect (OSTI)

    JC Liljegren

    2006-10-01T23:59:59.000Z

    The purpose of this report is to provide a concise but comprehensive overview of Atmospheric Radiation Measurement Program Climate Research Facility instrumentation status. The report is divided into four sections: (1) new instrumentation in the process of being acquired and deployed, (2) existing instrumentation and progress on improvements or upgrades, (3) proposed future instrumentation, and (4) Small Business Innovation Research instrument development.

  15. ACRF Instrumentation Status: New, Current, and Future - October – November 2007

    SciTech Connect (OSTI)

    JW Voyles

    2007-11-30T23:59:59.000Z

    The purpose of this report is to provide a concise but comprehensive overview of Atmospheric Radiation Measurement (ARM) Climate Research Facility (ACRF) instrumentation status. The report is divided into the following four sections: (1) new instrumentation in the process of being acquired and deployed, (2) existing instrumentation and progress on improvements or upgrades, (3) proposed future instrumentation, and (4) SBIR instrument development.

  16. The Adaptive Optics Lucky Imager: combining adaptive optics and lucky imaging

    E-Print Network [OSTI]

    Crass, Jonathan

    2014-07-01T23:59:59.000Z

    , in particular the adaptive optics system and a new type of wavefront sensor, the non-linear curvature wavefront sensor (nlCWFS), being used within the instrument. The development of the nlCWFS has been the focus of my work, bringing the technique from a...

  17. Fiber optics spectrochemical emission sensors

    DOE Patents [OSTI]

    Griffin, J.W.; Olsen, K.B.

    1992-02-04T23:59:59.000Z

    A method is described of in situ monitoring of a body of a fluid stored in a tank or groundwater or vadose zone gases in a well for the presence of selected chemical species. The method uses a probe insertable into the well or tank via a cable and having an electrical apparatus for exciting selected chemical species in the body of fluid. The probe can have a pair of electrodes for initiating a spark or a plasma cell for maintaining a plasma to excite the selected chemical species. The probe also has an optical apparatus for receiving optical emissions emitted by the excited species and optically transmitting the emissions via the cable to an analysis location outside the well. The analysis includes detecting a selected wavelength in the emissions indicative of the presence of the selected chemical species. A plurality of probes can be suspended at an end of a respective cable, with the transmitting and analyzing steps for each probe being synchronized sequentially for one set of support equipment and instrumentation to monitor at multiple test points. The optical apparatus is arranged about the light guide axis so that the selected chemical species are excited in the fluid in alignment with the light guide axis. Optical emissions are received from the excited chemical species along such axis. 18 figs.

  18. Fiber optics spectrochemical emission sensors

    DOE Patents [OSTI]

    Griffin, Jeffrey W. (Kennewick, WA); Olsen, Khris B. (West Richland, WA)

    1992-01-01T23:59:59.000Z

    A method of in situ monitoring of a body of a fluid stored in a tank or groundwater or vadose zone gases in a well for the presence of selected chemical species uses a probe insertable into the well or tank via a cable and having electrical apparatus for exciting selected chemical species in the body of fluid. The probe can have a pair of electrodes for initiating a spark or a plasma cell for maintaining a plasma to excite the selected chemical species. The probe also has optical apparatus for receiving optical emissions emitted by the excited species and optically transmitting the emissions via the cable to an analysis location outside the well. The analysis includes detecting a selected wavelength in the emissions indicative of the presence of the selected chemical species. A plurality of probes can be suspended at an end of a respective cable, with the transmitting and analyzing steps for each probe being synchronized sequentially for one set of support equipment and instrumentation to monitor at multiple test points. The optical apparatus is arranged about the light guide axis so that the selected chemical species are excited the fluid in alignment with the light guide axis and optical emissions are received from the excited chemical species along such axis.

  19. High-resolution retinal imaging using adaptive optics and Fourier-domain optical coherence tomography

    DOE Patents [OSTI]

    Olivier, Scot S. (Livermore, CA); Werner, John S. (Davis, CA); Zawadzki, Robert J. (Sacramento, CA); Laut, Sophie P. (Pasedena, CA); Jones, Steven M. (Livermore, CA)

    2010-09-07T23:59:59.000Z

    This invention permits retinal images to be acquired at high speed and with unprecedented resolution in three dimensions (4.times.4.times.6 .mu.m). The instrument achieves high lateral resolution by using adaptive optics to correct optical aberrations of the human eye in real time. High axial resolution and high speed are made possible by the use of Fourier-domain optical coherence tomography. Using this system, we have demonstrated the ability to image microscopic blood vessels and the cone photoreceptor mosaic.

  20. PRINCIPLES OF SCIENTIFIC INSTRUMENTS Spring 2012

    E-Print Network [OSTI]

    Sharp, Kim

    /email interaction. Course requirements: Participation in class discussion, problem sets, take home final exam of exponential behavior in chem., biochem., physics: molecules vs. instruments. 6 Light absorption densitometry, energy transfer, photobleaching and single molec., image analysis. Anisotropy and molecular mobility

  1. MENTORING EIN ERFOLGREICHES INSTRUMENT DER PERSONALENTWICKLUNG

    E-Print Network [OSTI]

    Greifswald, Ernst-Moritz-Arndt-Universität

    MENTORING ­ EIN ERFOLGREICHES INSTRUMENT DER PERSONALENTWICKLUNG VON JUNGEN WISSENSCHAFTLERINNEN für Doktorandinnen INFORMATIONEN UND KONTAKT MENTORING-PROGRAMM für Doktorandinnen Ansprechpartnerinnen an den Universitäten Greifswald und Rostock Annette Ehmler Telefon 03834 861146 mentoring

  2. Cellular telephone-based radiation detection instrument

    DOE Patents [OSTI]

    Craig, William W. (Pittsburg, CA); Labov, Simon E. (Berkeley, CA)

    2011-06-14T23:59:59.000Z

    A network of radiation detection instruments, each having a small solid state radiation sensor module integrated into a cellular phone for providing radiation detection data and analysis directly to a user. The sensor module includes a solid-state crystal bonded to an ASIC readout providing a low cost, low power, light weight compact instrument to detect and measure radiation energies in the local ambient radiation field. In particular, the photon energy, time of event, and location of the detection instrument at the time of detection is recorded for real time transmission to a central data collection/analysis system. The collected data from the entire network of radiation detection instruments are combined by intelligent correlation/analysis algorithms which map the background radiation and detect, identify and track radiation anomalies in the region.

  3. A nano-stepping robotic instrumentation platform

    E-Print Network [OSTI]

    Wahab, Adam Joseph

    2013-01-01T23:59:59.000Z

    The development of an Autonomous Nano-stepping Tool (ANT) system is presented. Each ANT is a small, tripodal, robotic instrument capable of untethered precision motion within a quasi-three-dimensional workspace of arbitrary ...

  4. Enhanced In-pile Instrumentation for Material Testing Reactors

    SciTech Connect (OSTI)

    Joy Rempe; Darrell Knudson; Joshua Daw; Troy Unruh; Benjamin Chase; Kurt Davis; Robert Schley

    2012-07-01T23:59:59.000Z

    An increasing number of U.S. nuclear research programs are requesting enhanced in-pile instrumentation capable of providing real-time measurements of key parameters during irradiations. For example, fuel research and development funded by the U.S. Department of Energy now emphasize approaches that rely on first principle models to develop optimized fuel designs that offer significant improvements over current fuels. To facilitate this approach, high fidelity, real-time data are essential for characterizing the performance of new fuels during irradiation testing. Furthermore, sensors that obtain such data must be miniature, reliable and able to withstand high flux/high temperature conditions. Depending on user requirements, sensors may need to obtain data in inert gas, pressurized water, or liquid metal environments. To address these user needs, in-pile instrumentation development efforts have been initiated as part of the Advanced Test Reactor (ATR) National Scientific User Facility (NSUF), the Fuel Cycle Research & Development (FCR&D), and the Nuclear Energy Enabling Technology (NEET) programs. This paper reports on recent INL achievements to support these programs. Specifically, an overview of the types of sensors currently available to support in-pile irradiations and those sensors currently available to MTR users are identified. In addition, recent results and products available from sensor research and development are detailed. Specifically, progress in deploying enhanced in-pile sensors for detecting elongation and thermal conductivity are reported. Results from research to evaluate the viability of ultrasonic and fiber optic technologies for irradiation testing are also summarized.

  5. Calibration of LSST Instrumental and Atmospheric Photometric Passbands

    SciTech Connect (OSTI)

    Burke, David L.; /SLAC; Axelrod, T.; /Arizona U., Astron. Dept. - Steward Observ.; Barrau, Aurelien; Baumont, Sylvain; /LPSC, Grenoble; Blondin, Stephane; /Marseille, CPPM; Claver, Chuck; /NOAO, Tucson; Gorecki, Alexia; /LPSC, Grenoble; Ivezic, Zeljko; Jones, Lynne; /Washington U., Seattle, Astron. Dept.; Krabbendam, Victor; Liang, Ming; Saha, Abhijit; /NOAO, Tucson; Smith, Allyn; /Austin Peay State U.; Smith, R.Chris; /Cerro-Tololo InterAmerican Obs.; Stubbs, Christopher W.; /Harvard-Smithsonian Ctr. Astrophys.

    2011-07-06T23:59:59.000Z

    The Large Synoptic Survey Telescope (LSST) will continuously image the entire sky visible from Cerro Pachon in northern Chile every 3-4 nights throughout the year. The LSST will provide data for a broad range of science investigations that require better than 1% photometric precision across the sky (repeatability and uniformity) and a similar accuracy of measured broadband color. The fast and persistent cadence of the LSST survey will significantly improve the temporal sampling rate with which celestial events and motions are tracked. To achieve these goals, and to optimally utilize the observing calendar, it will be necessary to obtain excellent photometric calibration of data taken over a wide range of observing conditions - even those not normally considered 'photometric'. To achieve this it will be necessary to routinely and accurately measure the full optical passband that includes the atmosphere as well as the instrumental telescope and camera system. The LSST mountain facility will include a new monochromatic dome illumination projector system to measure the detailed wavelength dependence of the instrumental passband for each channel in the system. The facility will also include an auxiliary spectroscopic telescope dedicated to measurement of atmospheric transparency at all locations in the sky during LSST observing. In this paper, we describe these systems and present laboratory and observational data that illustrate their performance.

  6. An instrument for 3D x-ray nano-imaging

    SciTech Connect (OSTI)

    Holler, M.; Raabe, J.; Diaz, A.; Guizar-Sicairos, M.; Quitmann, C.; Menzel, A.; Bunk, O. [Paul Scherrer Institut, 5232 Villigen PSI (Switzerland)

    2012-07-15T23:59:59.000Z

    We present an instrument dedicated to 3D scanning x-ray microscopy, allowing a sample to be precisely scanned through a beam while the angle of x-ray incidence can be changed. The position of the sample is controlled with respect to the beam-defining optics by laser interferometry. The instrument achieves a position stability better than 10 nm standard deviation. The instrument performance is assessed using scanning x-ray diffraction microscopy and we demonstrate a resolution of 18 nm in 2D imaging of a lithographic test pattern while the beam was defined by a pinhole of 3 {mu}m in diameter. In 3D on a test object of copper interconnects of a microprocessor, a resolution of 53 nm is achieved.

  7. Optical coupler

    DOE Patents [OSTI]

    Majewski, Stanislaw; Weisenberger, Andrew G.

    2004-06-15T23:59:59.000Z

    In a camera or similar radiation sensitive device comprising a pixilated scintillation layer, a light guide and an array of position sensitive photomultiplier tubes, wherein there exists so-called dead space between adjacent photomultiplier tubes the improvement comprising a two part light guide comprising a first planar light spreading layer or portion having a first surface that addresses the scintillation layer and optically coupled thereto at a second surface that addresses the photomultiplier tubes, a second layer or portion comprising an array of trapezoidal light collectors defining gaps that span said dead space and are individually optically coupled to individual position sensitive photomultiplier tubes. According to a preferred embodiment, coupling of the trapezoidal light collectors to the position sensitive photomultiplier tubes is accomplished using an optical grease having about the same refractive index as the material of construction of the two part light guide.

  8. Optical analyzer

    DOE Patents [OSTI]

    Hansen, A.D.

    1987-09-28T23:59:59.000Z

    An optical analyzer wherein a sample of particulate matter, and particularly of organic matter, which has been collected on a quartz fiber filter is placed in a combustion tube, and light from a light source is passed through the sample. The temperature of the sample is raised at a controlled rate and in a controlled atmosphere. The magnitude of the transmission of light through the sample is detected as the temperature is raised. A data processor, differentiator and a two pen recorder provide a chart of the optical transmission versus temperature and the rate of change of optical transmission versus temperature signatures (T and D) of the sample. These signatures provide information as to physical and chemical processes and a variety of quantitative and qualitative information about the sample. Additional information is obtained by repeating the run in different atmospheres and/or different rates or heating with other samples of the same particulate material collected on other filters. 7 figs.

  9. Optical memory

    DOE Patents [OSTI]

    Mao, Samuel S; Zhang, Yanfeng

    2013-07-02T23:59:59.000Z

    Optical memory comprising: a semiconductor wire, a first electrode, a second electrode, a light source, a means for producing a first voltage at the first electrode, a means for producing a second voltage at the second electrode, and a means for determining the presence of an electrical voltage across the first electrode and the second electrode exceeding a predefined voltage. The first voltage, preferably less than 0 volts, different from said second voltage. The semiconductor wire is optically transparent and has a bandgap less than the energy produced by the light source. The light source is optically connected to the semiconductor wire. The first electrode and the second electrode are electrically insulated from each other and said semiconductor wire.

  10. Compact MEMS-based Adaptive Optics Optical Coherence Tomography for Clinical Use

    SciTech Connect (OSTI)

    Chen, D; Olivier, S; Jones, S; Zawadzki, R; Evans, J; Choi, S; Werner, J

    2008-02-04T23:59:59.000Z

    We describe a compact MEMS-based adaptive optics (AO) optical coherence tomography system with improved AO performance and ease of clinical use. A typical AO system consists of a Shack-Hartmann wavefront sensor and a deformable mirror that measures and corrects the ocular and system aberrations. Because of the limitation on the current deformable mirror technologies, the amount of real-time ocular-aberration compensation is restricted and small in the previous AO-OCT instruments. In this instrument, we proposed to add an optical apparatus to correct the spectacle aberrations of the patients such as myopia, hyperopia and astigmatism. This eliminated the tedious process of the trial lenses in clinical imaging. Different amount of spectacle aberration compensation was achieved by motorized stages and automated with the AO computer for ease of clinical use. In addition, the compact AO-OCT was optimized to have minimum system aberrations to reduce AO registration errors and improve AO performance.

  11. The application of fiber optic sensors to the monitoring of roller element bearing systems 

    E-Print Network [OSTI]

    Juarez, Juan Carlos

    2002-01-01T23:59:59.000Z

    A rotating machinery test rig was instrumented with fiber optic Fabry-Perot Interferometer (FFPI) strain sensors for condition monitoring of rolling element bearings. Wavelength division multiplexing (WDM) was utilized to simultaneously monitor...

  12. Performance of the upgraded LTP-II at the ALS Optical Metrology Laboratory

    E-Print Network [OSTI]

    Kirschman, Jonathan L.; Advanced Light Source

    2008-01-01T23:59:59.000Z

    the Advanced Light Source,” BESSY Measurement Report (July,for X- ray Optics at BESSY,” AIP Conf. Proc. 705, 847-850measuring instruments, such as BESSY NOM. 5 A few years ago,

  13. Optical Probe for Semiconductor: Cooperative Research and Development Final Report, CRADA Number CRD-06-206

    SciTech Connect (OSTI)

    Sopori, B.

    2011-02-01T23:59:59.000Z

    This CRADA involves development of a new semiconductor characterization tool, Optical Probe, which can be commercialized by GT Solar. GT Solar will participate in the design and testing of this instrument that will be developed under an IPP project.

  14. Optical switch

    DOE Patents [OSTI]

    Reedy, R.P.

    1987-11-10T23:59:59.000Z

    An optical switching device is provided whereby light from a first glass fiber or a second glass fiber may be selectively transmitted into a third glass fiber. Each glass fiber is provided with a focusing and collimating lens system. In one mode of operation, light from the first glass fiber is reflected by a planar mirror into the third glass fiber. In another mode of operation, light from the second glass fiber passes directly into the third glass fiber. The planar mirror is attached to a rotatable table which is rotated to provide the optical switching. 3 figs.

  15. SciTech Connect: Nuclear power reactor instrumentation systems...

    Office of Scientific and Technical Information (OSTI)

    of Publication: United States Language: English Subject: N79400* --Reactors--Reactor Control Systems; N46110 -- Instrumentation--Radiation Detection Instruments--General...

  16. analysis instruments add: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    to giveCHEM 434 INSTRUMENTAL ANALYSIS Southern Illinois University Carbondale SYLLABUS FOR FALL 2014 Nickrent, Daniel L. 2 Instrumenting Executables for Dynamic Analysis...

  17. Development of a Low-Temperature Photoelectron Spectroscopy Instrument...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Low-Temperature Photoelectron Spectroscopy Instrument Using an Electrospray Ion Source and a Cryogenically Development of a Low-Temperature Photoelectron Spectroscopy Instrument...

  18. Instrumentation Technical Program Management Team: FY-1987 annual report

    SciTech Connect (OSTI)

    Hanson, M.L.; Englert, G.L.; Grametbauer, G.L.

    1988-04-14T23:59:59.000Z

    This report contains evaluations of process, environmental, health, and safety instrumentation of gaseous diffusion plants. The study was conducted by the instrumentation technical program management team. (LSP)

  19. IceCube: An Instrument for Neutrino Astronomy

    SciTech Connect (OSTI)

    IceCube Collaboration; Halzen, F.; Klein, S.

    2010-06-04T23:59:59.000Z

    Neutrino astronomy beyond the Sun was first imagined in the late 1950s; by the 1970s, it was realized that kilometer-scale neutrino detectors were required. The first such instrument, IceCube, is near completion and taking data. The IceCube project transforms a cubic kilometer of deep and ultra-transparent Antarctic ice into a particle detector. A total of 5,160 optical sensors are embedded into a gigaton of Antarctic ice to detect the Cherenkov light emitted by secondary particles produced when neutrinos interact with nuclei in the ice. Each optical sensor is a complete data acquisition system, including a phototube, digitization electronics, control and trigger systems and LEDs for calibration. The light patterns reveal the type (flavor) of neutrino interaction and the energy and direction of the neutrino, making neutrino astronomy possible. The scientific missions of IceCube include such varied tasks as the search for sources of cosmic rays, the observation of Galactic supernova explosions, the search for dark matter, and the study of the neutrinos themselves. These reach energies well beyond those produced with accelerator beams.

  20. Spring/dimple instrument tube restraint

    DOE Patents [OSTI]

    DeMario, E.E.; Lawson, C.N.

    1993-11-23T23:59:59.000Z

    A nuclear fuel assembly for a pressurized water nuclear reactor has a spring and dimple structure formed in a non-radioactive insert tube placed in the top of a sensor receiving instrumentation tube thimble disposed in the fuel assembly and attached at a top nozzle, a bottom nozzle, and intermediate grids. The instrumentation tube thimble is open at the top, where the sensor or its connection extends through the cooling water for coupling to a sensor signal processor. The spring and dimple insert tube is mounted within the instrumentation tube thimble and extends downwardly adjacent the top. The springs and dimples restrain the sensor and its connections against lateral displacement causing impact with the instrumentation tube thimble due to the strong axial flow of cooling water. The instrumentation tube has a stainless steel outer sleeve and a zirconium alloy inner sleeve below the insert tube adjacent the top. The insert tube is relatively non-radioactivated inconel alloy. The opposed springs and dimples are formed on diametrically opposite inner walls of the insert tube, the springs being formed as spaced axial cuts in the insert tube, with a web of the insert tube between the cuts bowed radially inwardly for forming the spring, and the dimples being formed as radially inward protrusions opposed to the springs. 7 figures.

  1. Sandia Energy - Quantum Optics

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Quantum Optics Home Energy Research EFRCs Solid-State Lighting Science EFRC Quantum Optics Quantum OpticsTara Camacho-Lopez2015-03-30T16:37:03+00:00 Quantum Optics with a Single...

  2. Nuclear Instruments and Methods in Physics Research A 356 (1995) l-4 INSTRUMENTS

    E-Print Network [OSTI]

    Dutz, Hartmut

    ELSEVIER Nuclear Instruments and Methods in Physics Research A 356 (1995) l-4 NUCLEAR INSTRUMENTS 8 METHODS IN PHYSICS REgtR?n Thermodynamics of dynamic nuclear polarization W.Th. Wenckebach Faculty ofApplied Physics, Delfr Unicersity of Technology, P.O.B. 5046, 2600 GA De& The Netherlands Abstract Dynamic nuclear

  3. Pulse energy measurement at the SXR instrument

    DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

    Moeller, Stefan; Brown, Garth; Dakovski, Georgi; Hill, Bruce; Holmes, Michael; Loos, Jennifer; Maida, Ricardo; Paiser, Ernesto; Schlotter, William; Turner, Joshua J.; et al

    2015-05-01T23:59:59.000Z

    A gas monitor detector was implemented and characterized at the Soft X-ray Research (SXR) instrument to measure the average, absolute and pulse-resolved photon flux of the LCLS beam in the energy range between 280 and 2000 eV. The detector is placed after the monochromator and addresses the need to provide reliable absolute pulse energy as well as pulse-resolved measurements for the various experiments at this instrument. This detector provides a reliable non-invasive measurement for determining flux levels on the samples in the downstream experimental chamber and for optimizing signal levels of secondary detectors and for the essential need of datamore »normalization. The design, integration into the instrument and operation are described, and examples of its performance are given.« less

  4. Instrumentation to Enhance Advanced Test Reactor Irradiations

    SciTech Connect (OSTI)

    J. L. Rempe; D. L. Knudson; K. G. Condie; J. E. Daw; S. C. Taylor

    2009-09-01T23:59:59.000Z

    The Department of Energy (DOE) designated the Advanced Test Reactor (ATR) as a National Scientific User Facility (NSUF) in April 2007 to support U.S. leadership in nuclear science and technology. By attracting new research users - universities, laboratories, and industry - the ATR will support basic and applied nuclear research and development, further advancing the nation's energy security needs. A key component of the ATR NSUF effort is to prove new in-pile instrumentation techniques that are capable of providing real-time measurements of key parameters during irradiation. To address this need, an assessment of instrumentation available and under-development at other test reactors has been completed. Based on this review, recommendations are made with respect to what instrumentation is needed at the ATR and a strategy has been developed for obtaining these sensors. Progress toward implementing this strategy is reported in this document. It is anticipated that this report will be updated on an annual basis.

  5. First results of the Instrumentation Line for the deep-sea ANTARES neutrino telescope

    E-Print Network [OSTI]

    Aguilar, J A; Ameli, F; Anghinolfi, M; Anton, G; Anvar, S; Aslanides, E; Aubert, Jean-Jacques; Barbarito, E; Basa, S; Battaglieri, M; Becherini, Y; Bellotti, R; Beltramelli, J; Bertin, V; Bigi, A; Billault, M; Blaes, R; de Botton, N; Bouwhuis, M C; Bradbury, S M; Bruijn, R; Brunner, J; Burgio, G F; Busto, J; Cafagna, F; Caillat, L; Calzas, A; Capone, A; Caponetto, L; Carmona, E; Carr, J; Cartwright, S L; Castel, D; Castorina, E; Cavasinni, V; Cecchini, S; Ceres, A; Charvis, P; Chauchot, P; Chiarusi, T; Circella, M; Colnard, C; Compere, C; Coniglione, R; Cottini, N; Coyle, P; Cuneo, S; Cussatlegras, A S; Damy, G; Van Dantzig, R; De Marzo, C; Dekeyser, I; Delagnes, E; Denans, D; Deschamps, A; Dessages-Ardellier, F; Destelle, J J; Dinkespieler, B; Distefano, C; Donzaud, C; Drogou, J F; Druillole, F; Durand, D; Ernenwein, J P; Escoffier, S; Falchini, E; Favard, S; Feinstein, F; Ferry, S; Festy, D; Fiorello, C; Flaminio, V; Galeotti, S; Gallone, J M; Giacomelli, G; Girard, N; Gojak, C; Goret, P; Graf, K; Hallewell, G D; Harakeh, M N; Hartmann, B; Heijboer, A; Heine, E; Hello, Y; Hernández-Rey, J J; Hossl, J; Hoffman, C; Hogenbirk, J; Hubbard, John R; Jaquet, M; Jaspers, M; De Jong, M; Jouvenot, F; Kalantar-Nayestanaki, N; Kappes, A; Karg, T; Karkar, S; Katz, U; Keller, P; Kok, H; Kooijman, P; Kopper, C; Korolkova, E V; Kouchner, A; Kretschmer, W; Kruijer, A; Kuch, S; Kudryavtsev, V A; Lachartre, D; Lafoux, H; Lagier, P; Lahmann, R; Lamanna, G; Lamare, P; Languillat, J C; Laschinsky, H; Le Guen, Y; Le Provost, H; Le Van-Suu, A; Legou, T; Lim, G; Lo Nigro, L; Lo Presti, D; Löhner, H; Loucatos, Sotirios S; Louis, F; Lucarelli, F; Lyashuk, V; Marcelin, M; Margiotta, A; Masullo, R; Mazéas, F; Mazure, A; McMillan, J E; Megna, R; Melissas, M; Migneco, E; Milovanovic, A; Mongelli, M; Montaruli, T; Morganti, M; Moscoso, L; Musumeci, M; Naumann, C; Naumann-Godo, M; Niess, V; Olivetto, C; Ostasch, R; Palanque-Delabrouille, Nathalie; Payre, P; Peek, H; Petta, C; Piattelli, P; Pineau, J P; Poinsignon, J; Popa, V; Pradier, T; Racca, C; Randazzo, N; Van Randwijk, J; Real, D; Van Rens, B; Rethore, F; Rewiersma, P A M; Riccobene, G; Rigaud, V; Ripani, M; Roca, V; Roda, C; Rolin, J F; Romita, M; Rose, H J; Rostovtsev, A; Roux, J; Ruppi, M; Russo, G V; Salesa, F; Salomon, K; Sapienza, P; Schmitt, F; Schuller, J P; Shadnize, R; Sokalski, I A; Spona, T; Spurio, M; van der Steenhoven, G; Stolarczyk, T; Streeb, K; Stubert, D; Sulak, L; Taiuti, M; Tamburini, C; Tao, C; Terreni, G; Thompson, L F; Valdy, P; Valente, V; Vallage, B; Venekamp, G; Verlaat, B; Vernin, P; De Vita, R; De Vries, G; Van Wijk, R F; De Witt-Huberts, P K A; Wobbe, G; De Wolf, E; Yao, A F; Zaborov, D; Zaccone, Henri; De Dios-Zornoza-Gomez, Juan; Zúñiga, J; Deceased

    2006-01-01T23:59:59.000Z

    In 2005, the ANTARES Collaboration deployed and operated at a depth of 2500 m a so-called Mini Instrumentation Line equipped with Optical Modules (MILOM) at the ANTARES site. The various data acquired during the continuous operation from April to December 2005 of the MILOM confirm the satisfactory performance of the Optical Modules, their front-end electronics and readout system, as well as the calibration devices of the detector. The in-situ measurement of the Optical Module time response yields a resolution better than 0.5 ns. The performance of the acoustic positioning system, which enables the spatial reconstruction of the ANTARES detector with a precision of about 10 cm, is verified. These results demonstrate that with the full ANTARES neutrino telescope the design angular resolution of better than $0.3^\\circ$ can be realistically achieved.

  6. Parallel optical sampler

    DOE Patents [OSTI]

    Tauke-Pedretti, Anna; Skogen, Erik J; Vawter, Gregory A

    2014-05-20T23:59:59.000Z

    An optical sampler includes a first and second 1.times.n optical beam splitters splitting an input optical sampling signal and an optical analog input signal into n parallel channels, respectively, a plurality of optical delay elements providing n parallel delayed input optical sampling signals, n photodiodes converting the n parallel optical analog input signals into n respective electrical output signals, and n optical modulators modulating the input optical sampling signal or the optical analog input signal by the respective electrical output signals, and providing n successive optical samples of the optical analog input signal. A plurality of output photodiodes and eADCs convert the n successive optical samples to n successive digital samples. The optical modulator may be a photodiode interconnected Mach-Zehnder Modulator. A method of sampling the optical analog input signal is disclosed.

  7. ACRF Instrumentation Status: New, Current, and Future - April 2008

    SciTech Connect (OSTI)

    JW Voyles

    2008-05-01T23:59:59.000Z

    The purpose of this report is to provide a concise but comprehensive overview of Atmospheric Radiation Measurement Climate Research Facility instrumentation status. The report is divided into the following five sections: (1) new instrumentation in the process of being acquired and deployed, (2) field campaigns, (3) existing instrumentation and progress on improvements or upgrades, (4) proposed future instrumentation, and (5) Small Business Innovation Research instrument development.

  8. ACRF Instrumentation Status: New, Current, and Future July 2006

    SciTech Connect (OSTI)

    JC Liljegren

    2006-07-01T23:59:59.000Z

    The purpose of this report is to provide a concise but comprehensive overview of Atmospheric Radiation Measurement Program Climate Research Facility instrumentation status. The report is divided into four sections: (1) new instrumentation in the process of being acquired and deployed, (2) existing instrumentation and progress on improvements or upgrades, (3) proposed future instrumentation, and (4) Small Business Innovation Research instrument development. New information is highlighted in blue text.

  9. ACRF Instrumentation Status: New, Current, and Future February 2009

    SciTech Connect (OSTI)

    JW Voyles

    2009-02-15T23:59:59.000Z

    The purpose of this report is to provide a concise but comprehensive overview of Atmospheric Radiation Measurement Climate Research Facility instrumentation status. The report is divided into the following five sections: (1) new instrumentation in the process of being acquired and deployed, (2) field campaigns, (3) existing instrumentation and progress on improvements or upgrades, (4) proposed future instrumentation, and (5) Small Business Innovation Research instrument development.

  10. ACRF Instrumentation Status: New, Current, and Future September 2006

    SciTech Connect (OSTI)

    JC Liljegren

    2006-09-01T23:59:59.000Z

    The purpose of this report is to provide a concise but comprehensive overview of Atmospheric Radiation Measurement Program Climate Research Facility instrumentation status. The report is divided into four sections: (1) new instrumentation in the process of being acquired and deployed, (2) existing instrumentation and progress on improvements or upgrades, (3) proposed future instrumentation, and (4) Small Business Innovation Research instrument development. New information is highlighted in blue text.

  11. ARM Climate Research Facility Monthly Instrument Report May 2010

    SciTech Connect (OSTI)

    Voyles, JW

    2010-06-21T23:59:59.000Z

    The purpose of this report is to provide a concise but comprehensive overview of Atmospheric Radiation Measurement Climate Research Facility instrumentation status. The report is divided into the following five sections: (1) new instrumentation in the process of being acquired and deployed, (2) field campaigns, (3) existing instrumentation and progress on improvements or upgrades, (4) proposed future instrumentation, and (5) Small Business Innovation Research instrument development.

  12. ACRF Instrumentation Status: New, Current, and Future - November 2008

    SciTech Connect (OSTI)

    JW Voyles

    2008-12-01T23:59:59.000Z

    The purpose of this report is to provide a concise but comprehensive overview of Atmospheric Radiation Measurement Climate Research Facility instrumentation status. The report is divided into the following five sections: (1) new instrumentation in the process of being acquired and deployed, (2) field campaigns, (3) existing instrumentation and progress on improvements or upgrades, (4) proposed future instrumentation, and (5) Small Business Innovation Research instrument development.

  13. ACRF Instrumentation Status: New, Current, and Future - May 2008

    SciTech Connect (OSTI)

    JW Voyles

    2008-05-01T23:59:59.000Z

    The purpose of this report is to provide a concise but comprehensive overview of Atmospheric Radiation Measurement Climate Research Facility instrumentation status. The report is divided into the following five sections: (1) new instrumentation in the process of being acquired and deployed, (2) field campaigns, (3) existing instrumentation and progress on improvements or upgrades, (4) proposed future instrumentation, and (5) Small Business Innovation Research instrument development.

  14. ACRF Instrumentation Status: New, Current, and Future - August 2008

    SciTech Connect (OSTI)

    JW Voyles

    2008-09-01T23:59:59.000Z

    The purpose of this report is to provide a concise but comprehensive overview of Atmospheric Radiation Measurement Climate Research Facility instrumentation status. The report is divided into the following five sections: (1) new instrumentation in the process of being acquired and deployed, (2) field campaigns, (3) existing instrumentation and progress on improvements or upgrades, (4) proposed future instrumentation, and (5) Small Business Innovation Research instrument development.

  15. ARM Climate Research Facility Instrumentation Status and Information October 2009

    SciTech Connect (OSTI)

    JW Voyles

    2009-10-01T23:59:59.000Z

    The purpose of this report is to provide a concise but comprehensive overview of Atmospheric Radiation Measurement Climate Research Facility instrumentation status. The report is divided into the following five sections: (1) new instrumentation in the process of being acquired and deployed, (2) field campaigns, (3) existing instrumentation and progress on improvements or upgrades, (4) proposed future instrumentation, and (5) Small Business Innovation Research instrument development.

  16. ARM Climate Research Facility Monthly Instrument Report August 2010

    SciTech Connect (OSTI)

    Voyles, JW

    2010-09-28T23:59:59.000Z

    The purpose of this report is to provide a concise but comprehensive overview of Atmospheric Radiation Measurement Climate Research Facility instrumentation status. The report is divided into the following five sections: (1) new instrumentation in the process of being acquired and deployed, (2) field campaigns, (3) existing instrumentation and progress on improvements or upgrades, (4) proposed future instrumentation, and (5) Small Business Innovation Research instrument development.

  17. ACRF Instrumentation Status: New, Current, and Future - September 2008

    SciTech Connect (OSTI)

    JW Voyles

    2008-10-15T23:59:59.000Z

    The purpose of this report is to provide a concise but comprehensive overview of Atmospheric Radiation Measurement Climate Research Facility instrumentation status. The report is divided into the following five sections: (1) new instrumentation in the process of being acquired and deployed, (2) field campaigns, (3) existing instrumentation and progress on improvements or upgrades, (4) proposed future instrumentation, and (5) Small Business Innovation Research instrument development.

  18. ARM Climate Research Facility Instrumentation Status and Information December 2009

    SciTech Connect (OSTI)

    JW Voyles

    2010-12-30T23:59:59.000Z

    The purpose of this report is to provide a concise but comprehensive overview of Atmospheric Radiation Measurement Climate Research Facility instrumentation status. The report is divided into the following five sections: (1) new instrumentation in the process of being acquired and deployed, (2) field campaigns, (3) existing instrumentation and progress on improvements or upgrades, (4) proposed future instrumentation, and (5) Small Business Innovation Research instrument development.

  19. ARM Climate Research Facility Monthly Instrument Report June 2010

    SciTech Connect (OSTI)

    Voyles, JW

    2010-07-13T23:59:59.000Z

    The purpose of this report is to provide a concise but comprehensive overview of Atmospheric Radiation Measurement Climate Research Facility instrumentation status. The report is divided into the following five sections: (1) new instrumentation in the process of being acquired and deployed, (2) field campaigns, (3) existing instrumentation and progress on improvements or upgrades, (4) proposed future instrumentation, and (5) Small Business Innovation Research instrument development.

  20. ACRF Instrumentation Status: New, Current, and Future - July 2008

    SciTech Connect (OSTI)

    JW Voyles

    2008-07-01T23:59:59.000Z

    The purpose of this report is to provide a concise but comprehensive overview of Atmospheric Radiation Measurement Climate Research Facility instrumentation status. The report is divided into the following five sections: (1) new instrumentation in the process of being acquired and deployed, (2) field campaigns, (3) existing instrumentation and progress on improvements or upgrades, (4) proposed future instrumentation, and (5) Small Business Innovation Research instrument development.

  1. ARM Climate Research Facility Monthly Instrument Report July 2010

    SciTech Connect (OSTI)

    Voyles, JW

    2010-08-18T23:59:59.000Z

    The purpose of this report is to provide a concise but comprehensive overview of Atmospheric Radiation Measurement Climate Research Facility instrumentation status. The report is divided into the following five sections: (1) new instrumentation in the process of being acquired and deployed, (2) field campaigns, (3) existing instrumentation and progress on improvements or upgrades, (4) proposed future instrumentation, and (5) Small Business Innovation Research instrument development.

  2. ARM Climate Research Facility Instrumentation Status and Information March 2010

    SciTech Connect (OSTI)

    Voyles, JW

    2010-04-19T23:59:59.000Z

    The purpose of this report is to provide a concise but comprehensive overview of Atmospheric Radiation Measurement Climate Research Facility instrumentation status. The report is divided into the following five sections: (1) new instrumentation in the process of being acquired and deployed, (2) field campaigns, (3) existing instrumentation and progress on improvements or upgrades, (4) proposed future instrumentation, and (5) Small Business Innovation Research instrument development.

  3. ARM Climate Research Facility Instrumentation Status and Information January 2010

    SciTech Connect (OSTI)

    JW Voyles

    2010-02-28T23:59:59.000Z

    The purpose of this report is to provide a concise but comprehensive overview of Atmospheric Radiation Measurement Climate Research Facility instrumentation status. The report is divided into the following five sections: (1) new instrumentation in the process of being acquired and deployed, (2) field campaigns, (3) existing instrumentation and progress on improvements or upgrades, (4) proposed future instrumentation, and (5) Small Business Innovation Research instrument development.

  4. ARM Climate Research Facility Instrumentation Status and Information February 2010

    SciTech Connect (OSTI)

    Voyles, JW

    2010-03-25T23:59:59.000Z

    The purpose of this report is to provide a concise but comprehensive overview of Atmospheric Radiation Measurement Climate Research Facility instrumentation status. The report is divided into the following five sections: (1) new instrumentation in the process of being acquired and deployed, (2) field campaigns, (3) existing instrumentation and progress on improvements or upgrades, (4) proposed future instrumentation, and (5) Small Business Innovation Research instrument development.

  5. ACRF Instrumentation Status: New, Current, and Future August 2006

    SciTech Connect (OSTI)

    JC Liljegren

    2006-08-01T23:59:59.000Z

    The purpose of this report is to provide a concise but comprehensive overview of Atmospheric Radiation Measurement Program Climate Research Facility instrumentation status. The report is divided into four sections: (1) new instrumentation in the process of being acquired and deployed, (2) existing instrumentation and progress on improvements or upgrades, (3) proposed future instrumentation, and (4) Small Business Innovation Research instrument development. New information is highlighted in blue text.

  6. ACRF Instrumentation Status: New, Current, and Future - December 2008

    SciTech Connect (OSTI)

    JW Voyles

    2009-01-15T23:59:59.000Z

    The purpose of this report is to provide a concise but comprehensive overview of Atmospheric Radiation Measurement Climate Research Facility instrumentation status. The report is divided into the following five sections: (1) new instrumentation in the process of being acquired and deployed, (2) field campaigns, (3) existing instrumentation and progress on improvements or upgrades, (4) proposed future instrumentation, and (5) Small Business Innovation Research instrument development.

  7. ACRF Instrumentation Status: New, Current, and Future - June 2008

    SciTech Connect (OSTI)

    JW Voyles

    2008-07-01T23:59:59.000Z

    The purpose of this report is to provide a concise but comprehensive overview of Atmospheric Radiation Measurement Climate Research Facility instrumentation status. The report is divided into the following five sections: (1) new instrumentation in the process of being acquired and deployed, (2) field campaigns, (3) existing instrumentation and progress on improvements or upgrades, (4) proposed future instrumentation, and (5) Small Business Innovation Research instrument development.

  8. ARM Climate Research Facility Instrumentation Status and Information April 2010

    SciTech Connect (OSTI)

    Voyles, JW

    2010-05-15T23:59:59.000Z

    The purpose of this report is to provide a concise but comprehensive overview of Atmospheric Radiation Measurement Climate Research Facility instrumentation status. The report is divided into the following five sections: (1) new instrumentation in the process of being acquired and deployed, (2) field campaigns, (3) existing instrumentation and progress on improvements or upgrades, (4) proposed future instrumentation, and (5) Small Business Innovation Research instrument development.

  9. ACRF Instrumentation Status: New, Current, and Future March 2009

    SciTech Connect (OSTI)

    JW Voyles

    2009-03-15T23:59:59.000Z

    The purpose of this report is to provide a concise but comprehensive overview of Atmospheric Radiation Measurement Climate Research Facility instrumentation status. The report is divided into the following five sections: (1) new instrumentation in the process of being acquired and deployed, (2) field campaigns, (3) existing instrumentation and progress on improvements or upgrades, (4) proposed future instrumentation, and (5) Small Business Innovation Research instrument development.

  10. ACRF Instrumentation Status: New, Current, and Future - October 2008

    SciTech Connect (OSTI)

    JW Voyles

    2008-10-01T23:59:59.000Z

    The purpose of this report is to provide a concise but comprehensive overview of Atmospheric Radiation Measurement Climate Research Facility instrumentation status. The report is divided into the following five sections: (1) new instrumentation in the process of being acquired and deployed, (2) field campaigns, (3) existing instrumentation and progress on improvements or upgrades, (4) proposed future instrumentation, and (5) Small Business Innovation Research instrument development.

  11. ACRF Instrumentation Status: New, Current, and Future - January 2009

    SciTech Connect (OSTI)

    JW Voyles

    2009-03-02T23:59:59.000Z

    The purpose of this report is to provide a concise but comprehensive overview of Atmospheric Radiation Measurement Climate Research Facility instrumentation status. The report is divided into the following five sections: (1) new instrumentation in the process of being acquired and deployed, (2) field campaigns, (3) existing instrumentation and progress on improvements or upgrades, (4) proposed future instrumentation, and (5) Small Business Innovation Research instrument development.

  12. ARM Climate Research Facility Monthly Instrument Report September 2010

    SciTech Connect (OSTI)

    Voyles, JW

    2010-10-18T23:59:59.000Z

    The purpose of this report is to provide a concise but comprehensive overview of Atmospheric Radiation Measurement Climate Research Facility instrumentation status. The report is divided into the following five sections: (1) new instrumentation in the process of being acquired and deployed, (2) field campaigns, (3) existing instrumentation and progress on improvements or upgrades, (4) proposed future instrumentation, and (5) Small Business Innovation Research instrument development.

  13. 305 Stimulus Isolator WORLD PRECISION INSTRUMENTS 1

    E-Print Network [OSTI]

    Kleinfeld, David

    dry cell batteries. NOTE: The Model 305 may be driven from devices other than the WPI Series Anapulse INSTRUMENTS 2 Specifications Isolation Impedance to signal source ........................1011 Ohms, shunted by 2 pF Impedance to ground ..................................1011 Ohms, shunted by 15 pF Input Accepts

  14. EXPERIMENT 5 FTIR Instrument Operation and Calibration

    E-Print Network [OSTI]

    Nazarenko, Alexander

    EXPERIMENT 5 FTIR Instrument Operation and Calibration OBJECTIVE 1. To become acquainted with the operation of the FTIR spectrometer and with calibration of the wavelength scale. 2. To prepare reference guide. You will use a polystyrene film standard to check the wavelength calibration. INTRODUCTION

  15. UW SCHOOL OF PHARMACY INSTRUMENTATION COMMITTEE

    E-Print Network [OSTI]

    Sheridan, Jennifer

    UW SCHOOL OF PHARMACY INSTRUMENTATION COMMITTEE 2013-2014 Warren Heideman (chair) Mass spec users-related activities of the School. 4. Provide input and advice to the Dean on issues of importance to the AIC the research enterprise within the School of Pharmacy, across campus, and in the scientific community such as

  16. Integrated polymerase chain reaction/electrophoresis instrument

    DOE Patents [OSTI]

    Andresen, Brian D. (Livermore, CA)

    2000-01-01T23:59:59.000Z

    A new approach and instrument for field identification of micro-organisms and DNA fragments using a small and disposable device containing integrated polymerase chain reaction (PCR) enzymatic reaction wells, attached capillary electrophoresis (CE) channels, detectors, and read-out all on/in a small hand-held package. The analysis instrument may be made inexpensively, for example, of plastic, and thus is disposable, which minimizes cross contamination and the potential for false positive identification between samples. In addition, it is designed for multiple users with individual applications. The integrated PCR/CE is manufactured by the PCR well and CE channels are "stamped" into plastic depressions where conductive coatings are made in the wells and ends of the CE microchannels to carry voltage and current to heat the PCR reaction mixtures and simultaneously draw DNA bands up the CE channels. Light is transmitted through the instrument at appropriate points and detects PCR bands and identifies DNA fragments by size (retention time) and quantifies each by the amount of light generated as each phototransistor positioned below each CE channel detects a passing band. The instrument is so compact that at least 100 PCR/CE reactions/analyses can be performed easily on one detection device.

  17. SNS Vacuum Instrumentation and Control System

    SciTech Connect (OSTI)

    J. Y. Tang; L. A. Smart; H. C. Hseuh; P. S. Marroquin; L. R. Dalesio; S. A. Lewis; C. A. Lionberger; K. Kishiyama; D. P. Gurd; M. Hechler; W. Schneider

    2001-11-01T23:59:59.000Z

    The Spallation Neutron Source (SNS) vacuum instrumentation and control systems are being designed at Lawrence Berkeley National Laboratory (LBNL), Brookhaven National Laboratory (BNL), Thomas Jefferson National Accelerator facility (TJNAF) and Los Alamos National Laboratory (LANL). Each participating lab is responsible for a different section of the machine: LBNL for the Front-End section, LANL for the warm LINAC section, TJNAF for the cold LINAC section and BNL for the Ring and transfer line sections. The vacuum instrumentation and control systems are scheduled to be installed and be in operation at Oak Ridge National Laboratory in 2004 or 2005. Although the requirements vary for different sections of the machine, a collaborative effort has been made to standardize vacuum instrumentation components and the global control system interfaces. This paper summarizes the design of each sub-section of vacuum instrumentation and control system and discusses SNS standards for Ion Pump and Gauge controllers, Programmable Logic Controller (PLC) interfaces, Ladder Logic programming and the SNS global control system interfaces.

  18. Cooling the dark energy camera instrument

    SciTech Connect (OSTI)

    Schmitt, R.L.; Cease, H.; /Fermilab; DePoy, D.; /Ohio State U.; Diehl, H.T.; Estrada, J.; Flaugher, B.; /Fermilab; Kuhlmann, S.; /Ohio State U.; Onal, Birce; Stefanik, A.; /Fermilab

    2008-06-01T23:59:59.000Z

    DECam, camera for the Dark Energy Survey (DES), is undergoing general design and component testing. For an overview see DePoy, et al in these proceedings. For a description of the imager, see Cease, et al in these proceedings. The CCD instrument will be mounted at the prime focus of the CTIO Blanco 4m telescope. The instrument temperature will be 173K with a heat load of 113W. In similar applications, cooling CCD instruments at the prime focus has been accomplished by three general methods. Liquid nitrogen reservoirs have been constructed to operate in any orientation, pulse tube cryocoolers have been used when tilt angles are limited and Joule-Thompson or Stirling cryocoolers have been used with smaller heat loads. Gifford-MacMahon cooling has been used at the Cassegrain but not at the prime focus. For DES, the combined requirements of high heat load, temperature stability, low vibration, operation in any orientation, liquid nitrogen cost and limited space available led to the design of a pumped, closed loop, circulating nitrogen system. At zenith the instrument will be twelve meters above the pump/cryocooler station. This cooling system expected to have a 10,000 hour maintenance interval. This paper will describe the engineering basis including the thermal model, unbalanced forces, cooldown time, the single and two-phase flow model.

  19. MICROHOLE TECHNOLOGY -PROGRESS ON BOREHOLE INSTRUMENTATION DEVELOPMENT

    E-Print Network [OSTI]

    will comprise a very low cost alternative to currently available technology for deep subsurface characterizationMICROHOLE TECHNOLOGY - PROGRESS ON BOREHOLE INSTRUMENTATION DEVELOPMENT Jim Albright j Microhole technology development is based on the premise that with advances in electronics and sensors

  20. Metrology of reflection optics for synchrotron radiation

    SciTech Connect (OSTI)

    Takacs, P.Z.

    1985-09-01T23:59:59.000Z

    Recent years have seen an almost explosive growth in the number of beam lines on new and existing synchrotron radiation facilities throughout the world. The need for optical components to utilize the unique characteristics of synchrotron radiation has increased accordingly. Unfortunately, the technology to manufacture and measure the large, smooth, exotic optical surfaces required to focus and steer the synchrotron radiation beam has not progressed as rapidly as the operational demands on these components. Most companies do not wish to become involved with a project that requires producing a single, very expensive, aspheric optic with surface roughness and figure tolerances that are beyond their capabilities to measure. This paper will review some of the experiences of the National Synchrotron Light Source in procuring grazing incidence optical components over the past several years. We will review the specification process - how it is related to the function of the optic, and how it relates to the metrology available during the manufacturing process and after delivery to the user's laboratory. We will also discuss practical aspects of our experience with new technologies, such as single point diamond turning of metal mirrors and the use of SiC as a mirror material. Recent advances in metrology instrumentation have the potential to move the measurement of surface figure and finish from the research laboratory into the optical shop, which should stimulate growth and interest in the manufacturing of optics to meet the needs of the synchrotron radiation user community.

  1. Ultrafast optics For optics and photonics course,

    E-Print Network [OSTI]

    Palffy-Muhoray, Peter

    ultrafast and ultrashort generally describe pulses of widths in the nanosecond to femtosecond, or shorterUltrafast optics For optics and photonics course, Spring 2012 By :Alireza Moheghi Ultrafast optics, regimes. · Interest in ultrashort optical pulses began with the invention of the laser, · Ultrashort

  2. Matter in Extreme Conditions instrument (MECi)

    E-Print Network [OSTI]

    Wechsler, Risa H.

    ) · LCLS parameters · Layout · X-ray optics · Lasers systems · Baseline component summary #12;LCLS Beam per pulse: ~ 1mJ (1x1012 photons @ 8 keV · Pulse length 100 fsec #12;LCLS Experimental HallsLCLS

  3. Protective shield for an instrument probe

    DOE Patents [OSTI]

    Johnsen, Howard A.; Ross, James R.; Birtola, Sal R.

    2004-10-26T23:59:59.000Z

    A shield is disclosed that is particularly useful for protecting exposed optical elements at the end of optical probes used in the analysis of hazardous emissions in and around an industrial environment from the contaminating effects of those emissions. The instant invention provides a hood or cowl in the shape of a right circular cylinder that can be fitted over the end of such optical probes. The hood provides a clear aperture through which the probe can perform unobstructed analysis. The probe optical elements are protected from the external environment by passing a dry gas through the interior of the hood and out through the hood aperture in sufficient quantity and velocity to prevent any significant mixing between the internal and external environments. Additionally, the hood is provided with a cooling jacket to lessen the potential for damaging the probe due to temperature excursions.

  4. PERFORMANCE CONFIRMATION IN-SITU INSTRUMENTATION

    SciTech Connect (OSTI)

    N.T. Raczka

    2000-05-23T23:59:59.000Z

    The purpose of this document is to identify and analyze the types of in-situ instruments and methods that could be used in support of the data acquisition portion of the Performance Confirmation (PC) program at the potential nuclear waste repository at Yucca Mountain. The PC program will require geomechanical , geophysical, thermal, and hydrologic instrumentation of several kinds. This analysis is being prepared to document the technical issues associated with each type of measurement during the PC period. This analysis utilizes the ''Performance Confirmation Input Criteria'' (CRWMS M&O 1999a) as its starting point. The scope of this analysis is primarily on the period after the start of waste package emplacement and before permanent closure of the repository, a period lasting between 15 and 300 years after last package emplacement (Stroupe 2000, Attachment 1, p. 1). The primary objectives of this analysis are to: (1) Review the design criteria as presented in the ''Performance Confirmation Input Criteria'' (CRWMS M&O 1999a). The scope of this analysis will be limited to the instrumentation related to parameters that require continuous monitoring of the conditions underground. (2) Preliminary identification and listing of the data requirements and parameters as related to the current repository layout in support of PC monitoring. (3) Preliminary identification of methods and instrumentation for the acquisition of the required data. Although the ''Performance Confirmation Input Criteria'' (CRWMS M&O 1999a) defines a broad range of data that must be obtained from a variety of methods, the focus of this analysis is on instrumentation related to the performance of the rock mass and the formation of water in the repository environment, that is obtainable from in-situ observation, testing, and monitoring.

  5. Optics and Optical Engineering Program Assessment Plan Program Learning Objectives

    E-Print Network [OSTI]

    Cantlon, Jessica F.

    Optics and Optical Engineering Program Assessment Plan Program Learning, and processes that underlie optics and optical engineering. 2. Strong understanding of the fundamental science, mathematics, and processes that underlie optics and optical

  6. Measurement of large strains in ropes using plastic optical fibers

    DOE Patents [OSTI]

    Williams, Jerry Gene; Smith, David Barton; Muhs, Jeffrey David

    2006-02-14T23:59:59.000Z

    A method for the direct measurement of large strains in ropes in situ using a plastic optical fiber, for example, perfluorocarbon or polymethyl methacrylate and Optical Time-Domain Reflectometer or other light time-of-flight measurement instrumentation. Protective sheaths and guides are incorporated to protect the plastic optical fiber. In one embodiment, a small rope is braided around the plastic optical fiber to impose lateral compressive forces to restrain the plastic optical fiber from slipping and thus experience the same strain as the rope. Methods are described for making reflective interfaces along the length of the plastic optical fiber and to provide the capability to measure strain within discrete segments of the rope. Interpretation of the data allows one to calculate the accumulated strain at any point in time and to determine if the rope has experienced local damage.

  7. Optical microphone

    DOE Patents [OSTI]

    Veligdan, James T. (Manorville, NY)

    2000-01-11T23:59:59.000Z

    An optical microphone includes a laser and beam splitter cooperating therewith for splitting a laser beam into a reference beam and a signal beam. A reflecting sensor receives the signal beam and reflects it in a plurality of reflections through sound pressure waves. A photodetector receives both the reference beam and reflected signal beam for heterodyning thereof to produce an acoustic signal for the sound waves. The sound waves vary the local refractive index in the path of the signal beam which experiences a Doppler frequency shift directly analogous with the sound waves.

  8. Optical devices

    DOE Patents [OSTI]

    Chaves, Julio C.; Falicoff, Waqidi; Minano, Juan C.; Benitez, Pablo; Dross, Oliver; Parkyn Jr., William A.

    2010-07-13T23:59:59.000Z

    An optical manifold for efficiently combining a plurality of blue LED outputs to illuminate a phosphor for a single, substantially homogeneous output, in a small, cost-effective package. Embodiments are disclosed that use a single or multiple LEDs and a remote phosphor, and an intermediate wavelength-selective filter arranged so that backscattered photoluminescence is recycled to boost the luminance and flux of the output aperture. A further aperture mask is used to boost phosphor luminance with only modest loss of luminosity. Alternative non-recycling embodiments provide blue and yellow light in collimated beams, either separately or combined into white.

  9. Optical microfluidics

    SciTech Connect (OSTI)

    Kotz, K.T.; Noble, K.A.; Faris, G.W. [Molecular Physics Laboratory, SRI International, 333 Ravenswood Avenue, Menlo Park, California 94025 (United States)

    2004-09-27T23:59:59.000Z

    We present a method for the control of small droplets based on the thermal Marangoni effect using laser heating. With this approach, droplets covering five orders of magnitude in volume ({approx}1.7 {mu}L to 14 pL), immersed in decanol, were moved on an unmodified polystyrene surface, with speeds of up to 3 mm/s. When two droplets were brought into contact, they spontaneously fused and rapidly mixed in less than 33 ms. This optically addressed microfluidic approach has many advantages for microfluidic transport, including exceptional reconfigurability, low intersample contamination, large volume range, extremely simple substrates, no electrical connections, and ready scaling to large arrays.

  10. Instrumentation Report No. 3: performance and reliability of instrumentation deployed for the Spent Fuel Test - Climax

    SciTech Connect (OSTI)

    Patrick, W.C.; Rector, N.L.; Scarafiotti, J.J.

    1984-12-01T23:59:59.000Z

    A demonstration of the short-term storage and subsequent retrieval of spent nuclear fuel assemblies was successfully completed at the US Department of Energy`s Nevada Test Site. Nearly 1000 instruments were deployed to monitor the temperature of rock, air, and metallic components of the test; displacements and stress changes within the rock mass; radiation dosage to personnel and to the rock; thermal energy input; characteristics of the ventilation airstream; and the operational status of the test. Careful selection, installation, calibration, and maintenance of these instruments ensured the acquisition of about 15.3 x 10{sup 6} high-quality data points. With few exceptions, the performance and reliability of the instrumentation and associated data acquisition system (DAS) were within specified acceptable limits. Details of the performance and reliability of the instrumentation are discussed in this report. 42 figs., 32 tabs.

  11. Instrumentation in Health Education and the Adolescent Health Risk Behavior Survey (AHRBS) Instrument

    E-Print Network [OSTI]

    Smith, Matthew L.

    2010-01-14T23:59:59.000Z

    , characteristics of the peer group. The author concluded the following: (1) published articles in the four health education journals inconsistently reported survey instrument characteristics or results of psychometric property testing for the data collected...

  12. rved.Announcements Apparel & Accessories

    E-Print Network [OSTI]

    the resulting methane for later use. Because windmills and solar panels only work when the wind's blowing power and efficiency of, uh, farts Here's a new green machine that coaxes microbes into farting, storing, in turn, can be used to power fuel cells or to store the electrical energy chemically until it's needed

  13. Optical Coherence Tomography for Neurosurgical Imaging of Human Intracortical Melanoma

    E-Print Network [OSTI]

    Boppart, Stephen

    Optical Coherence Tomography for Neurosurgical Imaging of Human Intracortical Melanoma Stephen A an intracortical melanoma. INSTRUMENTATION: OCT is a new, noncontact, high-speed imaging technology capable for imaging within the surgical field. Cadaveric human cortex with metastatic melanoma was harvested

  14. Solar Energy Research Center Instrumentation Facility

    SciTech Connect (OSTI)

    Meyer, Thomas, J.; Papanikolas, John, P.

    2011-11-11T23:59:59.000Z

    SOLAR ENERGY RESEARCH CENTER INSTRUMENTATION FACILITY The mission of the Solar Energy Research Center (UNC SERC) at the University of North Carolina at Chapel Hill (UNC-CH) is to establish a world leading effort in solar fuels research and to develop the materials and methods needed to fabricate the next generation of solar energy devices. We are addressing the fundamental issues that will drive new strategies for solar energy conversion and the engineering challenges that must be met in order to convert discoveries made in the laboratory into commercially available devices. The development of a photoelectrosynthesis cell (PEC) for solar fuels production faces daunting requirements: (1) Absorb a large fraction of sunlight; (2) Carry out artificial photosynthesis which involves multiple complex reaction steps; (3) Avoid competitive and deleterious side and reverse reactions; (4) Perform 13 million catalytic cycles per year with minimal degradation; (5) Use non-toxic materials; (6) Cost-effectiveness. PEC efficiency is directly determined by the kinetics of each reaction step. The UNC SERC is addressing this challenge by taking a broad interdisciplinary approach in a highly collaborative setting, drawing on expertise across a broad range of disciplines in chemistry, physics and materials science. By taking a systematic approach toward a fundamental understanding of the mechanism of each step, we will be able to gain unique insight and optimize PEC design. Access to cutting-edge spectroscopic tools is critical to this research effort. We have built professionally-staffed facilities equipped with the state-of the-art instrumentation funded by this award. The combination of staff, facilities, and instrumentation specifically tailored for solar fuels research establishes the UNC Solar Energy Research Center Instrumentation Facility as a unique, world-class capability. This congressionally directed project funded the development of two user facilities: TASK 1: SOLAR DEVICE FABRICATION LABORATORY DEVELOPMENT The space allocated for this laboratory was �¢����shell space�¢��� that required an upfit in order to accommodate nano-fabrication equipment in a quasi-clean room environment. This construction project (cost $279,736) met the non-federal cost share requirement of $250,000 for this award. The central element of the fabrication laboratory is a new $400,000+ stand-alone system, funded by other sources, for fabricating and characterizing photovoltaic devices, in a state-of-the-art nanofabrication environment. This congressionally directed project also included the purchase of an energy dispersive x-ray analysis (EDX) detector for a pre-existing transmission electron microscope (TEM). This detector allows elemental analysis and elemental mapping of materials used to fabricate solar energy devices which is a key priority for our research center. TASK 2: SOLAR ENERGY SPECTROSCOPY LABORATORY DEVELOPMENT (INSTRUMENTATION) This laboratory provides access to modern spectroscopy and photolysis instrumentation for characterizing devices, materials and components on time scales ranging from femtoseconds to seconds and for elucidating mechanisms. The goals of this congressionally directed project included the purchase and installation of spectroscopy and photolysis instrumentation that would substantially and meaningfully enhance the capabilities of this laboratory. Some changes were made to the list of equipment proposed in the original budget. These changes did not represent a change in scope, approach or aims of this project. All of the capabilities and experiments represented in the original budget were maintained. The outcome of this Congressionally Directed Project has been the development of world-class fabrication and spectroscopy user facilities for solar fuels research at UNC-CH. This award has provided a significant augmentation of our pre-existing instrumentation capabilities which were funded by earlier UNC SERC projects, including the Energy Frontier

  15. Ultrasonic unipolar pulse/echo instrument

    DOE Patents [OSTI]

    Hughes, M.J.; Hsu, D.K.; Thompson, D.O.; Wormley, S.J.

    1993-04-06T23:59:59.000Z

    An ultrasonic unipolar pulse/echo instrument uses active switches and a timing and drive circuitry to control electrical energy to a transducer, the discharging of the transducer, and the opening of an electrical pathway to the receiving circuitry for the returning echoes. The active switches utilize MOSFET devices along with decoupling circuitry to insure the preservation of the unipolar nature of the pulses, insure fast transition times, and maintain broad band width and time resolution. A housing contains the various circuitry and switches and allows connection to a power supply and a movable ultrasonic transducer. The circuitry maintains low impedance input to the transducer during transmitting cycles, and high impedance between the transducer and the receiving circuit during receive cycles to maintain the unipolar pulse shape. A unipolar pulse is valuable for nondestructive evaluation, a prime use for the present instrument.

  16. Signal conditioning circuitry design for instrumentation systems.

    SciTech Connect (OSTI)

    Larsen, Cory A.

    2012-01-01T23:59:59.000Z

    This report details the current progress in the design, implementation, and validation of the signal conditioning circuitry used in a measurement instrumentation system. The purpose of this text is to document the current progress of a particular design in signal conditioning circuitry in an instrumentation system. The input of the signal conditioning circuitry comes from a piezoresistive transducer and the output will be fed to a 250 ksps, 12-bit analog-to-digital converter (ADC) with an input range of 0-5 V. It is assumed that the maximum differential voltage amplitude input from the sensor is 20 mV with an unknown, but presumably high, sensor bandwidth. This text focuses on a specific design; however, the theory is presented in such a way that this text can be used as a basis for future designs.

  17. Manufacturing challenges of optical current and voltage sensors for utility applications

    SciTech Connect (OSTI)

    Yakymyshyn, C.P. [Montana State Univ., Bozeman, MT (United States). Dept. of Electrical and Computer Engineering; Brubaker, M.A. [Los Alamos National Lab., NM (United States); Johnston, P.M. [Johnston (Paul M.), Raleigh, NC (United States); Reinbold, C. [ABB High Voltage Switchgear, Greensburg, PA (United States)

    1997-12-01T23:59:59.000Z

    Measurement of voltages and currents in power transmission and distribution systems are critical to the electric utility industry for both revenue metering and reliability. Nonconventional instrument transformers based on intensity modulation of optical signals have been reported in the literature for more than 20 years. Recently described devices using passive bulk optical sensor elements include the Electro-Optic Voltage Transducer (EOVT) and Magneto-Optic Current Transducer (MOCT). These technologies offer substantial advantages over conventional instrument transformers in accuracy, optical isolation bandwidth, environmental compatibility, weight and size. This paper describes design and manufacturing issues associated with the EOVT and the Optical Metering Unit (OMU) recently introduced by ABB with field installation results presented for prototype units in the 345 kV and 420 kV voltage classes. The OMU incorporates an EOVT and MOCT to monitor the voltage and current on power transmission lines using a single free-standing device.

  18. The NSTX Central Instrumentation and Control System

    SciTech Connect (OSTI)

    G. Oliaro; J. Dong; K. Tindall; P. Sichta

    1999-12-17T23:59:59.000Z

    Earlier this year the National Spherical Torus Experiment (NSTX) at the Princeton Plasma Physics Laboratory achieved ''first plasma''. The Central Instrumentation and Control System was used to support plasma operations. Major elements of the system include the Process Control System, Plasma Control System, Network System, Data Acquisition System, and Synchronization System. This paper will focus on the Process Control System. Topics include the architecture, hardware interface, operator interface, data management, and system performance.

  19. The DARHTAcquisition, Archival, Analysis, And Instrument Control System (DAAAC), And Network Infrastructure

    SciTech Connect (OSTI)

    Archuleta, Rita Denise [Los Alamos National Laboratory; Sanchez, Lawrence [Los Alamos National Laboratory

    2008-01-01T23:59:59.000Z

    The Dual Axis Radiographic Hydrodynamic Test Facility (DARHT) at Los Alamos National Laboratory is the world's most advanced weapons test facility. DARHT contains two linear accelerators for producing flash radiographs of hydrodynamic experiments. High-speed electronics and optical instrumentation are used for triggering the accelerators and collecting accelerator data. Efficient and effective diagnostics provide basic information needed to routinely tune the accelerators for peak radiographic performance, and to successfully monitor the accelerators performance. DARHT's server and network infrastructure is a key element in providing shot related data storage and retrieval for successfully executing radiographic experiments. This paper will outline the elaborate Data Acquisition, Archival, Analysis, and Instrument Control System (DAAAC), as well as the server and network infrastructure for both accelerators.

  20. Optic for an endoscope/borescope having high resolution and narrow field of view

    DOE Patents [OSTI]

    Stone, Gary F.; Trebes, James E.

    2003-10-28T23:59:59.000Z

    An optic having optimized high spatial resolution, minimal nonlinear magnification distortion while at the same time having a limited chromatic focal shift or chromatic aberrations. The optic located at the distal end of an endoscopic inspection tool permits a high resolution, narrow field of view image for medical diagnostic applications, compared to conventional optics for endoscopic instruments which provide a wide field of view, low resolution image. The image coverage is over a narrow (<20 degrees) field of view with very low optical distortion (<5% pin cushion or barrel distortion. The optic is also optimized for best color correction as well as to aid medical diagnostics.

  1. SURFACE NONLINEAR OPTICS

    E-Print Network [OSTI]

    Shen, Y.R.

    2010-01-01T23:59:59.000Z

    B. de Castro, and Y. R. Shen, Optics Lett. i, 393 See, for3, 1980 SURFACE NONLINEAR OPTICS Y.R. Shen, C.K. Chen, andde Janiero SURFRACE NONLINEAR OPTICS Y. R. Shen, C. K. Chen,

  2. NONLINEAR OPTICS AT INTERFACES

    E-Print Network [OSTI]

    Chen, Chenson K.

    2010-01-01T23:59:59.000Z

    N. Bloembergen, Nonlinear Optics (W. A. Benjamin, 1977) p.Research Division NONLINEAR OPTICS AT INTERFACES Chenson K.ED LBL-12084 NONLINEAR OPTICS AT INTERFACES Chenson K. Chen

  3. The SLS optics beamline

    E-Print Network [OSTI]

    2006-01-01T23:59:59.000Z

    The SLS Optics Beamline U. Flechsig ? , R. Abela ? , R.in the ?eld of x-ray optics and synchrotron radiation in-radiation, beamline optics, channel cut monochromator,

  4. Optical manifold

    DOE Patents [OSTI]

    Falicoff, Waqidi; Chaves, Julio C.; Minano, Juan Carlos; Benitez, Pablo; Dross, Oliver; Parkyn, Jr., William A.

    2010-02-23T23:59:59.000Z

    Optical systems are described that have at least one source of a beam of blue light with divergence under 15.degree.. A phosphor emits yellow light when excited by the blue light. A collimator is disposed with the phosphor and forms a yellow beam with divergence under 15.degree.. A dichroic filter is positioned to transmit the beam of blue light to the phosphor and to reflect the beam of yellow light to an exit aperture. In different embodiments, the beams of blue and yellow light are incident upon said filter with central angles of 15.degree., 22.degree., and 45.degree.. The filter may reflect all of one polarization and part of the other polarization, and a polarization rotating retroreflector may then be provided to return the unreflected light to the filter.

  5. The Focusing Optics x-ray Solar Imager: FOXSI Sam Kruckera,b, Steven Christec, Lindsay Glesenera,d, Shin-nosuke Ishikawaa, Stephen

    E-Print Network [OSTI]

    California at Berkeley, University of

    University, Furo-cho, Chikusa-ku, Nagoya 464-8601, Japan ABSTRACT The Focusing Optics x-ray Solar Imager. Today's leading solar HXR instrument, the Reuven Ramaty High Energy Solar Spectroscopic Imager (RHESSI, solar physics, solar flares, silicon strip detectors, grazing-incidence optics, high-energy x-ray optics

  6. BACKSCATTERING BY NON-SPHERICAL NATURAL PARTICLES: INSTRUMENT DEVELOPMENT, IOP'S,

    E-Print Network [OSTI]

    Boss, Emmanuel S.

    of the proposed instrument. Figure 1: Engineering view of the self-contained battery powered instrument. In light-spherical effects on backscatter. b. Characterization of scattering from terrigenous and biological size-sorted non

  7. Instrumentation for multiaxial mechanical testing of inhomogeneous elastic membranes

    E-Print Network [OSTI]

    Herrmann, Ariel Marc

    2006-01-01T23:59:59.000Z

    This thesis presents the design, development, and construction of an instrument for biaxial mechanical testing of inhomogeneous elastic membranes. The instrument incorporates an arrangement of linear motion stages for ...

  8. Development and Validation of an Occupational Skills Assessment Instrument

    E-Print Network [OSTI]

    Mathews, R. Mark; Whang, Paula L.; Fawcett, Stephen B.

    1980-01-01T23:59:59.000Z

    The development and validation of an occupational skills assessment instrument is described. The instrument was designed to describe accurately a participant's actual level of occupational skills in a variety of job-related ...

  9. Chameleon Guitar : a physical heart in a digital instrument

    E-Print Network [OSTI]

    Zoran, Amit (Amit Shlomo)

    2009-01-01T23:59:59.000Z

    Today's tools and instruments, whether musical or graphical, fall into two very distinct classes, each with its own benefits and drawbacks. Traditional physical instruments offer a richness and uniqueness of qualities that ...

  10. Optical absorption measurement system

    DOE Patents [OSTI]

    Draggoo, Vaughn G. (Livermore, CA); Morton, Richard G. (San Diego, CA); Sawicki, Richard H. (Pleasanton, CA); Bissinger, Horst D. (Livermore, CA)

    1989-01-01T23:59:59.000Z

    The system of the present invention contemplates a non-intrusive method for measuring the temperature rise of optical elements under high laser power optical loading to determine the absorption coefficient. The method comprises irradiating the optical element with a high average power laser beam, viewing the optical element with an infrared camera to determine the temperature across the optical element and calculating the absorption of the optical element from the temperature.

  11. SP100i Syringe Pump WORLD PRECISION INSTRUMENTS 15

    E-Print Network [OSTI]

    Kleinfeld, David

    SP100i Syringe Pump WORLD PRECISION INSTRUMENTS 15 INSTRUCTION MANUAL Serial No._____________________ 8/94 World Precision Instruments, Inc. SP100i Syringe Pump Digital Infusion Syringe Pump #12;SP100i Syringe Pump WORLD PRECISION INSTRUMENTS 1 Contents GENERAL DESCRIPTION

  12. Beam instrumentation for the Tevatron Collider

    SciTech Connect (OSTI)

    Moore, Ronald S.; Jansson, Andreas; Shiltsev, Vladimir; /Fermilab

    2009-10-01T23:59:59.000Z

    The Tevatron in Collider Run II (2001-present) is operating with six times more bunches and many times higher beam intensities and luminosities than in Run I (1992-1995). Beam diagnostics were crucial for the machine start-up and the never-ending luminosity upgrade campaign. We present the overall picture of the Tevatron diagnostics development for Run II, outline machine needs for new instrumentation, present several notable examples that led to Tevatron performance improvements, and discuss the lessons for future colliders.

  13. ARM - Campaign Instrument - 5mm-mwr

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOnItemResearchSOLICITATIONIMODI FICATIONCLASIC Science Team RelatedgovInstruments5mm-mwr

  14. ARM - Campaign Instrument - kandz-cm21

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492air Comments? We would love to hear from you! Send us agovInstrumentsisland-guest-instruments Comments?

  15. Mars Rover's ChemCam Instrument gets

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645U.S. DOEThe Bonneville PowerCherries 82981-1cnHighand Retrievals from a New 183-GHz WaterMarkRover's ChemCam Instrument

  16. Mechanical design and vibro-acoustic testing of ultrathin carbon foils for a spacecraft instrument

    SciTech Connect (OSTI)

    Bernardin, John D [Los Alamos National Laboratory; Baca, Allen G [SNL

    2009-01-01T23:59:59.000Z

    IBEX-Hi is an electrostatic analyzer spacecraft instrument designed to measure the energy and flux distribution of energetic neutral atoms (ENAs) emanating from the interaction zone between the Earth's solar system and the Milky Way galaxy. A key element to this electro-optic instrument is an array of fourteen carbon foils that are used to ionize the ENAs. The foils are comprised of an ultrathin (50-100 {angstrom} thick) layer of carbon suspended across the surface of an electroformed Nickel wire screen, which in turn is held taught by a metal frame holder. The electro formed orthogonal screen has square wire elements, 12.7 {micro}m thick, with a pitch of 131.1 wires/cm. Each foil holder has an open aperture approximately 5 cm by 2.5 cm. Designing and implementing foil holders with such a large surface area has not been attempted for spaceflight in the past and has proven to be extremely challenging. The delicate carbon foils are subject to fatigue failure from the large acoustic and vibration loads that they will be exposed to during launch of the spacecraft. This paper describes the evolution of the foil holder design from previous space instrument applications to a flight-like IBEX-Hi prototype. Vibro-acoustic qualification tests of the IBEX-Hi prototype instrument and the resulting failure of several foils are summarized. This is followed by a discussion of iterative foil holder design modifications and laser vibrometer modal testing to support future fatigue failure analyses, along with additional acoustic testing of the IBEX-Hi prototype instrument. The results of these design and testing activities are merged and the resulting flight-like foil holder assembly is proposed.

  17. Accommodating subject and instrument variations in spectroscopic determinations

    DOE Patents [OSTI]

    Haas, Michael J. (Albuquerque, NM); Rowe, Robert K. (Corrales, NM); Thomas, Edward V. (Albuquerque, NM)

    2006-08-29T23:59:59.000Z

    A method and apparatus for measuring a biological attribute, such as the concentration of an analyte, particularly a blood analyte in tissue such as glucose. The method utilizes spectrographic techniques in conjunction with an improved instrument-tailored or subject-tailored calibration model. In a calibration phase, calibration model data is modified to reduce or eliminate instrument-specific attributes, resulting in a calibration data set modeling intra-instrument or intra-subject variation. In a prediction phase, the prediction process is tailored for each target instrument separately using a minimal number of spectral measurements from each instrument or subject.

  18. astronomical instrument control: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    process. We will cover key aspects of some of the most important topics in the field: optics and optical design, mechanical design and machining, electronics design and...

  19. astronomical instrumentation: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    process. We will cover key aspects of some of the most important topics in the field: optics and optical design, mechanical design and machining, electronics design and...

  20. Microfabricated instrument for tissue biopsy and analysis

    DOE Patents [OSTI]

    Krulevitch, Peter A. (Pleasanton, CA); Lee, Abraham P. (Walnut Creek, CA); Northrup, M. Allen (Berkeley, CA); Benett, William J. (Livermore, CA)

    1999-01-01T23:59:59.000Z

    A microfabricated biopsy/histology instrument which has several advantages over the conventional procedures, including minimal specimen handling, smooth cutting edges with atomic sharpness capable of slicing very thin specimens (approximately 2 .mu.m or greater), micro-liter volumes of chemicals for treating the specimens, low cost, disposable, fabrication process which renders sterile parts, and ease of use. The cutter is a "cheese-grater" style design comprising a block or substrate of silicon and which uses anisotropic etching of the silicon to form extremely sharp and precise cutting edges. As a specimen is cut, it passes through the silicon cutter and lies flat on a piece of glass which is bonded to the cutter. Microchannels are etched into the glass or silicon substrates for delivering small volumes of chemicals for treating the specimen. After treatment, the specimens can be examined through the glass substrate. For automation purposes, microvalves and micropumps may be incorporated. Also, specimens in parallel may be cut and treated with identical or varied chemicals. The instrument is disposable due to its low cost and thus could replace current expensive microtome and histology equipment.

  1. THE Q/U IMAGING EXPERIMENT INSTRUMENT

    SciTech Connect (OSTI)

    Bischoff, C.; Brizius, A.; Buder, I.; Kusaka, A.; Smith, K. M.; Bogdan, M. [Kavli Institute for Cosmological Physics, Department of Physics, Enrico Fermi Institute, The University of Chicago, Chicago, IL 60637 (United States); Chinone, Y. [High Energy Accelerator Research Organization (KEK), 1-1 Oho, Tsukuba, Ibaraki 305-0801 (Japan); Cleary, K.; Reeves, R. [Cahill Center for Astronomy and Astrophysics, California Institute of Technology, 1200 E. California Blvd M/C 249-17, Pasadena, CA 91125 (United States); Dumoulin, R. N.; Newburgh, L. B. [Department of Physics and Columbia Astrophysics Laboratory, Columbia University, New York, NY 10027 (United States); Monsalve, R.; Bustos, R. [Department of Physics, University of Miami, 1320 Campo Sano Drive, Coral Gables, FL 33146 (United States); Naess, S. K. [Institute of Theoretical Astrophysics, University of Oslo, P.O. Box 1029 Blindern, N-0315 Oslo (Norway); Nixon, G. [Joseph Henry Laboratories of Physics, Jadwin Hall, Princeton University, Princeton, NJ 08544 (United States); Vanderlinde, K. [Department of Physics, McGill University, 3600 Rue University, Montreal, Quebec H3A 2T8 (Canada); Wehus, I. K. [Department of Physics, University of Oslo, P.O. Box 1048 Blindern, N-0316 Oslo (Norway); Church, S. E. [Kavli Institute for Particle Astrophysics and Cosmology and Department of Physics, Stanford University, Varian Physics Building, 382 Via Pueblo Mall, Stanford, CA 94305 (United States); Davis, R.; Dickinson, C., E-mail: newburgh@princeton.edu [Jodrell Bank Centre for Astrophysics, Alan Turing Building, School of Physics and Astronomy, University of Manchester, Oxford Road, Manchester M13 9PL (United Kingdom); and others

    2013-05-01T23:59:59.000Z

    The Q/U Imaging ExperimenT (QUIET) is designed to measure polarization in the cosmic microwave background, targeting the imprint of inflationary gravitational waves at large angular scales({approx}1 Degree-Sign ). Between 2008 October and 2010 December, two independent receiver arrays were deployed sequentially on a 1.4 m side-fed Dragonian telescope. The polarimeters that form the focal planes use a compact design based on high electron mobility transistors (HEMTs) that provides simultaneous measurements of the Stokes parameters Q, U, and I in a single module. The 17-element Q-band polarimeter array, with a central frequency of 43.1 GHz, has the best sensitivity (69 {mu}Ks{sup 1/2}) and the lowest instrumental systematic errors ever achieved in this band, contributing to the tensor-to-scalar ratio at r < 0.1. The 84-element W-band polarimeter array has a sensitivity of 87 {mu}Ks{sup 1/2} at a central frequency of 94.5 GHz. It has the lowest systematic errors to date, contributing at r < 0.01. The two arrays together cover multipoles in the range l {approx} 25-975. These are the largest HEMT-based arrays deployed to date. This article describes the design, calibration, performance, and sources of systematic error of the instrument.

  2. LABORATORY I: GEOMETRIC OPTICS

    E-Print Network [OSTI]

    Minnesota, University of

    Lab I - 1 LABORATORY I: GEOMETRIC OPTICS In this lab, you will solve several problems related to the formation of optical images. Most of us have a great deal of experience with the formation of optical images this laboratory, you should be able to: · Describe features of real optical systems in terms of ray diagrams

  3. Optical XOR gate

    DOE Patents [OSTI]

    Vawter, G. Allen

    2013-11-12T23:59:59.000Z

    An optical XOR gate is formed as a photonic integrated circuit (PIC) from two sets of optical waveguide devices on a substrate, with each set of the optical waveguide devices including an electroabsorption modulator electrically connected in series with a waveguide photodetector. The optical XOR gate utilizes two digital optical inputs to generate an XOR function digital optical output. The optical XOR gate can be formed from III-V compound semiconductor layers which are epitaxially deposited on a III-V compound semiconductor substrate, and operates at a wavelength in the range of 0.8-2.0 .mu.m.

  4. GRB optical and IR rapid follow-up with the 2 m Liverpool Robotic Telescope

    E-Print Network [OSTI]

    A. Gomboc; M. F. Bode; D. Carter; C. G. Mundell; A. M. Newsam; R. J. Smith; I. A. Steele

    2003-10-06T23:59:59.000Z

    The Liverpool Telescope, owned and operated by Liverpool John Moores University and situated at Roque de los Muchachos, La Palma, is the first 2-m, fully instrumented robotic telescope. We plan to use the LT in conjunction with Gamma Ray Observatories (HETE-2, INTEGRAL, Swift) to study GRB physics. A special over-ride mode will enable observations commencing less than a minute after the GRB alert, including optical and near infrared imaging and spectroscopy. These observations, together with systematic monitoring of the burst through the afterglow, will help to unravel the nature of prompt optical flashes, short bursts, optically dark bursts, redshift distribution, GRB - supernova connection and other questions related to the GRB phenomenon. In particular, the combination of aperture, instrumentation and rapid automated response makes the Liverpool Telescope excellently suited to the investigation of optically dark bursts and currently optically unstudied short bursts.

  5. Using instrument scraper surveys for corrosion repair

    SciTech Connect (OSTI)

    Akhnoukh, S.R.; Baghabrah, M.A. (Aramco (SA))

    1990-07-01T23:59:59.000Z

    This paper reports on a program for overall pipe line repair. This program was implemented to maintain pipe line integrity and for identifying problem areas which require reconditioning or replacing by: reviewing pipe line leak history; checking periodically lifetime expectancy and integrity of pipe coatings; using cathodic protection annual survey results to locate low potential areas (close-interval survey is needed to identify the exact location of corrosion); and hydrotesting the pipe line (using leaks or ruptures from the hydrotest to identify problem areas). The pipe line revalidation plan is insufficient for identifying pipe line leaks. Instrumented pig testing provides more accurate and reliable ways of testing the pipe line for internal or external corrosion or defects.

  6. Assessing the local windfield with instrumentation

    SciTech Connect (OSTI)

    Zambrano, T.G.

    1980-10-01T23:59:59.000Z

    This report concerns the development and testing of a technique for the initial screening and evaluation of potential sites for wind-energy conversion systems (WECS). The methodology was developed through a realistic siting exercise. The siting exercise involved measurements of winds along the surface and winds aloft using a relatively new instrument system, the Tethered Aerodynamic Lifting Anemometer (TALA) kite; notation of ecological factors such as vegetation flagging, soil erosion and site exposure, and verification of an area best suited for wind-energy development by establishing and maintaining a wind monitoring network. The siting exercise was carried out in an approximately 100-square-mile region of the Tehachapi Mountains of Southern California. The results showed that a comprehensive site survey involving field measurements, ecological survey, and wind-monitoring can be an effective tool for preliminary evaluation of WECS sites.

  7. Microfabricated instrument for tissue biopsy and analysis

    DOE Patents [OSTI]

    Krulevitch, Peter A. (Pleasanton, CA); Lee, Abraham P. (Walnut Creek, CA); Northrup, M. Allen (Berkeley, CA); Benett, William J. (Livermore, CA)

    2001-01-01T23:59:59.000Z

    A microfabricated biopsy/histology instrument which has several advantages over the conventional procedures, including minimal specimen handling, smooth cutting edges with atomic sharpness capable of slicing very thin specimens (approximately 2 .mu.m or greater), micro-liter volumes of chemicals for treating the specimens, low cost, disposable, fabrication process which renders sterile parts, and ease of use. The cutter is a "cheese-grater" style design comprising a block or substrate of silicon and which uses anisotropic etching of the silicon to form extremely sharp and precise cutting edges. As a specimen is cut, it passes through the silicon cutter and lies flat on a piece of glass which is bonded to the cutter. Microchannels are etched into the glass or silicon substrates for delivering small volumes of chemicals for treating the specimen. After treatment, the specimens can be examined through the glass substrate.

  8. SUNRISE: INSTRUMENT, MISSION, DATA, AND FIRST RESULTS

    SciTech Connect (OSTI)

    Solanki, S. K.; Barthol, P.; Danilovic, S.; Feller, A.; Gandorfer, A.; Hirzberger, J.; Riethmueller, T. L.; Schuessler, M. [Max-Planck-Institut fuer Sonnensystemforschung, Max-Planck-Str. 2, 37191 Katlenburg-Lindau (Germany); Bonet, J. A.; Pillet, V. MartInez [Instituto de Astrofisica de Canarias, C/Via Lactea s/n, 38200 La Laguna, Tenerife (Spain); Del Toro Iniesta, J. C. [Instituto de Astrofisica de AndalucIa (CSIC), Apdo. de Correos 3004, E-18080, Granada (Spain); Domingo, V.; Palacios, J. [Grupo de AstronomIa y Ciencias del Espacio, Universidad de Valencia, E-46980, Paterna, Valencia (Spain); Knoelker, M. [High Altitude Observatory, National Center for Atmospheric Research, P.O. Box 3000, Boulder, CO 80307-3000 (United States); Gonzalez, N. Bello; Berkefeld, T.; Franz, M.; Schmidt, W. [Kiepenheuer-Institut fuer Sonnenphysik, Schoeneckstr. 6, 79104 Freiburg (Germany); Title, A. M., E-mail: solanki@mps.mpg.d [Lockheed-Martin Solar and Astrophysical Lab., Palo Alto, CA 94304 (United States)

    2010-11-10T23:59:59.000Z

    The SUNRISE balloon-borne solar observatory consists of a 1 m aperture Gregory telescope, a UV filter imager, an imaging vector polarimeter, an image stabilization system, and further infrastructure. The first science flight of SUNRISE yielded high-quality data that revealed the structure, dynamics, and evolution of solar convection, oscillations, and magnetic fields at a resolution of around 100 km in the quiet Sun. After a brief description of instruments and data, the first qualitative results are presented. In contrast to earlier observations, we clearly see granulation at 214 nm. Images in Ca II H display narrow, short-lived dark intergranular lanes between the bright edges of granules. The very small-scale, mixed-polarity internetwork fields are found to be highly dynamic. A significant increase in detectable magnetic flux is found after phase-diversity-related reconstruction of polarization maps, indicating that the polarities are mixed right down to the spatial resolution limit and probably beyond.

  9. SRS delayed neutron instruments for safeguards measurements

    SciTech Connect (OSTI)

    Studley, R.V. [Westinghouse SRC, Aiken, SC (United States)

    1993-12-31T23:59:59.000Z

    Six analytical systems measuring delayed neutrons have been used for safeguards measurements at the Savannah River Site (SRS). A predecessor, the 252Cf Activation Analysis Facility installed at the Savannah River Technology Center (formally SR Laboratory) has been used since 1974 to analyze small samples, measuring both delayed neutrons and gammas. The six shufflers, plus one currently being fabricated, were developed, designed and fabricated by the LANL N-1 group. These shufflers have provided safeguards measurements of product (2 each), in-process scrap (2 each plus a conceptual replacement) and process waste (2 each plus one being fabricated). One shuffler for scrap assay was the first shuffler to be installed (1978) in a process. Another (waste) was the first installed in a process capable of assaying barrels. A third (waste) is the first pass-through model and a fourth (product) is the most precise ({+-}.12%) and accurate NDA instrument yet produced.

  10. Fiber optic quality assurance at the Nevada Test Site

    SciTech Connect (OSTI)

    Manning, J.; Baumgart, S.; Malone, R.; Thayer, D.

    1981-01-01T23:59:59.000Z

    A large number of fiber optic cables were used in support of a neutron imaging experiment at the Nevada Test Site. This paper describes the quality control testing of fiber components used on this experiment. The principal reason for quality control testing was to ensure reliable, high transmission fibers; a secondary reason was to gain data on a large sample of fiber cables in the field. Also described is the instrumentation developed for carrying out these field measurements. The design of the quality control instrumentation was a compromise between accuracy and simplicity of use.

  11. Optical and mechanical behavior of the optical fiber infrasound sensor

    E-Print Network [OSTI]

    DeWolf, Scott

    2009-01-01T23:59:59.000Z

    1.2 The Optical Fiber Infrasound Sensor . . . . . . .Fiber Infrasound Sensor Optical fibers are well known forSchnidrig. An optical fiber infrasound sensor: A new lower

  12. C H A P T E R F O U R T E E N Single-Molecule Dual-Beam Optical

    E-Print Network [OSTI]

    Spudich, James A.

    C H A P T E R F O U R T E E N Single-Molecule Dual-Beam Optical Trap Analysis of Protein Structure. Introduction 322 2. Insights into Myosin Function Using a Dual-Beam Optical Trap 322 3. Optical Trap Instrumentation 324 3.1. Basic concept of an optical trap 324 3.2. Design and components 325 3.3. Noise

  13. Latching micro optical switch

    DOE Patents [OSTI]

    Garcia, Ernest J; Polosky, Marc A

    2013-05-21T23:59:59.000Z

    An optical switch reliably maintains its on or off state even when subjected to environments where the switch is bumped or otherwise moved. In addition, the optical switch maintains its on or off state indefinitely without requiring external power. External power is used only to transition the switch from one state to the other. The optical switch is configured with a fixed optical fiber and a movable optical fiber. The movable optical fiber is guided by various actuators in conjunction with a latching mechanism that configure the switch in one position that corresponds to the on state and in another position that corresponds to the off state.

  14. First results from the MIT optical rapid imaging system (MORIS) on the IRTF: A stellar occultation by Pluto and a transit by exoplanet XO-2b

    E-Print Network [OSTI]

    Gulbis, Amanda A. S.

    We present a high-speed, visible-wavelength imaging instrument: MORIS (the MIT Optical Rapid Imaging System). MORIS is mounted on the 3 m Infrared Telescope Facility (IRTF) on Mauna Kea, Hawaii. Its primary component is ...

  15. Sandia National Laboratories: Quantum Optics

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    ClimateQuantum Optics Quantum Optics videobanner Quantum Optics with a Single Semiconductor Quantum Dot Speaker: Weng Chow, EFRC Scientist Date: September 14, 2011 Event:...

  16. 2H Evaporator CP class instrumentation uncertainties evaluations

    SciTech Connect (OSTI)

    Hwang, E.

    1994-02-10T23:59:59.000Z

    The Evaporator Pot Temperature Instrumentations and the Steam Condensate Gamma Monitors are two instrumentation systems in the 2H Evaporator facilities that are classified as the critical protection. The temperature high alarm and interlock circuit and the temperature recorder circuit of the pot temperature instrumentation loop are described. From the gamma monitor loop, the high gamma alarm and interlock circuit, failure alarm and interlock circuit, cesium activity recorder circuit, and americium activity recorder circuit are described. (GHH)

  17. DOE Fundamentals Handbook: Instrumentation and Control, Volume 2

    SciTech Connect (OSTI)

    Not Available

    1992-06-01T23:59:59.000Z

    The Instrumentation and Control Fundamentals Handbook personnel, and the technical staff facility operating contractors provide operators, maintenance personnel, and the technical staff with the necessary fundamentals training to ensure a basic understanding of instrumentation and control systems. The handbook includes information on temperature, pressure, flow, and level detection systems; position indication systems; process control systems; and radiation detection principles. This information will provide personnel with an understanding of the basic operation of various types of DOE nuclear facility instrumentation and control systems.

  18. DOE Fundamentals Handbook: Instrumentation and Control, Volume 1

    SciTech Connect (OSTI)

    Not Available

    1992-06-01T23:59:59.000Z

    The Instrumentation and Control Fundamentals Handbook was developed to assist nuclear facility operating contractors provide operators, maintenance personnel, and the technical staff with the necessary fundamentals training to ensure a basic understanding of instrumentation and control systems. The handbook includes information on temperature, pressure, flow, and level detection systems; position indication systems; process control systems; and radiation detection principles. This information will provide personnel with an understanding of the basic operation of various types of DOE nuclear facility instrumentation and control systems.

  19. Near-infrared fluorescence enhanced optical imaging: an analysis of penetration depth

    E-Print Network [OSTI]

    Houston, Jessica Perea

    2002-01-01T23:59:59.000Z

    , . . . . . . . 59 . . . . . . . 59 . . . . . . . 60 . . . . . . . 6 I vn Page 3. 2 ICCD system (instrumentation) . . 3. 2. 1 Laser diode and optical filters. . 3. 2. 2 Gain-modulated image intensifier and lenses. . . . . . . . . 3. 2. 3 CCD camera. . 3. 2.... 4 Modulation instrumentation. 3. 3 ICCD system (raw data acquisition and processing). . . . . 3. 3. 1 Data acquisition . . 3. 4 Data acquisition for filter combinations 63 65 . . . 66 67 67 . . . 70 71 74 4. DEVELOPMENT OF THEORETICAL...

  20. QAS 2.4 Instrument Calibration 5/26/95

    Broader source: Energy.gov [DOE]

    The objective of this surveillance is to evaluate the implementation of the contractor's program to routinely calibrate instruments, alarms, and sensors.  The Facility Representative observes...

  1. analytical instrumentation handbook: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Open Access Theses and Dissertations Summary: ??Three instrumental approaches to process analytical chemistry are introduced.First, a field portable, multiwavelength,...

  2. adaptive nonparametric instrumental: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    both selects Faraway, Julian 27 Spanish Version of the Sport Satisfaction Instrument (SSI) Adapted to Physical Education CiteSeer Summary: The objective of this research was to...

  3. activation instrumental analysis: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    car electronics industry. There are currently many electronic systems improving the safety Wieringa, Roel 17 Runtime Instrumentation for Precise Flow-Sensitive Type Analysis...

  4. Radiation Protection Instrument Manual, Revision 1, PNL-MA-562

    SciTech Connect (OSTI)

    Johnson, Michelle Lynn

    2009-09-23T23:59:59.000Z

    PNL-MA-562 This manual provides specific information for operating and using portable radiological monitoring instruments available for use on the Hanford Site.

  5. automatic stapling instrument: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    MUSICAL INSTRUMENT DETECTOR BY USING EVOLUTIONARY LEARNING METHOD Yoshiyuki Kobayashi SONY Corporation, Japan Yoshiyuki.Kobayashi@jp.sony.com ABSTRACT This paper presents a novel...

  6. CLEAN-Linking International Instruments to Support Low Emission...

    Open Energy Info (EERE)

    CLEAN-Linking International Instruments to Support Low Emission Planning Webinar- TNAs, NAMAs, LEDS and Roadmaps Jump to: navigation, search Tool Summary LAUNCH TOOL Name:...

  7. Orders of Magnitude: Three Works for Instruments and Electronics

    E-Print Network [OSTI]

    Einbond, Aaron Michael

    2009-01-01T23:59:59.000Z

    EINBOND for viola and live electronics Indifferent (q » 60-piano, percussion, and electronics WHAT THE BLIND SEE tofor Instruments and Electronics by Aaron Michael Einbond

  8. Tuesday, March 14, 2006 POSTER SESSION I: INSTRUMENT FACILITIES

    E-Print Network [OSTI]

    Rathbun, Julie A.

    -of-the-art instrument and the research that we will do with it. Kohout T. Elbra T. Pesonen L. J. Schnabl P. Slechta S

  9. Active optical zoom system

    DOE Patents [OSTI]

    Wick, David V.

    2005-12-20T23:59:59.000Z

    An active optical zoom system changes the magnification (or effective focal length) of an optical imaging system by utilizing two or more active optics in a conventional optical system. The system can create relatively large changes in system magnification with very small changes in the focal lengths of individual active elements by leveraging the optical power of the conventional optical elements (e.g., passive lenses and mirrors) surrounding the active optics. The active optics serve primarily as variable focal-length lenses or mirrors, although adding other aberrations enables increased utility. The active optics can either be LC SLMs, used in a transmissive optical zoom system, or DMs, used in a reflective optical zoom system. By appropriately designing the optical system, the variable focal-length lenses or mirrors can provide the flexibility necessary to change the overall system focal length (i.e., effective focal length), and therefore magnification, that is normally accomplished with mechanical motion in conventional zoom lenses. The active optics can provide additional flexibility by allowing magnification to occur anywhere within the FOV of the system, not just on-axis as in a conventional system.

  10. Conference Paper NFO-7:7th International Conference on Near-Field Optics and Related Technologies

    SciTech Connect (OSTI)

    Prof.Dr. Lukas Novotny

    2004-10-18T23:59:59.000Z

    The seventh conference in the NFO conference series, held here in Rochester, provided to be the principal forum for advances in sub-wavelength optics, near-field optical microscopy, local field enhancement, instrumental developments and the ever-increasing range of applications. This conference brought together the diverse scientific communities working on the theory and application of near-field optics (NFO) and related techniques.

  11. Instrumentation development for real time brainwave monitoring.

    SciTech Connect (OSTI)

    Anderson, Lawrence Frederick; Clough, Benjamin W.

    2005-12-01T23:59:59.000Z

    The human brain functions through a chemically-induced biological process which operates in a manner similar to electrical systems. The signal resulting from this biochemical process can actually be monitored and read using tools and having patterns similar to those found in electrical and electronics engineering. The primary signature of this electrical activity is the ''brain wave'', which looks remarkably similar to the output of many electrical systems. Likewise, the device currently used in medical arenas to read brain electrical activity is the electroencephalogram (EEG) which is synonymous with a multi-channel oscilloscope reading. Brain wave readings and recordings for medical purposes are traditionally taken in clinical settings such as hospitals, laboratories or diagnostic clinics. The signal is captured via externally applied scalp electrodes using semi-viscous gel to reduce impedance. The signal will be in the 10 to 100 microvolt range. In other instances, where surgeons are attempting to isolate particular types of minute brain signals, the electrodes may actually be temporarily implanted in the brain during a preliminary procedure. The current configurations of equipment required for EEGs involve large recording instruments, many electrodes, wires, and large amounts of hard disk space devoted to storing large files of brain wave data which are then eventually analyzed for patterns of concern. Advances in sensors, signal processing, data storage and microelectronics over the last decade would seem to have paved the way for the realization of devices capable of ''real time'' external monitoring, and possible assessment, of brain activity. A myriad of applications for such a capability are likewise presenting themselves, including the ability to assess brain functioning, level of functioning and malfunctioning. Our plan is to develop the sensors, signal processing, and portable instrumentation package which could capture, analyze, and communicate information on brain activity which could be of use to the individual, medical personnel or in other potential arenas. To take this option one step further, one might foresee that the signal would be captured, analyzed, and communicated to a person or device and which would result an action or reaction by that person or device. It is envisioned that ultimately a system would include a sensor detection mechanism, transmitter, receiver, microprocessor and associated memory, and audio and/or visual alert system. If successful in prototyping, the device could be considered for eventual implementation in ASIC form or as a fully integrated CMOS microsystem.

  12. Development of a new generation of optical slope measuring profiler

    SciTech Connect (OSTI)

    Yashchuk, Valeriy V.; Takacs, Peter Z.; McKinney, Wayne R.; Assoufid, Lahsen; Siewert, Frank; Zeschke, Thomas

    2010-09-16T23:59:59.000Z

    A collaboration, including all DOE synchrotron labs, industrial vendors of x-ray optics, and with active participation of the HBZ-BESSY-II optics group has been established to work together on a new slope measuring profiler -- the optical slope measuring system (OSMS). The slope measurement accuracy of the instrument is expected to be<50 nrad for the current and future metrology of x-ray optics for the next generation of light sources. The goals were to solidify a design that meets the needs of mirror specifications and also be affordable; and to create a common specification for fabrication of a multi-functional translation/scanning (MFTS) system for the OSMS. This was accomplished by two collaborative meetings at the ALS (March 26, 2010) and at the APS (May 6, 2010).

  13. High bandwidth optical mount

    SciTech Connect (OSTI)

    Bender, D.A.; Kuklo, T.

    1994-11-08T23:59:59.000Z

    An optical mount, which directs a laser beam to a point by controlling the position of a light-transmitting optic, is stiffened so that a lowest resonant frequency of the mount is approximately one kilohertz. The optical mount, which is cylindrically-shaped, positions the optic by individually moving a plurality of carriages which are positioned longitudinally within a sidewall of the mount. The optical mount is stiffened by allowing each carriage, which is attached to the optic, to move only in a direction which is substantially parallel to a center axis of the optic. The carriage is limited to an axial movement by flexures or linear bearings which connect the carriage to the mount. The carriage is moved by a piezoelectric transducer. By limiting the carriage to axial movement, the optic can be kinematically clamped to a carriage. 5 figs.

  14. Radiation-Resistant WDM Optical Link for Thermonuclear Fusion Reactor Instrumentation

    E-Print Network [OSTI]

    A. Fernandez Fernandez; Ez Fern; P. Borgermans; B. Brichard; P. Borgermans; A. I. Gusarov; M. Van Uffelen; P. Megret; M. Decréton; M. Blondel; A. Delchambre

    2001-01-01T23:59:59.000Z

    The future International Thermonuclear Experimental Reactor (ITER) is a complex installation that will require permanent monitoring and frequent maintenance operations. The high-gamma dose rates, the high neutron fluence, and other radiological hazards call for the use of remote-handled equipment

  15. Optical Design To accommodate the largest possible range of scientific instruments, a dual

    E-Print Network [OSTI]

    Sirianni, Marco

    at the angle of closest solar approach: 60 deg. For launch, doors cover the secondary mirror support structure tube is split into two parts. The lower part is structural and supports the secondary mirror. The upper and +/- 1 g dynamic load. The forward structure and secondary mirror spiders have a first fundamental mode

  16. Design of an Instrument to Measure Optical Reflectance of Scintillating Crystal Surfaces

    E-Print Network [OSTI]

    Janecek, Martin

    2008-01-01T23:59:59.000Z

    AC02-05CH11231, grant number NNSA LB06-316-PD05 / NN2001000.AC03-76SF00098, grant number NNSA LB06-316-PD05 / NN2001000.

  17. ''Atomic Optics'': Nonimaging Optics on the Nanoscale

    SciTech Connect (OSTI)

    Roland Winston Joseph O'Gallagher

    2005-01-15T23:59:59.000Z

    This is the final report for a one year close out extension of our basic research program that was established at the University of Chicago more than sixteen years ago to explore and develop the optical sub-discipline that has come to be known as ''nonimaging optics''. This program has been extremely fruitful, having both broadened the range of formalism available for workers in this field and led to the discovery of many new families of optical devices. These devices and techniques have applications wherever the efficient transport and transformation of light distributions are important, in particular in illumination, fiber optics, collection and concentration of sunlight, and the detection of faint light signals in physics and astrophysics. Over the past thirty years, Nonimaging Optics (Welford and Winston, 1989) has brought a fresh approach to the analysis of many problems in classical macro-scale optics. Through the application of phase-space concepts, statistical methods, thermodynamic arguments, etc., many previously established performance limits were able to be broken and many technical surprises with exciting practical applications were discovered. The most recent three-year phase of our long-term continuing program ended in late 2002 and emphasized extending our work in geometrical optics and expanding it to include some interesting questions in physical optics as well as in the new field of statistical optics. This report presents a survey of the basic history and concepts of nonimaging optics and reviews highlights and significant accomplishments over the past fifteen years. This is followed by a more detailed summary of recent research directions and accomplishments during the last three years. This most recent phase was marked by the broadening in scope to include a separate project involving a collaboration with an industrial partner, Science Applications International Corporation (SAIC). This effort was proposed and approved in 1998 and was incorporated into this project (September, 1998) with the required additional funding provided through this already existing grant.

  18. Reflective optical imaging system

    DOE Patents [OSTI]

    Shafer, David R. (Fairfield, CT)

    2000-01-01T23:59:59.000Z

    An optical system compatible with short wavelength (extreme ultraviolet) radiation comprising four reflective elements for projecting a mask image onto a substrate. The four optical elements are characterized in order from object to image as convex, concave, convex and concave mirrors. The optical system is particularly suited for step and scan lithography methods. The invention increases the slit dimensions associated with ringfield scanning optics, improves wafer throughput and allows higher semiconductor device density.

  19. Optical voltage reference

    DOE Patents [OSTI]

    Rankin, R.; Kotter, D.

    1994-04-26T23:59:59.000Z

    An optical voltage reference for providing an alternative to a battery source is described. The optical reference apparatus provides a temperature stable, high precision, isolated voltage reference through the use of optical isolation techniques to eliminate current and impedance coupling errors. Pulse rate frequency modulation is employed to eliminate errors in the optical transmission link while phase-lock feedback is employed to stabilize the frequency to voltage transfer function. 2 figures.

  20. Fiber optic micro accelerometer

    DOE Patents [OSTI]

    Swierkowski, Steve P.

    2005-07-26T23:59:59.000Z

    An accelerometer includes a wafer, a proof mass integrated into the wafer, at least one spring member connected to the proof mass, and an optical fiber. A Fabry-Perot cavity is formed by a partially reflective surface on the proof mass and a partially reflective surface on the end of the optical fiber. The two partially reflective surfaces are used to detect movement of the proof mass through the optical fiber, using an optical detection system.

  1. Calibration facility for environment dosimetry instruments

    SciTech Connect (OSTI)

    Bercea, Sorin; Celarel, Aurelia; Cenusa, Constantin [Horia Hulubei National Institute for Physics and Nuclear Engineering, 30 Reactorului St, Magurele, Jud Ilfov, P.O.B. MG-6, RO-077125 (Romania)

    2013-12-16T23:59:59.000Z

    In the last ten years, the nuclear activities, as well as the major nuclear events (see Fukushima accident) had an increasing impact on the environment, merely by contamination with radioactive materials. The most conferment way to quickly identify the presence of some radioactive elements in the environment, is to measure the dose-equivalent rate H. In this situation, information concerning the values of H due only to the natural radiation background must exist. Usually, the values of H due to the natural radiation background, are very low (?10{sup ?9} - 10{sup ?8} Sv/h). A correct measurement of H in this range involve a performing calibration of the measuring instruments in the measuring range corresponding to the natural radiation background lead to important problems due to the presence of the natural background itself the best way to overlap this difficulty is to set up the calibration stand in an area with very low natural radiation background. In Romania, we identified an area with such special conditions at 200 m dept, in a salt mine. This paper deals with the necessary requirements for such a calibration facility, as well as with the calibration stand itself. The paper includes also, a description of the calibration stand (and images) as well as the radiological and metrological parameters. This calibration facilities for environment dosimetry is one of the few laboratories in this field in Europe.

  2. Advances in nuclear instrumentation for safeguards

    SciTech Connect (OSTI)

    Prettyman, T.H.; Reilly, T.D.; Miller, M.C.; Hollas, C.L.; Pickrell, M.M.; Prommel, J.M.; Dreicer, J.S.

    1996-12-31T23:59:59.000Z

    This paper describes detectors, instrumentation, and analytical methods under development to address the above issues. The authors will describe work underway on room-temperature semiconductors including attempts to model the response of these detectors to improve spectrum analysis procedures and detector design. Computerized tomography is used in many medical and industrial applications; they are developing both gamma-ray and neutron tomography for improved measurements of waste and direct-use materials. Modern electronics and scintillation detectors should permit the development of fast neutron coincidence detectors with dramatically improved signal-to-noise ratios. For active measurements, they are studying several improved neutron sources, including a high-fluence, plasma-based, d-t generator. New analysis tools from information theory may permit one to better combine data from different measurement systems. This paper attempts to briefly describe a range of new sensors, electronics, and data analysis methods under study at Los Alamos and other laboratories to promote discussion of promising technology that they may bring to bear on these important global issues.

  3. University of Central Florida College of Optics & Photonics Optics

    E-Print Network [OSTI]

    Van Stryland, Eric

    University of Central Florida College of Optics & Photonics Optics Spring 2010 OSE-6432: Principles of guided wave optics; electro -optics, acousto-optics and optoelectronics. Location: CREOL-A-214 or by Appointment Reference Materials: 1. Class Notes. 2. "Fundamentals of Optical Waveguides", K. Okamoto, Academic

  4. Local Optical Spectroscopies for Subnanometer Spatial Resolution Chemical Imaging

    SciTech Connect (OSTI)

    Weiss, Paul

    2014-01-20T23:59:59.000Z

    The evanescently coupled photon scanning tunneling microscopes (STMs) have special requirements in terms of stability and optical access. We have made substantial improvements to the stability, resolution, and noise floor of our custom-built visible-photon STM, and will translate these advances to our infrared instrument. Double vibration isolation of the STM base with a damping system achieved increased rigidity, giving high tunneling junction stability for long-duration and high-power illumination. Light frequency modulation with an optical chopper and phase-sensitive detection now enhance the signal-to-noise ratio of the tunneling junction during irradiation.

  5. Medical catheters thermally manipulated by fiber optic bundles

    DOE Patents [OSTI]

    Chastagner, P.

    1992-10-06T23:59:59.000Z

    A maneuverable medical catheter comprising a flexible tube having a functional tip is described. The catheter is connected to a control source. The functional tip of the catheter carries a plurality of temperature activated elements arranged in parallel and disposed about the functional tip and held in spaced relation at each end. These elements expand when they are heated. A plurality of fiber optic bundles, each bundle having a proximal end attached to the control source and a distal end attached to one of the elements carry light into the elements where the light is absorbed as heat. By varying the optic fiber that is carrying the light and the intensity of the light, the bending of the elements can be controlled and thus the catheter steered. In an alternate embodiment, the catheter carries a medical instrument for gathering a sample of tissue. The instrument may also be deployed and operated by thermal expansion and contraction of its moving parts. 10 figs.

  6. Instrumental Borders of Gender and Religious Conversion in the Balkans*

    E-Print Network [OSTI]

    Paris-Sud XI, Université de

    Instrumental Borders of Gender and Religious Conversion in the Balkans* ALBERT DOJA ABSTRACT In this paper I look at religious identifications and affiliations in the Balkans as instrumental political else, the Balkans is a place of passages, encounters and contacts, formidable in its capability

  7. CU-LASP Test Facilities ! and Instrument Calibration Capabilities"

    E-Print Network [OSTI]

    Mojzsis, Stephen J.

    CU-LASP Test Facilities ! and Instrument Calibration Capabilities" Ginger Drake Calibration Group of LASP's vacuum chambers · Ideal for performing top-level instrument tests ­ Thermal Vacuum tests ­ In-band light testing (EUV-IR) · Independently temperature- controlled shroud and platen · Optional 4-axis

  8. A New Instrument For Characterizing Solid Oxide Fuel Cell Catalysts

    E-Print Network [OSTI]

    RESEARCH HIGHLIGHTS A New Instrument For Characterizing Solid Oxide Fuel Cell Catalysts From fuels to renewable energy sources. Solid oxide fuel cells (SOFCs) have enormous potential in this area A New Instrument For Characterizing Solid Oxide Fuel Cell Catalysts Rob Usiskin In partnership

  9. The Cosmic Origins Spectrograph: A Hubble Replacement Instrument

    E-Print Network [OSTI]

    Colorado at Boulder, University of

    The Cosmic Origins Spectrograph: A Hubble Replacement Instrument for the 2002 Reservicing Mission Origins Spectrograph (COS) has recently been selected as a replacement instrument for the Hubble Space Telescope. Installation is scheduled for late 2002, replacing COSTAR, which at that time will be unnecessary

  10. Instrument Series: Microscopy Ultra-High Vacuum, Low-

    E-Print Network [OSTI]

    Instrument Series: Microscopy Ultra-High Vacuum, Low- Temperature Scanning Probe Microscope EMSL's ultra-high vacuum, low-temperature scanning probe microscope instrument, or UHV LT SPM range of surface analytical techniques at low temperature ­ enables ultra-violet/X-ray photoelectron

  11. Brookhaven National Laboratory meteorological services instrument calibration plan and procedures

    SciTech Connect (OSTI)

    Heiser .

    2013-02-16T23:59:59.000Z

    This document describes the Meteorological Services (Met Services) Calibration and Maintenance Schedule and Procedures, The purpose is to establish the frequency and mechanism for the calibration and maintenance of the network of meteorological instrumentation operated by Met Services. The goal is to maintain the network in a manner that will result in accurate, precise and reliable readings from the instrumentation.

  12. Part I: Instrumentation The Chandra X-ray Observatory and

    E-Print Network [OSTI]

    -ray Observatory showing the HRMA, four sci- entific instruments (two types of gratings, HRC, and ACIS) and major://asc.harvard.edu. 2.2 Scientific Instruments 2.2.1 HRMA At energies above 10 eV, photons scatter at incident angles and (usually) prohibitively expensive endeavor. The High Resolution Mirror Assembly (HRMA) gives Chandra

  13. Part I: Instrumentation The Chandra Xray Observatory and

    E-Print Network [OSTI]

    of the Chandra X­ray Observatory showing the HRMA, four sci­ entific instruments (two types of gratings, HRC://asc.harvard.edu. 2.2 Scientific Instruments 2.2.1 HRMA At energies above ¸10 eV, photons scatter at incident angles and (usually) prohibitively expensive endeavor. The High Resolution Mirror Assembly (HRMA) gives Chandra

  14. Hand-held pulse-train-analysis instrument

    SciTech Connect (OSTI)

    Nixon, K.V.; Garcia, C.

    1982-01-01T23:59:59.000Z

    A portable hand-held pulse-train-analysis instrument uses a number-oriented microprocessor sequenced by a single component microprocessor. The incorporation of new CMOS integrated circuits makes possible complex analysis in a small, easily operated, battery-powered unit. The instrument solves an immediate problem with threshold setting of plastic scintillators and promises numerous other applications.

  15. Instrumentation for nuclear applications - FY 1993. Final report

    SciTech Connect (OSTI)

    Costrell, L.

    1994-05-01T23:59:59.000Z

    The objective of this project is to develop and coordinate nuclear instrumentation standards with resulting economies for the nuclear and radiation fields. There is particular emphasis on coordination and management of the Nuclear Instrument Module (NIM) System, US activity involving the CAMAC international standard dataway system and advanced system development, processing and management of national nuclear instrumentation and detector standards, as well as a modest amount of assistance and consultation services to the Pollutant Characterization and Safety Research Division of the Office of Health and Environmental Research. Recent accomplishments include the issuance of the updated NIM standard, that is the predominant instrumentation system in the nuclear and radiation fields worldwide, and of numerous national and international nuclear instrumentation standards. Current objectives include continued updating of the standards as the technology advances and continued management and coordination with the National Laboratories, with university and other laboratories and industry.

  16. New Optical Sensor Suite for Ultrahigh Temperature Fossil Fuel Application

    SciTech Connect (OSTI)

    John Coggin; Tom Flynn; Jonas Ivasauskas; Daniel Kominsky; Carrie Kozikowski; Russell May; Michael Miller; Tony Peng; Gary Pickrell; Raymond Rumpf; Kelly Stinson-Bagby; Dan Thorsen; Rena Wilson

    2007-12-31T23:59:59.000Z

    Accomplishments of a program to develop and demonstrate photonic sensor technology for the instrumentation of advanced powerplants and solid oxide fuel cells are described. The goal of this project is the research and development of advanced, robust photonic sensors based on improved sapphire optical waveguides, and the identification and demonstration of applications of the new sensors in advanced fossil fuel power plants, where the new technology will contribute to improvements in process control and monitoring.

  17. Omnidirectional fiber optic tiltmeter

    DOE Patents [OSTI]

    Benjamin, B.C.; Miller, H.M.

    1983-06-30T23:59:59.000Z

    A tiltmeter is provided which is useful in detecting very small movements such as earth tides. The device comprises a single optical fiber, and an associated weight affixed thereto, suspended from a support to form a pendulum. A light source, e.g., a light emitting diode, mounted on the support transmits light through the optical fiber to a group of further optical fibers located adjacent to but spaced from the free end of the single optical fiber so that displacement of the single optical fiber with respect to the group will result in a change in the amount of light received by the individual optical fibers of the group. Photodetectors individually connectd to the fibers produce corresponding electrical outputs which are differentially compared and processed to produce a resultant continuous analog output representative of the amount and direction of displacement of the single optical fiber.

  18. Fiber optic vibration sensor

    DOE Patents [OSTI]

    Dooley, Joseph B. (Harriman, TN); Muhs, Jeffrey D. (Lenoir City, TN); Tobin, Kenneth W. (Harriman, TN)

    1995-01-01T23:59:59.000Z

    A fiber optic vibration sensor utilizes two single mode optical fibers supported by a housing with one optical fiber fixedly secured to the housing and providing a reference signal and the other optical fiber having a free span length subject to vibrational displacement thereof with respect to the housing and the first optical fiber for providing a signal indicative of a measurement of any perturbation of the sensor. Damping or tailoring of the sensor to be responsive to selected levels of perturbation is provided by altering the diameter of optical fibers or by immersing at least a portion of the free span length of the vibration sensing optical fiber into a liquid of a selected viscosity.

  19. Fiber optic vibration sensor

    DOE Patents [OSTI]

    Dooley, J.B.; Muhs, J.D.; Tobin, K.W.

    1995-01-10T23:59:59.000Z

    A fiber optic vibration sensor utilizes two single mode optical fibers supported by a housing with one optical fiber fixedly secured to the housing and providing a reference signal and the other optical fiber having a free span length subject to vibrational displacement thereof with respect to the housing and the first optical fiber for providing a signal indicative of a measurement of any perturbation of the sensor. Damping or tailoring of the sensor to be responsive to selected levels of perturbation is provided by altering the diameter of optical fibers or by immersing at least a portion of the free span length of the vibration sensing optical fiber into a liquid of a selected viscosity. 2 figures.

  20. Modular Optical PDV System

    SciTech Connect (OSTI)

    Araceli Rutkowski, David Esquibel

    2008-12-11T23:59:59.000Z

    A modular optical photon Doppler velocimetry (PDV) detector system has been developed by using readily available optical components with a 20-GHz Miteq optical detector into eight channels of single-wide modules integrated into a 3U rack unit (1U = 1.75 inches) with a common power supply. Optical fibers were precisely trimmed, welded, and timed within each unit. This system has been used to collect dynamic velocity data on various physics experiments. An optical power meter displays the laser input power to the module and optical power at the detector. An adjustable micro-electromechanical system (MEMS) optical attenuator is used to adjust the amount of unshifted light entering the detector. Front panel LEDs show the presence of power to the module. A fully loaded chassis with eight channels consumes 45 watts of power. Each chassis requires 1U spacing above and below for heat management. Modules can be easily replaced.

  1. Holdup Measures on an SRNL Mossbauer Spectroscopy Instrument

    SciTech Connect (OSTI)

    Dewberry, R.; Brown, T.; Salaymeh, S.

    2010-05-05T23:59:59.000Z

    Gamma-ray holdup measurements of a Mossbauer spectroscopy instrument are described and modeled. In the qualitative acquisitions obtained in a low background area of Savannah River National Laboratory, only Am-241 and Np-237 activity were observed. The Am-241 was known to be the instrumental activation source, while the Np-237 is clearly observed as a source of contamination internal to the instrument. The two sources of activity are modeled separately in two acquisition configurations using two separate modeling tools. The results agree well, demonstrating a content of (1980 {+-} 150) {mu}Ci Am-241 and (110 {+-} 50) {mu}Ci of Np-237.

  2. Evaluation of Instrumentation and Dynamic Thermal Ratings for Overhead Lines

    SciTech Connect (OSTI)

    Phillips, A.

    2013-01-31T23:59:59.000Z

    In 2010, a project was initiated through a partnership between the Department of Energy (DOE) and the New York Power Authority (NYPA) to evaluate EPRI?s rating technology and instrumentation that can be used to monitor the thermal states of transmission lines and provide the required real-time data for real-time rating calculations. The project included the installation and maintenance of various instruments at three 230 kV line sites in northern New York. The instruments were monitored, and data collection and rating calculations were performed for about a three year period.

  3. Compound semiconductor optical waveguide switch

    DOE Patents [OSTI]

    Spahn, Olga B.; Sullivan, Charles T.; Garcia, Ernest J.

    2003-06-10T23:59:59.000Z

    An optical waveguide switch is disclosed which is formed from III-V compound semiconductors and which has a moveable optical waveguide with a cantilevered portion that can be bent laterally by an integral electrostatic actuator to route an optical signal (i.e. light) between the moveable optical waveguide and one of a plurality of fixed optical waveguides. A plurality of optical waveguide switches can be formed on a common substrate and interconnected to form an optical switching network.

  4. Multichannel optical sensing device

    DOE Patents [OSTI]

    Selkowitz, Stephen E. (Piedmont, CA)

    1990-01-01T23:59:59.000Z

    A multichannel optical sensing device is disclosed, for measuring the outr sky luminance or illuminance or the luminance or illuminance distribution in a room, comprising a plurality of light receptors, an optical shutter matrix including a plurality of liquid crystal optical shutter elements operable by electrical control signals between light transmitting and light stopping conditions, fiber optic elements connected between the receptors and the shutter elements, a microprocessor based programmable control unit for selectively supplying control signals to the optical shutter elements in a programmable sequence, a photodetector including an optical integrating spherical chamber having an input port for receiving the light from the shutter matrix and at least one detector element in the spherical chamber for producing output signals corresponding to the light, and output units for utilizing the output signals including a storage unit having a control connection to the microprocessor based programmable control unit for storing the output signals under the sequence control of the programmable control unit.

  5. Multichannel optical sensing device

    DOE Patents [OSTI]

    Selkowitz, S.E.

    1985-08-16T23:59:59.000Z

    A multichannel optical sensing device is disclosed, for measuring the outdoor sky luminance or illuminance or the luminance or illuminance distribution in a room, comprising a plurality of light receptors, an optical shutter matrix including a plurality of liquid crystal optical shutter elements operable by electrical control signals between light transmitting and light stopping conditions, fiber optical elements connected between the receptors and the shutter elements, a microprocessor based programmable control unit for selectively supplying control signals to the optical shutter elements in a programmable sequence, a photodetector including an optical integrating spherical chamber having an input port for receiving the light from the shutter matrix and at least one detector element in the spherical chamber for producing output signals corresponding to the light, and output units for utilizing the output signals including a storage unit having a control connection to the microprocessor based programmable control unit for storing the output signals under the sequence control of the programmable control unit.

  6. Atmospheric optical calibration system

    DOE Patents [OSTI]

    Hulstrom, Roland L. (Bloomfield, CO); Cannon, Theodore W. (Golden, CO)

    1988-01-01T23:59:59.000Z

    An atmospheric optical calibration system is provided to compare actual atmospheric optical conditions to standard atmospheric optical conditions on the basis of aerosol optical depth, relative air mass, and diffuse horizontal skylight to global horizontal photon flux ratio. An indicator can show the extent to which the actual conditions vary from standard conditions. Aerosol scattering and absorption properties, diffuse horizontal skylight to global horizontal photon flux ratio, and precipitable water vapor determined on a real-time basis for optical and pressure measurements are also used to generate a computer spectral model and for correcting actual performance response of a photovoltaic device to standard atmospheric optical condition response on a real-time basis as the device is being tested in actual outdoor conditions.

  7. Atmospheric optical calibration system

    DOE Patents [OSTI]

    Hulstrom, R.L.; Cannon, T.W.

    1988-10-25T23:59:59.000Z

    An atmospheric optical calibration system is provided to compare actual atmospheric optical conditions to standard atmospheric optical conditions on the basis of aerosol optical depth, relative air mass, and diffuse horizontal skylight to global horizontal photon flux ratio. An indicator can show the extent to which the actual conditions vary from standard conditions. Aerosol scattering and absorption properties, diffuse horizontal skylight to global horizontal photon flux ratio, and precipitable water vapor determined on a real-time basis for optical and pressure measurements are also used to generate a computer spectral model and for correcting actual performance response of a photovoltaic device to standard atmospheric optical condition response on a real-time basis as the device is being tested in actual outdoor conditions. 7 figs.

  8. Transpiration purged optical probe

    DOE Patents [OSTI]

    2004-01-06T23:59:59.000Z

    An optical apparatus for clearly viewing the interior of a containment vessel by applying a transpiration fluid to a volume directly in front of the external surface of the optical element of the optical apparatus. The fluid is provided by an external source and transported by means of an annular tube to a capped end region where the inner tube is perforated. The perforation allows the fluid to stream axially towards the center of the inner tube and then axially away from an optical element which is positioned in the inner tube just prior to the porous sleeve. This arrangement draws any contaminants away from the optical element keeping it free of contaminants. In one of several embodiments, the optical element can be a lens, a viewing port or a laser, and the external source can provide a transpiration fluid having either steady properties or time varying properties.

  9. Entanglement in Classical Optics

    E-Print Network [OSTI]

    Partha Ghose; Anirban Mukherjee

    2013-09-12T23:59:59.000Z

    The emerging field of entanglement or nonseparability in classical optics is reviewed, and its similarities with and differences from quantum entanglement clearly pointed out through a recapitulation of Hilbert spaces in general, the special restrictions on Hilbert spaces imposed in quantum mechanics and the role of Hilbert spaces in classical polarization optics. The production of Bell-like states in classical polarization optics is discussed, and new theorems are proved to discriminate between separable and nonseparable states in classical wave optics where no discreteness is involved. The influence of the Pancharatnam phase on a classical Bell-like state is deived. Finally, to what extent classical polarization optics can be used to simulate quantum information processing tasks is also discussed. This should be of great practical importance because coherence and entanglement are robust in classical optics but not in quantum systems.

  10. ARM Climate Research Facility Quarterly Instrument Report Fourth Quarter: October 1–December 30, 2010

    SciTech Connect (OSTI)

    Voyles, JW

    2011-01-17T23:59:59.000Z

    The purpose of this report is to provide a concise but comprehensive overview of Atmospheric Radiation Measurement Climate Research Facility instrumentation status. The report is divided into the following sections: (1) new instrumentation in the process of being acquired and deployed, (2) existing instrumentation and progress on improvements or upgrades, (3) proposed future instrumentation, and (4) Small Business Innovation Research instrument development.

  11. ACRF Instrumentation Status: New, Current, and Future November-December 2006

    SciTech Connect (OSTI)

    JC Liljegren

    2006-12-01T23:59:59.000Z

    The purpose of this report is to provide a concise but comprehensive overview of Atmospheric Radiation Measurement Program Climate Research Facility instrumentation status. The report is divided into four sections: (1) new instrumentation in the process of being acquired and deployed, (2) existing instrumentation and progress on improvements or upgrades, (3) proposed future instrumentation, and (4) Small Business Innovation Research instrument development.

  12. Atmospheric Radiation Measurement Climate Research Facility (ACRF Instrumentation Status: New, Current, and Future)

    SciTech Connect (OSTI)

    JW Voyles

    2008-01-30T23:59:59.000Z

    The purpose of this report is to provide a concise but comprehensive overview of Atmospheric Radiation Measurement Climate Research Facility instrumentation status. The report is divided into the following four sections: (1) new instrumentation in the process of being acquired and deployed, (2) existing instrumentation and progress on improvements or upgrades, (3) proposed future instrumentation, and (4) Small Business Innovation Research instrument development.

  13. Content Protection for Optical Media Content Protection for Optical Media

    E-Print Network [OSTI]

    Amir, Yair

    Content Protection for Optical Media Content Protection for Optical Media A Comparison of Self-Protecting Digital Content and AACS Independent Security Evaluators www.securityevaluators.com May 3, 2005 Copyright for Optical Media 2 #12;Content Protection for Optical Media Content Protection for Optical Media 3 Executive

  14. Optical atomic magnetometer

    DOE Patents [OSTI]

    Budker, Dmitry; Higbie, James; Corsini, Eric P

    2013-11-19T23:59:59.000Z

    An optical atomic magnetometers is provided operating on the principles of nonlinear magneto-optical rotation. An atomic vapor is optically pumped using linearly polarized modulated light. The vapor is then probed using a non-modulated linearly polarized light beam. The resulting modulation in polarization angle of the probe light is detected and used in a feedback loop to induce self-oscillation at the resonant frequency.

  15. Prismatic optical display

    DOE Patents [OSTI]

    Veligdan, James T.; DeSanto, Leonard; Brewster, Calvin

    2004-06-29T23:59:59.000Z

    A spatially modulated light beam is projected, reflected, and redirected through a prismatic optical panel to form a video image for direct viewing thereon.

  16. Optical theorem and unitarity

    E-Print Network [OSTI]

    Valeriy Nazaruk

    2014-03-20T23:59:59.000Z

    It is shown that an application of optical theorem for the non-unitary S-matrix can lead to the qualitative error in the result.

  17. Optical limiting materials

    DOE Patents [OSTI]

    McBranch, Duncan W. (Santa Fe, NM); Mattes, Benjamin R. (Santa Fe, NM); Koskelo, Aaron C. (Los Alamos, NM); Heeger, Alan J. (Santa Barbara, CA); Robinson, Jeanne M. (Los Alamos, NM); Smilowitz, Laura B. (Los Alamos, NM); Klimov, Victor I. (Los Alamos, NM); Cha, Myoungsik (Goleta, CA); Sariciftci, N. Serdar (Santa Barbara, CA); Hummelen, Jan C. (Groningen, NL)

    1998-01-01T23:59:59.000Z

    Optical limiting materials. Methanofullerenes, fulleroids and/or other fullerenes chemically altered for enhanced solubility, in liquid solution, and in solid blends with transparent glass (SiO.sub.2) gels or polymers, or semiconducting (conjugated) polymers, are shown to be useful as optical limiters (optical surge protectors). The nonlinear absorption is tunable such that the energy transmitted through such blends saturates at high input energy per pulse over a wide range of wavelengths from 400-1100 nm by selecting the host material for its absorption wavelength and ability to transfer the absorbed energy into the optical limiting composition dissolved therein. This phenomenon should be generalizable to other compositions than substituted fullerenes.

  18. LSST Camera Optics Design

    SciTech Connect (OSTI)

    Riot, V J; Olivier, S; Bauman, B; Pratuch, S; Seppala, L; Gilmore, D; Ku, J; Nordby, M; Foss, M; Antilogus, P; Morgado, N

    2012-05-24T23:59:59.000Z

    The Large Synoptic Survey Telescope (LSST) uses a novel, three-mirror, telescope design feeding a camera system that includes a set of broad-band filters and three refractive corrector lenses to produce a flat field at the focal plane with a wide field of view. Optical design of the camera lenses and filters is integrated in with the optical design of telescope mirrors to optimize performance. We discuss the rationale for the LSST camera optics design, describe the methodology for fabricating, coating, mounting and testing the lenses and filters, and present the results of detailed analyses demonstrating that the camera optics will meet their performance goals.

  19. Instrument for Measuring the Earth's Time-Retarded Transverse Gravitational Vector Potential

    E-Print Network [OSTI]

    J. C. Hafele

    2010-09-20T23:59:59.000Z

    Here within the basic design for a ground-based instrument for measuring the magnitude of the Earth's time-retarded transverse gravitational vector potential is described. The formula for the Earth's transverse vector potential is derived from the known formula for the neoclassical time-retarded transverse gravitational field (arXiv:0904.0383v2 [physics.gen-ph] 25May2010). The device senses the relativistic shift in the frequency of laser-diode oscillators set into circular motion at the tips of a two-arm rotor. The instrument employs fiber optics and a digital electronic interferometer/spectrometer to measure the effect of the relativistic time dilation on the frequency-modulated (FM) harmonic amplitudes in the beat signals between the tip-diodes and a stationary reference diode. The FM amplitudes depend on the orientation of the rotor. For the vertical-east-west orientation with a rotor frequency of 73.9 Hz, the predicted FM amplitudes for overtones at 148 Hz, 222 Hz, and 296 Hz are respectively 7x10^-10 Hz, 4x10^-11 Hz, and 9x10^-11 Hz. The overtones in the beat signals can be amplified and observed with a tunable FM digital audio amplifier. The measured values for the harmonics of the vector potential can be determined by back-calculating what the amplitudes must have been at the input to the amplifier. The instrument can be used to establish the speed of the Earth's gravitational field and to study the structure of the Earth's mantle and outer core.

  20. Detecting buffer overflows using testcase synthesis and code instrumentation

    E-Print Network [OSTI]

    Zhivich, Michael A

    2005-01-01T23:59:59.000Z

    The research presented in this thesis aims to improve existing approaches to dynamic buffer overflow detection by developing a system that utilizes code instrumentation and adaptive test case synthesis to find buffer ...

  1. acrf instrumentation status: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    224 DIRECT EXPERIMENTAL TESTS AND COMPARISON BETWEEN SUB-MINIATURE FISSION CHAMBERS AND SPND FOR FIXED IN-CORE INSTRUMENTATION OF LWR CiteSeer Summary: A fixed in-core...

  2. The chandelier : an exploration in robotic musical instrument design

    E-Print Network [OSTI]

    Fabio, Michael A., S.M. Massachusetts Institute of Technology

    2007-01-01T23:59:59.000Z

    This thesis presents several works involving robotic musical instruments. Robots have long been used in industry for performing repetitive tasks, or jobs requiring superhuman strength. However, more recently robots have ...

  3. The localization of instrumental learning within the spinal cord

    E-Print Network [OSTI]

    Liu, Grace Alexandra Tsu-Chi

    2013-02-22T23:59:59.000Z

    Spinal neurons of surgically transected rats can support a simple form of instrumental learning. Rats learn to maintain leg flexion as a response to shock. The present experiments localized the region of the spinal cord that mediates this learning...

  4. Hybrid percussion : extending physical instruments using sampled acoustics

    E-Print Network [OSTI]

    Aimi, Roberto Mario, 1973-

    2007-01-01T23:59:59.000Z

    This thesis presents a system architecture for creating hybrid digital-acoustic percussion instruments by combining extensions of existing signal processing techniques with specially-designed semi-acoustic physical ...

  5. Instrumenting Buildings to Determine Retrofit Savings: Murphy's Law Strikes Again

    E-Print Network [OSTI]

    O'Neal, D. L.; Bryant, J.; Carlson, K.

    1998-01-01T23:59:59.000Z

    &M University. Metering typically includes monitoring for the whole-building electric load, chilled and hot water thermal loads and selected submetered electrical loads. The emphasis of the lessons learned was on the instrumentation used and installation...

  6. The development of an effective portfolio assessment instrument

    E-Print Network [OSTI]

    Alderete, Karen Leigh

    1993-01-01T23:59:59.000Z

    THE DEVELOPMENT OF AN EFFECTIVE PORTFOLIO ASSESSMENT INSTRUMENT A Thesis by KAREN LEIGH ALDERETE Submitted to the Offices of Graduate Studies of Texas AfxM University in partial fulfillment of the requirements for the degree of MASTER... OF SCIENCE August 1993 Major Subject: Curriculum and Instruction THE DEVELOPMENT OF AN EFFECTIVE PORTFOLIO ASSESSMENT INSTRUMENT A Thesis by KAREN LEIGH ALDERETE Approved as to style and content by: Viola E. Florez ( Chair of Committee ) Rafael ra...

  7. Advanced Instrumentation, Information, and Control Systems Technologies Technical Program Plan

    SciTech Connect (OSTI)

    Bruce Hallbert

    2012-09-01T23:59:59.000Z

    Reliable instrumentation, information, and control (II&C) systems technologies are essential to ensuring safe and efficient operation of the U.S. light water reactor (LWR) fleet. These technologies affect every aspect of nuclear power plant (NPP) and balance-of-plant operations. In 1997, the National Research Council conducted a study concerning the challenges involved in modernization of digital instrumentation and control systems in NPPs. Their findings identified the need for new II&C technology integration.

  8. Instrumentation and control for fossil-energy processes

    SciTech Connect (OSTI)

    Not Available

    1982-09-01T23:59:59.000Z

    The 1982 symposium on instrumentation and control for fossil energy processes was held June 7 through 9, 1982, at Adam's Mark Hotel, Houston, Texas. It was sponsored by the US Department of Energy, Office of Fossil Energy; Argonne National Laboratory; and the Society for Control and Instrumentation of Energy Processes. Fifty-two papers have been entered individually into EDB and ERA; eleven papers had been entered previously from other sources. (LTN)

  9. AN INTRODUCTION TO QUANTUM OPTICS...

    E-Print Network [OSTI]

    Palffy-Muhoray, Peter

    AN INTRODUCTION TO QUANTUM OPTICS... ...the light as you've never seen before... Optics:http://science.howstuffworks.com/laser5.htm #12;5 DEFINITION Quantum Optics: "Quantum optics is a field in quantum physics, dealing OPTICS OPERATORS Light is described in terms of field operators for creation and annihilation of photons

  10. An optical water vapor sensor for unmanned aerial vehicles

    SciTech Connect (OSTI)

    Timothy A. Berkoff; Paul L. Kebabian; Robert A. McClatchy; Charles E. Kolb; Andrew Freedman

    1998-12-01T23:59:59.000Z

    The water vapor sensor developed by Aerodyne Research, based on the optical absorption of light at {approximately}935 nm, has been successfully demonstrated on board the Pacific Northwest National Laboratory's Gulfstream-1 research aircraft during the Department of Energy's ARM Intensive Operations Period in August 1998. Data taken during this field campaign show excellent agreement with a chilled mirror and Lyman-alpha hygrometers and measurements confirm the ability to measure rapid, absolute water vapor fluctuations with a high degree of instrument stability and accuracy, with a noise level as low 10 ppmv (1 Hz measurement bandwidth). The construction of this small, lightweight sensor contains several unique elements which result in several significant advantages when compared to other techniques. First, the low power consumption Argon discharge lamp provides an optical beam at a fixed wavelength without a need for temperature or precision current control. The multi-pass absorption cell developed for this instrument provides a compact, low cost method that can survive deployment in the field. Fiber-optic cables, which are used to convey to light between the absorption cell, light source, and detection modules enable remote placement of the absorption cell from the opto-electronics module. Finally, the sensor does not use any moving parts which removes a significant source of potential malfunction. The result is an instrument which maintained its calibration throughout the field measurement campaign, and was not affected by high vibration and large uncontrolled temperature excursions. We believe that the development of an accurate, fast response water vapor monitor described in this report will open up new avenues of aerial-vehicle-based atmospheric research which have been relatively unexplored due to the lack of suitable low-cost, light-weight instrumentation.

  11. Flexible optical panel

    DOE Patents [OSTI]

    Veligdan, James T. (Manorville, NY)

    2001-01-01T23:59:59.000Z

    A flexible optical panel includes laminated optical waveguides, each including a ribbon core laminated between cladding, with the core being resilient in the plane of the core for elastically accommodating differential movement thereof to permit winding of the panel in a coil.

  12. Multimode optical fiber

    DOE Patents [OSTI]

    Bigot-Astruc, Marianne; Molin, Denis; Sillard, Pierre

    2014-11-04T23:59:59.000Z

    A depressed graded-index multimode optical fiber includes a central core, an inner depressed cladding, a depressed trench, an outer depressed cladding, and an outer cladding. The central core has an alpha-index profile. The depressed claddings limit the impact of leaky modes on optical-fiber performance characteristics (e.g., bandwidth, core size, and/or numerical aperture).

  13. Apollo Ring Optical Switch

    SciTech Connect (OSTI)

    Maestas, J.H.

    1987-03-01T23:59:59.000Z

    An optical switch was designed, built, and installed at Sandia National Laboratories in Albuquerque, New Mexico, to facilitate the integration of two Apollo computer networks into a single network. This report presents an overview of the optical switch as well as its layout, switch testing procedure and test data, and installation.

  14. Method for quantifying optical properties of the human lens

    DOE Patents [OSTI]

    Loree, deceased, Thomas R. (late of Albuquerque, NM); Bigio, Irving J. (Los Alamos, NM); Zuclich, Joseph A. (San Antonio, TX); Shimada, Tsutomu (Los Alamos, NM); Strobl, Karlheinz (Fiskdale, MA)

    1999-01-01T23:59:59.000Z

    Method for quantifying optical properties of the human lens. The present invention includes the application of fiberoptic, OMA-based instrumentation as an in vivo diagnostic tool for the human ocular lens. Rapid, noninvasive and comprehensive assessment of the optical characteristics of a lens using very modest levels of exciting light are described. Typically, the backscatter and fluorescence spectra (from about 300- to 900-nm) elicited by each of several exciting wavelengths (from about 300- to 600-nm) are collected within a few seconds. The resulting optical signature of individual lenses is then used to assess the overall optical quality of the lens by comparing the results with a database of similar measurements obtained from a reference set of normal human lenses having various ages. Several metrics have been identified which gauge the optical quality of a given lens relative to the norm for the subject's chronological age. These metrics may also serve to document accelerated optical aging and/or as early indicators of cataract or other disease processes.

  15. Method for quantifying optical properties of the human lens

    DOE Patents [OSTI]

    Loree, T.R.; Bigio, I.J.; Zuclich, J.A.; Shimada, Tsutomu; Strobl, K.

    1999-04-13T23:59:59.000Z

    A method is disclosed for quantifying optical properties of the human lens. The present invention includes the application of fiberoptic, OMA-based instrumentation as an in vivo diagnostic tool for the human ocular lens. Rapid, noninvasive and comprehensive assessment of the optical characteristics of a lens using very modest levels of exciting light are described. Typically, the backscatter and fluorescence spectra (from about 300- to 900-nm) elicited by each of several exciting wavelengths (from about 300- to 600-nm) are collected within a few seconds. The resulting optical signature of individual lenses is then used to assess the overall optical quality of the lens by comparing the results with a database of similar measurements obtained from a reference set of normal human lenses having various ages. Several metrics have been identified which gauge the optical quality of a given lens relative to the norm for the subject`s chronological age. These metrics may also serve to document accelerated optical aging and/or as early indicators of cataract or other disease processes. 8 figs.

  16. Digital optical conversion module

    DOE Patents [OSTI]

    Kotter, D.K.; Rankin, R.A.

    1988-07-19T23:59:59.000Z

    A digital optical conversion module used to convert an analog signal to a computer compatible digital signal including a voltage-to-frequency converter, frequency offset response circuitry, and an electrical-to-optical converter. Also used in conjunction with the digital optical conversion module is an optical link and an interface at the computer for converting the optical signal back to an electrical signal. Suitable for use in hostile environments having high levels of electromagnetic interference, the conversion module retains high resolution of the analog signal while eliminating the potential for errors due to noise and interference. The module can be used to link analog output scientific equipment such as an electrometer used with a mass spectrometer to a computer. 2 figs.

  17. Fiber optic hydrophone

    DOE Patents [OSTI]

    Kuzmenko, P.J.; Davis, D.T.

    1994-05-10T23:59:59.000Z

    A miniature fiber optic hydrophone based on the principles of a Fabry-Perot interferometer is disclosed. The hydrophone, in one embodiment, includes a body having a shaped flexible bladder at one end which defines a volume containing air or suitable gas, and including a membrane disposed adjacent a vent. An optical fiber extends into the body with one end terminating in spaced relation to the membrane. Acoustic waves in the water that impinge on the bladder cause the pressure of the volume therein to vary causing the membrane to deflect and modulate the reflectivity of the Fabry-Perot cavity formed by the membrane surface and the cleaved end of the optical fiber disposed adjacent to the membrane. When the light is transmitted down the optical fiber, the reflected signal is amplitude modulated by the incident acoustic wave. Another embodiment utilizes a fluid filled volume within which the fiber optic extends. 2 figures.

  18. Optical amplifier-powered quantum optical amplification

    E-Print Network [OSTI]

    John Jeffers

    2011-05-16T23:59:59.000Z

    I show that an optical amplifier, when combined with photon subtraction, can be used for quantum state amplification, adding noise at a level below the standard minimum. The device could be used to significantly decrease the probability of incorrectly identifying coherent states chosen from a finite set.

  19. Summary of the Preliminary Optical ICHMI Design Study: A Preliminary Engineering Design Study for a Standpipe Viewport

    SciTech Connect (OSTI)

    Anheier, Norman C.; Qiao, Hong (Amy) [Amy; Berglin, Eric J.; Hatchell, Brian K.

    2013-12-26T23:59:59.000Z

    This summary report examines an in-vessel optical access concept intended to support standoff optical instrumentation, control and human-machine interface (ICHMI) systems for future advanced small modular reactor (AdvSMR) applications. Optical-based measurement and sensing systems for AdvSMR applications have several key benefits over traditional instrumentation and control systems used to monitor reactor process parameters, such as temperature, flow rate, pressure, and coolant chemistry (Anheier et al. 2013). Direct and continuous visualization of the in-vessel components can be maintained using external cameras. Many optical sensing techniques can be performed remotely using open optical beam path configurations. Not only are in-vessel cables eliminated by these configurations, but also sensitive optical monitoring components (e.g., electronics, lasers, detectors, and cameras) can be placed outside the reactor vessel in the instrument vault, containment building, or other locations where temperatures and radiation levels are much lower. However, the extreme AdvSMR environment present challenges for optical access designs and optical materials. Optical access is not provided in any commercial nuclear power plant or featured in any reactor design, although successful implementation of optical access has been demonstrated in test reactors (Arkani and Gharib 2009). This report outlines the key engineering considerations for an AdvSMR optical access concept. Strict American Society of Mechanical Engineers (ASME) construction codes must be followed for any U.S. nuclear facility component (ASME 2013); however, the scope of this study is to evaluate the preliminary engineering issues for this concept, rather than developing a nuclear-qualified design. In addition, this study does not consider accident design requirements. In-vessel optical access using a standpipe viewport concept serves as a test case to explore the engineering challenges and performance requirements for sodium fast reactor (SFR) and high-temperature gas reactor (HTGR) AdvSMR applications. The expected environmental conditions for deployment are reviewed for both AdvSMR designs. Optical and mechanical materials that maximize component lifetime are evaluated for the standpipe viewport design under these conditions. Optical components and opto-mechanical designs that provide robust optical-to-metal seals and stress-free optical component mounting are identified, and then key performance specifications are developed for a sapphire optical viewport concept. Design strategies are examined that protect the internal optical surfaces from liquid-coolant condensation and impurity deposits. Finally, a conceptual standpipe viewport design that is suggestive of how this concept could be assembled using standard nuclear-qualified pipe components, is presented.

  20. A user-friendly, graphical interface for the Monte Carlo neutron optics code MCLIB

    SciTech Connect (OSTI)

    Thelliez, T.; Daemen, L.; Hjelm, R.P. [Los Alamos National Lab., NM (United States); Seeger, P.A. [Seeger (Phil A.), Los Alamos, NM (United States)

    1995-12-01T23:59:59.000Z

    The authors describe a prototype of a new user interface for the Monte Carlo neutron optics simulation program MCLIB. At this point in its development the interface allows the user to define an instrument as a set of predefined instrument elements. The user can specify the intrinsic parameters of each element, its position and orientation. The interface then writes output to the MCLIB package and starts the simulation. The present prototype is an early development stage of a comprehensive Monte Carlo simulations package that will serve as a tool for the design, optimization and assessment of performance of new neutron scattering instruments. It will be an important tool for understanding the efficacy of new source designs in meeting the needs of these instruments.

  1. Optical durability testing of candidate solar mirrors

    SciTech Connect (OSTI)

    Jorgensen, G.; Kennedy, C.; King, D.; Terwilliger, K.

    2000-03-24T23:59:59.000Z

    Durability testing of a variety of candidate solar reflector materials at outdoor test sites and in laboratory accelerated weathering chambers is the main activity within the Advanced Materials task of the Concentrated Solar Power (CSP) Program. Outdoor exposure testing (OET) at up to eight outdoor, worldwide exposure sites has been underway for several years. This includes collaboration under the auspices of the International Energy Agency (IEA) Solar Power and Chemical Energy Systems (SolarPACES) agreement. Outdoor sites are fully instrumented in terms of monitoring meteorological conditions and solar irradiance. Candidate materials are optically characterized prior to being subjected to exposure in real and simulated weathering environments. Optical durability is quantified by periodically re-measuring hemispherical and specular reflectance as a function of exposure time. By closely monitoring the site- and time-dependent environmental stress conditions experienced by the material samples, site-dependent loss of performance may be quantified. In addition, accelerated exposure testing (AET) of these materials in parallel under laboratory-controlled conditions may permit correlating the outdoor results with AET, and subsequently predicting service lifetimes. Test results to date for a large number of candidate solar reflector materials are presented in this report. Acronyms are defined. Based upon OET and AET results to date, conclusions can be drawn about the optical durability of the candidate reflector materials. The optical durability of thin glass, thick glass, and two metallized polymers can be characterized as excellent. The all-polymeric construction, several of the aluminized reflectors, and a metallized polymer can be characterized as having intermediate durability and require further improvement, testing and evaluation, or both.

  2. Projection optics box

    DOE Patents [OSTI]

    Hale, Layton C. (Livermore, CA); Malsbury, Terry (Tracy, CA); Hudyma, Russell M. (San Ramon, CA); Parker, John M. (Tracy, CA)

    2000-01-01T23:59:59.000Z

    A projection optics box or assembly for use in an optical assembly, such as in an extreme ultraviolet lithography (EUVL) system using 10-14 nm soft x-ray photons. The projection optics box utilizes a plurality of highly reflective optics or mirrors, each mounted on a precision actuator, and which reflects an optical image, such as from a mask, in the EUVL system onto a point of use, such as a target or silicon wafer, the mask, for example, receiving an optical signal from a source assembly, such as a developed from laser system, via a series of highly reflective mirrors of the EUVL system. The plurality of highly reflective optics or mirrors are mounted in a housing assembly comprised of a series of bulkheads having wall members secured together to form a unit construction of maximum rigidity. Due to the precision actuators, the mirrors must be positioned precisely and remotely in tip, tilt, and piston (three degrees of freedom), while also providing exact constraint.

  3. Integrated head package for top mounted nuclear instrumentation

    DOE Patents [OSTI]

    Malandra, Louis J. (McKeesport, PA); Hornak, Leonard P. (Forest Hills, PA); Meuschke, Robert E. (Monroeville, PA)

    1993-01-01T23:59:59.000Z

    A nuclear reactor such as a pressurized water reactor has an integrated head package providing structural support and increasing shielding leading toward the vessel head. A reactor vessel head engages the reactor vessel, and a control rod guide mechanism over the vessel head raises and lowers control rods in certain of the thimble tubes, traversing penetrations in the reactor vessel head, and being coupled to the control rods. An instrumentation tube structure includes instrumentation tubes with sensors movable into certain thimble tubes disposed in the fuel assemblies. Couplings for the sensors also traverse penetrations in the reactor vessel head. A shroud is attached over the reactor vessel head and encloses the control rod guide mechanism and at least a portion of the instrumentation tubes when retracted. The shroud forms a structural element of sufficient strength to support the vessel head, the control rod guide mechanism and the instrumentation tube structure, and includes radiation shielding material for limiting passage of radiation from retracted instrumentation tubes. The shroud is thicker at the bottom adjacent the vessel head, where the more irradiated lower ends of retracted sensors reside. The vessel head, shroud and contents thus can be removed from the reactor as a unit and rested safely and securely on a support.

  4. Nuclear and fundamental physics instrumentation for the ANS project

    SciTech Connect (OSTI)

    Robinson, S.J. [Tennessee Technological Univ., Cookeville, TN (United States). Dept. of Physics; Raman, S.; Arterburn, J.; McManamy, T.; Peretz, F.J. [Oak Ridge National Lab., TN (United States); Faust, H. [Institut Laue-Langevin, 38 - Grenoble (France); Piotrowski, A.E. [Soltan Inst. for Nuclear Studies, Otwock-Swierk (Poland)

    1996-05-01T23:59:59.000Z

    This report summarizes work carried out during the period 1991-1995 in connection with the refinement of the concepts and detailed designs for nuclear and fundamental physics research instrumentation at the proposed Advanced Neutron source at Oak Ridge National Laboratory. Initially, emphasis was placed on refining the existing System Design Document (SDD-43) to detail more accurately the needs and interfaces of the instruments that are identified in the document. The conceptual designs of these instruments were also refined to reflect current thinking in the field of nuclear and fundamental physics. In particular, the on-line isotope separator (ISOL) facility design was reconsidered in the light of the development of interest in radioactive ion beams within the nuclear physics community. The second stage of this work was to define those instrument parameters that would interface directly with the reactor systems so that these parameters could be considered for the ISOL facility and particularly for its associated ion source. Since two of these options involved ion sources internal to the long slant beam tube, these were studied in detail. In addition, preliminary work was done to identify the needs for the target holder and changing facility to be located in the tangential through-tube. Because many of the planned nuclear and fundamental physics instruments have similar needs in terms of detection apparatus, some progress was also made in defining the parameters for these detectors. 21 refs., 32 figs., 2 tabs.

  5. Gregorian optical system with non-linear optical technology for protection against intense optical transients

    DOE Patents [OSTI]

    Ackermann, Mark R. (Albuquerque, NM); Diels, Jean-Claude M. (Albuquerque, NM)

    2007-06-26T23:59:59.000Z

    An optical system comprising a concave primary mirror reflects light through an intermediate focus to a secondary mirror. The secondary mirror re-focuses the image to a final image plane. Optical limiter material is placed near the intermediate focus to optically limit the intensity of light so that downstream components of the optical system are protected from intense optical transients. Additional lenses before and/or after the intermediate focus correct optical aberrations.

  6. Optical Quadratic Measure Eigenmodes

    E-Print Network [OSTI]

    Michael Mazilu; Joerg Baumgartl; Sebastian Kosmeier; Kishan Dholakia

    2010-07-13T23:59:59.000Z

    We report a mathematically rigorous technique which facilitates the optimization of various optical properties of electromagnetic fields. The technique exploits the linearity of electromagnetic fields along with the quadratic nature of their interaction with matter. In this manner we may decompose the respective fields into optical quadratic measure eigenmodes (QME). Key applications include the optimization of the size of a focused spot, the transmission through photonic devices, and the structured illumination of photonic and plasmonic structures. We verify the validity of the QME approach through a particular experimental realization where the size of a focused optical field is minimized using a superposition of Bessel beams.

  7. Fiber optic laser rod

    DOE Patents [OSTI]

    Erickson, G.F.

    1988-04-13T23:59:59.000Z

    A laser rod is formed from a plurality of optical fibers, each forming an individual laser. Synchronization of the individual fiber lasers is obtained by evanescent wave coupling between adjacent optical fiber cores. The fiber cores are dye-doped and spaced at a distance appropriate for evanescent wave coupling at the wavelength of the selected dye. An interstitial material having an index of refraction lower than that of the fiber core provides the optical isolation for effective lasing action while maintaining the cores at the appropriate coupling distance. 2 figs.

  8. Tuned optical cavity magnetometer

    DOE Patents [OSTI]

    Okandan, Murat (Edgewood, NM); Schwindt, Peter (Albuquerque, NM)

    2010-11-02T23:59:59.000Z

    An atomic magnetometer is disclosed which utilizes an optical cavity formed from a grating and a mirror, with a vapor cell containing an alkali metal vapor located inside the optical cavity. Lasers are used to magnetically polarize the alkali metal vapor and to probe the vapor and generate a diffracted laser beam which can be used to sense a magnetic field. Electrostatic actuators can be used in the magnetometer for positioning of the mirror, or for modulation thereof. Another optical cavity can also be formed from the mirror and a second grating for sensing, adjusting, or stabilizing the position of the mirror.

  9. Silicon fiber optic sensors

    DOE Patents [OSTI]

    Pocha, Michael D. (Livermore, CA); Swierkowski, Steve P. (Livermore, CA); Wood, Billy E. (Livermore, CA)

    2007-10-02T23:59:59.000Z

    A Fabry-Perot cavity is formed by a partially or wholly reflective surface on the free end of an integrated elongate channel or an integrated bounding wall of a chip of a wafer and a partially reflective surface on the end of the optical fiber. Such a constructed device can be utilized to detect one or more physical parameters, such as, for example, strain, through the optical fiber using an optical detection system to provide measuring accuracies of less than aboutb0.1%.

  10. Optical limiting materials

    DOE Patents [OSTI]

    McBranch, D.W.; Mattes, B.R.; Koskelo, A.C.; Heeger, A.J.; Robinson, J.M.; Smilowitz, L.B.; Klimov, V.I.; Cha, M.; Sariciftci, N.S.; Hummelen, J.C.

    1998-04-21T23:59:59.000Z

    Methanofullerenes, fulleroids and/or other fullerenes chemically altered for enhanced solubility, in liquid solution, and in solid blends with transparent glass (SiO{sub 2}) gels or polymers, or semiconducting (conjugated) polymers, are shown to be useful as optical limiters (optical surge protectors). The nonlinear absorption is tunable such that the energy transmitted through such blends saturates at high input energy per pulse over a wide range of wavelengths from 400--1,100 nm by selecting the host material for its absorption wavelength and ability to transfer the absorbed energy into the optical limiting composition dissolved therein. This phenomenon should be generalizable to other compositions than substituted fullerenes. 5 figs.

  11. Methods for globally treating silica optics to reduce optical damage

    DOE Patents [OSTI]

    Miller, Philip Edward; Suratwala, Tayyab Ishaq; Bude, Jeffrey Devin; Shen, Nan; Steele, William Augustus; Laurence, Ted Alfred; Feit, Michael Dennis; Wong, Lana Louie

    2012-11-20T23:59:59.000Z

    A method for preventing damage caused by high intensity light sources to optical components includes annealing the optical component for a predetermined period. Another method includes etching the optical component in an etchant including fluoride and bi-fluoride ions. The method also includes ultrasonically agitating the etching solution during the process followed by rinsing of the optical component in a rinse bath.

  12. Adaptive optics enhanced simultaneous en-face optical coherence tomography

    E-Print Network [OSTI]

    Dainty, Chris

    Adaptive optics enhanced simultaneous en-face optical coherence tomography and scanning laser ophthalmoscopy David Merino and Chris Dainty Applied Optics Group, Department of Experimental Physics, National and Adrian Gh. Podoleanu Applied Optics Group, School of Physical Sciences, University of Kent at Canterbury

  13. ATR NATIONAL SCIENTIFIC USER FACILITY INSTRUMENTATION ENHANCEMENT EFFORTS

    SciTech Connect (OSTI)

    Joy L. Rempe; Mitchell K. Meyer

    2009-04-01T23:59:59.000Z

    A key component of the Advanced Test Reactor (ATR) National Scientific User Facility (NSUF) effort is to enhance instrumentation techniques available to users conducting irradiation tests in this unique facility. In particular, development of sensors capable of providing ‘real-time’ measurements of key irradiation parameters is emphasized because of their potential to offer increased fidelity data and reduced post-test examination costs. This paper describes the strategy for identifying new instrumentation needed for ATR irradiations and the program underway to develop and evaluate new sensors to address these needs. Accomplishments from this program are illustrated by describing several new sensors now available to users of the ATR NSUF. In addition, progress is reported on current research efforts to provide users improved in-pile instrumentation.

  14. Safeguards instrumentation: a computer-based catalog. Second edition

    SciTech Connect (OSTI)

    Auerbach, C.

    1985-04-01T23:59:59.000Z

    This catalog contains entries on new developments and on items listed in BNL 51450, which have either been carried over unchanged or been updated. More than 70 entries were deleted because of either obsolescence, insufficient interest in terms of safeguards, or lack of documentable development activities in recent years. Some old listings as well as new material was consolidated into more generic entries. As in the earlier document, the emphasis is on devices and instruments that are either in field use at this time or under active development. A few items such as NDA reference materials, instrument vans and certain shipping containers are included because they are important adjuncts to optimum utilization of safeguards instrumentation. This catalog does not include devices for physical protection. As was the case with its predecessor, most of the material in this catalog originated in the US and Canada; a few contributions came from member states of the European Community.

  15. High Availability Instrumentation Packaging Standards for the ILC and Detectors

    SciTech Connect (OSTI)

    Downing, R.W.; Larsen, R.S.; /SLAC

    2006-11-30T23:59:59.000Z

    ILC designers are exploring new packaging standards for Accelerator Controls and Instrumentation, particularly high-speed serial interconnect systems for intelligent instruments versus the existing parallel backplanes of VME, VXI and CAMAC. The High Availability Advanced Telecom Computing Architecture (ATCA) system is a new industrial open standard designed to withstand single-point hardware or software failures. The standard crate, controller, applications module and sub-modules are being investigated. All modules and sub-modules are hot-swappable. A single crate is designed for a data throughput in communications applications of 2 Tb/s and an Availability of 0.99999, which translates into a downtime of five minutes per year. The ILC is planning to develop HA architectures for controls, beam instrumentation and detector systems.

  16. PURDUE UNIVERSITY ULTRAFAST OPTICS AND OPTICAL FIBER COMMUNICATIONS LABORATORY Femtosecond Pulse

    E-Print Network [OSTI]

    Purdue University

    as new pulse sequence processing functionalities. #12;PURDUE UNIVERSITY ULTRAFAST OPTICS AND OPTICAL UNIVERSITY ULTRAFAST OPTICS AND OPTICAL FIBER COMMUNICATIONS LABORATORY CLEO 2002 One Guide ­ One PulsePURDUE UNIVERSITY ULTRAFAST OPTICS AND OPTICAL FIBER COMMUNICATIONS LABORATORY CLEO 2002

  17. PURDUE UNIVERSITY ULTRAFAST OPTICS & OPTICAL FIBER COMMUNICATIONS LABORATORY Photonic RF Waveform Synthesis,

    E-Print Network [OSTI]

    Purdue University

    PURDUE UNIVERSITY ULTRAFAST OPTICS & OPTICAL FIBER COMMUNICATIONS LABORATORY Photonic RF Waveform, Shijun Xiao Funding from ARO, DARPA, and NSF #12;PURDUE UNIVERSITY ULTRAFAST OPTICS & OPTICAL FIBER performance (spectral engineering, dispersion compensation) #12;PURDUE UNIVERSITY ULTRAFAST OPTICS & OPTICAL

  18. Absorbance modulation optical lithography

    E-Print Network [OSTI]

    Tsai, Hsin-Yu Sidney

    2007-01-01T23:59:59.000Z

    In this thesis, the concept of absorbance-modulation optical lithography (AMOL) is described, and the feasibility experimentally verified. AMOL is an implementation of nodal lithography, which is not bounded by the diffraction ...

  19. Erected mirror optical switch

    DOE Patents [OSTI]

    Allen, James J.

    2005-06-07T23:59:59.000Z

    A microelectromechanical (MEM) optical switching apparatus is disclosed that is based on an erectable mirror which is formed on a rotatable stage using surface micromachining. An electrostatic actuator is also formed on the substrate to rotate the stage and mirror with a high angular precision. The mirror can be erected manually after fabrication of the device and used to redirect an incident light beam at an arbitrary angel and to maintain this state in the absence of any applied electrical power. A 1.times.N optical switch can be formed using a single rotatable mirror. In some embodiments of the present invention, a plurality of rotatable mirrors can be configured so that the stages and mirrors rotate in unison when driven by a single micromotor thereby forming a 2.times.2 optical switch which can be used to switch a pair of incident light beams, or as a building block to form a higher-order optical switch.

  20. Optical Quantum Computing

    E-Print Network [OSTI]

    Jeremy L. O'Brien

    2008-03-11T23:59:59.000Z

    In 2001 all-optical quantum computing became feasible with the discovery that scalable quantum computing is possible using only single photon sources, linear optical elements, and single photon detectors. Although it was in principle scalable, the massive resource overhead made the scheme practically daunting. However, several simplifications were followed by proof-of-principle demonstrations, and recent approaches based on cluster states or error encoding have dramatically reduced this worrying resource overhead, making an all-optical architecture a serious contender for the ultimate goal of a large-scale quantum computer. Key challenges will be the realization of high-efficiency sources of indistinguishable single photons, low-loss, scalable optical circuits, high efficiency single photon detectors, and low-loss interfacing of these components.

  1. Stereoscopic optical viewing system

    DOE Patents [OSTI]

    Tallman, Clifford S. (Walnut Creek, CA)

    1987-01-01T23:59:59.000Z

    An improved optical system which provides the operator a stereoscopic viewing field and depth of vision, particularly suitable for use in various machines such as electron or laser beam welding and drilling machines. The system features two separate but independently controlled optical viewing assemblies from the eyepiece to a spot directly above the working surface. Each optical assembly comprises a combination of eye pieces, turning prisms, telephoto lenses for providing magnification, achromatic imaging relay lenses and final stage pentagonal turning prisms. Adjustment for variations in distance from the turning prisms to the workpiece, necessitated by varying part sizes and configurations and by the operator's visual accuity, is provided separately for each optical assembly by means of separate manual controls at the operator console or within easy reach of the operator.

  2. Stereoscopic optical viewing system

    DOE Patents [OSTI]

    Tallman, C.S.

    1986-05-02T23:59:59.000Z

    An improved optical system which provides the operator with a stereoscopic viewing field and depth of vision, particularly suitable for use in various machines such as electron or laser beam welding and drilling machines. The system features two separate but independently controlled optical viewing assemblies from the eyepiece to a spot directly above the working surface. Each optical assembly comprises a combination of eye pieces, turning prisms, telephoto lenses for providing magnification, achromatic imaging relay lenses and final stage pentagonal turning prisms. Adjustment for variations in distance from the turning prisms to the workpiece, necessitated by varying part sizes and configurations and by the operator's visual accuity, is provided separately for each optical assembly by means of separate manual controls at the operator console or within easy reach of the operator.

  3. Integrated optical isolators

    E-Print Network [OSTI]

    Zaman, Tauhid R

    2005-01-01T23:59:59.000Z

    Introduction: Optical isolators are important components in lasers. Their main function is to eliminate noise caused by back-reflections into these lasers. The need for integrated isolators comes from the continuing growth ...

  4. Optical displacement sensor

    DOE Patents [OSTI]

    Carr, Dustin W. (Albuquerque, NM)

    2008-04-08T23:59:59.000Z

    An optical displacement sensor is disclosed which uses a vertical-cavity surface-emitting laser (VCSEL) coupled to an optical cavity formed by a moveable membrane and an output mirror of the VCSEL. This arrangement renders the lasing characteristics of the VCSEL sensitive to any movement of the membrane produced by sound, vibrations, pressure changes, acceleration, etc. Some embodiments of the optical displacement sensor can further include a light-reflective diffractive lens located on the membrane or adjacent to the VCSEL to control the amount of lasing light coupled back into the VCSEL. A photodetector detects a portion of the lasing light from the VCSEL to provide an electrical output signal for the optical displacement sensor which varies with the movement of the membrane.

  5. Fiber optic fluid detector

    DOE Patents [OSTI]

    Angel, S.M.

    1987-02-27T23:59:59.000Z

    Particular gases or liquids are detected with a fiber optic element having a cladding or coating of a material which absorbs the fluid or fluids and which exhibits a change of an optical property, such as index of refraction, light transmissiveness or fluoresence emission, for example, in response to absorption of the fluid. The fluid is sensed by directing light into the fiber optic element and detecting changes in the light, such as exit angle changes for example, that result from the changed optical property of the coating material. The fluid detector may be used for such purposes as sensing toxic or explosive gases in the atmosphere, measuring ground water contamination or monitoring fluid flows in industrial processes, among other uses. 10 figs.

  6. Intracoronary Optical Diagnostics

    E-Print Network [OSTI]

    Lowe, Harry C.

    Optical coherence tomography (OCT), is a novel intravascular imaging modality analogous to intravascular ultrasound but uses light instead of sound. This review details the background, development, and status of current ...

  7. Beam instrumentation for future high intense hadron accelerators at Fermilab

    SciTech Connect (OSTI)

    Wendt, M.; Hu, M.; Tassotto, G.; Thurman-Keup, R.; Scarpine, V.; Shin, S.; Zagel, J.; /Fermilab

    2008-08-01T23:59:59.000Z

    High intensity hadron beams of up to 2 MW beam power are a key element of new proposed experimental facilities at Fermilab. Project X, which includes a SCRF 8 GeV H{sup -} linac, will be the centerpiece of future HEP activities in the neutrino sector. After a short overview of this, and other proposed projects, we present the current status of the beam instrumentation activities at Fermilab with a few examples. With upgrades and improvements they can meet the requirements of the new beam facilities, however design and development of new instruments is needed, as shown by the prototype and conceptual examples in the last section.

  8. Surface and Tower Meteorological Instrumentation at NSA Handbook - January 2006

    SciTech Connect (OSTI)

    MT Ritsche

    2006-01-30T23:59:59.000Z

    The Surface and Tower Meteorological Instrumentation at Atqasuk (METTWR2H) uses mainly conventional in situ sensors to measure wind speed, wind direction, air temperature, dew point and humidity mounted on a 10-m tower. It also obtains barometric pressure, visibility, and precipitation data from sensors at or near the base of the tower. In addition, a Chilled Mirror Hygrometer is located at 1 m for comparison purposes. Temperature and relative humidity probes are mounted at 2 m and 5 m on the tower. For more information, see the Surface and Tower Meteorological Instrumentation at Atqasuk Handbook.

  9. Optical pumping in a whispering mode optical waveguide

    DOE Patents [OSTI]

    Kurnit, Norman A. (Santa Fe, NM)

    1984-01-01T23:59:59.000Z

    A device and method for optical pumping in a whispering mode optical waveguide. Both a helical ribbon and cylinder are disclosed which incorporate an additional curvature for confining the beam to increase intensity. An optical pumping medium is disposed in the optical path of the beam as it propagates along the waveguide. Optical pumping is enhanced by the high intensities of the beam and long interaction pathlengths which are achieved in a small volume.

  10. Optical pumping in a whispering-mode optical waveguide

    DOE Patents [OSTI]

    Kurnit, N.A.

    1981-08-11T23:59:59.000Z

    A device and method for optical pumping in a whispering mode optical waveguide are described. Both a helical ribbon and cylinder are disclosed which incorporate an additional curvature for confining the beam to increase intensity. An optical pumping medium is disposed in the optical path of the beam as it propagates along the waveguide. Optical pumping is enhanced by the high intensities of the beam and long interaction path lengths which are achieved in a small volume.

  11. Optical Quantum Computation

    E-Print Network [OSTI]

    T. C. Ralph; G. J. Pryde

    2011-03-31T23:59:59.000Z

    We review the field of Optical Quantum Computation, considering the various implementations that have been proposed and the experimental progress that has been made toward realizing them. We examine both linear and nonlinear approaches and both particle and field encodings. In particular we discuss the prospects for large scale optical quantum computing in terms of the most promising physical architectures and the technical requirements for realizing them.

  12. Supersymmetric transparent optical intersections

    E-Print Network [OSTI]

    Stefano Longhi

    2015-01-09T23:59:59.000Z

    Supersymmetric (SUSY) optical structures provide a versatile platform to manipulate the scattering and localization properties of light, with potential applications to mode conversion, spatial multiplexing and invisible devices. Here we show that SUSY can be exploited to realize broadband transparent intersections between guiding structures in optical networks for both continuous and discretized light. These include transparent crossing of high-contrast-index waveguides and directional couplers, as well as crossing of guiding channels in coupled resonator lattices.

  13. Integrated Optical Probes

    SciTech Connect (OSTI)

    Brent Frogget, Douglas DeVore, Vincent Romero, David Esquibel, and David Holtkamp

    2008-09-04T23:59:59.000Z

    Optical probes used in velocimetry measurements have typically been individual probes that collect data for a single diagnostic at a single point. These probes have been used in diagnostics such as VISAR, PDV, and radiometry, which measure surface velocity, temperature, and other characteristics. When separate probes are used for these measurements, the different diagnostic points measured must be significantly separated. We have developed integrated probes that collect data for multiple optical diagnostics; these probes measure points in close proximity.

  14. INSTRUMENT MENTOR MONTHLY SUMMARY REPORTING SYSTEM Doty, K. and Wagener, R.

    E-Print Network [OSTI]

    INSTRUMENT MENTOR MONTHLY SUMMARY REPORTING SYSTEM Doty, K. and Wagener, R. Brookhaven National in a particular instrument system, the ARM instrument mentor plays a key role in maintaining the quality of the data produced by the instruments. The mentor, although not directly responsible for daily monitoring

  15. Optical Solitons and their applications

    E-Print Network [OSTI]

    Palffy-Muhoray, Peter

    Optical Solitons and their applications By: Mohammad Nopoush Supervisor: Professor Palffy-Muhoray #12;Definition Optical: Non-changing optical field during propagation due to delicate balance between nonlinear and linear effects. Nonlinear effects: Due to the optical Kerr effect (AC Kerr effect

  16. Optical computing Damien Woods a

    E-Print Network [OSTI]

    Woods, Damien

    Optical computing Damien Woods a aDepartment of Computer Science and Artificial Intelligence Institute, Vierimaantie 5, 84100 Ylivieska, Finland Abstract In this survey we consider optical computers of such optical computing archi- tectures, including descriptions of the type of hardware commonly used in optical

  17. Undergraduate Handbook Dear Optics student,

    E-Print Network [OSTI]

    Cantlon, Jessica F.

    Undergraduate Handbook Fall 2013 #12;2 Dear Optics student, It is my great pleasure to welcome you to The Institute of Optics. The Institute of Optics has been educating the next generation of leaders in the field since it was founded in 1929 as the first optics department in the country

  18. SCIENCE, OPTICS & YOU GUIDEBOOK INTRODUCTION

    E-Print Network [OSTI]

    Weston, Ken

    SCIENCE, OPTICS & YOU GUIDEBOOK - i - INTRODUCTION WHAT IS SCIENCE, 0PTICS & YOU? The Science, Optics and You Guidebook is made up as follows: Science, Optics and You is a standards light, color, and optics. Activities are designed to engage students in active investigation

  19. Universal Linear Optics

    E-Print Network [OSTI]

    Jacques Carolan; Chris Harrold; Chris Sparrow; Enrique Martín-López; Nicholas J. Russell; Joshua W. Silverstone; Peter J. Shadbolt; Nobuyuki Matsuda; Manabu Oguma; Mikitaka Itoh; Graham D. Marshall; Mark G. Thompson; Jonathan C. F. Matthews; Toshikazu Hashimoto; Jeremy L. O'Brien; Anthony Laing

    2015-05-05T23:59:59.000Z

    Linear optics underpins tests of fundamental quantum mechanics and computer science, as well as quantum technologies. Here we experimentally demonstrate the longstanding goal of a single reprogrammable optical circuit that is sufficient to implement all possible linear optical protocols up to the size of that circuit. Our six-mode universal system consists of a cascade of 15 Mach-Zehnder interferometers with 30 thermo-optic phase shifters integrated into a single photonic chip that is electrically and optically interfaced for arbitrary setting of all phase shifters, input of up to six photons and their measurement with a 12 single-photon detector system. We programmed this system to implement heralded quantum logic and entangling gates, boson sampling with verification tests, and six-dimensional complex Hadamards. We implemented 100 Haar random unitaries with average fidelity 0.999 $\\pm$ 0.001. Our system is capable of switching between these and any other linear optical protocol in seconds. These results point the way to applications across fundamental science and quantum technologies.

  20. Multiparameter fiber optic sensing system for monitoring enhanced geothermal systems

    SciTech Connect (OSTI)

    William A. Challener

    2014-12-04T23:59:59.000Z

    The goal of this project was to design, fabricate and test an optical fiber cable which supports multiple sensing modalities for measurements in the harsh environment of enhanced geothermal systems. To accomplish this task, optical fiber was tested at both high temperatures and strains for mechanical integrity, and in the presence of hydrogen for resistance to darkening. Both single mode (SM) and multimode (MM) commercially available optical fiber were identified and selected for the cable based on the results of these tests. The cable was designed and fabricated using a tube-within-tube construction containing two MM fibers and one SM fiber, and without supporting gel that is not suitable for high temperature environments. Commercial fiber optic sensing instruments using Raman DTS (distributed temperature sensing), Brillouin DTSS (distributed temperature and strain sensing), and Raleigh COTDR (coherent optical time domain reflectometry) were selected for field testing. A microelectromechanical systems (MEMS) pressure sensor was designed, fabricated, packaged, and calibrated for high pressure measurements at high temperatures and spliced to the cable. A fiber Bragg grating (FBG) temperature sensor was also spliced to the cable. A geothermal well was selected and its temperature and pressure were logged. The cable was then deployed in the well in two separate field tests and measurements were made on these different sensing modalities. Raman DTS measurements were found to be accurate to ���±5���°C, even with some residual hydrogen darkening. Brillouin DTSS measurements were in good agreement with the Raman results. The Rayleigh COTDR instrument was able to detect some acoustic signatures, but was generally disappointing. The FBG sensor was used to determine the effects of hydrogen darkening, but drift over time made it unreliable as a temperature or pressure sensor. The MEMS sensor was found to be highly stable and accurate to better than its 0.1% calibration.

  1. Optical Comb Generation for Streak Camera Calibration for Inertial Confinement Fusion Experiments

    SciTech Connect (OSTI)

    Ronald Justin, Terence Davies, Frans Janson, Bruce Marshall, Perry Bell, Daniel Kalantar, Joseph Kimbrough, Stephen Vernon, Oliver Sweningsen

    2008-09-18T23:59:59.000Z

    The National Ignition Facility (NIF) at Lawrence Livermore National Laboratory (LLNL) is coming on-line to support physics experimentation for the U.S. Department of Energy (DOE) programs in Inertial Confinement Fusion (ICF) and Stockpile Stewardship (SS). Optical streak cameras are an integral part of the experimental diagnostics instrumentation at NIF. To accurately reduce streak camera data a highly accurate temporal calibration is required. This article describes a technique for simultaneously generating a precise +/- 2 ps optical marker pulse (fiducial reference) and trains of precisely timed, short-duration optical pulses (so-called “comb” pulse trains) that are suitable for the timing calibrations. These optical pulse generators are used with the LLNL optical streak cameras. They are small, portable light sources that, in the comb mode, produce a series of temporally short, uniformly spaced optical pulses, using a laser diode source. Comb generators have been produced with pulse-train repetition rates up to 10 GHz at 780 nm, and somewhat lower frequencies at 664 nm. Individual pulses can be as short as 25-ps FWHM. Signal output is via a fiber-optic connector on the front panel of the generator box. The optical signal is transported from comb generator to streak camera through multi-mode, graded-index optical fiber.

  2. Transparent electrode for optical switch

    DOE Patents [OSTI]

    Goldhar, J.; Henesian, M.A.

    1984-10-19T23:59:59.000Z

    The invention relates generally to optical switches and techniques for applying a voltage to an electro-optical crystal, and more particularly, to transparent electodes for an optical switch. System architectures for very large inertial confinement fusion (ICF) lasers require active optical elements with apertures on the order of one meter. Large aperture optical switches are needed for isolation of stages, switch-out from regenerative amplifier cavities and protection from target retroreflections.

  3. The NASA Aura satellite houses four instruments to study atmospheric ozone. The Ozone Monitoring Instrument (OMI) onboard the satellite provides global total column ozone (TCO) and in combination

    E-Print Network [OSTI]

    Thompson, Anne

    iii ABSTRACT The NASA Aura satellite houses four instruments to study atmospheric ozone. The Ozone Monitoring Instrument (OMI) onboard the satellite provides global total column ozone (TCO) and in combination with other instruments tropospheric ozone residual (TOR) can be derived. In this study, the trajectory

  4. INSTITUTE OF PHYSICS PUBLISHING JOURNAL OF OPTICS A: PURE AND APPLIED OPTICS Polarization Optics

    E-Print Network [OSTI]

    Friesem, Asher A.

    INSTITUTE OF PHYSICS PUBLISHING JOURNAL OF OPTICS A: PURE AND APPLIED OPTICS EDITORIAL Polarization Optics Guest Editors Jari Turunen University of Joensuu, Finland Asher A Friesem Weizmann Institute This special issue on Polarization Optics contains one review article and 23 research papers, many of which

  5. Piecewise Linear Instrumental Variable Estimation of Causal Influence Richard Scheines

    E-Print Network [OSTI]

    Spirtes, Peter

    studies show that when the causal influence of X on Y is non-linear, the piecewise linear linear IV-estimator. In the final section, we describe an experiment comparing regular regression, linearPiecewise Linear Instrumental Variable Estimation of Causal Influence Richard Scheines Dept

  6. Sourcebook on high-temperature electronics and instrumentation

    SciTech Connect (OSTI)

    Veneruso, A.F. (ed.)

    1981-10-01T23:59:59.000Z

    This sourcebook summarizes the high-temperature characteristics of a number of commercially available electronic components and materials required in geothermal well-logging instruments that must operate to 275/sup 0/C. The sourcebook is written to provide a starting place for instrument designers, who need to know the high-temperature electronic products that are available and the design and performance limitations of these products. The electronic component information given includes the standard repertoire of passive devices such as resistors, capacitors, and magnetics; the active devices and integrated circuits sections emphasize silicon semiconductor JFETs and CMOS circuits; and, to complete the electronics, interconnections and packaging of hybrid microelectronics are described. Thermal insulation and refrigeration alternatives are also presented in the sourcebook. Finally, instrument housing materials and high-temperature cables and cablehead connectors are listed. This information was compiled as part of the Geothermal Logging Instrumentation Development Program that Sandia National Laboratories conducted for the US Department of Energy's Divison of Geothermal Energy from 1976 to 1981.

  7. An Ice Lithography Instrument Anpan Han 1, John Chervinsky2

    E-Print Network [OSTI]

    Page 1 An Ice Lithography Instrument Anpan Han 1, John Chervinsky2 , Daniel Branton3 , and J. A a new nano-patterning method called ice lithography, where ice is used as the resist. Water vapor. The vapor condenses, covering the sample with an amorphous layer of ice. To form a lift-off mask, ice

  8. RESEARCH Open Access Economic instruments for obesity prevention

    E-Print Network [OSTI]

    LaFrance, Jeffrey T.

    RESEARCH Open Access Economic instruments for obesity prevention: results of a scoping review: Comprehensive, multi-level approaches are required to address obesity. One important target for intervention of economic policies targeting obesity and its causal behaviours (diet, physical activity), and to make

  9. Experiment #1 Maintenance of UV/vis Instruments

    E-Print Network [OSTI]

    Nazarenko, Alexander

    considerably worse than it should be. For these reasons, most companies have a preventive maintenance program that might be included in a preventive maintenance program for a UV-visible spectrometer. Your taskExperiment #1 Maintenance of UV/vis Instruments Objectives: 1. Learn how to use different UV

  10. PNWD-SA-6893 Instrumenting the Intelligence Analysis Process

    E-Print Network [OSTI]

    Lean, VA, USA Battelle Memorial Institute #12;Instrumenting the Intelligence Analysis Process Ernest Hampson Battelle, Colonial Place Operations 2111 Wilson Blvd., Suite 1000 Arlington, VA 22201 hampsone@battelle.org Paula Cowley Battelle, Pacific Northwest Division 3350 Q Avenue, K7-22 Richland, WA 99352 paula

  11. The GRAVITY instrument software / High-level software

    E-Print Network [OSTI]

    Burtscher, Leonard; Ott, Thomas; Kok, Yitping; Yazici, Senol; Anugu, Narsireddy; Dembet, Roderick; Fedou, Pierre; Lacour, Sylvestre; Ott, Juergen; Paumard, Thibaut; Lapeyrere, Vincent; Kervella, Pierre; Abuter, Roberto; Pozna, Eszter; Eisenhauer, Frank; Blind, Nicolas; Genzel, Reinhard; Gillessen, Stefan; Hans, Oliver; Haug, Marcus; Haussmann, Frank; Kellner, Stefan; Lippa, Magdalena; Pfuhl, Oliver; Sturm, Eckhard; Weber, Johannes; Amorim, Antonio; Brandner, Wolfgang; Rousselet-Perraut, Karine; Perrin, Guy S; Straubmeier, Christian; Schoeller, Markus

    2015-01-01T23:59:59.000Z

    GRAVITY is the four-beam, near- infrared, AO-assisted, fringe tracking, astrometric and imaging instrument for the Very Large Telescope Interferometer (VLTI). It is requiring the development of one of the most complex instrument software systems ever built for an ESO instrument. Apart from its many interfaces and interdependencies, one of the most challenging aspects is the overall performance and stability of this complex system. The three infrared detectors and the fast reflective memory network (RMN) recorder contribute a total data rate of up to 20 MiB/s accumulating to a maximum of 250 GiB of data per night. The detectors, the two instrument Local Control Units (LCUs) as well as the five LCUs running applications under TAC (Tools for Advanced Control) architecture, are interconnected with fast Ethernet, RMN fibers and dedicated fiber connections as well as signals for the time synchronization. Here we give a simplified overview of all subsystems of GRAVITY and their interfaces and discuss two examples of...

  12. InsectJ: A Generic Instrumentation Framework for Collecting Dynamic

    E-Print Network [OSTI]

    Orso, Alessandro "Alex"

    TX 2005 Method exit Method entry Monitor Probe GUI-based Instrumentation void foo { ... } void bar { ... } P #12;Arjan Seesing and Alex Orso ­ eTX 2005 Method profiling Method exit Method entry Monitor ProbeTX 2005 Method profiling Method exit Method entry Monitor Probe void foo { ... } void bar { ... } P GUI

  13. Offshore wind profile measurements from remote sensing instruments

    E-Print Network [OSTI]

    Offshore wind profile measurements from remote sensing instruments Ioannis Antoniou (1) , Hans E) have been mounted on top of a transformer platform situated offshore close to the Nysted wind farm offshore wind energy potential depends greatly on the ability to make offshore windfarms economically

  14. Optical key system

    DOE Patents [OSTI]

    Hagans, Karla G. (Livermore, CA); Clough, Robert E. (Danville, CA)

    2000-01-01T23:59:59.000Z

    An optical key system comprises a battery-operated optical key and an isolated lock that derives both its operating power and unlock signals from the correct optical key. A light emitting diode or laser diode is included within the optical key and is connected to transmit a bit-serial password. The key user physically enters either the code-to-transmit directly, or an index to a pseudorandom number code, in the key. Such person identification numbers can be retained permanently, or ephemeral. When a send button is pressed, the key transmits a beam of light modulated with the password information. The modulated beam of light is received by a corresponding optical lock with a photovoltaic cell that produces enough power from the beam of light to operate a password-screen digital logic. In one application, an acceptable password allows a two watt power laser diode to pump ignition and timing information over a fiberoptic cable into a sealed engine compartment. The receipt of a good password allows the fuel pump, spark, and starter systems to each operate. Therefore, bypassing the lock mechanism as is now routine with automobile thieves is pointless because the engine is so thoroughly disabled.

  15. Optical high acidity sensor

    DOE Patents [OSTI]

    Jorgensen, B.S.; Nekimken, H.L.; Carey, W.P.; O`Rourke, P.E.

    1997-07-22T23:59:59.000Z

    An apparatus and method for determining acid concentrations in solutions having acid concentrations of from about 0.1 Molar to about 16 Molar is disclosed. The apparatus includes a chamber for interrogation of the sample solution, a fiber optic light source for passing light transversely through the chamber, a fiber optic collector for receiving the collimated light after transmission through the chamber, a coating of an acid resistant polymeric composition upon at least one fiber end or lens, the polymeric composition in contact with the sample solution within the chamber and having a detectable response to acid concentrations within the range of from about 0.1 Molar to about 16 Molar, a measurer for the response of the polymeric composition in contact with the sample solution, and a comparer of the measured response to predetermined standards whereby the acid molarity of the sample solution within the chamber can be determined. Preferably, a first lens is attached to the end of the fiber optic light source, the first lens adapted to collimate light from the fiber optic light source, and a second lens is attached to the end of the fiber optic collector for focusing the collimated light after transmission through the chamber. 10 figs.

  16. Fiber optic hydrogen sensor

    DOE Patents [OSTI]

    Buchanan, B.R.; Prather, W.S.

    1991-01-01T23:59:59.000Z

    Apparatus and method for detecting a chemical substance by exposing an optic fiber having a core and a cladding to the chemical substance so that the chemical substance can be adsorbed onto the surface of the cladding. The optic fiber is coiled inside a container having a pair of valves for controlling the entrance and exit of the substance. Light from a light source is received by one end of the optic fiber, preferably external to the container, and carried by the core of the fiber. Adsorbed substance changes the transmissivity of the fiber as measured by a spectrophotometer at the other end, also preferably external to the container. Hydrogen is detected by the absorption of infrared light carried by an optic fiber with a silica cladding. Since the adsorption is reversible, a sensor according to the present invention can be used repeatedly. Multiple positions in a process system can be monitored using a single container that can be connected to each location to be monitored so that a sample can be obtained for measurement, or, alternatively, containers can be placed near each position and the optic fibers carrying the partially-absorbed light can be multiplexed for rapid sequential reading, by a single spectrophotometer.

  17. OFFICE OF MATERIALS & LOGISTICS MANAGEMENT Policy for Charge Capture of Implant(s), Instrument(s), Device(s)

    E-Print Network [OSTI]

    Oliver, Douglas L.

    OFFICE OF MATERIALS & LOGISTICS MANAGEMENT Policy for Charge Capture of Implant(s), Instrument entirety and fax to Materials Management at x1993. 3.0 Materials Management must complete Section 2 Service. Materials Management will provide the product part number, cost and charge code, if applicable

  18. Absolute calibration of optical flats

    DOE Patents [OSTI]

    Sommargren, Gary E.

    2005-04-05T23:59:59.000Z

    The invention uses the phase shifting diffraction interferometer (PSDI) to provide a true point-by-point measurement of absolute flatness over the surface of optical flats. Beams exiting the fiber optics in a PSDI have perfect spherical wavefronts. The measurement beam is reflected from the optical flat and passed through an auxiliary optic to then be combined with the reference beam on a CCD. The combined beams include phase errors due to both the optic under test and the auxiliary optic. Standard phase extraction algorithms are used to calculate this combined phase error. The optical flat is then removed from the system and the measurement fiber is moved to recombine the two beams. The newly combined beams include only the phase errors due to the auxiliary optic. When the second phase measurement is subtracted from the first phase measurement, the absolute phase error of the optical flat is obtained.

  19. Stability comparison of two absolute gravimeters: optical versus atomic interferometers

    E-Print Network [OSTI]

    Gillot, Pierre; Landragin, Arnaud; Santos, Franck Pereira Dos; Merlet, Sébastien

    2014-01-01T23:59:59.000Z

    We report the direct comparison between the stabilities of two mobile absolute gravimeters of different technology: the LNE-SYRTE Cold Atom Gravimeter and FG5X\\#216 of the Universit\\'e du Luxembourg. These instruments rely on two different principles of operation: atomic and optical interferometry. The comparison took place in the Walferdange Underground Laboratory for Geodynamics in Luxembourg, at the beginning of the last International Comparison of Absolute Gravimeters, ICAG-2013. We analyse a 2h10 duration common measurement, and find that the CAG shows better immunity with respect to changes in the level of vibration noise, as well as a slightly better short term stability.

  20. GNOSIS: THE FIRST INSTRUMENT TO USE FIBER BRAGG GRATINGS FOR OH SUPPRESSION

    SciTech Connect (OSTI)

    Trinh, Christopher Q.; Ellis, Simon C.; Bland-Hawthorn, Joss; Bryant, Julia; O'Byrne, John [Sydney Institute for Astronomy, School of Physics, The University of Sydney, NSW 2006 (Australia); Lawrence, Jon S.; Horton, Anthony J.; Shortridge, Keith; Case, Scott; Colless, Matthew; Gers, Luke; Lee, Steve; Miziarski, Stan [Australian Astronomical Observatory, 105 Delhi Road, North Ryde, P.O. Box 915, NSW 1670 (Australia); Leon-Saval, Sergio G. [Institute of Photonics and Optical Science, School of Physics, University of Sydney, NSW 2006 (Australia); Couch, Warrick; Glazebrook, Karl [Centre for Astrophysics and Supercomputing, Swinburne University of Technology, P.O. Box 218, Hawthorn, VIC 3122 (Australia); Freeman, Kenneth [Research School of Astronomy and Astrophysics, Australian National University, Weston Creek, ACT 2611 (Australia); Loehmannsroeben, Hans-Gerd [innoFSPEC-Institut fuer Chemie/Physikalische Chemie, Universitaet Potsdam, Karl-Liebknecht-Strasse 24-25, D-14476 Potsdam-Golm (Germany); Haynes, Roger; Roth, Martin M., E-mail: c.trinh@physics.usyd.edu.au [innoFSPEC-Leibniz-Institut fuer Astrophysik Potsdam, An der Sternwarte 16, D-14482 Potsdam (Germany); and others

    2013-02-01T23:59:59.000Z

    The near-infrared is an important part of the spectrum in astronomy, especially in cosmology because the light from objects in the early universe is redshifted to these wavelengths. However, deep near-infrared observations are extremely difficult to make from ground-based telescopes due to the bright background from the atmosphere. Nearly all of this background comes from the bright and narrow emission lines of atmospheric hydroxyl (OH) molecules. The atmospheric background cannot be easily removed from data because the brightness fluctuates unpredictably on short timescales. The sensitivity of ground-based optical astronomy far exceeds that of near-infrared astronomy because of this long-standing problem. GNOSIS is a prototype astrophotonic instrument that utilizes 'OH suppression fibers' consisting of fiber Bragg gratings and photonic lanterns to suppress the 103 brightest atmospheric emission doublets between 1.47 and 1.7 {mu}m. GNOSIS was commissioned at the 3.9 m Anglo-Australian Telescope with the IRIS2 spectrograph to demonstrate the potential of OH suppression fibers, but may be potentially used with any telescope and spectrograph combination. Unlike previous atmospheric suppression techniques GNOSIS suppresses the lines before dispersion and in a manner that depends purely on wavelength. We present the instrument design and report the results of laboratory and on-sky tests from commissioning. While these tests demonstrated high throughput ( Almost-Equal-To 60%) and excellent suppression of the skylines by the OH suppression fibers, surprisingly GNOSIS produced no significant reduction in the interline background and the sensitivity of GNOSIS+IRIS2 is about the same as IRIS2. It is unclear whether the lack of reduction in the interline background is due to physical sources or systematic errors as the observations are detector noise dominated. OH suppression fibers could potentially impact ground-based astronomy at the level of adaptive optics or greater. However, until a clear reduction in the interline background and the corresponding increasing in sensitivity is demonstrated optimized OH suppression fibers paired with a fiber-fed spectrograph will at least provide a real benefit at low resolving powers.

  1. Interactive optical panel

    DOE Patents [OSTI]

    Veligdan, J.T.

    1995-10-03T23:59:59.000Z

    An interactive optical panel assembly includes an optical panel having a plurality of ribbon optical waveguides stacked together with opposite ends thereof defining panel first and second faces. A light source provides an image beam to the panel first face for being channeled through the waveguides and emitted from the panel second face in the form of a viewable light image. A remote device produces a response beam over a discrete selection area of the panel second face for being channeled through at least one of the waveguides toward the panel first face. A light sensor is disposed across a plurality of the waveguides for detecting the response beam therein for providing interactive capability. 10 figs.

  2. Interactive optical panel

    DOE Patents [OSTI]

    Veligdan, James T. (Manorville, NY)

    1995-10-03T23:59:59.000Z

    An interactive optical panel assembly 34 includes an optical panel 10 having a plurality of ribbon optical waveguides 12 stacked together with opposite ends thereof defining panel first and second faces 16, 18. A light source 20 provides an image beam 22 to the panel first face 16 for being channeled through the waveguides 12 and emitted from the panel second face 18 in the form of a viewable light image 24a. A remote device 38 produces a response beam 40 over a discrete selection area 36 of the panel second face 18 for being channeled through at least one of the waveguides 12 toward the panel first face 16. A light sensor 42,50 is disposed across a plurality of the waveguides 12 for detecting the response beam 40 therein for providing interactive capability.

  3. Jueves 10 de octubre de 2013, de 13:00 a 14:00 h Neutron optics using holographic gratings

    E-Print Network [OSTI]

    Escolano, Francisco

    are being developed at present. Finally we will give an outlook on novel neutron-scattering instrumentationJueves 10 de octubre de 2013, de 13:00 a 14:00 h Neutron optics using holographic gratings Prof. Dr. Martin Fally Holography and Neutron Diffraction Group - Faculty of Physics - University of Vienna

  4. Versatile magneto-optic Kerr effect polarimeter for studies of domain-wall dynamics in magnetic nanostructures

    E-Print Network [OSTI]

    Erskine, James L.

    and magnetic energy loss measurements spanning ten decades of drive frequency; spatially and temporally ns rise time or by electric currents from dc to 10 GHz. A detailed description of the instrument based on the MOKE. Pump-probe techniques7­15 that utilize magneto-optical sampling and ultrashort

  5. Optics & Laser Technology, Vol. 29, No. 1, pp. 35-39, 1997 Copyright 0 1996 Elsevier Science Ltd

    E-Print Network [OSTI]

    Strathclyde, University of

    on its own. Power can then be drawn from a larger capacity battery (on a buoy for example) or from or consumption of reagents, they have relatively low power requirements, and the instrumentation can-systems including microprocessor controller, data storage, power supplies and a submersible housing. The optics

  6. Detection of accessory corpora lutea in swine

    E-Print Network [OSTI]

    Reitmeyer, James Clement

    1962-01-01T23:59:59.000Z

    Post&onception Estrus Corpora Lutea in Pregnancy Mistclogy IIX ~ MATERIALS AMD METHOUS Animals and Breeding Anesthesia Surgery Slaughter IV. RESULTS AMU UXSCUSSIOM Anesthesia Surgery Marking tike Corpora Hemorrhagica Qvulati. on Rate Post...-Operative Care Mistology V. SUMMARY LXTERATURE CXTEU APPEMBXX 13 14 14 15 16 16 16 17 26 TABLES 1. Coaparisou of Corpora EeaorrhaEicua 3 days post Matiag to Corpora Lutea 40 days post MatiaE LIST OF FIGURES FLGURES 1. Marking a Corpus...

  7. Lorentz Group in Ray Optics

    E-Print Network [OSTI]

    S. Baskal; E. Georgieva; Y. S. Kim; M. E. Noz

    2004-01-18T23:59:59.000Z

    It has been almost one hundred years since Einstein formulated his special theory of relativity in 1905. He showed that the basic space-time symmetry is dictated by the Lorentz group. It is shown that this group of Lorentz transformations is not only applicable to special relativity, but also constitutes the scientific language for optical sciences. It is noted that coherent and squeezed states of light are representations of the Lorentz group. The Lorentz group is also the basic underlying language for classical ray optics, including polarization optics, interferometers, the Poincare\\'e sphere, one-lens optics, multi-lens optics, laser cavities, as well multilayer optics.

  8. Optical Characterization Laboratory (Fact Sheet)

    SciTech Connect (OSTI)

    Not Available

    2011-10-01T23:59:59.000Z

    This fact sheet describes the purpose, lab specifications, applications scenarios, and information on how to partner with NREL's Optical Characterization Laboratory at the Energy Systems Integration Facility. The Optical Characterization Laboratory at NREL's Energy Systems Integration Facility (ESIF) conducts optical characterization of large solar concentration devices. Concentration solar power (CSP) mirror panels and concentrating solar systems are tested with an emphasis is on measurement of parabolic trough mirror panels. The Optical Characterization Laboratory provides state-of-the-art characterization and testing capabilities for assessing the optical surface quality and optical performance for various CSP technologies including parabolic troughs, linear Fresnel, dishes, and heliostats.

  9. Cavity quantum electro-optics

    E-Print Network [OSTI]

    Mankei Tsang

    2010-06-30T23:59:59.000Z

    The quantum dynamics of the coupling between a cavity optical field and a resonator microwave field via the electro-optic effect is studied. This coupling has the same form as the opto-mechanical coupling via radiation pressure, so all previously considered opto-mechanical effects can in principle be observed in electro-optic systems as well. In particular, I point out the possibilities of laser cooling of the microwave mode, entanglement between the optical mode and the microwave mode via electro-optic parametric amplification, and back-action-evading optical measurements of a microwave quadrature.

  10. Nonimaging optical illumination system

    DOE Patents [OSTI]

    Winston, R.; Ries, H.

    1996-12-17T23:59:59.000Z

    A nonimaging illumination optical device for producing a selected far field illuminance over an angular range. The optical device includes a light source, a light reflecting surface, and a family of light edge rays defined along a reference line with the reflecting surface defined in terms of the reference line as a parametric function R(t) where t is a scalar parameter position and R(t)=k(t)+Du(t) where k(t) is a parameterization of the reference line, and D is a distance from a point on the reference line to the reflection surface along the desired edge ray through the point. 35 figs.

  11. Nonimaging optical illumination system

    DOE Patents [OSTI]

    Winston, R.; Ries, H.

    1998-10-06T23:59:59.000Z

    A nonimaging illumination optical device for producing a selected far field illuminance over an angular range. The optical device includes a light source a light reflecting surface, and a family of light edge rays defined along a reference line with the reflecting surface defined in terms of the reference lines a parametric function R(t) where t is a scalar parameter position and R(t)=k(t)+Du(t) where k(t) is a parameterization of the reference line, and D is a distance from a point on the reference line to the reflection surface along the desired edge ray through the point. 35 figs.

  12. Full spectrum optical safeguard

    DOE Patents [OSTI]

    Ackerman, Mark R. (Albuquerque, NM)

    2008-12-02T23:59:59.000Z

    An optical safeguard device with two linear variable Fabry-Perot filters aligned relative to a light source with at least one of the filters having a nonlinear dielectric constant material such that, when a light source produces a sufficiently high intensity light, the light alters the characteristics of the nonlinear dielectric constant material to reduce the intensity of light impacting a connected optical sensor. The device can be incorporated into an imaging system on a moving platform, such as an aircraft or satellite.

  13. Optics in data center network architecture

    E-Print Network [OSTI]

    Farrington, Nathan

    2012-01-01T23:59:59.000Z

    Chapter 2 Reducing Cabling Complexity with Optics . . . . .Advances in Information Optics and Photonics. SPIE, 2008. [c-Through: Part-time Optics in Data Centers,” in Proceedings

  14. High-index-contrast electromechanical optical switches

    E-Print Network [OSTI]

    Bryant, Reginald (Reginald Eugene), 1978-

    2011-01-01T23:59:59.000Z

    System developers are looking to replace protocol-dependent, bandwidth-limited optical networks with intelligent optically-transparent integrated photonic networks. Several electromechanical optical switches are explored ...

  15. Optical fiber based ultrashort pulse multispectral nonlinear optical microscopy

    E-Print Network [OSTI]

    Larson, Adam Michael

    2009-05-15T23:59:59.000Z

    Nonlinear optical microscopy (NLOM) utilizing femtosecond laser pulses is well suited for imaging living tissues. This work reports on the design and development of an optical fiber based multispectral NLOM developed around a laser generating...

  16. Microwave to Optical Link Using an Optical Microresonator

    E-Print Network [OSTI]

    Jost, J D; Lecaplain, C; Brasch, V; Pfeiffer, M H P; Kippenberg, T J

    2014-01-01T23:59:59.000Z

    The ability to phase coherently link optical to radio frequencies with femtosecond modelocked lasers has enabled counting cycles of light and is the basis of optical clocks, absolute frequency synthesis, tests of fundamental physics, and improved spectroscopy. Using an optical microresonator frequency comb to establish a coherent link promises to greatly extend optical frequency synthesis and measurements to areas requiring compact form factor, on chip integration and repetition rates in the microwave regime, including coherent telecommunications, astrophysical spectrometer calibration or microwave photonics. Here we demonstrate for the first time a microwave to optical link using a microresonator. Using a temporal dissipative single soliton state in an ultra high Q crystalline microresonator an optical frequency comb is generated that is self-referenced, allowing to phase coherently link a 190 THZ optical carrier directly to a 14 GHz microwave frequency. Our work demonstrates that precision optical frequency...

  17. NEW OPTICAL SENSOR SUITE FOR ULTRAHIGH TEMPERATURE FOSSIL FUEL APPLICATIONS

    SciTech Connect (OSTI)

    Russell G. May; Tony Peng; Tom Flynn

    2004-04-01T23:59:59.000Z

    Accomplishments during the first six months of a program to develop and demonstrate technology for the instrumentation of advanced powerplants are described. Engineers from Prime Research, LC and Babcock and Wilcox Research Center collaborated to generate a list of potential applications for robust photonic sensors in existing and future boiler plants. From that list, three applications were identified as primary candidates for initial development and demonstration of high-temperature sensors in an ultrasupercritical power plant. In addition, progress was made in the development of materials and methods to apply high-temperature optical claddings to sapphire fibers, in order to improve their optical waveguiding properties so that they can be used in the design and fabrication of high-temperature sensors. Through refinements in the processing steps, the quality of the interface between core and cladding of the fibers was improved, which is expected to reduce scattering and attenuation in the fibers.

  18. Modelling the optically dark side of high--redshift galaxies

    E-Print Network [OSTI]

    B. Guiderdoni

    1998-09-14T23:59:59.000Z

    The recent detection of the Cosmic Infrared Background in FIRAS and DIRBE residuals, and the observations of IR/submm sources by the ISOPHOT and SCUBA instruments have shed new light on the optically dark side of galaxy formation. It turns out that our view on the deep universe has been so far biassed towards optically bright galaxies. We now know that a significant fraction of galaxy/star formation in the universe is hidden by dust shrouds. In this paper, we introduce a new modelling of galaxy formation and evolution that provides us with specific predictions in the IR/submm wavebands. These predictions are compared with the current status of the observations. Finally, the future all-sky and deep surveys with the PLANCK and FIRST missions are briefly described.

  19. Bachelor of Science Degree in Optics Bachelor of Science Degree in Optical Engineering

    E-Print Network [OSTI]

    Bachelor of Science Degree in Optics Bachelor of Science Degree in Optical Engineering The Institute of Optics Major Requirements OPT 201 Geometrical Optics Lab (2 cr.) OPT 202 Physical Optics Lab (2 Theory of Optics OPT 225 Optical Sources and Detectors OPT 241 Geometrical Optics OPT 242 Aberrations

  20. Bachelor of Science Degree in Optics Bachelor of Science Degree in Optical Engineering

    E-Print Network [OSTI]

    Mahon, Bradford Z.

    Bachelor of Science Degree in Optics Bachelor of Science Degree in Optical Engineering The Institute of Optics Major Requirements OPT 197 Geometrical Optics Lab (2 cr.) OPT 198 Physical Optics Lab (2 Theory of Optics OPT 225 Optical Sources and Detectors OPT 241 Geometrical Optics OPT 242 Aberrations